F492911

General Info

Members Datasets Scaffolds Average Seq Length
1315 1004 448 361

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0026895|Ga0495625_0026895_1336_2610
Length 424
Sequence MVGRFAMFASSGSSEARYIILIGNDRNYLCDVESIIGRRYFQPRSQAGIRWSERRLPWEAIMTATPSRRDYSLIGRDAKLAVETGLSAAEWYHTDIPRKQMKELMQRSDGPAIRDTAIWLAALILSAAGGAWFWGTWWCVPFFFVYGVLYGSSTDSRWHECGHGTAFRTQWMNDTVYQIACFMIMRNPVTWRWSHTRHHTDTIIVGRDPEISVMRPPDLLRVVLAFVGVLDAWHAMSDMLRNAAGNISPAEKTFIPEQEQPKAIRAARIWTAIYAVTIALALSFGSFLPLMLVGLPRLYGAWHHVMVGLLQHGGLAENVTDHRLNSRTVYMNPISRFIYWNMNYHVEHHMFPMVPYHALPRLHALIKHDLPAPTPSILAGYREMIPAFLRQLRNEDYFIKRELPPTARPYREEFHNDAVAAAAE

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
14 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
15 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
16 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
17 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
18 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
19 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
20 2512875024 Mesorhizobium loti R88b Isolate Nodule
21 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
22 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
23 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
24 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
25 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
26 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
27 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
28 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
29 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
30 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
31 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
32 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
33 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
34 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
35 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
36 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
37 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
38 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
39 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
40 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
41 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
42 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
43 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
44 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
45 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
46 2516143018 Ensifer sp. BR816 Isolate Nodule
47 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
48 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
49 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
50 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
51 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
52 2519899620 Rhizobium sp. Pop5 Isolate Nodule
53 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
54 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
55 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
56 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
57 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
58 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
59 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
60 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
61 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
62 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
63 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
64 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
65 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
66 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
67 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
68 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
69 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
70 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
71 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
72 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
73 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
74 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
75 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
76 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
77 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
78 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
79 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
80 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
81 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
82 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
83 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
84 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
85 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
86 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
87 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
88 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
89 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
90 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
91 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
92 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
93 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
94 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
95 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
96 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
97 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
98 2643221557 Ensifer sp. Root558 Isolate Unclassified
99 2643221558 Rhizobium sp. Root149 Isolate Unclassified
100 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
101 2643221599 Rhizobium sp. Root708 Isolate Unclassified
102 2643221607 Rhizobium sp. Root73 Isolate Unclassified
103 2643221610 Ensifer sp. Root74 Isolate Unclassified
104 2643221618 Ensifer sp. Root231 Isolate Unclassified
105 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
106 2643221626 Ensifer sp. Root31 Isolate Unclassified
107 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
108 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
109 2643221655 Ensifer sp. Root1252 Isolate Unclassified
110 2643221659 Ensifer sp. Root127 Isolate Unclassified
111 2643221668 Ensifer sp. Root423 Isolate Unclassified
112 2643221675 Ensifer sp. Root1298 Isolate Unclassified
113 2643221680 Ensifer sp. Root1312 Isolate Unclassified
114 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
115 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
116 2643221698 Ensifer sp. Root142 Isolate Unclassified
117 2643221712 Ensifer sp. Root258 Isolate Unclassified
118 2643221723 Ensifer sp. Root278 Isolate Unclassified
119 2643221726 Ensifer sp. Root954 Isolate Unclassified
120 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
121 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
122 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
123 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
124 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
125 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
126 2718217882 Rhizobium sp. N741 Isolate Nodule
127 2718217927 Rhizobium sp. N324 Isolate Nodule
128 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
129 2718218009 Rhizobium sp. N561 Isolate Nodule
130 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
131 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
132 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
133 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
134 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
135 2718218363 Rhizobium sp. N113 Isolate Nodule
136 2718218365 Rhizobium sp. N731 Isolate Nodule
137 2718218366 Rhizobium sp. N621 Isolate Nodule
138 2718218423 Rhizobium sp. N941 Isolate Nodule
139 2721755514 Rhizobium sp. N6212 Isolate Nodule
140 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
141 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
142 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
143 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
144 2721755809 Rhizobium sp. N541 Isolate Nodule
145 2721755810 Rhizobium sp. N871 Isolate Nodule
146 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
147 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
148 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
149 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
150 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
151 2728369365 Rhizobium sp. N1341 Isolate Nodule
152 2728369397 Rhizobium sp. N1314 Isolate Nodule
153 2738541293 Rhizobium sp. GV031 Isolate Unclassified
154 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
155 2738543024 Aminobacter sp. AP02 Isolate Unclassified
156 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
157 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
158 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
159 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
160 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
161 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
162 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
163 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
164 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
165 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
166 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
167 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
168 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
169 2791355256 Rhizobium sp. M10 Isolate Nodule
170 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
171 2791355260 Rhizobium sp. L9 Isolate Nodule
172 2791355261 Rhizobium sp. J15 Isolate Nodule
173 2791355262 Rhizobium sp. M1 Isolate Nodule
174 2791355263 Rhizobium chutanense C5 Isolate Nodule
175 2791355264 Rhizobium sp. S9 Isolate Nodule
176 2791355265 Rhizobium sp. H4 Isolate Nodule
177 2791355266 Rhizobium sp. L43 Isolate Nodule
178 2791355267 Rhizobium sp. L18 Isolate Nodule
179 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
180 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
181 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
182 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
183 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
184 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
185 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
186 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
187 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
188 2802429633 Rhizobium anhuiense J3 Isolate Nodule
189 2802429634 Rhizobium anhuiense S10 Isolate Nodule
190 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
191 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
192 2802429637 Rhizobium anhuiense C15 Isolate Nodule
193 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
194 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
195 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
196 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
197 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
198 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
199 2838048938 Rhizobium pisi 27/80 Isolate Nodule
200 2838061910 Rhizobium phaseoli L15 Isolate Nodule
201 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
202 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
203 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
204 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
205 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
206 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
207 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
208 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
209 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
210 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
211 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
212 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
213 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
214 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
215 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
216 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
217 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
218 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
219 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
220 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
221 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
222 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
223 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
224 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
225 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
226 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
227 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
228 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
229 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
230 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
231 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
232 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
233 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
234 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
235 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
236 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
237 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
238 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
239 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
240 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
241 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
242 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
243 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
244 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
245 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
246 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
247 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
248 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
249 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
250 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
251 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
252 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
253 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
254 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
255 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
256 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
257 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
258 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
259 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
260 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
261 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
262 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
263 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
264 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
265 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
266 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
267 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
268 2844163670 Ensifer sp. 1H6 Isolate Unclassified
269 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
270 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
271 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
272 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
273 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
274 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
275 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
276 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
277 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
278 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
279 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
280 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
281 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
282 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
283 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
284 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
285 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
286 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
287 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
288 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
289 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
290 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
291 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
292 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
293 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
294 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
295 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
296 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
297 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
298 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
299 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
300 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
301 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
302 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
303 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
304 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
305 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
306 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
307 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
308 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
309 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
310 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
311 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
312 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
313 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
314 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
315 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
316 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
317 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
318 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
319 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
320 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
321 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
322 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
323 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
324 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
325 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
326 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
327 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
328 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
