F492911
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1315 | 1004 | 448 | 361 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0026895|Ga0495625_0026895_1336_2610 |
| Length | 424 |
| Sequence | MVGRFAMFASSGSSEARYIILIGNDRNYLCDVESIIGRRYFQPRSQAGIRWSERRLPWEAIMTATPSRRDYSLIGRDAKLAVETGLSAAEWYHTDIPRKQMKELMQRSDGPAIRDTAIWLAALILSAAGGAWFWGTWWCVPFFFVYGVLYGSSTDSRWHECGHGTAFRTQWMNDTVYQIACFMIMRNPVTWRWSHTRHHTDTIIVGRDPEISVMRPPDLLRVVLAFVGVLDAWHAMSDMLRNAAGNISPAEKTFIPEQEQPKAIRAARIWTAIYAVTIALALSFGSFLPLMLVGLPRLYGAWHHVMVGLLQHGGLAENVTDHRLNSRTVYMNPISRFIYWNMNYHVEHHMFPMVPYHALPRLHALIKHDLPAPTPSILAGYREMIPAFLRQLRNEDYFIKRELPPTARPYREEFHNDAVAAAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 10 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 11 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 12 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 13 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 14 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 15 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 16 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 17 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 18 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 19 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 20 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 21 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 22 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 23 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 24 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 25 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 26 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 27 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 28 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 29 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 30 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 31 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 32 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 33 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 34 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 35 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 36 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 37 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 38 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 39 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 40 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 41 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 42 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 43 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 44 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 45 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 46 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 47 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 48 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 49 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 50 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 51 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 52 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 53 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 54 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 55 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 56 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 57 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 58 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 59 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 60 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 61 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 62 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 63 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 64 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 65 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 66 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 67 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 68 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 69 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 70 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 71 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 72 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 73 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 74 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 75 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 76 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 77 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 78 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 79 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 80 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 81 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 82 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 83 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 84 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 85 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 86 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 87 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 88 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 89 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 90 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 91 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 92 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 93 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 94 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 95 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 96 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 97 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 98 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 99 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 100 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 101 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 102 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 103 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 104 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 105 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 106 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 107 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 108 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 109 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 110 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 111 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 112 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 113 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 114 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 115 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 116 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 117 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 118 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 119 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 120 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 121 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 122 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 123 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 124 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 125 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 126 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 127 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 128 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 129 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 130 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 131 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 132 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 133 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 134 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 135 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 136 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 137 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 138 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 139 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 140 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 141 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 142 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 143 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 144 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 145 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 146 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 147 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 148 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 149 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 150 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 151 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 152 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 153 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 154 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 155 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 156 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 157 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 158 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 159 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 160 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 161 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 162 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 163 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 164 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 165 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 166 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 167 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 168 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 169 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 170 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 171 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 172 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 173 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 174 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 175 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 176 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 177 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 178 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 179 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 180 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 181 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 182 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 183 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 184 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 185 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 186 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 187 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 188 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 189 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 190 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 191 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 192 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 193 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 194 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 195 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 196 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 197 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 198 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 199 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 200 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 201 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 202 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 203 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 204 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 205 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 206 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 207 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 208 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 209 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 210 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 211 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 212 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 213 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 214 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 215 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 216 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 217 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 218 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 219 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 220 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 221 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 222 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 223 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 224 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 225 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 226 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 227 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 228 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 229 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 230 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 231 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 232 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 233 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 234 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 235 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 236 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 237 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 238 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 239 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 240 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 241 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 242 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 243 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 244 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 245 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 246 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 247 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 248 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 249 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 250 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 251 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 252 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 253 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 254 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 255 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 256 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 257 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 258 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 259 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 260 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 261 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 262 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 263 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 264 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 265 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 266 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 267 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 268 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 269 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 270 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 271 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 272 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 273 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 274 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 275 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 276 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 277 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 278 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 279 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 280 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 281 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 282 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 283 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 284 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 285 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 286 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 287 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 288 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 289 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 290 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 291 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 292 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 293 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 294 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 295 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 296 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 297 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 298 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 299 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 300 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 301 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 302 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 303 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 304 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 305 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 306 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 307 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 308 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 309 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 310 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 311 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 312 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 313 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 314 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 315 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 316 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 317 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 318 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 319 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 320 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 321 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 322 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 323 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 324 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 325 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 326 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 327 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 328 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 329 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 330 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 331 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 332 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 333 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 334 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 335 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 336 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 337 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 338 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 339 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 340 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 341 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 342 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 343 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 344 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 345 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 346 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 347 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 348 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 349 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 350 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 351 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 352 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 353 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 354 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 355 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 356 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 357 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 358 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 359 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 360 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 361 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 362 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 363 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 364 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 365 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 366 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 367 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 368 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 369 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 370 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 371 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 372 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 373 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 374 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 375 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 