329 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
330 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
331 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
332 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
333 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
334 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
335 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
336 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
337 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
338 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
339 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
340 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
341 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
342 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
343 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
344 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
345 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
346 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
347 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
348 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
349 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
350 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
351 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
352 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
353 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
354 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
355 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
356 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
357 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
358 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
359 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
360 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
361 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
362 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
363 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
364 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
365 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
366 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
367 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
368 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
369 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
370 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
371 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
372 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
373 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
374 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
375 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
376 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
377 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
378 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
379 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
380 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
381 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
382 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
383 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
384 2909042592 Labrys sp. LIt4 Isolate Nodule
385 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
386 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
387 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
388 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
389 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
390 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
391 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
392 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
393 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
394 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
395 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
396 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
397 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
398 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
399 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
400 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
401 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
402 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
403 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
404 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
405 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
406 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
407 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
408 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
409 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
410 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
411 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
412 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
413 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
414 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
415 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
416 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
417 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
418 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
419 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
420 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
421 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
422 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
423 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
424 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
425 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
426 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
427 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
428 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
429 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
430 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
431 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
432 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
433 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
434 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
435 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
436 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
437 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
438 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
439 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
440 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
441 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
442 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
443 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
444 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
445 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
446 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
447 2933599457 Rhizobium phaseoli M3 Isolate Nodule
448 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
449 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
450 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
451 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
452 2936381700 Rhizobium chutanense C16 Isolate Unclassified
453 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
454 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
455 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
456 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
457 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
458 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
459 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
460 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
461 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
462 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
463 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
464 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
465 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
466 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
467 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
468 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
469 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
470 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
471 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
472 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
473 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
474 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
475 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
476 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
477 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
478 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
479 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
480 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
481 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
482 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
483 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
484 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
485 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
486 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
487 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
488 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
489 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
490 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
491 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
492 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
493 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
494 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
495 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
496 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
497 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
498 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
499 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
500 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
501 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
502 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
503 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
504 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
505 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
506 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
507 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
508 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
509 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
510 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
511 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
512 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
513 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
514 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
515 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
516 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
517 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
518 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
519 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
520 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
521 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
522 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
523 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
524 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
525 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
526 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
527 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
528 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
529 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
530 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
531 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
532 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
533 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
534 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
535 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
536 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
537 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
538 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
539 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
540 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
541 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
542 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
543 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
544 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
545 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
546 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
547 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
548 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
549 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
550 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
551 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
552 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
553 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
554 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
555 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
556 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
557 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
558 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
559 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
560 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
561 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
562 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
563 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
564 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
565 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
566 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
567 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
568 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
569 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
570 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
571 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
572 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
573 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
574 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
575 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
576 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
577 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
578 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
579 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
580 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
581 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
582 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
583 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
584 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
585 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
586 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
587 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
588 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
589 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
590 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
591 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
592 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
593 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
594 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
595 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
596 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
597 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
598 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
599 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
600 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
601 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
602 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
603 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
604 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
605 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
606 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
607 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
608 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
609 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
610 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
611 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
612 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
613 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
614 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
615 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
616 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
617 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
618 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
619 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
620 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
621 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
622 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
623 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
624 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
625 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
626 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
627 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
628 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
629 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
630 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
631 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
632 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
633 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
634 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
635 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
636 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
637 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
638 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
639 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
640 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
641 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
642 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
643 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
644 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
645 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
646 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
647 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
648 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