376 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 377 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 378 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 379 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 380 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 381 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 382 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 383 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 384 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 385 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 386 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 387 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 388 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 389 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 390 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 391 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 392 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 393 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 394 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 395 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 396 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 397 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 398 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 399 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 400 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 401 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 402 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 403 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 404 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 405 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 406 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 407 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 408 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 409 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 410 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 411 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 412 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 413 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 414 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 415 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 416 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 417 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 418 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 419 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 420 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 421 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 422 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 423 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 424 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 425 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 426 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 427 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 428 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 429 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 430 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 431 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 432 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 433 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 434 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 435 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 436 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 437 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 438 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 439 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 440 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 441 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 442 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 443 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 444 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 445 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 446 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 447 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 448 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 449 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 450 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 451 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 452 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 453 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 454 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 455 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 456 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 457 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 458 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 459 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 460 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 461 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 462 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 463 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 464 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 465 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 466 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 467 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 468 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 469 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 470 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 471 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 472 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 473 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 474 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 475 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 476 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 477 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 478 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 479 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 480 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 481 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 482 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 483 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 484 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 485 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 486 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 487 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 488 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 489 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 490 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 491 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 492 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 493 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 494 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 495 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 496 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 497 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 498 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 499 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 500 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 501 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 502 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 503 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 504 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 505 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 506 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 507 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 508 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 509 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 510 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 511 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 512 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 513 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 514 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 515 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 516 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 517 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 518 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 519 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 520 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 521 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 522 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 523 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 524 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 525 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 526 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 527 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 528 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 529 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 530 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 531 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 532 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 533 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 534 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 535 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 536 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 537 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 538 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 539 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 540 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 541 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 542 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 543 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 544 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 545 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 546 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 547 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 548 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 549 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 550 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 551 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 552 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 553 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 554 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 555 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 556 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 557 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 558 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 559 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 560 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 561 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 562 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 563 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 