649 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
650 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
651 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
652 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
653 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
654 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
655 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
656 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
657 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
658 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
659 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
660 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
661 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
662 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
663 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
664 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
665 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
666 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
667 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
668 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
669 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
670 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
671 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
672 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
673 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
674 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
675 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
676 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
677 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
678 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
679 2996893221 Rhizobium sp. R635 Isolate Nodule
680 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
681 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
682 3004167301 Mesorhizobium loti 582 Isolate Unclassified
683 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
684 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
685 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
686 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
687 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
688 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
689 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
690 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
691 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
692 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
693 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
694 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
695 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
696 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
697 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
698 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
699 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
700 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
701 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
702 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
703 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
704 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
705 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
706 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
707 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
708 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
709 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
710 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
711 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
712 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
713 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
714 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
715 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
716 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
717 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
718 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
719 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
720 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
721 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
722 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
723 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
724 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
725 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
726 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
727 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
728 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
729 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
730 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
731 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
732 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
733 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
734 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
735 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
736 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
737 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
738 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
739 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
740 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
741 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
742 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
743 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
744 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
745 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
746 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
747 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
748 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
749 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
750 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
751 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
752 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
753 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
754 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
755 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
756 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
757 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
758 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
759 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
760 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
761 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
762 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
763 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
764 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
765 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
766 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
767 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
768 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
769 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
770 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
771 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
772 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
773 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
774 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
775 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
776 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
777 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
778 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
779 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
780 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
781 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
782 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
783 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
784 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
785 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
786 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
787 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
788 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
789 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
790 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
791 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
792 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
793 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
794 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
795 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
796 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
797 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
798 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
799 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
800 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
801 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
802 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
803 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
804 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
805 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
806 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
807 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
808 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
809 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
810 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
811 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
812 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
813 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
814 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
815 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
816 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
817 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
818 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
819 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
820 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
821 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
822 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
823 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
824 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
825 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
826 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
827 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
828 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
829 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
830 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
831 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
832 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
833 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
834 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
835 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
836 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
837 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
838 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
839 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
840 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
841 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
842 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
843 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
844 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
845 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
846 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
847 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
848 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
849 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
850 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
851 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
852 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
853 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
854 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
855 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
856 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
857 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
858 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
859 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
860 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
861 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
862 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
863 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
864 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
865 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
866 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
867 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
868 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
869 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
870 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
871 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
872 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
873 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
874 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
875 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
876 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
877 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
878 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
879 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
880 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
881 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
882 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
883 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
884 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
885 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
886 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
887 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
888 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
889 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
890 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
891 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
892 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
893 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
894 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
895 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
896 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
897 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
898 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
899 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
900 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
901 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
902 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
903 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
904 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
905 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
906 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
907 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
908 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
909 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
910 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
911 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
912 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
913 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
914 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
915 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
916 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
917 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
918 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
919 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
920 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
921 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
922 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
923 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
924 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
925 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
926 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
927 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
928 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
929 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
930 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
931 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
932 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
933 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
934 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
935 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
936 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
937 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
938 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
939 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
940 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
941 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
942 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
943 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
944 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
945 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
946 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
947 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
948 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
949 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
950 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
951 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
952 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
953 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
954 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
955 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
956 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
957 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
958 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
959 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
960 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
961 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
962 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
963 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
964 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
965 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
966 8005275841 Rhizobium sp. N4311 Isolate Nodule
967 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
968 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
969 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
970 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
971 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
972 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
973 8005382845 Rhizobium sp. R634 Isolate Nodule
974 8005395548 Rhizobium sp. R339 Isolate Nodule
975 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
976 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
977 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
978 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
979 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
980 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
981 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
982 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
983 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
984 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
985 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
986 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
987 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
988 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
989 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
990 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
991 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
992 8018176218 Rhizobium sp. N122 Isolate Nodule
993 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
994 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
995 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
996 8024501048 Rhizobium sp. H4 Isolate Nodule
997 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
998 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
999 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1000 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1001 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1002 8056382006 Rhizobium croatiense 13T Isolate Nodule
1003 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1004 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 33.99
Metatranscriptomes 0.08
Isolates 65.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.31
Nodule 55.13
Rhizoplane 1.29
Rhizosphere 18.02
Stem 0
Stem Tuber 0
Unclassified 12.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10007488 3300001979 Bacteria 4433
2 JGI24740J21852_10008714 3300001979 Bacteria 4027
3 JGI25155J39150_1000020 3300002704 Bacteria 152963
4 JGI25156J39149_1000021 3300002705 Bacteria 152968
5 JGI25162J39368_1000365 3300002737 Bacteria 38564
6 JGI25162J39368_1004315 3300002737 Bacteria 3385
7 JGI25154J39366_1000039 3300002738 Bacteria 152972
8 JGI25158J39367_1000082 3300002739 Bacteria 21992
9 JGI25158J39367_1001318 3300002739 Bacteria 4403
10 JGI25157J39369_1000019 3300002741 Bacteria 176591
11 JGI25157J39369_1000470 3300002741 Bacteria 25329
12 JGI25152J39213_1001420 3300002773 Bacteria 10367
13 JGI25152J39213_1001841 3300002773 Bacteria 8561
14 JGI25152J39213_1006895 3300002773 Bacteria 3006
15 JGI25150J39212_1002943 3300002774 Bacteria 4107
16 JGI25159J45721_1000144 3300002987 Bacteria 32636
17 JGI25159J45721_1001639 3300002987 Bacteria 9104
18 JGI25159J45721_1002456 3300002987 Bacteria 7030
19 JGI25151J46595_10000508 3300003187 Bacteria 36520
20 JGI25151J46595_10009496 3300003187 Bacteria 4599
21 JGI25406J46586_10039323 3300003203 Bacteria 1687
22 JGI25165J46597_1000018 3300003214 Bacteria 374701
23 JGI25165J46597_1000078 3300003214 Bacteria 179320
24 JGI25165J46597_1001675 3300003214 Bacteria 10066
25 JGI25165J46597_1006637 3300003214 Bacteria 2027
26 JGI25153J46596_10006031 3300003215 Bacteria 6228
27 JGI25153J46596_10006757 3300003215 Bacteria 5753
28 JGI25153J46596_10026215 3300003215 Bacteria 2068
29 JGI25160J50197_1000014 3300003354 Bacteria 259862
30 JGI25160J50197_1000299 3300003354 Bacteria 34962
31 JGI25160J50197_1005949 3300003354 Bacteria 5011
32 JGI25160J50197_1006197 3300003354 Bacteria 4867
33 JGI25161J50226_1000061 3300003374 Bacteria 101391
34 JGI25161J50226_1000682 3300003374 Bacteria 13426
35 JGI25161J50226_1000727 3300003374 Bacteria 12773
36 JGI25161J50226_1004538 3300003374 Bacteria 2890
37 Ga0055542_1001263 3300003762 Bacteria 13787
38 Ga0055529_1001910 3300003763 Bacteria 4760
39 Ga0055526_1003605 3300003771 Bacteria 9713
40 Ga0055526_1003836 3300003771 Bacteria 9335
41 Ga0055526_1004842 3300003771 Bacteria 7943
42 Ga0055526_1020052 3300003771 Bacteria 2401
43 Ga0055524_1001107 3300003775 Bacteria 16291
44 Ga0055524_1002762 3300003775 Bacteria 8828
45 Ga0055524_1010769 3300003775 Bacteria 3618
46 Ga0055524_1020860 3300003775 Bacteria 2192
47 Ga0055536_1018593 3300003781 Bacteria 2221
48 Ga0055528_1000109 3300003790 Bacteria 66661
49 Ga0055528_1000206 3300003790 Bacteria 49816
50 Ga0055528_1002426 3300003790 Bacteria 9994
51 Ga0055528_1010402 3300003790 Bacteria 3784
52 Ga0055528_1010816 3300003790 Bacteria 3677
53 Ga0055540_1000197 3300003792 Bacteria 58449
54 Ga0055540_1004400 3300003792 Bacteria 6375
55 Ga0055540_1015850 3300003792 Bacteria 2172
56 Ga0055531_10006820 3300003794 Bacteria 6375
57 Ga0058692_1007706 3300003856 Bacteria 2834
58 Ga0055543_1000005 3300004625 Bacteria 223621
59 Ga0055543_1000327 3300004625 Bacteria 32674
60 Ga0055543_1000578 3300004625 Bacteria 20193
61 Ga0055543_1000913 3300004625 Bacteria 13784
62 Ga0065165_1000126 3300005262 Bacteria 129946
63 Ga0065165_1001070 3300005262 Bacteria 32674
64 Ga0065165_1003349 3300005262 Bacteria 11399
65 Ga0065165_1011198 3300005262 Bacteria 3775
66 Ga0065707_10020754 3300005295 Bacteria 1839
67 Ga0070676_10134815 3300005328 Bacteria 1565
68 Ga0070666_10155484 3300005335 Bacteria 1597
69 Ga0068868_100078415 3300005338 Bacteria 2645
70 Ga0070660_100007424 3300005339 Bacteria 7639
71 Ga0070689_100222069 3300005340 Bacteria 1550
72 Ga0070691_10031439 3300005341 Bacteria 2489
73 Ga0070661_100007127 3300005344 Bacteria 7710
74 Ga0070661_100157862 3300005344 Bacteria 1717
75 Ga0070671_100037928 3300005355 Bacteria 3998
76 Ga0070674_100004659 3300005356 Bacteria 7835
77 Ga0070659_100135236 3300005366 Bacteria 2004
78 Ga0070667_100053632 3300005367 Bacteria 3403
79 Ga0070667_100066279 3300005367 Bacteria 3068
80 Ga0070663_100142285 3300005455 Bacteria 1832
81 Ga0070684_100260441 3300005535 Bacteria 1586
82 Ga0070665_100033626 3300005548 Bacteria 5158
83 Ga0070665_100131156 3300005548 Bacteria 2508
84 Ga0070665_100149150 3300005548 Bacteria 2342
85 Ga0070665_100184907 3300005548 Bacteria 2084
86 Ga0068855_100018333 3300005563 Bacteria 8408
87 Ga0068855_100207120 3300005563 Bacteria 2206
88 Ga0068854_100058022 3300005578 Bacteria 2793
89 Ga0068856_100028448 3300005614 Bacteria 5459
90 Ga0068856_100192594 3300005614 Bacteria 2053
91 Ga0068856_100306076 3300005614 Bacteria 1607
92 Ga0068852_100054820 3300005616 Bacteria 3438
93 Ga0068852_100104186 3300005616 Bacteria 2567
94 Ga0068858_100053313 3300005842 Bacteria 3741
95 Ga0068860_100091484 3300005843 Bacteria 2898
96 Ga0081538_10000693 3300005981 Bacteria 37007
97 Ga0081540_1004077 3300005983 Bacteria 11309
98 Ga0081539_10000618 3300005985 Bacteria 71969
99 Ga0075365_10007816 3300006038 Bacteria 6021
100 Ga0075365_10024630 3300006038 Bacteria 3799
101 Ga0075365_10046141 3300006038 Bacteria 2861
102 Ga0075365_10102015 3300006038 Bacteria 1966
103 Ga0075365_10104563 3300006038 Bacteria 1941
104 Ga0075365_10125324 3300006038 Bacteria 1775
105 Ga0075368_10038116 3300006042 Bacteria 1881
106 Ga0075363_100104127 3300006048 Bacteria 1573
107 Ga0075363_100149446 3300006048 Bacteria 1318
108 Ga0075364_10060878 3300006051 Bacteria 2475
109 Ga0075362_10070629 3300006177 Bacteria 1594
110 Ga0075367_10006345 3300006178 Bacteria 5964
111 Ga0075367_10136538 3300006178 Bacteria 1517
112 Ga0075369_10013882 3300006186 Bacteria 3207
113 Ga0075369_10029051 3300006186 Bacteria 2320
114 Ga0075369_10048179 3300006186 Bacteria 1838
115 Ga0075366_10023777 3300006195 Bacteria 3570
116 Ga0097621_100025519 3300006237 Bacteria 4624
117 Ga0075370_10048803 3300006353 Bacteria 2399
118 Ga0075370_10114930 3300006353 Bacteria 1564
119 Ga0105251_10018174 3300009011 Bacteria 3745
120 Ga0105244_10108944 3300009036 Bacteria 1349
121 Ga0105240_10000012 3300009093 Bacteria 496639
122 Ga0105240_10004169 3300009093 Bacteria 22155
123 Ga0105240_10098247 3300009093 Bacteria 3566
124 Ga0105240_10126626 3300009093 Bacteria 3069
125 Ga0105240_10137792 3300009093 Bacteria 2921
126 Ga0105245_10229139 3300009098 Bacteria 1796
127 Ga0105247_10139471 3300009101 Bacteria 1587
128 Ga0105241_10076691 3300009174 Bacteria 2607
129 Ga0105241_10082912 3300009174 Bacteria 2514
130 Ga0105242_10052529 3300009176 Bacteria 3326
131 Ga0105248_10050963 3300009177 Bacteria 4645
132 Ga0105248_10145399 3300009177 Bacteria 2675
133 Ga0105237_10001333 3300009545 Bacteria 32755
134 Ga0105237_10229135 3300009545 Bacteria 1859
135 Ga0105237_10239493 3300009545 Bacteria 1816
136 Ga0105238_10001985 3300009551 Bacteria 20609
137 Ga0105238_10007461 3300009551 Bacteria 10956
138 Ga0105238_10078168 3300009551 Bacteria 3300
139 Ga0105238_10084094 3300009551 Bacteria 3171
140 Ga0123341_1000056 3300009765 Bacteria 48113
141 Ga0123342_1014953 3300009766 Bacteria 7236
142 Ga0123342_1022984 3300009766 Bacteria 4127
143 Ga0105239_10024984 3300010375 Bacteria 6581
144 Ga0105239_10080988 3300010375 Bacteria 3573
145 Ga0105239_10103692 3300010375 Bacteria 3148
146 Ga0105239_10112377 3300010375 Bacteria 3020
147 Ga0105239_10157262 3300010375 Bacteria 2539
148 Ga0157371_10094516 3300013102 Bacteria 2118
149 Ga0157370_10003035 3300013104 Bacteria 19919
150 Ga0157370_10019121 3300013104 Bacteria 6887
151 Ga0157369_10010647 3300013105 Bacteria 10469
152 Ga0157369_10079206 3300013105 Bacteria 3519
153 Ga0157369_10168370 3300013105 Bacteria 2310
154 Ga0157374_10025729 3300013296 Bacteria 5288
155 Ga0157374_10128299 3300013296 Bacteria 2453
156 Ga0163162_10481565 3300013306 Bacteria 1372
157 Ga0182008_10031883 3300014497 Bacteria 2649
158 Ga0157379_10004478 3300014968 Bacteria 11978
159 Ga0157376_10023221 3300014969 Bacteria 4852
160 Ga0182007_10009237 3300015262 Bacteria 3993
161 Ga0182005_1000879 3300015265 Bacteria 13296
162 Ga0183363_1378 3300015690 Bacteria 4519
163 Ga0214544_1000771 3300021320 Bacteria 61917
164 Ga0214542_1000032 3300021321 Bacteria 171690
165 Ga0214543_1000005 3300021327 Bacteria 454523
166 Ga0214543_1000016 3300021327 Bacteria 295257
167 Ga0224712_10041353 3300022467 Bacteria 1740
168 Ga0228710_1011640 3300022740 Bacteria 11259
169 Ga0209435_100025 3300025206 Bacteria 198776
170 Ga0209436_100008 3300025208 Bacteria 145772
171 Ga0209436_101349 3300025208 Bacteria 8678
172 Ga0209672_104342 3300025228 Bacteria 2648
173 Ga0209563_104417 3300025230 Bacteria 2691
174 Ga0209437_100022 3300025233 Bacteria 625694
175 Ga0209437_100040 3300025233 Bacteria 448096
176 Ga0209437_102580 3300025233 Bacteria 3478
177 Ga0207425_1002698 3300025245 Bacteria 6077
178 Ga0207425_1005570 3300025245 Bacteria 3570
179 Ga0209646_1000083 3300025246 Bacteria 198777
180 Ga0209646_1004647 3300025246 Bacteria 2477
181 Ga0209026_1000078 3300025250 Bacteria 198777
182 Ga0209026_1000151 3300025250 Bacteria 110338
183 Ga0209677_100948 3300025253 Bacteria 14158
184 Ga0209677_102746 3300025253 Bacteria 6291
185 Ga0209677_108148 3300025253 Bacteria 2079
186 Ga0209148_1000032 3300025254 Bacteria 557660
187 Ga0209759_1000060 3300025256 Bacteria 198777
188 Ga0209759_1000076 3300025256 Bacteria 175911
189 Ga0209129_1000016 3300025258 Bacteria 485491
190 Ga0209129_1004306 3300025258 Bacteria 5652
191 Ga0209129_1004490 3300025258 Bacteria 5420
192 Ga0209129_1006965 3300025258 Bacteria 3490
193 Ga0209129_1009104 3300025258 Bacteria 2664
194 Ga0209129_1015376 3300025258 Bacteria 1578
195 Ga0209233_1000031 3300025261 Bacteria 624646
196 Ga0209233_1000051 3300025261 Bacteria 447617
197 Ga0209233_1000146 3300025261 Bacteria 187269
198 Ga0209233_1000150 3300025261 Bacteria 179401
199 Ga0209233_1000216 3300025261 Bacteria 108123
200 Ga0209233_1012311 3300025261 Bacteria 2485
201 Ga0209233_1030683 3300025261 Bacteria 1264
202 Ga0209455_1000085 3300025272 Bacteria 247601
203 Ga0209455_1010995 3300025272 Bacteria 2258
204 Ga0209673_1000005 3300025273 Bacteria 692788
205 Ga0209673_1000023 3300025273 Bacteria 411385
206 Ga0209673_1000797 3300025273 Bacteria 41846
207 Ga0209673_1002811 3300025273 Bacteria 11252
208 Ga0209673_1004600 3300025273 Bacteria 7315
209 Ga0209673_1011855 3300025273 Bacteria 3559
210 Ga0209673_1011856 3300025273 Bacteria 3559
211 Ga0209130_1000013 3300025284 Bacteria 412810
212 Ga0209130_1000019 3300025284 Bacteria 381993
213 Ga0209130_1000054 3300025284 Bacteria 212299
214 Ga0209676_1003759 3300025292 Bacteria 8997
215 Ga0209676_1022772 3300025292 Bacteria 2067
216 Ga0209025_1000397 3300025294 Bacteria 89703
217 Ga0209025_1000794 3300025294 Bacteria 51442
218 Ga0209025_1002393 3300025294 Bacteria 20037
219 Ga0209025_1020637 3300025294 Bacteria 3591
220 Ga0209025_1027175 3300025294 Bacteria 2846
221 Ga0209025_1038447 3300025294 Bacteria 2104
222 Ga0209564_1000112 3300025295 Bacteria 211939
223 Ga0209564_1000929 3300025295 Bacteria 38046
224 Ga0209564_1004352 3300025295 Bacteria 8719
225 Ga0209564_1004904 3300025295 Bacteria 7931
226 Ga0209564_1006446 3300025295 Bacteria 6324
227 Ga0209564_1007010 3300025295 Bacteria 5910
228 Ga0209758_1000316 3300025297 Bacteria 93634
229 Ga0209758_1000532 3300025297 Bacteria 60639
230 Ga0209758_1001534 3300025297 Bacteria 26574
231 Ga0209758_1003167 3300025297 Bacteria 15436
232 Ga0209758_1007150 3300025297 Bacteria 7704
233 Ga0209758_1007291 3300025297 Bacteria 7586
234 Ga0209256_1000485 3300025299 Bacteria 58920
235 Ga0209256_1000549 3300025299 Bacteria 53852
236 Ga0209256_1000583 3300025299 Bacteria 51552
237 Ga0209256_1002847 3300025299 Bacteria 13193
238 Ga0209256_1007271 3300025299 Bacteria 5521
239 Ga0209256_1015469 3300025299 Bacteria 2666
240 Ga0209256_1018562 3300025299 Bacteria 2251
241 Ga0207426_1000005 3300025302 Bacteria 1037188
242 Ga0207426_1000022 3300025302 Bacteria 547377
243 Ga0207426_1000127 3300025302 Bacteria 212942
244 Ga0207426_1000355 3300025302 Bacteria 83450
245 Ga0207426_1000884 3300025302 Bacteria 30977
246 Ga0209051_1000119 3300025303 Bacteria 148746
247 Ga0209051_1006341 3300025303 Bacteria 6693
248 Ga0209051_1006348 3300025303 Bacteria 6688
249 Ga0209051_1012030 3300025303 Bacteria 4220
250 Ga0209051_1024195 3300025303 Bacteria 2503
251 Ga0209257_1005204 3300025304 Bacteria 9333
252 Ga0209257_1007029 3300025304 Bacteria 6971
253 Ga0207656_10019890 3300025321 Bacteria 2660
254 Ga0207647_10024760 3300025904 Bacteria 3954
255 Ga0207695_10000120 3300025913 Bacteria 234247
256 Ga0207695_10040383 3300025913 Bacteria 5004
257 Ga0207671_10000755 3300025914 Bacteria 41010
258 Ga0207671_10016640 3300025914 Bacteria 5710
259 Ga0207671_10033541 3300025914 Bacteria 3818
260 Ga0207657_10178302 3300025919 Bacteria 1718
261 Ga0207657_10188435 3300025919 Bacteria 1665
262 Ga0207649_10014377 3300025920 Bacteria 4430
263 Ga0207681_10163879 3300025923 Bacteria 1679
264 Ga0207694_10065860 3300025924 Bacteria 2825
265 Ga0207694_10100400 3300025924 Bacteria 2293
266 Ga0207690_10354943 3300025932 Bacteria 1160
267 Ga0207691_10232864 3300025940 Bacteria 1594
268 Ga0207667_10015837 3300025949 Bacteria 8546
269 Ga0207667_10174779 3300025949 Bacteria 2207
270 Ga0207667_10306196 3300025949 Bacteria 1623
271 Ga0207668_10082377 3300025972 Bacteria 2337
272 Ga0207640_10167509 3300025981 Bacteria 1633
273 Ga0207677_10023298 3300026023 Bacteria 3822
274 Ga0207639_10011379 3300026041 Bacteria 6179
275 Ga0207678_10142359 3300026067 Bacteria 2047
276 Ga0207702_10020473 3300026078 Bacteria 5476
277 Ga0207648_10088546 3300026089 Bacteria 2703
278 Ga0207648_10134773 3300026089 Bacteria 2175
279 Ga0207676_10175729 3300026095 Bacteria 1870
280 Ga0207683_10218704 3300026121 Bacteria 1735
281 Ga0207698_10088397 3300026142 Bacteria 2527
282 Ga0207698_10106579 3300026142 Bacteria 2338
283 Ga0207698_10314783 3300026142 Bacteria 1463
284 Ga0209281_1001451 3300027111 Bacteria 13925
285 Ga0209281_1001484 3300027111 Bacteria 13515
286 Ga0209371_1003208 3300027312 Bacteria 8234
287 Ga0268266_10084100 3300028379 Bacteria 2778
288 Ga0265318_10003621 3300028577 Bacteria 7718
289 Ga0265318_10047625 3300028577 Bacteria 1616
290 Ga0307515_10000136 3300028794 Bacteria 174265
291 Ga0307515_10000252 3300028794 Bacteria 132500
292 Ga0307515_10001908 3300028794 Bacteria 46296
293 Ga0307515_10007811 3300028794 Bacteria 21042
294 Ga0307515_10021612 3300028794 Bacteria 11395
295 Ga0307515_10088198 3300028794 Bacteria 3925
296 Ga0268256_1000785 3300030500 Bacteria 22910
297 Ga0265320_10007179 3300031240 Bacteria 6940
298 Ga0265339_10090250 3300031249 Bacteria 1607
299 Ga0265327_10027653 3300031251 Bacteria 3259
300 Ga0307513_10000302 3300031456 Bacteria 70793
301 Ga0307513_10140242 3300031456 Bacteria 2345
302 Ga0307513_10192902 3300031456 Bacteria 1887
303 Ga0265314_10024925 3300031711 Bacteria 4523
304 Ga0265314_10025241 3300031711 Bacteria 4489
305 Ga0307405_10134930 3300031731 Bacteria 1712
306 Ga0307412_10045558 3300031911 Bacteria 2868
307 Ga0315914_1022150 3300031967 Bacteria 4819
308 Ga0307414_10067027 3300032004 Bacteria 2569
309 Ga0307411_10106116 3300032005 Bacteria 1999
310 Ga0315915_1000265 3300033464 Bacteria 48403
311 Ga0373943_0053235 3300035170 Bacteria 1998
312 Ga0373935_0172695 3300035692 Bacteria 1479
313 Ga0373927_0003688 3300035695 Bacteria 10895
314 Ga0373925_0014583 3300037068 Bacteria 5679
315 Ga0395899_0005027 3300037312 Bacteria 10280
316 Ga0395900_0156037 3300037418 Bacteria 2331
317 Ga0395898_0064562 3300037466 Bacteria 3550
318 Ga0395905_0011186 3300037471 Bacteria 8676
319 Ga0395905_0109914 3300037471 Bacteria 2588
320 Ga0395901_0087394 3300038443 Bacteria 3259
321 Ga0395901_0293080 3300038443 Bacteria 1688
322 Ga0436363_1084910 3300039450 Bacteria 1525
323 Ga0451855_0071228 3300041511 Bacteria 1826
324 Ga0451577_0141154 3300042876 Bacteria 2165
325 Ga0466972_0029833 3300044658 Bacteria 2685
326 Ga0466961_0099736 3300044693 Bacteria 1830
327 Ga0466970_0001801 3300044765 Bacteria 10325
328 Ga0466960_0007204 3300044901 Bacteria 4503
329 Ga0495638_0013036 3300046460 Bacteria 5676
330 Ga0495638_0045935 3300046460 Bacteria 2745
331 Ga0495605_0001661 3300046474 Bacteria 14304
332 Ga0495662_0006894 3300046476 Bacteria 5643
333 Ga0495662_0058828 3300046476 Bacteria 1856
334 Ga0495585_0007048 3300046492 Bacteria 6914
335 Ga0495610_0067746 3300046512 Bacteria 1676
336 Ga0495610_0117707 3300046512 Bacteria 1169
337 Ga0495616_0022393 3300046513 Bacteria 3413
338 Ga0495620_0048340 3300046515 Bacteria 1826