564 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 565 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 566 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 567 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 568 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 569 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 570 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 571 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 572 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 573 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 574 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 575 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 576 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 577 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 578 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 579 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 580 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 581 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 582 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 583 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 584 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 585 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 586 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 587 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 588 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 589 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 590 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 591 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 592 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 593 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 594 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 595 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 596 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 597 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 598 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 599 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 600 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 601 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 602 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 603 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 604 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 605 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 606 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 607 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 608 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 609 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 610 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 611 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 612 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 613 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 614 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 615 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 616 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 617 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 618 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 619 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 620 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 621 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 622 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 623 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 624 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 625 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 626 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 627 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 628 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 629 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 630 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 631 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 632 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 633 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 634 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 635 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 636 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 637 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 638 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 639 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 640 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 641 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 642 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 643 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 644 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 645 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 646 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 647 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 648 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 649 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 650 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 651 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 652 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 653 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 654 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 655 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 656 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 657 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 658 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 659 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 660 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 661 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 662 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 663 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 664 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 665 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 666 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 667 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 668 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 669 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 670 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 671 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 672 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 673 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 674 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 675 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 676 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 677 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 678 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 679 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 680 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 681 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 682 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 683 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 684 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 685 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 686 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 687 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 688 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 689 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 690 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 691 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 692 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 693 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 694 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 695 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 696 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 697 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 698 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 699 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 700 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 701 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 702 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 703 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 704 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 705 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 706 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 707 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 708 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 709 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 710 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 711 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 712 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 713 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 714 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 715 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 716 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 717 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 718 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 719 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 720 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 721 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 722 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 723 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 724 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 725 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 726 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 727 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 728 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 729 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 730 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 731 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 732 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 733 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 734 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 735 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 736 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 737 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 738 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 739 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 740 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 741 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 742 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 743 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 744 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 745 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 746 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 747 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 748 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 749 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 750 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 751 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 752 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 753 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 754 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 755 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 756 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 757 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 758 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 759 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 760 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 761 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 762 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 763 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 764 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 765 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 766 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 767 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 768 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 769 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 770 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 771 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 772 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 773 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 774 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 775 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 776 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 777 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 778 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 779 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 780 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 781 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 782 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 783 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 784 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 785 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 786 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 787 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 788 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 789 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 790 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 791 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 792 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 793 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 794 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 795 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 796 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 797 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 798 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 799 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 800 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 801 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 802 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 803 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 804 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 805 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 806 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 807 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 808 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 809 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 810 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 811 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 812 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 813 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 814 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 815 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 816 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 817 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 818 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 819 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 820 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 821 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 822 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 823 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 824 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 825 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 826 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 827 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 828 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 829 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 830 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 831 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 832 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 833 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 834 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 835 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 836 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 837 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 838 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 839 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 840 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 841 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 842 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 843 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 844 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 845 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 846 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 847 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 848 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 849 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 850 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 851 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 852 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 853 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 854 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 855 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 856 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 857 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 858 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 859 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 860 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 861 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 862 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 863 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 864 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 865 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 866 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 867 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 868 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 869 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 870 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 871 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 872 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 873 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 874 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 875 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 876 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 877 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 878 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 879 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 880 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 881 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 882 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 883 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 884 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 885 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 886 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 887 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 888 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 889 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 890 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 891 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 892 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 893 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 894 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 895 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 896 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 897 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 898 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 899 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 900 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 901 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 902 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 903 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 904 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 905 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 906 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 907 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 908 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 909 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 910 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 911 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 912 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 913 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 914 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 915 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 916 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 917 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 918 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 919 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 920 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 921 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 922 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 923 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 924 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 925 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 926 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 927 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 928 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 929 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 930 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 931 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 932 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 933 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 934 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 935 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 936 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 937 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 938 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 939 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 