339 Ga0495631_0002544 3300046518 Bacteria 10221
340 Ga0495632_0030102 3300046519 Bacteria 2821
341 Ga0495643_0104040 3300046522 Bacteria 1451
342 Ga0495643_0114757 3300046522 Bacteria 1366
343 Ga0495665_0028717 3300046531 Bacteria 2981
344 Ga0495622_0006140 3300046557 Bacteria 5583
345 Ga0495633_0058083 3300046558 Bacteria 1816
346 Ga0495668_0007692 3300046616 Bacteria 6851
347 Ga0495625_0003553 3300046660 Bacteria 15383
348 Ga0495625_0015985 3300046660 Bacteria 5920
349 Ga0495625_0026895 3300046660 Bacteria 4338
350 Ga0495625_0162758 3300046660 Bacteria 1494
351 Ga0495660_0028017 3300046810 Bacteria 3185
352 Ga0495604_0039217 3300047317 Bacteria 3723
353 Ga0495687_021097 3300047443 Bacteria 3162
354 Ga0495686_0000547 3300047472 Bacteria 53728
355 Ga0495686_0179615 3300047472 Bacteria 1227
356 Ga0495626_0033628 3300048091 Bacteria 2456
357 Ga0496102_0118066 3300048905 Bacteria 2476
358 Ga0496103_0025684 3300048906 Bacteria 3562
359 Ga0496104_0008536 3300048907 Bacteria 9105
360 Ga0496104_0191297 3300048907 Bacteria 1958
361 Ga0496106_0064235 3300048909 Bacteria 2792
362 Ga0496108_0010633 3300048911 Bacteria 7465
363 Ga0496109_0033792 3300048912 Bacteria 4603
364 Ga0496109_0293805 3300048912 Bacteria 1532
365 Ga0496110_0157216 3300048913 Bacteria 2059
366 Ga0496112_0013656 3300048915 Bacteria 7504
367 Ga0496112_0323267 3300048915 Bacteria 1487
368 Ga0496113_0087689 3300048916 Bacteria 2393
369 Ga0496116_0023380 3300048919 Bacteria 4603
370 Ga0496116_0026027 3300048919 Bacteria 4287
371 Ga0496117_0022658 3300048920 Bacteria 5033
372 Ga0496117_0090384 3300048920 Bacteria 1973
373 Ga0496118_0000678 3300048921 Bacteria 55390
374 Ga0496118_0025744 3300048921 Bacteria 5033
375 Ga0496118_0046403 3300048921 Bacteria 3380
376 Ga0496119_0005218 3300048922 Bacteria 12541
377 Ga0496119_0047696 3300048922 Bacteria 2662
378 Ga0496120_0005160 3300048923 Bacteria 10549
379 Ga0496120_0045245 3300048923 Bacteria 2551
380 Ga0496120_0073917 3300048923 Bacteria 1864
381 Ga0496120_0086068 3300048923 Bacteria 1690
382 Ga0496121_0006740 3300048924 Bacteria 14095
383 Ga0496121_0019147 3300048924 Bacteria 6861
384 Ga0496121_0040375 3300048924 Bacteria 4095
385 Ga0496121_0041028 3300048924 Bacteria 4052
386 Ga0496121_0103625 3300048924 Bacteria 2188
387 Ga0496122_0013405 3300048925 Bacteria 8026
388 Ga0496122_0033322 3300048925 Bacteria 4239
389 Ga0496123_0030462 3300048926 Bacteria 3949
390 Ga0496123_0031049 3300048926 Bacteria 3896
391 Ga0496124_0006040 3300048927 Bacteria 13343
392 Ga0496124_0124481 3300048927 Bacteria 2056
393 Ga0496124_0208831 3300048927 Bacteria 1479
394 Ga0496125_0005418 3300048928 Bacteria 14211
395 Ga0496125_0019854 3300048928 Bacteria 6322
396 Ga0496126_0280571 3300048929 Bacteria 1380
397 Ga0501032_0011258 3300049569 Bacteria 6422
398 Ga0501032_0123145 3300049569 Bacteria 1713
399 Ga0501033_0011269 3300049570 Bacteria 6844
400 Ga0501034_0236774 3300049571 Bacteria 1773
401 Ga0501036_0148827 3300049572 Bacteria 1975
402 Ga0501037_0008644 3300049573 Bacteria 7467
403 Ga0501037_0014468 3300049573 Bacteria 5807
404 Ga0501038_0004644 3300049574 Bacteria 12785
405 Ga0501039_0204987 3300049575 Bacteria 1550
406 Ga0501043_0106341 3300049579 Bacteria 2204
407 Ga0501046_0007662 3300049580 Bacteria 9470
408 Ga0501047_0035639 3300049581 Bacteria 4806
409 Ga0501048_0062808 3300049582 Bacteria 2628
410 Ga0501068_0007716 3300049584 Bacteria 5953
411 Ga0501070_0047962 3300049586 Bacteria 3549
412 Ga0501070_0116753 3300049586 Bacteria 2204
413 Ga0501070_0141907 3300049586 Bacteria 1983
414 Ga0501073_0090684 3300049589 Bacteria 2124
415 Ga0501080_0169501 3300049742 Bacteria 2014
416 Ga0501241_001691 3300049758 Bacteria 4400
417 Ga0501035_0013801 3300049822 Bacteria 7457
418 Ga0501035_0024380 3300049822 Bacteria 5548
419 Ga0501035_0037022 3300049822 Bacteria 4420
420 Ga0501035_0069572 3300049822 Bacteria 3119
421 Ga0501044_0024577 3300049823 Bacteria 6393
422 Ga0501044_0033641 3300049823 Bacteria 5384
423 Ga0501044_0110010 3300049823 Bacteria 2764
424 nmdc:mga03683_67832_c1 3300050489 Bacteria 1519
425 nmdc:mga03n38_17358_c1 3300050490 Bacteria 2818
426 nmdc:mga00v17_100089_c1 3300050491 Bacteria 1829
427 nmdc:mga00v17_139140_c1 3300050491 Bacteria 1555
428 nmdc:mga0yw44_40180_c1 3300050492 Bacteria 2778
429 nmdc:mga0yw44_5089_c1 3300050492 Bacteria 6147
430 nmdc:mga0k408_100215_c1 3300050493 Bacteria 1708
431 nmdc:mga06z11_18043_c1 3300050494 Bacteria 3216
432 nmdc:mga07m45_74425_c1 3300050496 Bacteria 1935
433 nmdc:mga0n895_548986_c1 3300050512 Bacteria 1161
434 nmdc:mga0sz30_5266_c2 3300050516 Bacteria 3206
435 Ga0500643_021358 3300053087 Bacteria 2099
436 Ga0500618_002873 3300053125 Bacteria 6177
437 Ga0500658_0001270 3300053134 Bacteria 10234
438 Ga0500559_0025097 3300053136 Bacteria 2536
439 Ga0500573_0005111 3300053140 Bacteria 6993
440 Ga0500590_000016 3300053148 Bacteria 47232
441 Ga0500620_000018 3300053155 Bacteria 33396
442 Ga0500620_000555 3300053155 Bacteria 6434
443 Ga0500622_0001141 3300053156 Bacteria 22200
444 Ga0500627_0028922 3300053158 Bacteria 2307
445 Ga0500634_0000019 3300053161 Bacteria 109764
446 Ga0500611_003328 3300053727 Bacteria 2047
447 Ga0500645_033976 3300053730 Bacteria 1524
448 Ga0466962_0085684 3300061719 Bacteria 1508

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_548986_c1 nmdc:mga0n895_548986_c1_275_1150 287
2 3300048927 Ga0496124_0124481 Ga0496124_0124481_931_2022 339
3 3300031240 Ga0265320_10007179 Ga0265320_100071794 340
4 3300005338 Ga0068868_100078415 Ga0068868_1000784153 343
5 3300005339 Ga0070660_100007424 Ga0070660_1000074243 343
6 3300005341 Ga0070691_10031439 Ga0070691_100314392 343
7 3300005535 Ga0070684_100260441 Ga0070684_1002604411 343
8 3300005614 Ga0068856_100192594 Ga0068856_1001925941 343
9 3300005616 Ga0068852_100054820 Ga0068852_1000548202 343
10 3300005842 Ga0068858_100053313 Ga0068858_1000533135 343
11 3300005843 Ga0068860_100091484 Ga0068860_1000914843 343
12 3300006237 Ga0097621_100025519 Ga0097621_1000255192 343
13 3300009098 Ga0105245_10229139 Ga0105245_102291391 343
14 3300009101 Ga0105247_10139471 Ga0105247_101394712 343
15 3300009545 Ga0105237_10239493 Ga0105237_102394931 343
16 3300013102 Ga0157371_10094516 Ga0157371_100945162 343
17 3300013296 Ga0157374_10025729 Ga0157374_100257294 343
18 3300014968 Ga0157379_10004478 Ga0157379_100044786 343
19 3300014969 Ga0157376_10023221 Ga0157376_100232216 343
20 3300025932 Ga0207690_10354943 Ga0207690_103549431 343
21 3300026023 Ga0207677_10023298 Ga0207677_100232985 343
22 3300026089 Ga0207648_10134773 Ga0207648_101347732 343
23 3300026095 Ga0207676_10175729 Ga0207676_101757293 343
24 3300046476 Ga0495662_0058828 Ga0495662_0058828_179_1285 343
25 3300046531 Ga0495665_0028717 Ga0495665_0028717_1471_2577 343
26 3300048905 Ga0496102_0118066 Ga0496102_0118066_764_1870 343
27 3300048907 Ga0496104_0008536 Ga0496104_0008536_7312_8418 343
28 3300048911 Ga0496108_0010633 Ga0496108_0010633_68_1174 343
29 3300048912 Ga0496109_0033792 Ga0496109_0033792_2782_3888 343
30 3300048909 Ga0496106_0064235 Ga0496106_0064235_1303_2424 344
31 3300042876 Ga0451577_0141154 Ga0451577_0141154_683_1753 345
32 3300048927 Ga0496124_0006040 Ga0496124_0006040_12279_13316 345
33 3300002739 JGI25158J39367_1000082 JGI25158J39367_100008215 346
34 3300002773 JGI25152J39213_1001420 JGI25152J39213_10014204 346
35 3300002987 JGI25159J45721_1001639 JGI25159J45721_10016394 346
36 3300003215 JGI25153J46596_10006757 JGI25153J46596_100067572 346
37 3300003354 JGI25160J50197_1006197 JGI25160J50197_10061973 346
38 3300003374 JGI25161J50226_1000682 JGI25161J50226_100068212 346
39 3300003771 Ga0055526_1003836 Ga0055526_10038366 346
40 3300003790 Ga0055528_1002426 Ga0055528_10024264 346
41 3300004625 Ga0055543_1000913 Ga0055543_10009139 346
42 3300005262 Ga0065165_1011198 Ga0065165_10111984 346
43 3300021320 Ga0214544_1000771 Ga0214544_10007715 346
44 3300021321 Ga0214542_1000032 Ga0214542_100003222 346
45 3300021327 Ga0214543_1000005 Ga0214543_1000005441 346
46 3300021327 Ga0214543_1000016 Ga0214543_1000016256 346
47 3300022740 Ga0228710_1011640 Ga0228710_10116407 346
48 3300025208 Ga0209436_100008 Ga0209436_10000812 346
49 3300025258 Ga0209129_1015376 Ga0209129_10153762 346
50 3300025273 Ga0209673_1002811 Ga0209673_100281110 346
51 3300025284 Ga0209130_1000019 Ga0209130_1000019207 346
52 3300025295 Ga0209564_1004352 Ga0209564_10043527 346
53 3300025297 Ga0209758_1007291 Ga0209758_10072911 346
54 3300025299 Ga0209256_1007271 Ga0209256_10072713 346
55 3300025302 Ga0207426_1000005 Ga0207426_1000005401 346
56 3300025303 Ga0209051_1012030 Ga0209051_10120303 346
57 3300027111 Ga0209281_1001451 Ga0209281_10014514 346
58 3300031967 Ga0315914_1022150 Ga0315914_10221504 346
59 3300033464 Ga0315915_1000265 Ga0315915_100026538 346
60 iso_pu_bacteria 8004395343 8004402332 346
61 3300002773 JGI25152J39213_1001841 JGI25152J39213_10018416 347
62 3300002987 JGI25159J45721_1002456 JGI25159J45721_10024563 347
63 3300003187 JGI25151J46595_10009496 JGI25151J46595_100094965 347
64 3300003354 JGI25160J50197_1000014 JGI25160J50197_100001475 347
65 3300003374 JGI25161J50226_1000061 JGI25161J50226_100006175 347
66 3300003771 Ga0055526_1003605 Ga0055526_10036056 347
67 3300003775 Ga0055524_1002762 Ga0055524_10027627 347
68 3300003775 Ga0055524_1020860 Ga0055524_10208601 347
69 3300003790 Ga0055528_1000109 Ga0055528_100010951 347
70 3300004625 Ga0055543_1000005 Ga0055543_1000005158 347
71 3300005262 Ga0065165_1000126 Ga0065165_100012670 347
72 3300006038 Ga0075365_10104563 Ga0075365_101045633 347
73 3300009177 Ga0105248_10050963 Ga0105248_100509633 347
74 3300009177 Ga0105248_10145399 Ga0105248_101453992 347
75 3300025258 Ga0209129_1000016 Ga0209129_100001685 347
76 3300025273 Ga0209673_1000005 Ga0209673_1000005481 347
77 3300025284 Ga0209130_1000013 Ga0209130_1000013226 347
78 3300025294 Ga0209025_1002393 Ga0209025_100239314 347
79 3300025295 Ga0209564_1000929 Ga0209564_100092932 347
80 3300025295 Ga0209564_1007010 Ga0209564_10070102 347
81 3300025299 Ga0209256_1000549 Ga0209256_100054920 347
82 3300025299 Ga0209256_1002847 Ga0209256_10028473 347
83 3300025302 Ga0207426_1000022 Ga0207426_1000022155 347
84 3300025972 Ga0207668_10082377 Ga0207668_100823771 347
85 3300048923 Ga0496120_0073917 Ga0496120_0073917_44_1129 347
86 3300048924 Ga0496121_0103625 Ga0496121_0103625_542_1627 347
87 3300002773 JGI25152J39213_1006895 JGI25152J39213_10068953 351
88 3300013296 Ga0157374_10128299 Ga0157374_101282992 351
89 3300025302 Ga0207426_1000884 Ga0207426_10008847 351
90 3300047443 Ga0495687_021097 Ga0495687_021097_652_1740 351
91 3300049586 Ga0501070_0116753 Ga0501070_0116753_705_1814 351
92 3300053140 Ga0500573_0005111 Ga0500573_0005111_5416_6504 351
93 3300002774 JGI25150J39212_1002943 JGI25150J39212_10029433 352
94 3300009011 Ga0105251_10018174 Ga0105251_100181743 352
95 3300025245 Ga0207425_1002698 Ga0207425_10026987 352
96 3300025258 Ga0209129_1006965 Ga0209129_10069652 352
97 3300025258 Ga0209129_1009104 Ga0209129_10091042 352
98 3300025294 Ga0209025_1020637 Ga0209025_10206373 352
99 3300025294 Ga0209025_1038447 Ga0209025_10384471 352
100 3300025297 Ga0209758_1007150 Ga0209758_10071507 352
101 3300031251 Ga0265327_10027653 Ga0265327_100276532 352
102 3300031911 Ga0307412_10045558 Ga0307412_100455581 352
103 3300002739 JGI25158J39367_1001318 JGI25158J39367_10013183 353
104 3300002987 JGI25159J45721_1000144 JGI25159J45721_10001445 353
105 3300003354 JGI25160J50197_1000299 JGI25160J50197_100029935 353
106 3300003374 JGI25161J50226_1000727 JGI25161J50226_10007278 353
107 3300003775 Ga0055524_1001107 Ga0055524_100110715 353
108 3300004625 Ga0055543_1000327 Ga0055543_10003275 353
109 3300005262 Ga0065165_1001070 Ga0065165_10010705 353
110 3300006048 Ga0075363_100149446 Ga0075363_1001494462 353
111 3300044658 Ga0466972_0029833 Ga0466972_0029833_314_1420 353
112 3300044901 Ga0466960_0007204 Ga0466960_0007204_2401_3507 353
113 iso_pu_bacteria 2889790730 2889792032 353
114 iso_pu_bacteria 2889914905 2889918339 353
115 3300009093 Ga0105240_10098247 Ga0105240_100982473 354
116 3300028794 Ga0307515_10000252 Ga0307515_1000025237 354
117 iso_pu_bacteria 2996336353 2996339005 354
118 3300025208 Ga0209436_101349 Ga0209436_1013497 355
119 3300025284 Ga0209130_1000054 Ga0209130_1000054207 355
120 3300025294 Ga0209025_1000794 Ga0209025_100079427 355
121 3300025299 Ga0209256_1000583 Ga0209256_100058353 355
122 3300025302 Ga0207426_1000127 Ga0207426_1000127207 355
123 3300028577 Ga0265318_10047625 Ga0265318_100476252 355
124 3300031711 Ga0265314_10025241 Ga0265314_100252413 355
125 iso_pu_bacteria 2503198000 2503201441 355
126 iso_pu_bacteria 2512875024 2512959427 355
127 iso_pu_bacteria 2513237164 2514033516 355
128 iso_pu_bacteria 2881147464 2881151239 355
129 iso_pu_bacteria 2885312484 2885318066 355
130 iso_pu_bacteria 2898795034 2898796598 355
131 iso_pu_bacteria 2958064165 2958064469 355
132 iso_pu_bacteria 3004211236 3004217552 355
133 iso_pu_bacteria 3004218560 3004219899 355
134 3300048913 Ga0496110_0157216 Ga0496110_0157216_940_2028 356
135 iso_pu_bacteria 2841859092 2841862941 356
136 iso_pu_bacteria 2842515876 2842519542 356
137 iso_pu_bacteria 2933011516 2933011851 356
138 3300005981 Ga0081538_10000693 Ga0081538_1000069316 357
139 3300009551 Ga0105238_10007461 Ga0105238_100074617 357
140 3300010375 Ga0105239_10103692 Ga0105239_101036923 357
141 3300025230 Ga0209563_104417 Ga0209563_1044172 357
142 3300025914 Ga0207671_10033541 Ga0207671_100335414 357
143 3300025924 Ga0207694_10065860 Ga0207694_100658603 357
144 3300048912 Ga0496109_0293805 Ga0496109_0293805_371_1459 357
145 3300048915 Ga0496112_0323267 Ga0496112_0323267_178_1266 357
146 iso_pu_bacteria 2508501127 2509143975 357
147 iso_pu_bacteria 2513237085 2513581114 357
148 iso_pu_bacteria 2513237143 2513907316 357
149 iso_pu_bacteria 2513237159 2513999032 357
150 iso_pu_bacteria 2515154113 2515638368 357
151 iso_pu_bacteria 2516143018 2516207936 357
152 iso_pu_bacteria 2524023209 2524457058 357
153 iso_pu_bacteria 2524023209 2524461624 357
154 iso_pu_bacteria 2551306091 2551730396 357
155 iso_pu_bacteria 2582581283 2585169909 357
156 iso_pu_bacteria 2582581306 2585268757 357
157 iso_pu_bacteria 2582581307 2585272330 357
158 iso_pu_bacteria 2582581865 2585389402 357
159 iso_pu_bacteria 2582581866 2585397677 357
160 iso_pu_bacteria 2585427531 2585561606 357
161 iso_pu_bacteria 2585427608 2585899458 357
162 iso_pu_bacteria 2585427609 2585906834 357
163 iso_pu_bacteria 2585428125 2587982255 357
164 iso_pu_bacteria 2597489875 2597813312 357
165 iso_pu_bacteria 2615840698 2616553155 357
166 iso_pu_bacteria 2643221607 2644051380 357
167 iso_pu_bacteria 2643221636 2644201051 357
168 iso_pu_bacteria 2643221686 2644484284 357
169 iso_pu_bacteria 2643221689 2644497611 357
170 iso_pu_bacteria 2690316117 2692318923 357
171 iso_pu_bacteria 2751185821 2753461480 357
172 iso_pu_bacteria 2775506902 2776267960 357
173 iso_pu_bacteria 2775506904 2776281934 357
174 iso_pu_bacteria 2791355094 2792643024 357
175 iso_pu_bacteria 2841734538 2841739107 357
176 iso_pu_bacteria 2842298080 2842299389 357
177 iso_pu_bacteria 2842298080 2842303204 357
178 iso_pu_bacteria 2842509118 2842512289 357
179 iso_pu_bacteria 2842509118 2842513653 357
180 iso_pu_bacteria 2842521101 2842524776 357
181 iso_pu_bacteria 2847417321 2847422571 357
182 iso_pu_bacteria 2848992105 2848998027 357
183 iso_pu_bacteria 2852387548 2852394439 357
184 iso_pu_bacteria 2855872281 2855875911 357
185 iso_pu_bacteria 2856342000 2856343930 357
186 iso_pu_bacteria 2871474448 2871475911 357
187 iso_pu_bacteria 2878788777 2878795711 357
188 iso_pu_bacteria 2882632389 2882636189 357
189 iso_pu_bacteria 2888343758 2888346715 357
190 iso_pu_bacteria 2915986958 2915989032 357
191 iso_pu_bacteria 2916041962 2916048651 357
192 iso_pu_bacteria 2916076590 2916078556 357
193 iso_pu_bacteria 2921208531 2921208837 357
194 iso_pu_bacteria 2921237296 2921243282 357
195 iso_pu_bacteria 2924207177 2924212813 357
196 iso_pu_bacteria 2924754689 2924762586 357
197 iso_pu_bacteria 2924762789 2924765027 357
198 iso_pu_bacteria 2937836603 2937843151 357
199 iso_pu_bacteria 2958071322 2958072032 357
200 iso_pu_bacteria 2960624210 2960630543 357
201 iso_pu_bacteria 2960687367 2960693186 357
202 iso_pu_bacteria 2964636051 2964637175 357
203 iso_pu_bacteria 2964643177 2964649238 357
204 iso_pu_bacteria 2964663802 2964669639 357
205 iso_pu_bacteria 2964670856 2964672068 357
206 iso_pu_bacteria 2964691889 2964698703 357
207 iso_pu_bacteria 2967699805 2967701777 357
208 iso_pu_bacteria 2970082768 2970088287 357
209 iso_pu_bacteria 2970164137 2970169343 357
210 iso_pu_bacteria 2970170962 2970176254 357
211 iso_pu_bacteria 2970177841 2970184526 357
212 iso_pu_bacteria 2970524798 2970528499 357
213 iso_pu_bacteria 2970540015 2970546824 357
214 iso_pu_bacteria 2987666974 2987667933 357
215 iso_pu_bacteria 2989349275 2989350136 357
216 iso_pu_bacteria 3005416602 3005421132 357
217 iso_pu_bacteria 643692032 643823567 357
218 iso_pu_bacteria 648276728 648741415 357
219 iso_pu_bacteria 8004633249 8004637808 357
220 iso_pu_bacteria 8004640170 8004640915 357
221 iso_pu_bacteria 8005289223 8005293993 357
222 iso_pu_bacteria 8005301065 8005302219 357
223 iso_pu_bacteria 8005314921 8005319133 357
224 iso_pu_bacteria 8005688590 8005689766 357
225 iso_pu_bacteria 8046767195 8046774733 357
226 iso_pu_bacteria 8054558443 8054561948 357
227 iso_pu_bacteria 8055617313 8055620688 357
228 iso_pu_bacteria 8057575449 8057578648 357
229 3300005366 Ga0070659_100135236 Ga0070659_1001352362 358
230 3300005548 Ga0070665_100131156 Ga0070665_1001311562 358
231 3300005548 Ga0070665_100149150 Ga0070665_1001491503 358
232 3300006042 Ga0075368_10038116 Ga0075368_100381162 358
233 3300006048 Ga0075363_100104127 Ga0075363_1001041272 358
234 3300006353 Ga0075370_10114930 Ga0075370_101149302 358
235 3300010375 Ga0105239_10157262 Ga0105239_101572623 358
236 3300022467 Ga0224712_10041353 Ga0224712_100413531 358
237 3300025919 Ga0207657_10178302 Ga0207657_101783022 358
238 3300025940 Ga0207691_10232864 Ga0207691_102328642 358
239 3300025981 Ga0207640_10167509 Ga0207640_101675091 358
240 3300026121 Ga0207683_10218704 Ga0207683_102187041 358
241 3300046660 Ga0495625_0162758 Ga0495625_0162758_201_1277 358
242 3300049570 Ga0501033_0011269 Ga0501033_0011269_5072_6163 358
243 3300049579 Ga0501043_0106341 Ga0501043_0106341_679_1770 358
244 3300049586 Ga0501070_0141907 Ga0501070_0141907_568_1659 358
245 3300049742 Ga0501080_0169501 Ga0501080_0169501_653_1744 358
246 3300049822 Ga0501035_0024380 Ga0501035_0024380_968_2059 358
247 3300049822 Ga0501035_0069572 Ga0501035_0069572_630_1721 358
248 3300049823 Ga0501044_0033641 Ga0501044_0033641_248_1339 358
249 3300049823 Ga0501044_0110010 Ga0501044_0110010_638_1729 358
250 3300050493 nmdc:mga0k408_100215_c1 nmdc:mga0k408_100215_c1_230_1315 358
251 3300050496 nmdc:mga07m45_74425_c1 nmdc:mga07m45_74425_c1_435_1520 358
252 3300053087 Ga0500643_021358 Ga0500643_021358_269_1345 358
253 iso_pu_bacteria 2508501123 2509113039 358
254 iso_pu_bacteria 2509276021 2509385768 358
255 iso_pu_bacteria 2509276022 2509396213 358
256 iso_pu_bacteria 2509276033 2509448178 358
257 iso_pu_bacteria 2510065019 2510136753 358
258 iso_pu_bacteria 2510461076 2510899982 358
259 iso_pu_bacteria 2510461076 2510900578 358
260 iso_pu_bacteria 2510917030 2511193431 358
261 iso_pu_bacteria 2512875024 2512962349 358
262 iso_pu_bacteria 2513237084 2513569372 358
263 iso_pu_bacteria 2513237085 2513576693 358
264 iso_pu_bacteria 2513237088 2513599698 358
265 iso_pu_bacteria 2513237093 2513631627 358
266 iso_pu_bacteria 2513237103 2513710042 358
267 iso_pu_bacteria 2513237144 2513910012 358
268 iso_pu_bacteria 2513237162 2514021441 358
269 iso_pu_bacteria 2513237164 2514038690 358
270 iso_pu_bacteria 2515075009 2515115328 358
271 iso_pu_bacteria 2515154113 2515635948 358
272 iso_pu_bacteria 2515154114 2515644787 358
273 iso_pu_bacteria 2515154116 2515658086 358
274 iso_pu_bacteria 2515154134 2515742189 358
275 iso_pu_bacteria 2516653077 2517041677 358
276 iso_pu_bacteria 2516653085 2517080740 358
277 iso_pu_bacteria 2517093000 2517099134 358
278 iso_pu_bacteria 2517287029 2517411037 358
279 iso_pu_bacteria 2519899620 2520380624 358
280 iso_pu_bacteria 2524023209 2524461766 358
281 iso_pu_bacteria 2529292951 2530644837 358
282 iso_pu_bacteria 2534681796 2535518896 358
283 iso_pu_bacteria 2582581298 2585227303 358
284 iso_pu_bacteria 2582581308 2585278398 358
285 iso_pu_bacteria 2582581315 2585324758 358
286 iso_pu_bacteria 2582581316 2585332191 358
287 iso_pu_bacteria 2585427526 2585524422 358
288 iso_pu_bacteria 2585427527 2585531946 358
289 iso_pu_bacteria 2585427528 2585538676 358
290 iso_pu_bacteria 2585427529 2585550717 358
291 iso_pu_bacteria 2585427530 2585552305 358
292 iso_pu_bacteria 2585427593 2585836629 358
293 iso_pu_bacteria 2588253730 2588517436 358
294 iso_pu_bacteria 2615840624 2616295020 358
295 iso_pu_bacteria 2615840626 2616307916 358
296 iso_pu_bacteria 2617270742 2617381770 358
297 iso_pu_bacteria 2617270742 2617382399 358
298 iso_pu_bacteria 2643221623 2644133152 358
299 iso_pu_bacteria 2657244999 2657685654 358
300 iso_pu_bacteria 2667528174 2671112911 358
301 iso_pu_bacteria 2718217882 2719183958 358
302 iso_pu_bacteria 2718217927 2719388720 358
303 iso_pu_bacteria 2718217997 2719668244 358
304 iso_pu_bacteria 2718218009 2719728399 358
305 iso_pu_bacteria 2718218199 2720495007 358
306 iso_pu_bacteria 2718218232 2720611326 358
307 iso_pu_bacteria 2718218233 2720616496 358
308 iso_pu_bacteria 2718218235 2720629581 358
309 iso_pu_bacteria 2718218269 2720772154 358
310 iso_pu_bacteria 2718218363 2721145260 358
311 iso_pu_bacteria 2718218365 2721156004 358
312 iso_pu_bacteria 2718218366 2721167347 358
313 iso_pu_bacteria 2718218423 2721403347 358
314 iso_pu_bacteria 2721755514 2722838325 358
315 iso_pu_bacteria 2721755556 2723029578 358
316 iso_pu_bacteria 2721755684 2723563184 358
317 iso_pu_bacteria 2721755685 2723571179 358
318 iso_pu_bacteria 2721755809 2724035704 358
319 iso_pu_bacteria 2721755810 2724042593 358
320 iso_pu_bacteria 2721755819 2724086974 358
321 iso_pu_bacteria 2721755822 2724107130 358
322 iso_pu_bacteria 2721755823 2724107936 358
323 iso_pu_bacteria 2724679232 2725951572 358
324 iso_pu_bacteria 2728369352 2730105892 358
325 iso_pu_bacteria 2728369365 2730162098 358
326 iso_pu_bacteria 2728369397 2730301111 358
327 iso_pu_bacteria 2738541293 2738803443 358
328 iso_pu_bacteria 2738541333 2739034101 358
329 iso_pu_bacteria 2738543024 2739307416 358
330 iso_pu_bacteria 2765235942 2766068621 358
331 iso_pu_bacteria 2775507266 2778178253 358
332 iso_pu_bacteria 2791355082 2792580894 358
333 iso_pu_bacteria 2791355123 2792746985 358
334 iso_pu_bacteria 2791355256 2793296641 358
335 iso_pu_bacteria 2791355259 2793314829 358
336 iso_pu_bacteria 2791355260 2793321486 358
337 iso_pu_bacteria 2791355261 2793325857 358
338 iso_pu_bacteria 2791355262 2793332861 358
339 iso_pu_bacteria 2791355263 2793340345 358
340 iso_pu_bacteria 2791355264 2793345962 358
341 iso_pu_bacteria 2791355265 2793355184 358
342 iso_pu_bacteria 2791355266 2793357996 358
343 iso_pu_bacteria 2791355267 2793366757 358
344 iso_pu_bacteria 2802429268 2804755686 358
345 iso_pu_bacteria 2802429605 2805927864 358
346 iso_pu_bacteria 2802429606 2805933711 358
347 iso_pu_bacteria 2802429633 2806042898 358
348 iso_pu_bacteria 2802429633 2806043286 358
349 iso_pu_bacteria 2802429634 2806050851 358
350 iso_pu_bacteria 2802429635 2806057981 358
351 iso_pu_bacteria 2802429636 2806065306 358
352 iso_pu_bacteria 2802429637 2806076789 358
353 iso_pu_bacteria 2818991448 2819608013 358
354 iso_pu_bacteria 2818991453 2819640189 358
355 iso_pu_bacteria 2838016132 2838019270 358
356 iso_pu_bacteria 2838022645 2838026665 358
357 iso_pu_bacteria 2838029111 2838033753 358
358 iso_pu_bacteria 2838042994 2838048695 358
359 iso_pu_bacteria 2838048938 2838050336 358
360 iso_pu_bacteria 2838061910 2838063039 358
361 iso_pu_bacteria 2838068647 2838071600 358
362 iso_pu_bacteria 2838668709 2838673669 358
363 iso_pu_bacteria 2838680041 2838684189 358
364 iso_pu_bacteria 2838686498 2838692291 358
365 iso_pu_bacteria 2838694306 2838699679 358
366 iso_pu_bacteria 2838701080 2838705298 358
367 iso_pu_bacteria 2838707686 2838712035 358
368 iso_pu_bacteria 2838729681 2838734291 358
369 iso_pu_bacteria 2838742623 2838746743 358
370 iso_pu_bacteria 2841851746 2841853434 358
371 iso_pu_bacteria 2842077413 2842081655 358
372 iso_pu_bacteria 2842110456 2842114647 358
373 iso_pu_bacteria 2842118031 2842122231 358
374 iso_pu_bacteria 2842146304 2842150212 358
375 iso_pu_bacteria 2842156927 2842161481 358
376 iso_pu_bacteria 2842163707 2842167314 358
377 iso_pu_bacteria 2842180545 2842185718 358
378 iso_pu_bacteria 2842192696 2842195455 358
379 iso_pu_bacteria 2842198810 2842202268 358
380 iso_pu_bacteria 2842205361 2842210554 358
381 iso_pu_bacteria 2842217011 2842223134 358
382 iso_pu_bacteria 2842229732 2842234111 358
383 iso_pu_bacteria 2842237096 2842241447 358
384 iso_pu_bacteria 2842243621 2842246412 358
385 iso_pu_bacteria 2842250916 2842254898 358
386 iso_pu_bacteria 2842257432 2842260728 358
387 iso_pu_bacteria 2842264693 2842269374 358
388 iso_pu_bacteria 2842271015 2842276017 358
389 iso_pu_bacteria 2842278818 2842284008 358
390 iso_pu_bacteria 2842285085 2842287968 358
391 iso_pu_bacteria 2842291075 2842295311 358
392 iso_pu_bacteria 2842298080 2842303240 358
393 iso_pu_bacteria 2842304105 2842308664 358
394 iso_pu_bacteria 2842311132 2842311994 358
395 iso_pu_bacteria 2842317721 2842319217 358
396 iso_pu_bacteria 2842363717 2842368179 358
397 iso_pu_bacteria 2842370503 2842375854 358
398 iso_pu_bacteria 2842377471 2842381914 358
399 iso_pu_bacteria 2842384541 2842388780 358
400 iso_pu_bacteria 2842402390 2842405234 358
401 iso_pu_bacteria 2842409023 2842412009 358
402 iso_pu_bacteria 2842415677 2842418464 358
403 iso_pu_bacteria 2842422224 2842425233 358
404 iso_pu_bacteria 2842428310 2842432669 358
405 iso_pu_bacteria 2842434925 2842438883 358
406 iso_pu_bacteria 2842441272 2842445513 358
407 iso_pu_bacteria 2842447887 2842449967 358
408 iso_pu_bacteria 2842462802 2842467758 358
409 iso_pu_bacteria 2842469257 2842473498 358
410 iso_pu_bacteria 2842475841 2842480500 358
411 iso_pu_bacteria 2842482326 2842484073 358
412 iso_pu_bacteria 2842489311 2842491664 358
413 iso_pu_bacteria 2842495871 2842499734 358
414 iso_pu_bacteria 2842502639 2842507219 358
415 iso_pu_bacteria 2844454524 2844460844 358
416 iso_pu_bacteria 2856320880 2856327577 358
417 iso_pu_bacteria 2857516855 2857519457 358
418 iso_pu_bacteria 2869278585 2869280466 358
419 iso_pu_bacteria 2874123672 2874130519 358
420 iso_pu_bacteria 2874139085 2874144122 358
421 iso_pu_bacteria 2876392853 2876398356 358
422 iso_pu_bacteria 2878738818 2878745117 358
423 iso_pu_bacteria 2881161766 2881167445 358
424 iso_pu_bacteria 2882632389 2882634579 358
425 iso_pu_bacteria 2888337043 2888339331 358
426 iso_pu_bacteria 2904659560 2904664911 358
427 iso_pu_bacteria 2906354277 2906355866 358
428 iso_pu_bacteria 2909042592 2909046134 358
429 iso_pu_bacteria 2919100787 2919102051 358
430 iso_pu_bacteria 2919408235 2919412699 358
431 iso_pu_bacteria 2923556063 2923559613 358
432 iso_pu_bacteria 2924762789 2924768285 358
433 iso_pu_bacteria 2924776078 2924783254 358
434 iso_pu_bacteria 2933570622 2933575205 358
435 iso_pu_bacteria 2933586486 2933590497 358
436 iso_pu_bacteria 2933599457 2933602399 358
437 iso_pu_bacteria 2935894831 2935898470 358
438 iso_pu_bacteria 2935901341 2935906902 358
439 iso_pu_bacteria 2936367885 2936370432 358
440 iso_pu_bacteria 2936375103 2936378097 358
441 iso_pu_bacteria 2936381700 2936385487 358
442 iso_pu_bacteria 2937877337 2937882219 358
443 iso_pu_bacteria 2937972304 2937978680 358
444 iso_pu_bacteria 2958034702 2958036337 358
445 iso_pu_bacteria 2958041894 2958045700 358
446 iso_pu_bacteria 2958084443 2958089341 358
447 iso_pu_bacteria 2958144490 2958149472 358
448 iso_pu_bacteria 2961114664 2961119910 358
449 iso_pu_bacteria 2964643177 2964649886 358
450 iso_pu_bacteria 2967706974 2967709821 358
451 iso_pu_bacteria 2968016561 2968018547 358
452 iso_pu_bacteria 2968110612 2968116267 358
453 iso_pu_bacteria 2970136068 2970139062 358
454 iso_pu_bacteria 2970469710 2970471280 358
455 iso_pu_bacteria 2970593180 2970595063 358
456 iso_pu_bacteria 2977922695 2977924126 358
457 iso_pu_bacteria 2979742915 2979746471 358
458 iso_pu_bacteria 2987666974 2987671296 358
459 iso_pu_bacteria 2996348954 2996350071 358
460 iso_pu_bacteria 2996893221 2996896759 358
461 iso_pu_bacteria 3000135777 3000140764 358
462 iso_pu_bacteria 3004211236 3004215861 358
463 iso_pu_bacteria 3004275668 3004276770 358
464 iso_pu_bacteria 3004289098 3004295664 358
465 iso_pu_bacteria 3004334049 3004334460 358
466 iso_pu_bacteria 637000159 637074695 358
467 iso_pu_bacteria 639633055 639651972 358
468 iso_pu_bacteria 8002285264 8002291738 358
469 iso_pu_bacteria 8005275841 8005277443 358
470 iso_pu_bacteria 8005282627 8005288040 358
471 iso_pu_bacteria 8005289223 8005289413 358
472 iso_pu_bacteria 8005301065 8005305255 358
473 iso_pu_bacteria 8005307578 8005313359 358
474 iso_pu_bacteria 8005376324 8005382106 358
475 iso_pu_bacteria 8005382845 8005388645 358
476 iso_pu_bacteria 8005395548 8005397994 358
477 iso_pu_bacteria 8005430974 8005431267 358
478 iso_pu_bacteria 8005460587 8005467056 358
479 iso_pu_bacteria 8005484373 8005489544 358
480 iso_pu_bacteria 8005497431 8005503260 358
481 iso_pu_bacteria 8005556819 8005561930 358
482 iso_pu_bacteria 8005563573 8005567331 358
483 iso_pu_bacteria 8005570704 8005575751 358
484 iso_pu_bacteria 8005619151 8005625405 358
485 iso_pu_bacteria 8005626139 8005630387 358
486 iso_pu_bacteria 8005645114 8005650410 358
487 iso_pu_bacteria 8005668836 8005675179 358
488 iso_pu_bacteria 8005682033 8005683446 358
489 iso_pu_bacteria 8005688590 8005689277 358
490 iso_pu_bacteria 8005695170 8005696855 358
491 iso_pu_bacteria 8018127388 8018127788 358
492 iso_pu_bacteria 8018163183 8018166157 358
493 iso_pu_bacteria 8018176218 8018182946 358
494 iso_pu_bacteria 8023680758 8023688320 358
495 iso_pu_bacteria 8024479707 8024483956 358
496 iso_pu_bacteria 8024486573 8024488937 358
497 iso_pu_bacteria 8024501048 8024504009 358
498 iso_pu_bacteria 8049293176 8049297627 358
499 iso_pu_bacteria 8056382006 8056383094 358
500 iso_pu_bacteria 8057874678 8057880838 358
501 3300005295 Ga0065707_10020754 Ga0065707_100207542 359
502 3300005356 Ga0070674_100004659 Ga0070674_1000046594 359
503 3300028794 Ga0307515_10000136 Ga0307515_1000013669 359
504 3300031456 Ga0307513_10000302 Ga0307513_1000030233 359
505 3300049572 Ga0501036_0148827 Ga0501036_0148827_193_1278 359
506 3300053161 Ga0500634_0000019 Ga0500634_0000019_70573_71652 359
507 iso_pu_bacteria 2503198000 2503198474 359
508 iso_pu_bacteria 2508501122 2509109879 359
509 iso_pu_bacteria 2509276018 2509368542 359
510 iso_pu_bacteria 2509276019 2509377053 359
511 iso_pu_bacteria 2509276022 2509393539 359
512 iso_pu_bacteria 2510065057 2510306188 359
513 iso_pu_bacteria 2510065059 2510314823 359
514 iso_pu_bacteria 2510461069 2510843601 359
515 iso_pu_bacteria 2511231052 2511496816 359
516 iso_pu_bacteria 2512047086 2512528953 359
517 iso_pu_bacteria 2512875016 2512931590 359
518 iso_pu_bacteria 2512875016 2512934060 359
519 iso_pu_bacteria 2512875026 2512969205 359
520 iso_pu_bacteria 2513237086 2513585795 359
521 iso_pu_bacteria 2513237089 2513607057 359
522 iso_pu_bacteria 2513237091 2513615072 359
523 iso_pu_bacteria 2513237140 2513886376 359
524 iso_pu_bacteria 2513237143 2513907372 359
525 iso_pu_bacteria 2513237156 2513988346 359
526 iso_pu_bacteria 2513237160 2514008449 359
527 iso_pu_bacteria 2513237305 2514419663 359
528 iso_pu_bacteria 2515154107 2515612986 359
529 iso_pu_bacteria 2516653046 2516895972 359
530 iso_pu_bacteria 2524023207 2524454452 359
531 iso_pu_bacteria 2551306084 2551680862 359
532 iso_pu_bacteria 2551306085 2551684747 359
533 iso_pu_bacteria 2551306086 2551694211 359
534 iso_pu_bacteria 2551306087 2551698842 359
535 iso_pu_bacteria 2551306089 2551709764 359
536 iso_pu_bacteria 2551306090 2551718443 359
537 iso_pu_bacteria 2551306091 2551728899 359
538 iso_pu_bacteria 2551306092 2551738744 359
539 iso_pu_bacteria 2551306093 2551739351 359
540 iso_pu_bacteria 2558860100 2558862424 359
541 iso_pu_bacteria 2558860100 2558864641 359
542 iso_pu_bacteria 2585427633 2585993618 359
543 iso_pu_bacteria 2585427634 2586003849 359
544 iso_pu_bacteria 2588253730 2588520200 359
545 iso_pu_bacteria 2599185352 2600197802 359
546 iso_pu_bacteria 2643221557 2643806659 359
547 iso_pu_bacteria 2643221558 2643810928 359
548 iso_pu_bacteria 2643221595 2643983778 359
549 iso_pu_bacteria 2643221599 2644003671 359
550 iso_pu_bacteria 2643221610 2644068297 359
551 iso_pu_bacteria 2643221618 2644110278 359
552 iso_pu_bacteria 2643221626 2644144851 359
553 iso_pu_bacteria 2643221627 2644155911 359
554 iso_pu_bacteria 2643221655 2644310172 359
555 iso_pu_bacteria 2643221659 2644336936 359
556 iso_pu_bacteria 2643221668 2644375990 359
557 iso_pu_bacteria 2643221675 2644419223 359
558 iso_pu_bacteria 2643221680 2644452580 359
559 iso_pu_bacteria 2643221698 2644540720 359
560 iso_pu_bacteria 2643221712 2644613112 359
561 iso_pu_bacteria 2643221723 2644674404 359
562 iso_pu_bacteria 2643221726 2644691354 359
563 iso_pu_bacteria 2687453392 2688595797 359
564 iso_pu_bacteria 2721755686 2723575295 359
565 iso_pu_bacteria 2756170246 2756674868 359
566 iso_pu_bacteria 2791355091 2792621735 359
567 iso_pu_bacteria 2791355092 2792627579 359
568 iso_pu_bacteria 2802428858 2802721473 359
569 iso_pu_bacteria 2802428859 2802727604 359
570 iso_pu_bacteria 2802428860 2802734385 359
571 iso_pu_bacteria 2802428861 2802740972 359
572 iso_pu_bacteria 2802428862 2802747145 359
573 iso_pu_bacteria 2802428863 2802753855 359
574 iso_pu_bacteria 2838074704 2838075573 359
575 iso_pu_bacteria 2841864319 2841869184 359
576 iso_pu_bacteria 2842341865 2842344274 359
577 iso_pu_bacteria 2842395702 2842396668 359
578 iso_pu_bacteria 2844002411 2844003655 359
579 iso_pu_bacteria 2844009547 2844010602 359
580 iso_pu_bacteria 2844163670 2844165378 359
581 iso_pu_bacteria 2850079185 2850085189 359
582 iso_pu_bacteria 2855825444 2855829171 359
583 iso_pu_bacteria 2855839649 2855844265 359
584 iso_pu_bacteria 2856320880 2856322223 359
585 iso_pu_bacteria 2856328259 2856332717 359
586 iso_pu_bacteria 2856334872 2856340704 359
587 iso_pu_bacteria 2857367948 2857369261 359
588 iso_pu_bacteria 2858800743 2858804418 359
589 iso_pu_bacteria 2869234852 2869239952 359
590 iso_pu_bacteria 2869242130 2869247830 359
591 iso_pu_bacteria 2869249662 2869251669 359
592 iso_pu_bacteria 2869256925 2869257092 359
593 iso_pu_bacteria 2869264136 2869269871 359
594 iso_pu_bacteria 2869271264 2869277349 359
595 iso_pu_bacteria 2869278585 2869284682 359
596 iso_pu_bacteria 2871435913 2871438855 359
597 iso_pu_bacteria 2871451962 2871452937 359
598 iso_pu_bacteria 2871459585 2871465925 359
599 iso_pu_bacteria 2871466892 2871472944 359
600 iso_pu_bacteria 2871481445 2871483976 359
601 iso_pu_bacteria 2874109183 2874114510 359
602 iso_pu_bacteria 2874116593 2874122033 359
603 iso_pu_bacteria 2874131515 2874138693 359
604 iso_pu_bacteria 2874139085 2874142998 359
605 iso_pu_bacteria 2874162495 2874168339 359
606 iso_pu_bacteria 2874168670 2874172208 359
607 iso_pu_bacteria 2876363079 2876363682 359
608 iso_pu_bacteria 2876363079 2876368571 359
609 iso_pu_bacteria 2876386047 2876386520 359
610 iso_pu_bacteria 2876399893 2876403791 359
611 iso_pu_bacteria 2876406927 2876412078 359
612 iso_pu_bacteria 2876420981 2876424497 359
613 iso_pu_bacteria 2878730984 2878735327 359
614 iso_pu_bacteria 2878738818 2878740933 359
615 iso_pu_bacteria 2878774303 2878775273 359
616 iso_pu_bacteria 2878781027 2878785538 359
617 iso_pu_bacteria 2888337043 2888343315 359
618 iso_pu_bacteria 2896384573 2896388863 359
619 iso_pu_bacteria 2903448605 2903451223 359
620 iso_pu_bacteria 2903448605 2903454233 359
621 iso_pu_bacteria 2903513507 2903514200 359
622 iso_pu_bacteria 2903521522 2903523257 359
623 iso_pu_bacteria 2903521522 2903527570 359
624 iso_pu_bacteria 2903528002 2903529296 359
625 iso_pu_bacteria 2903528002 2903534024 359
626 iso_pu_bacteria 2906363423 2906368753 359
627 iso_pu_bacteria 2906370794 2906372832 359
628 iso_pu_bacteria 2906378014 2906383050 359
629 iso_pu_bacteria 2906386501 2906392542 359
630 iso_pu_bacteria 2906393657 2906394001 359
631 iso_pu_bacteria 2906401398 2906407328 359
632 iso_pu_bacteria 2906408224 2906408496 359
633 iso_pu_bacteria 2906427513 2906432798 359
634 iso_pu_bacteria 2913295892 2913296204 359
635 iso_pu_bacteria 2915980308 2915984866 359
636 iso_pu_bacteria 2915986958 2915993070 359
637 iso_pu_bacteria 2915993759 2915999894 359
638 iso_pu_bacteria 2916000859 2916005403 359
639 iso_pu_bacteria 2916007675 2916014432 359
640 iso_pu_bacteria 2916014648 2916020666 359
641 iso_pu_bacteria 2916021584 2916024475 359
642 iso_pu_bacteria 2916028427 2916034785 359
643 iso_pu_bacteria 2916035215 2916035903 359
644 iso_pu_bacteria 2916041962 2916046622 359
645 iso_pu_bacteria 2916048683 2916052744 359
646 iso_pu_bacteria 2916055098 2916060342 359