940 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 941 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 942 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 943 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 944 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 945 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 946 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 947 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 948 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 949 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 950 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 951 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 952 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 953 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 954 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 955 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 956 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 957 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 958 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 959 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 960 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 961 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 962 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 963 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 964 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 965 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 966 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 967 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 968 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 969 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 970 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 971 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 972 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 973 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 974 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 975 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 976 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 977 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 978 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 979 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 980 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 981 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 982 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 983 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 984 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 985 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 986 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 987 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 988 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 989 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 990 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 991 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 992 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 993 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 994 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 995 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 996 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 997 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 998 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 999 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1000 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1001 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1002 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1003 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1004 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 33.99 |
| Metatranscriptomes | 0.08 |
| Isolates | 65.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.31 |
| Nodule | 55.13 |
| Rhizoplane | 1.29 |
| Rhizosphere | 18.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10007488 | 3300001979 | Bacteria | 4433 |
| 2 | JGI24740J21852_10008714 | 3300001979 | Bacteria | 4027 |
| 3 | JGI25155J39150_1000020 | 3300002704 | Bacteria | 152963 |
| 4 | JGI25156J39149_1000021 | 3300002705 | Bacteria | 152968 |
| 5 | JGI25162J39368_1000365 | 3300002737 | Bacteria | 38564 |
| 6 | JGI25162J39368_1004315 | 3300002737 | Bacteria | 3385 |
| 7 | JGI25154J39366_1000039 | 3300002738 | Bacteria | 152972 |
| 8 | JGI25158J39367_1000082 | 3300002739 | Bacteria | 21992 |
| 9 | JGI25158J39367_1001318 | 3300002739 | Bacteria | 4403 |
| 10 | JGI25157J39369_1000019 | 3300002741 | Bacteria | 176591 |
| 11 | JGI25157J39369_1000470 | 3300002741 | Bacteria | 25329 |
| 12 | JGI25152J39213_1001420 | 3300002773 | Bacteria | 10367 |
| 13 | JGI25152J39213_1001841 | 3300002773 | Bacteria | 8561 |
| 14 | JGI25152J39213_1006895 | 3300002773 | Bacteria | 3006 |
| 15 | JGI25150J39212_1002943 | 3300002774 | Bacteria | 4107 |
| 16 | JGI25159J45721_1000144 | 3300002987 | Bacteria | 32636 |
| 17 | JGI25159J45721_1001639 | 3300002987 | Bacteria | 9104 |
| 18 | JGI25159J45721_1002456 | 3300002987 | Bacteria | 7030 |
| 19 | JGI25151J46595_10000508 | 3300003187 | Bacteria | 36520 |
| 20 | JGI25151J46595_10009496 | 3300003187 | Bacteria | 4599 |
| 21 | JGI25406J46586_10039323 | 3300003203 | Bacteria | 1687 |
| 22 | JGI25165J46597_1000018 | 3300003214 | Bacteria | 374701 |
| 23 | JGI25165J46597_1000078 | 3300003214 | Bacteria | 179320 |
| 24 | JGI25165J46597_1001675 | 3300003214 | Bacteria | 10066 |
| 25 | JGI25165J46597_1006637 | 3300003214 | Bacteria | 2027 |
| 26 | JGI25153J46596_10006031 | 3300003215 | Bacteria | 6228 |
| 27 | JGI25153J46596_10006757 | 3300003215 | Bacteria | 5753 |
| 28 | JGI25153J46596_10026215 | 3300003215 | Bacteria | 2068 |
| 29 | JGI25160J50197_1000014 | 3300003354 | Bacteria | 259862 |
| 30 | JGI25160J50197_1000299 | 3300003354 | Bacteria | 34962 |
| 31 | JGI25160J50197_1005949 | 3300003354 | Bacteria | 5011 |
| 32 | JGI25160J50197_1006197 | 3300003354 | Bacteria | 4867 |
| 33 | JGI25161J50226_1000061 | 3300003374 | Bacteria | 101391 |
| 34 | JGI25161J50226_1000682 | 3300003374 | Bacteria | 13426 |
| 35 | JGI25161J50226_1000727 | 3300003374 | Bacteria | 12773 |
| 36 | JGI25161J50226_1004538 | 3300003374 | Bacteria | 2890 |
| 37 | Ga0055542_1001263 | 3300003762 | Bacteria | 13787 |
| 38 | Ga0055529_1001910 | 3300003763 | Bacteria | 4760 |
| 39 | Ga0055526_1003605 | 3300003771 | Bacteria | 9713 |
| 40 | Ga0055526_1003836 | 3300003771 | Bacteria | 9335 |
| 41 | Ga0055526_1004842 | 3300003771 | Bacteria | 7943 |
| 42 | Ga0055526_1020052 | 3300003771 | Bacteria | 2401 |
| 43 | Ga0055524_1001107 | 3300003775 | Bacteria | 16291 |
| 44 | Ga0055524_1002762 | 3300003775 | Bacteria | 8828 |
| 45 | Ga0055524_1010769 | 3300003775 | Bacteria | 3618 |
| 46 | Ga0055524_1020860 | 3300003775 | Bacteria | 2192 |
| 47 | Ga0055536_1018593 | 3300003781 | Bacteria | 2221 |
| 48 | Ga0055528_1000109 | 3300003790 | Bacteria | 66661 |
| 49 | Ga0055528_1000206 | 3300003790 | Bacteria | 49816 |
| 50 | Ga0055528_1002426 | 3300003790 | Bacteria | 9994 |
| 51 | Ga0055528_1010402 | 3300003790 | Bacteria | 3784 |
| 52 | Ga0055528_1010816 | 3300003790 | Bacteria | 3677 |
| 53 | Ga0055540_1000197 | 3300003792 | Bacteria | 58449 |
| 54 | Ga0055540_1004400 | 3300003792 | Bacteria | 6375 |
| 55 | Ga0055540_1015850 | 3300003792 | Bacteria | 2172 |
| 56 | Ga0055531_10006820 | 3300003794 | Bacteria | 6375 |
| 57 | Ga0058692_1007706 | 3300003856 | Bacteria | 2834 |
| 58 | Ga0055543_1000005 | 3300004625 | Bacteria | 223621 |
| 59 | Ga0055543_1000327 | 3300004625 | Bacteria | 32674 |
| 60 | Ga0055543_1000578 | 3300004625 | Bacteria | 20193 |
| 61 | Ga0055543_1000913 | 3300004625 | Bacteria | 13784 |
| 62 | Ga0065165_1000126 | 3300005262 | Bacteria | 129946 |
| 63 | Ga0065165_1001070 | 3300005262 | Bacteria | 32674 |
| 64 | Ga0065165_1003349 | 3300005262 | Bacteria | 11399 |
| 65 | Ga0065165_1011198 | 3300005262 | Bacteria | 3775 |
| 66 | Ga0065707_10020754 | 3300005295 | Bacteria | 1839 |
| 67 | Ga0070676_10134815 | 3300005328 | Bacteria | 1565 |
| 68 | Ga0070666_10155484 | 3300005335 | Bacteria | 1597 |
| 69 | Ga0068868_100078415 | 3300005338 | Bacteria | 2645 |
| 70 | Ga0070660_100007424 | 3300005339 | Bacteria | 7639 |
| 71 | Ga0070689_100222069 | 3300005340 | Bacteria | 1550 |
| 72 | Ga0070691_10031439 | 3300005341 | Bacteria | 2489 |
| 73 | Ga0070661_100007127 | 3300005344 | Bacteria | 7710 |
| 74 | Ga0070661_100157862 | 3300005344 | Bacteria | 1717 |
| 75 | Ga0070671_100037928 | 3300005355 | Bacteria | 3998 |
| 76 | Ga0070674_100004659 | 3300005356 | Bacteria | 7835 |
| 77 | Ga0070659_100135236 | 3300005366 | Bacteria | 2004 |
| 78 | Ga0070667_100053632 | 3300005367 | Bacteria | 3403 |
| 79 | Ga0070667_100066279 | 3300005367 | Bacteria | 3068 |
| 80 | Ga0070663_100142285 | 3300005455 | Bacteria | 1832 |
| 81 | Ga0070684_100260441 | 3300005535 | Bacteria | 1586 |
| 82 | Ga0070665_100033626 | 3300005548 | Bacteria | 5158 |
| 83 | Ga0070665_100131156 | 3300005548 | Bacteria | 2508 |
| 84 | Ga0070665_100149150 | 3300005548 | Bacteria | 2342 |
| 85 | Ga0070665_100184907 | 3300005548 | Bacteria | 2084 |
| 86 | Ga0068855_100018333 | 3300005563 | Bacteria | 8408 |
| 87 | Ga0068855_100207120 | 3300005563 | Bacteria | 2206 |
| 88 | Ga0068854_100058022 | 3300005578 | Bacteria | 2793 |
| 89 | Ga0068856_100028448 | 3300005614 | Bacteria | 5459 |
| 90 | Ga0068856_100192594 | 3300005614 | Bacteria | 2053 |
| 91 | Ga0068856_100306076 | 3300005614 | Bacteria | 1607 |
| 92 | Ga0068852_100054820 | 3300005616 | Bacteria | 3438 |
| 93 | Ga0068852_100104186 | 3300005616 | Bacteria | 2567 |
| 94 | Ga0068858_100053313 | 3300005842 | Bacteria | 3741 |
| 95 | Ga0068860_100091484 | 3300005843 | Bacteria | 2898 |
| 96 | Ga0081538_10000693 | 3300005981 | Bacteria | 37007 |
| 97 | Ga0081540_1004077 | 3300005983 | Bacteria | 11309 |
| 98 | Ga0081539_10000618 | 3300005985 | Bacteria | 71969 |
| 99 | Ga0075365_10007816 | 3300006038 | Bacteria | 6021 |
| 100 | Ga0075365_10024630 | 3300006038 | Bacteria | 3799 |
| 101 | Ga0075365_10046141 | 3300006038 | Bacteria | 2861 |
| 102 | Ga0075365_10102015 | 3300006038 | Bacteria | 1966 |
| 103 | Ga0075365_10104563 | 3300006038 | Bacteria | 1941 |
| 104 | Ga0075365_10125324 | 3300006038 | Bacteria | 1775 |
| 105 | Ga0075368_10038116 | 3300006042 | Bacteria | 1881 |
| 106 | Ga0075363_100104127 | 3300006048 | Bacteria | 1573 |
| 107 | Ga0075363_100149446 | 3300006048 | Bacteria | 1318 |
| 108 | Ga0075364_10060878 | 3300006051 | Bacteria | 2475 |
| 109 | Ga0075362_10070629 | 3300006177 | Bacteria | 1594 |
| 110 | Ga0075367_10006345 | 3300006178 | Bacteria | 5964 |
| 111 | Ga0075367_10136538 | 3300006178 | Bacteria | 1517 |
| 112 | Ga0075369_10013882 | 3300006186 | Bacteria | 3207 |
| 113 | Ga0075369_10029051 | 3300006186 | Bacteria | 2320 |
| 114 | Ga0075369_10048179 | 3300006186 | Bacteria | 1838 |
| 115 | Ga0075366_10023777 | 3300006195 | Bacteria | 3570 |
| 116 | Ga0097621_100025519 | 3300006237 | Bacteria | 4624 |
| 117 | Ga0075370_10048803 | 3300006353 | Bacteria | 2399 |
| 118 | Ga0075370_10114930 | 3300006353 | Bacteria | 1564 |
| 119 | Ga0105251_10018174 | 3300009011 | Bacteria | 3745 |
| 120 | Ga0105244_10108944 | 3300009036 | Bacteria | 1349 |
| 121 | Ga0105240_10000012 | 3300009093 | Bacteria | 496639 |
| 122 | Ga0105240_10004169 | 3300009093 | Bacteria | 22155 |
| 123 | Ga0105240_10098247 | 3300009093 | Bacteria | 3566 |
| 124 | Ga0105240_10126626 | 3300009093 | Bacteria | 3069 |
| 125 | Ga0105240_10137792 | 3300009093 | Bacteria | 2921 |
| 126 | Ga0105245_10229139 | 3300009098 | Bacteria | 1796 |
| 127 | Ga0105247_10139471 | 3300009101 | Bacteria | 1587 |
| 128 | Ga0105241_10076691 | 3300009174 | Bacteria | 2607 |
| 129 | Ga0105241_10082912 | 3300009174 | Bacteria | 2514 |
| 130 | Ga0105242_10052529 | 3300009176 | Bacteria | 3326 |
| 131 | Ga0105248_10050963 | 3300009177 | Bacteria | 4645 |
| 132 | Ga0105248_10145399 | 3300009177 | Bacteria | 2675 |
| 133 | Ga0105237_10001333 | 3300009545 | Bacteria | 32755 |
| 134 | Ga0105237_10229135 | 3300009545 | Bacteria | 1859 |
| 135 | Ga0105237_10239493 | 3300009545 | Bacteria | 1816 |
| 136 | Ga0105238_10001985 | 3300009551 | Bacteria | 20609 |
| 137 | Ga0105238_10007461 | 3300009551 | Bacteria | 10956 |
| 138 | Ga0105238_10078168 | 3300009551 | Bacteria | 3300 |
| 139 | Ga0105238_10084094 | 3300009551 | Bacteria | 3171 |
| 140 | Ga0123341_1000056 | 3300009765 | Bacteria | 48113 |
| 141 | Ga0123342_1014953 | 3300009766 | Bacteria | 7236 |
| 142 | Ga0123342_1022984 | 3300009766 | Bacteria | 4127 |
| 143 | Ga0105239_10024984 | 3300010375 | Bacteria | 6581 |
| 144 | Ga0105239_10080988 | 3300010375 | Bacteria | 3573 |
| 145 | Ga0105239_10103692 | 3300010375 | Bacteria | 3148 |
| 146 | Ga0105239_10112377 | 3300010375 | Bacteria | 3020 |
| 147 | Ga0105239_10157262 | 3300010375 | Bacteria | 2539 |
| 148 | Ga0157371_10094516 | 3300013102 | Bacteria | 2118 |
| 149 | Ga0157370_10003035 | 3300013104 | Bacteria | 19919 |
| 150 | Ga0157370_10019121 | 3300013104 | Bacteria | 6887 |
| 151 | Ga0157369_10010647 | 3300013105 | Bacteria | 10469 |
| 152 | Ga0157369_10079206 | 3300013105 | Bacteria | 3519 |
| 153 | Ga0157369_10168370 | 3300013105 | Bacteria | 2310 |
| 154 | Ga0157374_10025729 | 3300013296 | Bacteria | 5288 |
| 155 | Ga0157374_10128299 | 3300013296 | Bacteria | 2453 |
| 156 | Ga0163162_10481565 | 3300013306 | Bacteria | 1372 |
| 157 | Ga0182008_10031883 | 3300014497 | Bacteria | 2649 |
| 158 | Ga0157379_10004478 | 3300014968 | Bacteria | 11978 |
| 159 | Ga0157376_10023221 | 3300014969 | Bacteria | 4852 |
| 160 | Ga0182007_10009237 | 3300015262 | Bacteria | 3993 |
| 161 | Ga0182005_1000879 | 3300015265 | Bacteria | 13296 |
| 162 | Ga0183363_1378 | 3300015690 | Bacteria | 4519 |
| 163 | Ga0214544_1000771 | 3300021320 | Bacteria | 61917 |
| 164 | Ga0214542_1000032 | 3300021321 | Bacteria | 171690 |
| 165 | Ga0214543_1000005 | 3300021327 | Bacteria | 454523 |
| 166 | Ga0214543_1000016 | 3300021327 | Bacteria | 295257 |
| 167 | Ga0224712_10041353 | 3300022467 | Bacteria | 1740 |
| 168 | Ga0228710_1011640 | 3300022740 | Bacteria | 11259 |
| 169 | Ga0209435_100025 | 3300025206 | Bacteria | 198776 |
| 170 | Ga0209436_100008 | 3300025208 | Bacteria | 145772 |
| 171 | Ga0209436_101349 | 3300025208 | Bacteria | 8678 |
| 172 | Ga0209672_104342 | 3300025228 | Bacteria | 2648 |
| 173 | Ga0209563_104417 | 3300025230 | Bacteria | 2691 |
| 174 | Ga0209437_100022 | 3300025233 | Bacteria | 625694 |
| 175 | Ga0209437_100040 | 3300025233 | Bacteria | 448096 |
| 176 | Ga0209437_102580 | 3300025233 | Bacteria | 3478 |
| 177 | Ga0207425_1002698 | 3300025245 | Bacteria | 6077 |
| 178 | Ga0207425_1005570 | 3300025245 | Bacteria | 3570 |
| 179 | Ga0209646_1000083 | 3300025246 | Bacteria | 198777 |
| 180 | Ga0209646_1004647 | 3300025246 | Bacteria | 2477 |
| 181 | Ga0209026_1000078 | 3300025250 | Bacteria | 198777 |
| 182 | Ga0209026_1000151 | 3300025250 | Bacteria | 110338 |
| 183 | Ga0209677_100948 | 3300025253 | Bacteria | 14158 |
| 184 | Ga0209677_102746 | 3300025253 | Bacteria | 6291 |
| 185 | Ga0209677_108148 | 3300025253 | Bacteria | 2079 |
| 186 | Ga0209148_1000032 | 3300025254 | Bacteria | 557660 |
| 187 | Ga0209759_1000060 | 3300025256 | Bacteria | 198777 |
| 188 | Ga0209759_1000076 | 3300025256 | Bacteria | 175911 |
| 189 | Ga0209129_1000016 | 3300025258 | Bacteria | 485491 |
| 190 | Ga0209129_1004306 | 3300025258 | Bacteria | 5652 |
| 191 | Ga0209129_1004490 | 3300025258 | Bacteria | 5420 |
| 192 | Ga0209129_1006965 | 3300025258 | Bacteria | 3490 |
| 193 | Ga0209129_1009104 | 3300025258 | Bacteria | 2664 |
| 194 | Ga0209129_1015376 | 3300025258 | Bacteria | 1578 |
| 195 | Ga0209233_1000031 | 3300025261 | Bacteria | 624646 |
| 196 | Ga0209233_1000051 | 3300025261 | Bacteria | 447617 |
| 197 | Ga0209233_1000146 | 3300025261 | Bacteria | 187269 |
| 198 | Ga0209233_1000150 | 3300025261 | Bacteria | 179401 |
| 199 | Ga0209233_1000216 | 3300025261 | Bacteria | 108123 |
| 200 | Ga0209233_1012311 | 3300025261 | Bacteria | 2485 |
| 201 | Ga0209233_1030683 | 3300025261 | Bacteria | 1264 |
| 202 | Ga0209455_1000085 | 3300025272 | Bacteria | 247601 |
| 203 | Ga0209455_1010995 | 3300025272 | Bacteria | 2258 |
| 204 | Ga0209673_1000005 | 3300025273 | Bacteria | 692788 |
| 205 | Ga0209673_1000023 | 3300025273 | Bacteria | 411385 |
| 206 | Ga0209673_1000797 | 3300025273 | Bacteria | 41846 |
| 207 | Ga0209673_1002811 | 3300025273 | Bacteria | 11252 |
| 208 | Ga0209673_1004600 | 3300025273 | Bacteria | 7315 |
| 209 | Ga0209673_1011855 | 3300025273 | Bacteria | 3559 |
| 210 | Ga0209673_1011856 | 3300025273 | Bacteria | 3559 |
| 211 | Ga0209130_1000013 | 3300025284 | Bacteria | 412810 |
| 212 | Ga0209130_1000019 | 3300025284 | Bacteria | 381993 |
| 213 | Ga0209130_1000054 | 3300025284 | Bacteria | 212299 |
| 214 | Ga0209676_1003759 | 3300025292 | Bacteria | 8997 |
| 215 | Ga0209676_1022772 | 3300025292 | Bacteria | 2067 |
| 216 | Ga0209025_1000397 | 3300025294 | Bacteria | 89703 |
| 217 | Ga0209025_1000794 | 3300025294 | Bacteria | 51442 |
| 218 | Ga0209025_1002393 | 3300025294 | Bacteria | 20037 |
| 219 | Ga0209025_1020637 | 3300025294 | Bacteria | 3591 |
| 220 | Ga0209025_1027175 | 3300025294 | Bacteria | 2846 |
| 221 | Ga0209025_1038447 | 3300025294 | Bacteria | 2104 |
| 222 | Ga0209564_1000112 | 3300025295 | Bacteria | 211939 |
| 223 | Ga0209564_1000929 | 3300025295 | Bacteria | 38046 |
| 224 | Ga0209564_1004352 | 3300025295 | Bacteria | 8719 |
| 225 | Ga0209564_1004904 | 3300025295 | Bacteria | 7931 |
| 226 | Ga0209564_1006446 | 3300025295 | Bacteria | 6324 |
| 227 | Ga0209564_1007010 | 3300025295 | Bacteria | 5910 |
| 228 | Ga0209758_1000316 | 3300025297 | Bacteria | 93634 |
| 229 | Ga0209758_1000532 | 3300025297 | Bacteria | 60639 |
| 230 | Ga0209758_1001534 | 3300025297 | Bacteria | 26574 |
| 231 | Ga0209758_1003167 | 3300025297 | Bacteria | 15436 |
| 232 | Ga0209758_1007150 | 3300025297 | Bacteria | 7704 |
| 233 | Ga0209758_1007291 | 3300025297 | Bacteria | 7586 |
| 234 | Ga0209256_1000485 | 3300025299 | Bacteria | 58920 |
| 235 | Ga0209256_1000549 | 3300025299 | Bacteria | 53852 |
| 236 | Ga0209256_1000583 | 3300025299 | Bacteria | 51552 |
| 237 | Ga0209256_1002847 | 3300025299 | Bacteria | 13193 |
| 238 | Ga0209256_1007271 | 3300025299 | Bacteria | 5521 |
| 239 | Ga0209256_1015469 | 3300025299 | Bacteria | 2666 |
| 240 | Ga0209256_1018562 | 3300025299 | Bacteria | 2251 |
| 241 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 242 | Ga0207426_1000022 | 3300025302 | Bacteria | 547377 |
| 243 | Ga0207426_1000127 | 3300025302 | Bacteria | 212942 |
| 244 | Ga0207426_1000355 | 3300025302 | Bacteria | 83450 |
| 245 | Ga0207426_1000884 | 3300025302 | Bacteria | 30977 |
| 246 | Ga0209051_1000119 | 3300025303 | Bacteria | 148746 |
| 247 | Ga0209051_1006341 | 3300025303 | Bacteria | 6693 |
| 248 | Ga0209051_1006348 | 3300025303 | Bacteria | 6688 |
| 249 | Ga0209051_1012030 | 3300025303 | Bacteria | 4220 |
| 250 | Ga0209051_1024195 | 3300025303 | Bacteria | 2503 |
| 251 | Ga0209257_1005204 | 3300025304 | Bacteria | 9333 |
| 252 | Ga0209257_1007029 | 3300025304 | Bacteria | 6971 |
| 253 | Ga0207656_10019890 | 3300025321 | Bacteria | 2660 |
| 254 | Ga0207647_10024760 | 3300025904 | Bacteria | 3954 |
| 255 | Ga0207695_10000120 | 3300025913 | Bacteria | 234247 |
| 256 | Ga0207695_10040383 | 3300025913 | Bacteria | 5004 |
| 257 | Ga0207671_10000755 | 3300025914 | Bacteria | 41010 |
| 258 | Ga0207671_10016640 | 3300025914 | Bacteria | 5710 |
| 259 | Ga0207671_10033541 | 3300025914 | Bacteria | 3818 |
| 260 | Ga0207657_10178302 | 3300025919 | Bacteria | 1718 |
| 261 | Ga0207657_10188435 | 3300025919 | Bacteria | 1665 |
| 262 | Ga0207649_10014377 | 3300025920 | Bacteria | 4430 |
| 263 | Ga0207681_10163879 | 3300025923 | Bacteria | 1679 |
| 264 | Ga0207694_10065860 | 3300025924 | Bacteria | 2825 |
| 265 | Ga0207694_10100400 | 3300025924 | Bacteria | 2293 |
| 266 | Ga0207690_10354943 | 3300025932 | Bacteria | 1160 |
| 267 | Ga0207691_10232864 | 3300025940 | Bacteria | 1594 |
| 268 | Ga0207667_10015837 | 3300025949 | Bacteria | 8546 |
| 269 | Ga0207667_10174779 | 3300025949 | Bacteria | 2207 |
| 270 | Ga0207667_10306196 | 3300025949 | Bacteria | 1623 |
| 271 | Ga0207668_10082377 | 3300025972 | Bacteria | 2337 |
| 272 | Ga0207640_10167509 | 3300025981 | Bacteria | 1633 |
| 273 | Ga0207677_10023298 | 3300026023 | Bacteria | 3822 |
| 274 | Ga0207639_10011379 | 3300026041 | Bacteria | 6179 |
| 275 | Ga0207678_10142359 | 3300026067 | Bacteria | 2047 |
| 276 | Ga0207702_10020473 | 3300026078 | Bacteria | 5476 |
| 277 | Ga0207648_10088546 | 3300026089 | Bacteria | 2703 |
| 278 | Ga0207648_10134773 | 3300026089 | Bacteria | 2175 |
| 279 | Ga0207676_10175729 | 3300026095 | Bacteria | 1870 |
| 280 | Ga0207683_10218704 | 3300026121 | Bacteria | 1735 |
| 281 | Ga0207698_10088397 | 3300026142 | Bacteria | 2527 |
| 282 | Ga0207698_10106579 | 3300026142 | Bacteria | 2338 |
| 283 | Ga0207698_10314783 | 3300026142 | Bacteria | 1463 |
| 284 | Ga0209281_1001451 | 3300027111 | Bacteria | 13925 |
| 285 | Ga0209281_1001484 | 3300027111 | Bacteria | 13515 |
| 286 | Ga0209371_1003208 | 3300027312 | Bacteria | 8234 |
| 287 | Ga0268266_10084100 | 3300028379 | Bacteria | 2778 |
| 288 | Ga0265318_10003621 | 3300028577 | Bacteria | 7718 |
| 289 | Ga0265318_10047625 | 3300028577 | Bacteria | 1616 |
| 290 | Ga0307515_10000136 | 3300028794 | Bacteria | 174265 |
| 291 | Ga0307515_10000252 | 3300028794 | Bacteria | 132500 |
| 292 | Ga0307515_10001908 | 3300028794 | Bacteria | 46296 |
| 293 | Ga0307515_10007811 | 3300028794 | Bacteria | 21042 |
| 294 | Ga0307515_10021612 | 3300028794 | Bacteria | 11395 |
| 295 | Ga0307515_10088198 | 3300028794 | Bacteria | 3925 |
| 296 | Ga0268256_1000785 | 3300030500 | Bacteria | 22910 |