647 iso_pu_bacteria 2916061851 2916067185 359
648 iso_pu_bacteria 2916068649 2916074164 359
649 iso_pu_bacteria 2916076590 2916081104 359
650 iso_pu_bacteria 2920760137 2920764257 359
651 iso_pu_bacteria 2920822456 2920828116 359
652 iso_pu_bacteria 2921201388 2921207235 359
653 iso_pu_bacteria 2921208531 2921212158 359
654 iso_pu_bacteria 2921237296 2921242467 359
655 iso_pu_bacteria 2921244191 2921245343 359
656 iso_pu_bacteria 2921250672 2921255412 359
657 iso_pu_bacteria 2921257292 2921263639 359
658 iso_pu_bacteria 2921263974 2921270444 359
659 iso_pu_bacteria 2921282425 2921286173 359
660 iso_pu_bacteria 2921289301 2921291806 359
661 iso_pu_bacteria 2921296804 2921298133 359
662 iso_pu_bacteria 2922151315 2922151873 359
663 iso_pu_bacteria 2922172374 2922174391 359
664 iso_pu_bacteria 2922178524 2922184513 359
665 iso_pu_bacteria 2924150972 2924154852 359
666 iso_pu_bacteria 2924158325 2924162346 359
667 iso_pu_bacteria 2924165586 2924170584 359
668 iso_pu_bacteria 2924172951 2924173958 359
669 iso_pu_bacteria 2924179722 2924185496 359
670 iso_pu_bacteria 2924186466 2924192085 359
671 iso_pu_bacteria 2924193448 2924194448 359
672 iso_pu_bacteria 2924207177 2924212673 359
673 iso_pu_bacteria 2924214083 2924215368 359
674 iso_pu_bacteria 2924221636 2924225693 359
675 iso_pu_bacteria 2924228884 2924229312 359
676 iso_pu_bacteria 2924710171 2924716533 359
677 iso_pu_bacteria 2924718760 2924722718 359
678 iso_pu_bacteria 2924733363 2924736514 359
679 iso_pu_bacteria 2924741084 2924741085 359
680 iso_pu_bacteria 2924748358 2924748635 359
681 iso_pu_bacteria 2924762789 2924765596 359
682 iso_pu_bacteria 2924776078 2924778534 359
683 iso_pu_bacteria 2936996657 2936999383 359
684 iso_pu_bacteria 2937002841 2937002861 359
685 iso_pu_bacteria 2937009748 2937013341 359
686 iso_pu_bacteria 2937016420 2937020687 359
687 iso_pu_bacteria 2937023124 2937025031 359
688 iso_pu_bacteria 2937029754 2937030787 359
689 iso_pu_bacteria 2937036028 2937041080 359
690 iso_pu_bacteria 2937042894 2937049717 359
691 iso_pu_bacteria 2937049772 2937054972 359
692 iso_pu_bacteria 2937056579 2937061377 359
693 iso_pu_bacteria 2937063883 2937068864 359
694 iso_pu_bacteria 2937071275 2937076637 359
695 iso_pu_bacteria 2937078374 2937082446 359
696 iso_pu_bacteria 2937084907 2937085796 359
697 iso_pu_bacteria 2937091812 2937098048 359
698 iso_pu_bacteria 2937098957 2937103328 359
699 iso_pu_bacteria 2937106411 2937108682 359
700 iso_pu_bacteria 2937119839 2937123411 359
701 iso_pu_bacteria 2937126314 2937128366 359
702 iso_pu_bacteria 2937822353 2937824360 359
703 iso_pu_bacteria 2937822353 2937826504 359
704 iso_pu_bacteria 2937848649 2937849575 359
705 iso_pu_bacteria 2937861824 2937866113 359
706 iso_pu_bacteria 2937868953 2937873191 359
707 iso_pu_bacteria 2937877337 2937878832 359
708 iso_pu_bacteria 2937972304 2937974387 359
709 iso_pu_bacteria 2941499720 2941502919 359
710 iso_pu_bacteria 2957375807 2957379901 359
711 iso_pu_bacteria 2957382221 2957386558 359
712 iso_pu_bacteria 2957388812 2957391270 359
713 iso_pu_bacteria 2957395598 2957397850 359
714 iso_pu_bacteria 2957402308 2957406906 359
715 iso_pu_bacteria 2957408893 2957414689 359
716 iso_pu_bacteria 2957415311 2957420192 359
717 iso_pu_bacteria 2957422303 2957426008 359
718 iso_pu_bacteria 2957437181 2957441958 359
719 iso_pu_bacteria 2957443900 2957447922 359
720 iso_pu_bacteria 2957450854 2957451479 359
721 iso_pu_bacteria 2957457609 2957463187 359
722 iso_pu_bacteria 2957464669 2957468456 359
723 iso_pu_bacteria 2957471148 2957475528 359
724 iso_pu_bacteria 2957478035 2957483472 359
725 iso_pu_bacteria 2957484790 2957485406 359
726 iso_pu_bacteria 2957491536 2957496813 359
727 iso_pu_bacteria 2957498199 2957499665 359
728 iso_pu_bacteria 2957505466 2957512332 359
729 iso_pu_bacteria 2958034702 2958041463 359
730 iso_pu_bacteria 2958041894 2958042437 359
731 iso_pu_bacteria 2958064165 2958069541 359
732 iso_pu_bacteria 2958084443 2958085983 359
733 iso_pu_bacteria 2958092219 2958092888 359
734 iso_pu_bacteria 2958092219 2958093336 359
735 iso_pu_bacteria 2958108152 2958109044 359
736 iso_pu_bacteria 2958122699 2958123255 359
737 iso_pu_bacteria 2958137437 2958144217 359
738 iso_pu_bacteria 2958144490 2958149547 359
739 iso_pu_bacteria 2958158011 2958164281 359
740 iso_pu_bacteria 2960584000 2960587852 359
741 iso_pu_bacteria 2960591022 2960595866 359
742 iso_pu_bacteria 2960597568 2960601758 359
743 iso_pu_bacteria 2960603979 2960604294 359
744 iso_pu_bacteria 2960610863 2960612000 359
745 iso_pu_bacteria 2960617483 2960624134 359
746 iso_pu_bacteria 2960624210 2960625901 359
747 iso_pu_bacteria 2960631154 2960636226 359
748 iso_pu_bacteria 2960637947 2960643595 359
749 iso_pu_bacteria 2960645483 2960648989 359
750 iso_pu_bacteria 2960652885 2960654602 359
751 iso_pu_bacteria 2960660292 2960664966 359
752 iso_pu_bacteria 2960667422 2960668004 359
753 iso_pu_bacteria 2960674078 2960676398 359
754 iso_pu_bacteria 2960680706 2960685335 359
755 iso_pu_bacteria 2960693952 2960699501 359
756 iso_pu_bacteria 2961136820 2961140509 359
757 iso_pu_bacteria 2961183825 2961184393 359
758 iso_pu_bacteria 2963644680 2963645142 359
759 iso_pu_bacteria 2963644680 2963647622 359
760 iso_pu_bacteria 2964607997 2964612871 359
761 iso_pu_bacteria 2964615318 2964615333 359
762 iso_pu_bacteria 2964621998 2964625934 359
763 iso_pu_bacteria 2964628898 2964631637 359
764 iso_pu_bacteria 2964636051 2964641946 359
765 iso_pu_bacteria 2964649959 2964654302 359
766 iso_pu_bacteria 2964656573 2964663415 359
767 iso_pu_bacteria 2964663802 2964664200 359
768 iso_pu_bacteria 2964670856 2964675276 359
769 iso_pu_bacteria 2964678106 2964682126 359
770 iso_pu_bacteria 2964685014 2964688283 359
771 iso_pu_bacteria 2964691889 2964698429 359
772 iso_pu_bacteria 2964705432 2964711677 359
773 iso_pu_bacteria 2964712639 2964714786 359
774 iso_pu_bacteria 2964719344 2964724943 359
775 iso_pu_bacteria 2965025482 2965030166 359
776 iso_pu_bacteria 2965032056 2965039531 359
777 iso_pu_bacteria 2965040258 2965045399 359
778 iso_pu_bacteria 2965047637 2965054743 359
779 iso_pu_bacteria 2965089291 2965096606 359
780 iso_pu_bacteria 2965102966 2965109700 359
781 iso_pu_bacteria 2965110997 2965117046 359
782 iso_pu_bacteria 2967664464 2967670160 359
783 iso_pu_bacteria 2967671571 2967672634 359
784 iso_pu_bacteria 2967678726 2967679999 359
785 iso_pu_bacteria 2967686174 2967690668 359
786 iso_pu_bacteria 2967693043 2967697648 359
787 iso_pu_bacteria 2967699805 2967700828 359
788 iso_pu_bacteria 2967714385 2967718705 359
789 iso_pu_bacteria 2967721400 2967726435 359
790 iso_pu_bacteria 2967728569 2967733579 359
791 iso_pu_bacteria 2967735183 2967737935 359
792 iso_pu_bacteria 2967742019 2967743806 359
793 iso_pu_bacteria 2967748971 2967752808 359
794 iso_pu_bacteria 2967755722 2967757414 359
795 iso_pu_bacteria 2967762386 2967767644 359
796 iso_pu_bacteria 2967775926 2967782721 359
797 iso_pu_bacteria 2968016561 2968022983 359
798 iso_pu_bacteria 2968083720 2968089959 359
799 iso_pu_bacteria 2968083720 2968090253 359
800 iso_pu_bacteria 2968138860 2968144373 359
801 iso_pu_bacteria 2970019648 2970023801 359
802 iso_pu_bacteria 2970026789 2970030155 359
803 iso_pu_bacteria 2970033650 2970038511 359
804 iso_pu_bacteria 2970040964 2970046451 359
805 iso_pu_bacteria 2970047711 2970050847 359
806 iso_pu_bacteria 2970054988 2970056981 359
807 iso_pu_bacteria 2970061556 2970062626 359
808 iso_pu_bacteria 2970068827 2970073462 359
809 iso_pu_bacteria 2970076120 2970078867 359
810 iso_pu_bacteria 2970082768 2970087896 359
811 iso_pu_bacteria 2970088815 2970095009 359
812 iso_pu_bacteria 2970095765 2970096367 359
813 iso_pu_bacteria 2970102677 2970103066 359
814 iso_pu_bacteria 2970109326 2970114540 359
815 iso_pu_bacteria 2970116247 2970121099 359
816 iso_pu_bacteria 2970122695 2970127529 359
817 iso_pu_bacteria 2970129317 2970134033 359
818 iso_pu_bacteria 2970143518 2970147542 359
819 iso_pu_bacteria 2970149975 2970155033 359
820 iso_pu_bacteria 2970156795 2970161155 359
821 iso_pu_bacteria 2970164137 2970168672 359
822 iso_pu_bacteria 2970170962 2970171417 359
823 iso_pu_bacteria 2970177841 2970181495 359
824 iso_pu_bacteria 2970184632 2970185061 359
825 iso_pu_bacteria 2970191845 2970193790 359
826 iso_pu_bacteria 2970469710 2970475568 359
827 iso_pu_bacteria 2970489779 2970492390 359
828 iso_pu_bacteria 2970510686 2970510885 359
829 iso_pu_bacteria 2970532167 2970539025 359
830 iso_pu_bacteria 2970547951 2970548669 359
831 iso_pu_bacteria 2970593180 2970599293 359
832 iso_pu_bacteria 2970619444 2970619865 359
833 iso_pu_bacteria 2970627176 2970628672 359
834 iso_pu_bacteria 2977516862 2977519678 359
835 iso_pu_bacteria 2977523885 2977529398 359
836 iso_pu_bacteria 2977537788 2977540843 359
837 iso_pu_bacteria 2977544691 2977549601 359
838 iso_pu_bacteria 2977551784 2977556486 359
839 iso_pu_bacteria 2977558990 2977561020 359
840 iso_pu_bacteria 2977565890 2977570444 359
841 iso_pu_bacteria 2977572785 2977576437 359
842 iso_pu_bacteria 2977579622 2977584890 359
843 iso_pu_bacteria 2977851361 2977855246 359
844 iso_pu_bacteria 2977872689 2977879645 359
845 iso_pu_bacteria 2977898635 2977905528 359
846 iso_pu_bacteria 2977915119 2977921276 359
847 iso_pu_bacteria 2977922695 2977925729 359
848 iso_pu_bacteria 2977935797 2977938196 359
849 iso_pu_bacteria 2977950692 2977954482 359
850 iso_pu_bacteria 2977957713 2977965258 359
851 iso_pu_bacteria 2977986579 2977988146 359
852 iso_pu_bacteria 2977986579 2977988782 359
853 iso_pu_bacteria 2979764755 2979769283 359
854 iso_pu_bacteria 2979772303 2979772710 359
855 iso_pu_bacteria 2979793036 2979800404 359
856 iso_pu_bacteria 2987645492 2987648700 359
857 iso_pu_bacteria 2987666974 2987669341 359
858 iso_pu_bacteria 2987673487 2987675266 359
859 iso_pu_bacteria 2989776772 2989777514 359
860 iso_pu_bacteria 2996348954 2996355822 359
861 iso_pu_bacteria 2996386984 2996387516 359
862 iso_pu_bacteria 3000135777 3000137165 359
863 iso_pu_bacteria 3004167301 3004173031 359
864 iso_pu_bacteria 3004195979 3004203499 359
865 iso_pu_bacteria 3004211236 3004217267 359
866 iso_pu_bacteria 3004218560 3004220467 359
867 iso_pu_bacteria 3004232784 3004237303 359
868 iso_pu_bacteria 3004239961 3004247243 359
869 iso_pu_bacteria 3004248173 3004250435 359
870 iso_pu_bacteria 3004268573 3004275064 359
871 iso_pu_bacteria 3004275668 3004282248 359
872 iso_pu_bacteria 3004289098 3004289189 359
873 iso_pu_bacteria 3004334049 3004337594 359
874 iso_pu_bacteria 3005452660 3005458306 359
875 iso_pu_bacteria 637000159 637077210 359
876 iso_pu_bacteria 648276728 648735337 359
877 iso_pu_bacteria 649633066 649870364 359
878 iso_pu_bacteria 8003992118 8003996843 359
879 iso_pu_bacteria 8003999396 8004004511 359
880 iso_pu_bacteria 8004300914 8004304040 359
881 iso_pu_bacteria 8004312739 8004315493 359
882 iso_pu_bacteria 8004361976 8004365825 359
883 iso_pu_bacteria 8004695233 8004695505 359
884 iso_pu_bacteria 8004727605 8004730978 359
885 iso_pu_bacteria 8056375014 8056375379 359
886 3300003203 JGI25406J46586_10039323 JGI25406J46586_100393231 360
887 3300003763 Ga0055529_1001910 Ga0055529_10019102 360
888 3300005340 Ga0070689_100222069 Ga0070689_1002220691 360
889 3300005344 Ga0070661_100007127 Ga0070661_1000071275 360
890 3300005578 Ga0068854_100058022 Ga0068854_1000580223 360
891 3300005985 Ga0081539_10000618 Ga0081539_1000061844 360
892 3300006051 Ga0075364_10060878 Ga0075364_100608783 360
893 3300006186 Ga0075369_10029051 Ga0075369_100290511 360
894 3300009093 Ga0105240_10126626 Ga0105240_101266263 360
895 3300009093 Ga0105240_10137792 Ga0105240_101377922 360
896 3300009174 Ga0105241_10076691 Ga0105241_100766913 360
897 3300009551 Ga0105238_10078168 Ga0105238_100781684 360
898 3300010375 Ga0105239_10024984 Ga0105239_100249845 360
899 3300025321 Ga0207656_10019890 Ga0207656_100198902 360
900 3300025920 Ga0207649_10014377 Ga0207649_100143773 360
901 3300026089 Ga0207648_10088546 Ga0207648_100885462 360
902 3300026142 Ga0207698_10106579 Ga0207698_101065793 360
903 3300037312 Ga0395899_0005027 Ga0395899_0005027_3247_4344 360
904 3300037466 Ga0395898_0064562 Ga0395898_0064562_444_1541 360
905 3300038443 Ga0395901_0087394 Ga0395901_0087394_1239_2336 360
906 3300046660 Ga0495625_0015985 Ga0495625_0015985_3385_4470 360
907 3300048091 Ga0495626_0033628 Ga0495626_0033628_909_1994 360
908 3300048915 Ga0496112_0013656 Ga0496112_0013656_3926_5047 360
909 3300048916 Ga0496113_0087689 Ga0496113_0087689_90_1211 360
910 3300048929 Ga0496126_0280571 Ga0496126_0280571_153_1244 360
911 3300049569 Ga0501032_0011258 Ga0501032_0011258_1800_2894 360
912 3300049573 Ga0501037_0014468 Ga0501037_0014468_135_1229 360
913 3300049575 Ga0501039_0204987 Ga0501039_0204987_43_1131 360
914 3300049581 Ga0501047_0035639 Ga0501047_0035639_410_1504 360
915 3300049589 Ga0501073_0090684 Ga0501073_0090684_407_1540 360
916 3300049822 Ga0501035_0037022 Ga0501035_0037022_221_1315 360
917 3300049823 Ga0501044_0024577 Ga0501044_0024577_2599_3693 360
918 3300050490 nmdc:mga03n38_17358_c1 nmdc:mga03n38_17358_c1_123_1208 360
919 3300050491 nmdc:mga00v17_139140_c1 nmdc:mga00v17_139140_c1_284_1387 360
920 3300053158 Ga0500627_0028922 Ga0500627_0028922_674_1759 360
921 iso_pu_bacteria 2599185301 2599935257 360
922 iso_pu_bacteria 3002141150 3002145055 360
923 3300003187 JGI25151J46595_10000508 JGI25151J46595_1000050814 361
924 3300003214 JGI25165J46597_1006637 JGI25165J46597_10066373 361
925 3300003215 JGI25153J46596_10006031 JGI25153J46596_100060314 361
926 3300003354 JGI25160J50197_1005949 JGI25160J50197_10059495 361
927 3300003374 JGI25161J50226_1004538 JGI25161J50226_10045382 361
928 3300003771 Ga0055526_1004842 Ga0055526_10048425 361
929 3300003771 Ga0055526_1020052 Ga0055526_10200522 361
930 3300003775 Ga0055524_1010769 Ga0055524_10107693 361
931 3300003790 Ga0055528_1000206 Ga0055528_100020636 361
932 3300003790 Ga0055528_1010402 Ga0055528_10104025 361
933 3300003790 Ga0055528_1010816 Ga0055528_10108163 361
934 3300003792 Ga0055540_1000197 Ga0055540_100019713 361
935 3300003792 Ga0055540_1015850 Ga0055540_10158501 361
936 3300003856 Ga0058692_1007706 Ga0058692_10077062 361
937 3300004625 Ga0055543_1000578 Ga0055543_100057816 361
938 3300005262 Ga0065165_1003349 Ga0065165_100334912 361
939 3300005328 Ga0070676_10134815 Ga0070676_101348152 361
940 3300005335 Ga0070666_10155484 Ga0070666_101554841 361
941 3300005355 Ga0070671_100037928 Ga0070671_1000379284 361
942 3300005563 Ga0068855_100018333 Ga0068855_1000183333 361
943 3300005614 Ga0068856_100306076 Ga0068856_1003060762 361
944 3300006038 Ga0075365_10007816 Ga0075365_100078168 361
945 3300006038 Ga0075365_10102015 Ga0075365_101020151 361
946 3300006178 Ga0075367_10006345 Ga0075367_100063457 361
947 3300006186 Ga0075369_10048179 Ga0075369_100481792 361
948 3300006195 Ga0075366_10023777 Ga0075366_100237773 361
949 3300006353 Ga0075370_10048803 Ga0075370_100488032 361
950 3300009036 Ga0105244_10108944 Ga0105244_101089442 361
951 3300009093 Ga0105240_10004169 Ga0105240_100041699 361
952 3300009174 Ga0105241_10082912 Ga0105241_100829123 361
953 3300009551 Ga0105238_10084094 Ga0105238_100840943 361
954 3300009765 Ga0123341_1000056 Ga0123341_100005612 361
955 3300009766 Ga0123342_1014953 Ga0123342_10149532 361
956 3300009766 Ga0123342_1022984 Ga0123342_10229845 361
957 3300013104 Ga0157370_10003035 Ga0157370_1000303515 361
958 3300013105 Ga0157369_10010647 Ga0157369_100106475 361
959 3300013306 Ga0163162_10481565 Ga0163162_104815652 361
960 3300025233 Ga0209437_102580 Ga0209437_1025803 361
961 3300025245 Ga0207425_1005570 Ga0207425_10055702 361
962 3300025253 Ga0209677_100948 Ga0209677_1009488 361
963 3300025253 Ga0209677_108148 Ga0209677_1081483 361
964 3300025258 Ga0209129_1004306 Ga0209129_10043065 361
965 3300025258 Ga0209129_1004490 Ga0209129_10044902 361
966 3300025261 Ga0209233_1000216 Ga0209233_100021664 361
967 3300025261 Ga0209233_1012311 Ga0209233_10123113 361
968 3300025273 Ga0209673_1000023 Ga0209673_100002360 361
969 3300025273 Ga0209673_1000797 Ga0209673_10007975 361
970 3300025273 Ga0209673_1004600 Ga0209673_10046004 361
971 3300025273 Ga0209673_1011855 Ga0209673_10118553 361
972 3300025273 Ga0209673_1011856 Ga0209673_10118563 361
973 3300025292 Ga0209676_1022772 Ga0209676_10227722 361
974 3300025294 Ga0209025_1000397 Ga0209025_100039785 361
975 3300025294 Ga0209025_1027175 Ga0209025_10271753 361
976 3300025295 Ga0209564_1000112 Ga0209564_100011277 361
977 3300025295 Ga0209564_1004904 Ga0209564_10049045 361
978 3300025295 Ga0209564_1006446 Ga0209564_10064463 361
979 3300025297 Ga0209758_1000316 Ga0209758_10003163 361
980 3300025297 Ga0209758_1001534 Ga0209758_100153412 361
981 3300025297 Ga0209758_1003167 Ga0209758_10031672 361
982 3300025299 Ga0209256_1000485 Ga0209256_100048541 361
983 3300025299 Ga0209256_1015469 Ga0209256_10154693 361
984 3300025299 Ga0209256_1018562 Ga0209256_10185623 361
985 3300025302 Ga0207426_1000355 Ga0207426_100035576 361
986 3300025303 Ga0209051_1000119 Ga0209051_100011987 361
987 3300025303 Ga0209051_1006341 Ga0209051_10063418 361
988 3300025303 Ga0209051_1024195 Ga0209051_10241952 361
989 3300025913 Ga0207695_10040383 Ga0207695_100403835 361
990 3300025923 Ga0207681_10163879 Ga0207681_101638792 361
991 3300025949 Ga0207667_10015837 Ga0207667_100158375 361
992 3300027111 Ga0209281_1001484 Ga0209281_10014846 361
993 3300027312 Ga0209371_1003208 Ga0209371_10032083 361
994 3300028794 Ga0307515_10001908 Ga0307515_1000190825 361
995 3300028794 Ga0307515_10007811 Ga0307515_1000781114 361
996 3300028794 Ga0307515_10088198 Ga0307515_100881982 361
997 3300030500 Ga0268256_1000785 Ga0268256_100078527 361
998 3300031456 Ga0307513_10140242 Ga0307513_101402422 361
999 3300031456 Ga0307513_10192902 Ga0307513_101929022 361
1000 3300031731 Ga0307405_10134930 Ga0307405_101349302 361
1001 3300032004 Ga0307414_10067027 Ga0307414_100670272 361
1002 3300032005 Ga0307411_10106116 Ga0307411_101061162 361
1003 3300039450 Ga0436363_1084910 Ga0436363_1084910_33_1142 361
1004 3300041511 Ga0451855_0071228 Ga0451855_0071228_653_1741 361
1005 3300044693 Ga0466961_0099736 Ga0466961_0099736_86_1234 361
1006 3300046474 Ga0495605_0001661 Ga0495605_0001661_6387_7475 361
1007 3300046476 Ga0495662_0006894 Ga0495662_0006894_1712_2836 361
1008 3300046492 Ga0495585_0007048 Ga0495585_0007048_5107_6195 361
1009 3300046512 Ga0495610_0067746 Ga0495610_0067746_64_1188 361
1010 3300046512 Ga0495610_0117707 Ga0495610_0117707_15_1103 361
1011 3300046513 Ga0495616_0022393 Ga0495616_0022393_1255_2343 361
1012 3300046515 Ga0495620_0048340 Ga0495620_0048340_127_1215 361
1013 3300046518 Ga0495631_0002544 Ga0495631_0002544_8492_9580 361
1014 3300046519 Ga0495632_0030102 Ga0495632_0030102_212_1399 361
1015 3300046522 Ga0495643_0104040 Ga0495643_0104040_291_1379 361
1016 3300046522 Ga0495643_0114757 Ga0495643_0114757_137_1225 361
1017 3300046557 Ga0495622_0006140 Ga0495622_0006140_528_1619 361
1018 3300046558 Ga0495633_0058083 Ga0495633_0058083_141_1229 361
1019 3300046616 Ga0495668_0007692 Ga0495668_0007692_26_1114 361
1020 3300046660 Ga0495625_0003553 Ga0495625_0003553_8342_9430 361
1021 3300046810 Ga0495660_0028017 Ga0495660_0028017_1399_2487 361
1022 3300047317 Ga0495604_0039217 Ga0495604_0039217_2145_3269 361
1023 3300047472 Ga0495686_0000547 Ga0495686_0000547_25368_26456 361
1024 3300047472 Ga0495686_0179615 Ga0495686_0179615_56_1144 361
1025 3300048919 Ga0496116_0023380 Ga0496116_0023380_2922_4010 361
1026 3300048920 Ga0496117_0090384 Ga0496117_0090384_776_1867 361
1027 3300048921 Ga0496118_0000678 Ga0496118_0000678_39927_41018 361
1028 3300048924 Ga0496121_0019147 Ga0496121_0019147_4224_5309 361
1029 3300048924 Ga0496121_0040375 Ga0496121_0040375_2464_3552 361
1030 3300048924 Ga0496121_0041028 Ga0496121_0041028_1962_3050 361
1031 3300048925 Ga0496122_0013405 Ga0496122_0013405_1760_2875 361
1032 3300048926 Ga0496123_0030462 Ga0496123_0030462_418_1533 361
1033 3300048927 Ga0496124_0208831 Ga0496124_0208831_351_1439 361
1034 3300048928 Ga0496125_0005418 Ga0496125_0005418_5789_6877 361
1035 3300049571 Ga0501034_0236774 Ga0501034_0236774_356_1441 361
1036 3300050489 nmdc:mga03683_67832_c1 nmdc:mga03683_67832_c1_41_1183 361
1037 3300053134 Ga0500658_0001270 Ga0500658_0001270_3238_4326 361
1038 3300053148 Ga0500590_000016 Ga0500590_000016_27616_28740 361
1039 3300053155 Ga0500620_000018 Ga0500620_000018_12828_13916 361
1040 3300053156 Ga0500622_0001141 Ga0500622_0001141_4744_5832 361
1041 iso_pu_bacteria 2510917028 2511182281 361
1042 iso_pu_bacteria 2513237305 2514418236 361
1043 iso_pu_bacteria 2582581867 2585403712 361
1044 iso_pu_bacteria 2585427590 2585824118 361
1045 iso_pu_bacteria 2588253730 2588514091 361
1046 iso_pu_bacteria 2721755686 2723573055 361
1047 iso_pu_bacteria 2839993093 2839998225 361
1048 iso_pu_bacteria 2856356410 2856356638 361
1049 iso_pu_bacteria 2871488783 2871489656 361
1050 iso_pu_bacteria 2871495908 2871502301 361
1051 iso_pu_bacteria 2878753008 2878754308 361
1052 iso_pu_bacteria 2878760144 2878766192 361
1053 iso_pu_bacteria 2878767105 2878773393 361
1054 iso_pu_bacteria 2881845957 2881847079 361
1055 iso_pu_bacteria 2881861095 2881865987 361
1056 iso_pu_bacteria 2882912400 2882913266 361
1057 iso_pu_bacteria 2885318864 2885323609 361
1058 iso_pu_bacteria 2903492973 2903497377 361
1059 iso_pu_bacteria 2903540706 2903547238 361
1060 iso_pu_bacteria 2924784321 2924784996 361
1061 iso_pu_bacteria 2937994558 2938001101 361
1062 iso_pu_bacteria 2958165035 2958171367 361
1063 iso_pu_bacteria 2961163497 2961169808 361
1064 iso_pu_bacteria 2961170736 2961176365 361
1065 iso_pu_bacteria 2965018300 2965024568 361
1066 iso_pu_bacteria 2967996073 2967996720 361
1067 iso_pu_bacteria 2968003550 2968004782 361
1068 iso_pu_bacteria 2968171901 2968178200 361
1069 iso_pu_bacteria 2970503327 2970509036 361
1070 iso_pu_bacteria 2970554993 2970561046 361
1071 iso_pu_bacteria 2977821940 2977823522 361
1072 iso_pu_bacteria 2977828996 2977830944 361
1073 iso_pu_bacteria 2979808191 2979813715 361
1074 iso_pu_bacteria 2987652177 2987656413 361
1075 iso_pu_bacteria 2987659509 2987666032 361
1076 iso_pu_bacteria 3004188549 3004195055 361
1077 iso_pu_bacteria 8004374579 8004375884 361
1078 iso_pu_bacteria 8005542996 8005546546 361
1079 3300001979 JGI24740J21852_10007488 JGI24740J21852_100074883 362
1080 3300001979 JGI24740J21852_10008714 JGI24740J21852_100087142 362
1081 3300002704 JGI25155J39150_1000020 JGI25155J39150_100002087 362
1082 3300002705 JGI25156J39149_1000021 JGI25156J39149_100002163 362
1083 3300002737 JGI25162J39368_1000365 JGI25162J39368_100036531 362
1084 3300002737 JGI25162J39368_1004315 JGI25162J39368_10043152 362
1085 3300002738 JGI25154J39366_1000039 JGI25154J39366_100003987 362
1086 3300002741 JGI25157J39369_1000019 JGI25157J39369_100001963 362
1087 3300002741 JGI25157J39369_1000470 JGI25157J39369_10004702 362
1088 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018314 362
1089 3300003214 JGI25165J46597_1000078 JGI25165J46597_1000078134 362
1090 3300003214 JGI25165J46597_1001675 JGI25165J46597_100167510 362
1091 3300003215 JGI25153J46596_10026215 JGI25153J46596_100262153 362
1092 3300003762 Ga0055542_1001263 Ga0055542_100126315 362
1093 3300003781 Ga0055536_1018593 Ga0055536_10185932 362
1094 3300003792 Ga0055540_1004400 Ga0055540_10044004 362
1095 3300003794 Ga0055531_10006820 Ga0055531_100068204 362
1096 3300005344 Ga0070661_100157862 Ga0070661_1001578621 362
1097 3300005367 Ga0070667_100053632 Ga0070667_1000536323 362
1098 3300005367 Ga0070667_100066279 Ga0070667_1000662793 362
1099 3300005455 Ga0070663_100142285 Ga0070663_1001422851 362
1100 3300005548 Ga0070665_100033626 Ga0070665_1000336266 362
1101 3300005548 Ga0070665_100184907 Ga0070665_1001849072 362
1102 3300005563 Ga0068855_100207120 Ga0068855_1002071203 362
1103 3300005614 Ga0068856_100028448 Ga0068856_1000284484 362
1104 3300005616 Ga0068852_100104186 Ga0068852_1001041862 362
1105 3300005983 Ga0081540_1004077 Ga0081540_10040775 362
1106 3300006038 Ga0075365_10024630 Ga0075365_100246303 362
1107 3300006038 Ga0075365_10046141 Ga0075365_100461413 362
1108 3300006038 Ga0075365_10125324 Ga0075365_101253241 362
1109 3300006177 Ga0075362_10070629 Ga0075362_100706292 362
1110 3300006178 Ga0075367_10136538 Ga0075367_101365382 362
1111 3300006186 Ga0075369_10013882 Ga0075369_100138822 362
1112 3300009093 Ga0105240_10000012 Ga0105240_1000001296 362
1113 3300009176 Ga0105242_10052529 Ga0105242_100525292 362
1114 3300009545 Ga0105237_10001333 Ga0105237_100013333 362
1115 3300009545 Ga0105237_10229135 Ga0105237_102291352 362
1116 3300009551 Ga0105238_10001985 Ga0105238_1000198520 362
1117 3300010375 Ga0105239_10080988 Ga0105239_100809883 362
1118 3300010375 Ga0105239_10112377 Ga0105239_101123772 362
1119 3300013104 Ga0157370_10019121 Ga0157370_100191213 362
1120 3300013105 Ga0157369_10079206 Ga0157369_100792063 362
1121 3300013105 Ga0157369_10168370 Ga0157369_101683702 362
1122 3300014497 Ga0182008_10031883 Ga0182008_100318833 362
1123 3300015262 Ga0182007_10009237 Ga0182007_100092373 362
1124 3300015265 Ga0182005_1000879 Ga0182005_10008795 362
1125 3300015690 Ga0183363_1378 Ga0183363_13784 362
1126 3300025206 Ga0209435_100025 Ga0209435_100025108 362
1127 3300025228 Ga0209672_104342 Ga0209672_1043422 362
1128 3300025233 Ga0209437_100022 Ga0209437_100022375 362
1129 3300025233 Ga0209437_100040 Ga0209437_100040284 362
1130 3300025246 Ga0209646_1000083 Ga0209646_1000083108 362
1131 3300025246 Ga0209646_1004647 Ga0209646_10046472 362
1132 3300025250 Ga0209026_1000078 Ga0209026_1000078108 362
1133 3300025250 Ga0209026_1000151 Ga0209026_100015182 362
1134 3300025253 Ga0209677_102746 Ga0209677_1027463 362
1135 3300025254 Ga0209148_1000032 Ga0209148_1000032484 362
1136 3300025256 Ga0209759_1000060 Ga0209759_1000060108 362
1137 3300025256 Ga0209759_1000076 Ga0209759_100007612 362
1138 3300025261 Ga0209233_1000031 Ga0209233_1000031375 362
1139 3300025261 Ga0209233_1000051 Ga0209233_1000051285 362
1140 3300025261 Ga0209233_1000146 Ga0209233_1000146116 362
1141 3300025261 Ga0209233_1000150 Ga0209233_100015047 362
1142 3300025261 Ga0209233_1030683 Ga0209233_10306831 362
1143 3300025272 Ga0209455_1000085 Ga0209455_1000085188 362
1144 3300025272 Ga0209455_1010995 Ga0209455_10109952 362
1145 3300025292 Ga0209676_1003759 Ga0209676_10037596 362
1146 3300025297 Ga0209758_1000532 Ga0209758_100053261 362
1147 3300025303 Ga0209051_1006348 Ga0209051_10063485 362
1148 3300025304 Ga0209257_1005204 Ga0209257_10052045 362
1149 3300025304 Ga0209257_1007029 Ga0209257_10070294 362
1150 3300025904 Ga0207647_10024760 Ga0207647_100247602 362
1151 3300025913 Ga0207695_10000120 Ga0207695_10000120118 362
1152 3300025914 Ga0207671_10000755 Ga0207671_1000075519 362
1153 3300025914 Ga0207671_10016640 Ga0207671_100166402 362
1154 3300025919 Ga0207657_10188435 Ga0207657_101884353 362
1155 3300025924 Ga0207694_10100400 Ga0207694_101004001 362
1156 3300025949 Ga0207667_10174779 Ga0207667_101747793 362
1157 3300025949 Ga0207667_10306196 Ga0207667_103061962 362
1158 3300026041 Ga0207639_10011379 Ga0207639_100113793 362
1159 3300026067 Ga0207678_10142359 Ga0207678_101423592 362
1160 3300026078 Ga0207702_10020473 Ga0207702_100204733 362
1161 3300026142 Ga0207698_10088397 Ga0207698_100883972 362
1162 3300026142 Ga0207698_10314783 Ga0207698_103147832 362
1163 3300028379 Ga0268266_10084100 Ga0268266_100841002 362
1164 3300028577 Ga0265318_10003621 Ga0265318_100036214 362
1165 3300028794 Ga0307515_10021612 Ga0307515_100216127 362
1166 3300031249 Ga0265339_10090250 Ga0265339_100902503 362
1167 3300031711 Ga0265314_10024925 Ga0265314_100249252 362
1168 3300035170 Ga0373943_0053235 Ga0373943_0053235_725_1819 362
1169 3300035692 Ga0373935_0172695 Ga0373935_0172695_349_1443 362
1170 3300035695 Ga0373927_0003688 Ga0373927_0003688_3205_4299 362
1171 3300037068 Ga0373925_0014583 Ga0373925_0014583_1016_2110 362
1172 3300037418 Ga0395900_0156037 Ga0395900_0156037_147_1238 362
1173 3300037471 Ga0395905_0011186 Ga0395905_0011186_4940_6031 362
1174 3300037471 Ga0395905_0109914 Ga0395905_0109914_1354_2460 362
1175 3300038443 Ga0395901_0293080 Ga0395901_0293080_189_1295 362
1176 3300044765 Ga0466970_0001801 Ga0466970_0001801_6402_7490 362
1177 3300046460 Ga0495638_0013036 Ga0495638_0013036_1793_2884 362
1178 3300046460 Ga0495638_0045935 Ga0495638_0045935_999_2090 362
1179 3300046660 Ga0495625_0026895 Ga0495625_0026895_1336_2610 362
1180 3300048906 Ga0496103_0025684 Ga0496103_0025684_524_1612 362
1181 3300048907 Ga0496104_0191297 Ga0496104_0191297_661_1749 362
1182 3300048919 Ga0496116_0026027 Ga0496116_0026027_432_1520 362
1183 3300048920 Ga0496117_0022658 Ga0496117_0022658_2548_3636 362
1184 3300048921 Ga0496118_0025744 Ga0496118_0025744_1398_2486 362
1185 3300048921 Ga0496118_0046403 Ga0496118_0046403_2034_3128 362
1186 3300048922 Ga0496119_0005218 Ga0496119_0005218_4917_6005 362
1187 3300048922 Ga0496119_0047696 Ga0496119_0047696_610_1698 362
1188 3300048923 Ga0496120_0005160 Ga0496120_0005160_8765_9871 362
1189 3300048923 Ga0496120_0045245 Ga0496120_0045245_1042_2130 362
1190 3300048923 Ga0496120_0086068 Ga0496120_0086068_515_1603 362
1191 3300048924 Ga0496121_0006740 Ga0496121_0006740_7886_8974 362
1192 3300048925 Ga0496122_0033322 Ga0496122_0033322_1876_2964 362
1193 3300048926 Ga0496123_0031049 Ga0496123_0031049_933_2021 362
1194 3300048928 Ga0496125_0019854 Ga0496125_0019854_1899_2987 362
1195 3300049569 Ga0501032_0123145 Ga0501032_0123145_557_1672 362
1196 3300049573 Ga0501037_0008644 Ga0501037_0008644_2128_3243 362
1197 3300049574 Ga0501038_0004644 Ga0501038_0004644_11086_12201 362
1198 3300049580 Ga0501046_0007662 Ga0501046_0007662_1090_2205 362
1199 3300049582 Ga0501048_0062808 Ga0501048_0062808_519_1634 362
1200 3300049584 Ga0501068_0007716 Ga0501068_0007716_154_1269 362
1201 3300049586 Ga0501070_0047962 Ga0501070_0047962_2409_3524 362
1202 3300049758 Ga0501241_001691 Ga0501241_001691_776_1867 362
1203 3300049822 Ga0501035_0013801 Ga0501035_0013801_5682_6797 362
1204 3300050491 nmdc:mga00v17_100089_c1 nmdc:mga00v17_100089_c1_593_1684 362
1205 3300050492 nmdc:mga0yw44_40180_c1 nmdc:mga0yw44_40180_c1_1301_2419 362
1206 3300050492 nmdc:mga0yw44_5089_c1 nmdc:mga0yw44_5089_c1_2698_3789 362
1207 3300050494 nmdc:mga06z11_18043_c1 nmdc:mga06z11_18043_c1_710_1801 362
1208 3300050516 nmdc:mga0sz30_5266_c2 nmdc:mga0sz30_5266_c2_268_1386 362
1209 3300053125 Ga0500618_002873 Ga0500618_002873_4641_5729 362
1210 3300053136 Ga0500559_0025097 Ga0500559_0025097_66_1154 362
1211 3300053155 Ga0500620_000555 Ga0500620_000555_918_2009 362
1212 3300053727 Ga0500611_003328 Ga0500611_003328_203_1294 362
1213 3300053730 Ga0500645_033976 Ga0500645_033976_208_1311 362
1214 3300061719 Ga0466962_0085684 Ga0466962_0085684_333_1421 362
1215 iso_pu_bacteria 2508501123 2509114035 362
1216 iso_pu_bacteria 2508501127 2509140748 362
1217 iso_pu_bacteria 2513237090 2513610657 362
1218 iso_pu_bacteria 2597489875 2597810395 362
1219 iso_pu_bacteria 2693429783 2694627972 362
1220 iso_pu_bacteria 2693429784 2694636222 362
1221 iso_pu_bacteria 2765235802 2765466416 362
1222 iso_pu_bacteria 2767802442 2770197059 362
1223 iso_pu_bacteria 2775506902 2776270321 362
1224 iso_pu_bacteria 2775506904 2776282331 362
1225 iso_pu_bacteria 2840764183 2840769066 362
1226 iso_pu_bacteria 2841734538 2841736218 362
1227 iso_pu_bacteria 2847670302 2847673364 362
1228 iso_pu_bacteria 2856314179 2856319167 362
1229 iso_pu_bacteria 2856342000 2856342838 362
1230 iso_pu_bacteria 2856349417 2856354572 362
1231 iso_pu_bacteria 2856364286 2856369971 362
1232 iso_pu_bacteria 2857349434 2857352834 362
1233 iso_pu_bacteria 2869162929 2869165337 362
1234 iso_pu_bacteria 2869285874 2869290778 362
1235 iso_pu_bacteria 2871429161 2871433060 362
1236 iso_pu_bacteria 2871444079 2871447982 362
1237 iso_pu_bacteria 2871474448 2871475656 362
1238 iso_pu_bacteria 2874102143 2874104963 362
1239 iso_pu_bacteria 2874123672 2874124238 362
1240 iso_pu_bacteria 2874146452 2874153779 362
1241 iso_pu_bacteria 2874155637 2874161044 362
1242 iso_pu_bacteria 2876369609 2876376010 362
1243 iso_pu_bacteria 2876377896 2876381377 362
1244 iso_pu_bacteria 2876392853 2876397134 362
1245 iso_pu_bacteria 2876413966 2876419084 362
1246 iso_pu_bacteria 2878035449 2878039556 362
1247 iso_pu_bacteria 2878745973 2878750673 362
1248 iso_pu_bacteria 2878788777 2878788907 362
1249 iso_pu_bacteria 2881147464 2881148224 362
1250 iso_pu_bacteria 2881155292 2881159192 362
1251 iso_pu_bacteria 2881161766 2881164888 362
1252 iso_pu_bacteria 2881853255 2881857619 362
1253 iso_pu_bacteria 2885305155 2885306763 362
1254 iso_pu_bacteria 2885312484 2885314320 362
1255 iso_pu_bacteria 2885326080 2885331247 362
1256 iso_pu_bacteria 2885334103 2885335729 362
1257 iso_pu_bacteria 2885342637 2885344607 362
1258 iso_pu_bacteria 2885350715 2885355663 362
1259 iso_pu_bacteria 2888343758 2888344178 362
1260 iso_pu_bacteria 2888350351 2888353062 362
1261 iso_pu_bacteria 2889010040 2889014808 362
1262 iso_pu_bacteria 2889016732 2889020107 362
1263 iso_pu_bacteria 2894652903 2894655647 362
1264 iso_pu_bacteria 2903492973 2903496280 362
1265 iso_pu_bacteria 2904578770 2904582193 362
1266 iso_pu_bacteria 2904659560 2904663888 362
1267 iso_pu_bacteria 2906308376 2906313598 362
1268 iso_pu_bacteria 2906321335 2906326307 362
1269 iso_pu_bacteria 2906328253 2906334264 362
1270 iso_pu_bacteria 2906414383 2906419239 362
1271 iso_pu_bacteria 2919119836 2919123027 362
1272 iso_pu_bacteria 2922130491 2922133925 362
1273 iso_pu_bacteria 2922158528 2922159729 362
1274 iso_pu_bacteria 2922185730 2922191518 362
1275 iso_pu_bacteria 2924726620 2924728931 362
1276 iso_pu_bacteria 2924754689 2924760767 362
1277 iso_pu_bacteria 2937813078 2937820097 362
1278 iso_pu_bacteria 2937836603 2937840588 362
1279 iso_pu_bacteria 2937891427 2937897227 362
1280 iso_pu_bacteria 2938014810 2938019706 362
1281 iso_pu_bacteria 2958071322 2958077179 362
1282 iso_pu_bacteria 2958100919 2958101958 362
1283 iso_pu_bacteria 2958115193 2958119245 362
1284 iso_pu_bacteria 2958130278 2958135178 362
1285 iso_pu_bacteria 2958172287 2958176811 362
1286 iso_pu_bacteria 2958179912 2958184207 362
1287 iso_pu_bacteria 2961077736 2961082262 362
1288 iso_pu_bacteria 2961114664 2961118972 362
1289 iso_pu_bacteria 2961127735 2961131467 362
1290 iso_pu_bacteria 2965062239 2965062353 362
1291 iso_pu_bacteria 2965119406 2965120679 362
1292 iso_pu_bacteria 2968091066 2968093676 362
1293 iso_pu_bacteria 2968097103 2968098506 362
1294 iso_pu_bacteria 2968110612 2968115027 362
1295 iso_pu_bacteria 2968117919 2968122761 362
1296 iso_pu_bacteria 2968128360 2968133891 362
1297 iso_pu_bacteria 2970524798 2970525888 362
1298 iso_pu_bacteria 2970540015 2970544450 362
1299 iso_pu_bacteria 2977843712 2977850359 362
1300 iso_pu_bacteria 2977858184 2977860391 362
1301 iso_pu_bacteria 2977864932 2977870232 362
1302 iso_pu_bacteria 2977942078 2977943445 362
1303 iso_pu_bacteria 2979710463 2979714762 362
1304 iso_pu_bacteria 2979779861 2979781802 362
1305 iso_pu_bacteria 2987636660 2987641426 362
1306 iso_pu_bacteria 2996341866 2996342427 362
1307 iso_pu_bacteria 3004203850 3004210235 362
1308 iso_pu_bacteria 8004387939 8004393067 362
1309 iso_pu_bacteria 8004395343 8004403089 362
1310 iso_pu_bacteria 8004445564 8004450332 362
1311 iso_pu_bacteria 8004633249 8004640005 362
1312 iso_pu_bacteria 8004640170 8004641555 362
1313 iso_pu_bacteria 8004703790 8004706829 362
1314 iso_pu_bacteria 8004714634 8004719854 362
1315 iso_pu_bacteria 8055617313 8055617702 362

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

135

380

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8t7h-assembly1.cif.gz_B quis-bound intermediate mglu5 0.2698 44 247
7ra3-assembly1.cif.gz_R cryo-em of human gastric inhibitory polypeptide receptor gipr bound to gip 0.2478 32 302
4kjr-assembly1.cif.gz_A crystal structure of selenium substituted ca2+/h+ antiporter proteinyfke 0.2393 56 331
2c32-assembly1.cif.gz_A co-axial association of recombinant eye lens aquaporin-0 observed in loosely packed 3d-crystals 0.2299 52 247
5k7v-assembly1.cif.gz_A computational design of self-assembling cyclic protein homooligomers 0.2293 15 337
ID Description Score Start End Superfamily
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.6381 81 305 3.30.40.10
af_A0A0R4J2X1_81_350_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.5439 81 305 3.30.40.10
af_O62051_23_289_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2985 51 243 1.20.1070.10
af_Q9VIT6_11_216_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.29 50 242 1.20.120.1770
af_O17523_44_292_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2783 50 244 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A526RPN6-F1-model_v4 Fatty acid desaturase 0.9746 59 301 GO:0016020
GO:0042284
GO:0046513
AF-A0A3M4KVT0-F1-model_v4 MocD 0.9717 7 347 GO:0006629
GO:0016020
GO:0016717
AF-A0A1M5X029-F1-model_v4 NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit 0.971 4 347 GO:0006629
GO:0006814
GO:0016020
GO:0016655
GO:0046872
GO:0051537
AF-A0A435Y022-F1-model_v4 Fatty acid desaturase 0.9696 2 308 GO:0006629
GO:0016020
GO:0016717
AF-A0A841NV51-F1-model_v4 deleted 0.9682 6 349

Feature Viewer

pLDDT pTM Quality
85.55 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map