| 297 | Ga0265320_10007179 | 3300031240 | Bacteria | 6940 |
| 298 | Ga0265339_10090250 | 3300031249 | Bacteria | 1607 |
| 299 | Ga0265327_10027653 | 3300031251 | Bacteria | 3259 |
| 300 | Ga0307513_10000302 | 3300031456 | Bacteria | 70793 |
| 301 | Ga0307513_10140242 | 3300031456 | Bacteria | 2345 |
| 302 | Ga0307513_10192902 | 3300031456 | Bacteria | 1887 |
| 303 | Ga0265314_10024925 | 3300031711 | Bacteria | 4523 |
| 304 | Ga0265314_10025241 | 3300031711 | Bacteria | 4489 |
| 305 | Ga0307405_10134930 | 3300031731 | Bacteria | 1712 |
| 306 | Ga0307412_10045558 | 3300031911 | Bacteria | 2868 |
| 307 | Ga0315914_1022150 | 3300031967 | Bacteria | 4819 |
| 308 | Ga0307414_10067027 | 3300032004 | Bacteria | 2569 |
| 309 | Ga0307411_10106116 | 3300032005 | Bacteria | 1999 |
| 310 | Ga0315915_1000265 | 3300033464 | Bacteria | 48403 |
| 311 | Ga0373943_0053235 | 3300035170 | Bacteria | 1998 |
| 312 | Ga0373935_0172695 | 3300035692 | Bacteria | 1479 |
| 313 | Ga0373927_0003688 | 3300035695 | Bacteria | 10895 |
| 314 | Ga0373925_0014583 | 3300037068 | Bacteria | 5679 |
| 315 | Ga0395899_0005027 | 3300037312 | Bacteria | 10280 |
| 316 | Ga0395900_0156037 | 3300037418 | Bacteria | 2331 |
| 317 | Ga0395898_0064562 | 3300037466 | Bacteria | 3550 |
| 318 | Ga0395905_0011186 | 3300037471 | Bacteria | 8676 |
| 319 | Ga0395905_0109914 | 3300037471 | Bacteria | 2588 |
| 320 | Ga0395901_0087394 | 3300038443 | Bacteria | 3259 |
| 321 | Ga0395901_0293080 | 3300038443 | Bacteria | 1688 |
| 322 | Ga0436363_1084910 | 3300039450 | Bacteria | 1525 |
| 323 | Ga0451855_0071228 | 3300041511 | Bacteria | 1826 |
| 324 | Ga0451577_0141154 | 3300042876 | Bacteria | 2165 |
| 325 | Ga0466972_0029833 | 3300044658 | Bacteria | 2685 |
| 326 | Ga0466961_0099736 | 3300044693 | Bacteria | 1830 |
| 327 | Ga0466970_0001801 | 3300044765 | Bacteria | 10325 |
| 328 | Ga0466960_0007204 | 3300044901 | Bacteria | 4503 |
| 329 | Ga0495638_0013036 | 3300046460 | Bacteria | 5676 |
| 330 | Ga0495638_0045935 | 3300046460 | Bacteria | 2745 |
| 331 | Ga0495605_0001661 | 3300046474 | Bacteria | 14304 |
| 332 | Ga0495662_0006894 | 3300046476 | Bacteria | 5643 |
| 333 | Ga0495662_0058828 | 3300046476 | Bacteria | 1856 |
| 334 | Ga0495585_0007048 | 3300046492 | Bacteria | 6914 |
| 335 | Ga0495610_0067746 | 3300046512 | Bacteria | 1676 |
| 336 | Ga0495610_0117707 | 3300046512 | Bacteria | 1169 |
| 337 | Ga0495616_0022393 | 3300046513 | Bacteria | 3413 |
| 338 | Ga0495620_0048340 | 3300046515 | Bacteria | 1826 |
| 339 | Ga0495631_0002544 | 3300046518 | Bacteria | 10221 |
| 340 | Ga0495632_0030102 | 3300046519 | Bacteria | 2821 |
| 341 | Ga0495643_0104040 | 3300046522 | Bacteria | 1451 |
| 342 | Ga0495643_0114757 | 3300046522 | Bacteria | 1366 |
| 343 | Ga0495665_0028717 | 3300046531 | Bacteria | 2981 |
| 344 | Ga0495622_0006140 | 3300046557 | Bacteria | 5583 |
| 345 | Ga0495633_0058083 | 3300046558 | Bacteria | 1816 |
| 346 | Ga0495668_0007692 | 3300046616 | Bacteria | 6851 |
| 347 | Ga0495625_0003553 | 3300046660 | Bacteria | 15383 |
| 348 | Ga0495625_0015985 | 3300046660 | Bacteria | 5920 |
| 349 | Ga0495625_0026895 | 3300046660 | Bacteria | 4338 |
| 350 | Ga0495625_0162758 | 3300046660 | Bacteria | 1494 |
| 351 | Ga0495660_0028017 | 3300046810 | Bacteria | 3185 |
| 352 | Ga0495604_0039217 | 3300047317 | Bacteria | 3723 |
| 353 | Ga0495687_021097 | 3300047443 | Bacteria | 3162 |
| 354 | Ga0495686_0000547 | 3300047472 | Bacteria | 53728 |
| 355 | Ga0495686_0179615 | 3300047472 | Bacteria | 1227 |
| 356 | Ga0495626_0033628 | 3300048091 | Bacteria | 2456 |
| 357 | Ga0496102_0118066 | 3300048905 | Bacteria | 2476 |
| 358 | Ga0496103_0025684 | 3300048906 | Bacteria | 3562 |
| 359 | Ga0496104_0008536 | 3300048907 | Bacteria | 9105 |
| 360 | Ga0496104_0191297 | 3300048907 | Bacteria | 1958 |
| 361 | Ga0496106_0064235 | 3300048909 | Bacteria | 2792 |
| 362 | Ga0496108_0010633 | 3300048911 | Bacteria | 7465 |
| 363 | Ga0496109_0033792 | 3300048912 | Bacteria | 4603 |
| 364 | Ga0496109_0293805 | 3300048912 | Bacteria | 1532 |
| 365 | Ga0496110_0157216 | 3300048913 | Bacteria | 2059 |
| 366 | Ga0496112_0013656 | 3300048915 | Bacteria | 7504 |
| 367 | Ga0496112_0323267 | 3300048915 | Bacteria | 1487 |
| 368 | Ga0496113_0087689 | 3300048916 | Bacteria | 2393 |
| 369 | Ga0496116_0023380 | 3300048919 | Bacteria | 4603 |
| 370 | Ga0496116_0026027 | 3300048919 | Bacteria | 4287 |
| 371 | Ga0496117_0022658 | 3300048920 | Bacteria | 5033 |
| 372 | Ga0496117_0090384 | 3300048920 | Bacteria | 1973 |
| 373 | Ga0496118_0000678 | 3300048921 | Bacteria | 55390 |
| 374 | Ga0496118_0025744 | 3300048921 | Bacteria | 5033 |
| 375 | Ga0496118_0046403 | 3300048921 | Bacteria | 3380 |
| 376 | Ga0496119_0005218 | 3300048922 | Bacteria | 12541 |
| 377 | Ga0496119_0047696 | 3300048922 | Bacteria | 2662 |
| 378 | Ga0496120_0005160 | 3300048923 | Bacteria | 10549 |
| 379 | Ga0496120_0045245 | 3300048923 | Bacteria | 2551 |
| 380 | Ga0496120_0073917 | 3300048923 | Bacteria | 1864 |
| 381 | Ga0496120_0086068 | 3300048923 | Bacteria | 1690 |
| 382 | Ga0496121_0006740 | 3300048924 | Bacteria | 14095 |
| 383 | Ga0496121_0019147 | 3300048924 | Bacteria | 6861 |
| 384 | Ga0496121_0040375 | 3300048924 | Bacteria | 4095 |
| 385 | Ga0496121_0041028 | 3300048924 | Bacteria | 4052 |
| 386 | Ga0496121_0103625 | 3300048924 | Bacteria | 2188 |
| 387 | Ga0496122_0013405 | 3300048925 | Bacteria | 8026 |
| 388 | Ga0496122_0033322 | 3300048925 | Bacteria | 4239 |
| 389 | Ga0496123_0030462 | 3300048926 | Bacteria | 3949 |
| 390 | Ga0496123_0031049 | 3300048926 | Bacteria | 3896 |
| 391 | Ga0496124_0006040 | 3300048927 | Bacteria | 13343 |
| 392 | Ga0496124_0124481 | 3300048927 | Bacteria | 2056 |
| 393 | Ga0496124_0208831 | 3300048927 | Bacteria | 1479 |
| 394 | Ga0496125_0005418 | 3300048928 | Bacteria | 14211 |
| 395 | Ga0496125_0019854 | 3300048928 | Bacteria | 6322 |
| 396 | Ga0496126_0280571 | 3300048929 | Bacteria | 1380 |
| 397 | Ga0501032_0011258 | 3300049569 | Bacteria | 6422 |
| 398 | Ga0501032_0123145 | 3300049569 | Bacteria | 1713 |
| 399 | Ga0501033_0011269 | 3300049570 | Bacteria | 6844 |
| 400 | Ga0501034_0236774 | 3300049571 | Bacteria | 1773 |
| 401 | Ga0501036_0148827 | 3300049572 | Bacteria | 1975 |
| 402 | Ga0501037_0008644 | 3300049573 | Bacteria | 7467 |
| 403 | Ga0501037_0014468 | 3300049573 | Bacteria | 5807 |
| 404 | Ga0501038_0004644 | 3300049574 | Bacteria | 12785 |
| 405 | Ga0501039_0204987 | 3300049575 | Bacteria | 1550 |
| 406 | Ga0501043_0106341 | 3300049579 | Bacteria | 2204 |
| 407 | Ga0501046_0007662 | 3300049580 | Bacteria | 9470 |
| 408 | Ga0501047_0035639 | 3300049581 | Bacteria | 4806 |
| 409 | Ga0501048_0062808 | 3300049582 | Bacteria | 2628 |
| 410 | Ga0501068_0007716 | 3300049584 | Bacteria | 5953 |
| 411 | Ga0501070_0047962 | 3300049586 | Bacteria | 3549 |
| 412 | Ga0501070_0116753 | 3300049586 | Bacteria | 2204 |
| 413 | Ga0501070_0141907 | 3300049586 | Bacteria | 1983 |
| 414 | Ga0501073_0090684 | 3300049589 | Bacteria | 2124 |
| 415 | Ga0501080_0169501 | 3300049742 | Bacteria | 2014 |
| 416 | Ga0501241_001691 | 3300049758 | Bacteria | 4400 |
| 417 | Ga0501035_0013801 | 3300049822 | Bacteria | 7457 |
| 418 | Ga0501035_0024380 | 3300049822 | Bacteria | 5548 |
| 419 | Ga0501035_0037022 | 3300049822 | Bacteria | 4420 |
| 420 | Ga0501035_0069572 | 3300049822 | Bacteria | 3119 |
| 421 | Ga0501044_0024577 | 3300049823 | Bacteria | 6393 |
| 422 | Ga0501044_0033641 | 3300049823 | Bacteria | 5384 |
| 423 | Ga0501044_0110010 | 3300049823 | Bacteria | 2764 |
| 424 | nmdc:mga03683_67832_c1 | 3300050489 | Bacteria | 1519 |
| 425 | nmdc:mga03n38_17358_c1 | 3300050490 | Bacteria | 2818 |
| 426 | nmdc:mga00v17_100089_c1 | 3300050491 | Bacteria | 1829 |
| 427 | nmdc:mga00v17_139140_c1 | 3300050491 | Bacteria | 1555 |
| 428 | nmdc:mga0yw44_40180_c1 | 3300050492 | Bacteria | 2778 |
| 429 | nmdc:mga0yw44_5089_c1 | 3300050492 | Bacteria | 6147 |
| 430 | nmdc:mga0k408_100215_c1 | 3300050493 | Bacteria | 1708 |
| 431 | nmdc:mga06z11_18043_c1 | 3300050494 | Bacteria | 3216 |
| 432 | nmdc:mga07m45_74425_c1 | 3300050496 | Bacteria | 1935 |
| 433 | nmdc:mga0n895_548986_c1 | 3300050512 | Bacteria | 1161 |
| 434 | nmdc:mga0sz30_5266_c2 | 3300050516 | Bacteria | 3206 |
| 435 | Ga0500643_021358 | 3300053087 | Bacteria | 2099 |
| 436 | Ga0500618_002873 | 3300053125 | Bacteria | 6177 |
| 437 | Ga0500658_0001270 | 3300053134 | Bacteria | 10234 |
| 438 | Ga0500559_0025097 | 3300053136 | Bacteria | 2536 |
| 439 | Ga0500573_0005111 | 3300053140 | Bacteria | 6993 |
| 440 | Ga0500590_000016 | 3300053148 | Bacteria | 47232 |
| 441 | Ga0500620_000018 | 3300053155 | Bacteria | 33396 |
| 442 | Ga0500620_000555 | 3300053155 | Bacteria | 6434 |
| 443 | Ga0500622_0001141 | 3300053156 | Bacteria | 22200 |
| 444 | Ga0500627_0028922 | 3300053158 | Bacteria | 2307 |
| 445 | Ga0500634_0000019 | 3300053161 | Bacteria | 109764 |
| 446 | Ga0500611_003328 | 3300053727 | Bacteria | 2047 |
| 447 | Ga0500645_033976 | 3300053730 | Bacteria | 1524 |
| 448 | Ga0466962_0085684 | 3300061719 | Bacteria | 1508 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8t7h-assembly1.cif.gz_B | quis-bound intermediate mglu5 | 0.2698 | 44 | 247 |
| 7ra3-assembly1.cif.gz_R | cryo-em of human gastric inhibitory polypeptide receptor gipr bound to gip | 0.2478 | 32 | 302 |
| 4kjr-assembly1.cif.gz_A | crystal structure of selenium substituted ca2+/h+ antiporter proteinyfke | 0.2393 | 56 | 331 |
| 2c32-assembly1.cif.gz_A | co-axial association of recombinant eye lens aquaporin-0 observed in loosely packed 3d-crystals | 0.2299 | 52 | 247 |
| 5k7v-assembly1.cif.gz_A | computational design of self-assembling cyclic protein homooligomers | 0.2293 | 15 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4J2X1_81_350_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.6381 | 81 | 305 | 3.30.40.10 |
| af_A0A0R4J2X1_81_350_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.5439 | 81 | 305 | 3.30.40.10 |
| af_O62051_23_289_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.2985 | 51 | 243 | 1.20.1070.10 |
| af_Q9VIT6_11_216_1.20.120.1770 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); | 0.29 | 50 | 242 | 1.20.120.1770 |
| af_O17523_44_292_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.2783 | 50 | 244 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526RPN6-F1-model_v4 | Fatty acid desaturase | 0.9746 | 59 | 301 |
GO:0016020
GO:0042284 GO:0046513 |
| AF-A0A3M4KVT0-F1-model_v4 | MocD | 0.9717 | 7 | 347 |
GO:0006629
GO:0016020 GO:0016717 |
| AF-A0A1M5X029-F1-model_v4 | NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit | 0.971 | 4 | 347 |
GO:0006629
GO:0006814 GO:0016020 GO:0016655 GO:0046872 GO:0051537 |
| AF-A0A435Y022-F1-model_v4 | Fatty acid desaturase | 0.9696 | 2 | 308 |
GO:0006629
GO:0016020 GO:0016717 |
| AF-A0A841NV51-F1-model_v4 | deleted | 0.9682 | 6 | 349 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar