F492898
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1313 | 591 | 2626 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300061719|Ga0466962_0003210|Ga0466962_0003210_1505_1846 |
| Length | 113 |
| Sequence | VIAVLGLVVGVVAGVAGLLVRPEVPAVVEPYLPIAVVAALDAVFGGLRAMLDGIFDDKVFVVSFLSNVVVAALIVFLGDKLGVGAQLSTGVVVVLGIRIFSNAAAIRRHVFRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 134 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 144 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 210 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 214 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 215 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 216 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 219 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 220 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 221 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 222 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 223 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 224 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 225 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 226 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 227 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 228 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 229 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 238 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 239 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 240 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 242 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 243 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 244 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 249 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 251 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 252 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 253 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 256 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 258 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 267 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 268 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 269 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 270 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 271 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 274 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 275 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 276 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 277 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 278 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 279 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 280 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 281 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 282 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 283 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 284 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 285 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 286 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 287 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 288 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 289 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 290 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 291 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 292 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 293 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 294 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 295 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 296 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 297 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 298 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 299 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 300 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 301 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 302 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 303 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 304 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 305 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 306 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 307 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 308 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 312 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 313 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 314 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 315 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 402 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 404 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 405 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 406 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 407 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 408 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 409 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 410 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 411 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 412 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 413 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 414 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 415 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 416 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 417 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 418 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 419 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 420 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 421 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 422 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 423 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 424 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 425 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 426 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 427 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 428 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 435 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 437 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 438 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 439 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 440 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 441 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 450 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 451 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 454 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 458 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 459 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 460 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 461 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 462 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 463 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 464 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 465 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 466 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 476 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 477 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 478 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 479 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 480 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 481 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 482 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 484 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 485 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 486 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 487 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 488 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 489 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 490 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 491 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 492 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 493 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 494 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 495 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 496 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 497 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 498 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 499 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 500 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 501 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 502 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 503 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 504 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 505 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 506 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 507 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 508 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 509 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 510 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 511 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 512 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 513 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 514 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 515 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 516 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 517 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 518 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 519 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 520 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 521 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 522 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 523 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 524 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 525 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 526 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 527 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 528 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 529 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 530 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 531 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 532 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 533 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 534 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 535 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 536 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 537 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 538 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 539 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 540 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 541 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 542 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 543 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 544 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 545 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 546 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 547 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 548 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 549 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 550 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 551 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 552 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 553 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 554 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 555 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 556 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 557 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 558 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 559 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 560 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 561 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 562 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 563 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 564 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 565 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 566 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 567 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 568 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 569 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 570 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 571 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 572 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 573 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 574 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 575 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 576 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 577 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 578 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 579 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 580 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 581 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 582 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 583 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 584 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 585 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 586 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 587 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 588 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 589 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 590 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 591 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.71 |
| Metatranscriptomes | 1.29 |
| Isolates | 8 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.9 |
| Nodule | 0.3 |
| Rhizoplane | 7.84 |
| Rhizosphere | 81.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466962_0003210 | 3300061719 | Bacteria | 7767 |
| 2 | LJQas_1022420 | 3300000549 | Bacteria | 733 |
| 3 | JGI24737J22298_10241717 | 3300001990 | Bacteria | 533 |
| 4 | JGI24738J21930_10047848 | 3300002075 | Bacteria | 870 |
| 5 | JGI24744J21845_10012255 | 3300002077 | Bacteria | 1743 |
| 6 | JGI25406J46586_10004005 | 3300003203 | Bacteria | 6891 |
| 7 | rootH2_10017275 | 3300003320 | Bacteria | 4833 |
| 8 | rootH1_10088192 | 3300003323 | Bacteria | 2175 |
| 9 | JGI25407J50210_10065969 | 3300003373 | Bacteria | 906 |
| 10 | Ga0070658_10416434 | 3300005327 | Bacteria | 1155 |
| 11 | Ga0070658_10951039 | 3300005327 | Bacteria | 747 |
| 12 | Ga0070658_11399344 | 3300005327 | Bacteria | 607 |
| 13 | Ga0070676_11176609 | 3300005328 | Bacteria | 582 |
| 14 | Ga0070676_11240252 | 3300005328 | Bacteria | 568 |
| 15 | Ga0070683_100057355 | 3300005329 | Bacteria | 3618 |
| 16 | Ga0070683_100079089 | 3300005329 | Bacteria | 3077 |
| 17 | Ga0070683_100099266 | 3300005329 | Bacteria | 2740 |
| 18 | Ga0070683_100692307 | 3300005329 | Bacteria | 976 |
| 19 | Ga0070683_101004593 | 3300005329 | Bacteria | 801 |
| 20 | Ga0070683_101371616 | 3300005329 | Bacteria | 679 |
| 21 | Ga0070670_101796132 | 3300005331 | Bacteria | 564 |
| 22 | Ga0068869_100237561 | 3300005334 | Bacteria | 1451 |
| 23 | Ga0070666_10003317 | 3300005335 | Bacteria | 9754 |
| 24 | Ga0070666_10064975 | 3300005335 | Bacteria | 2475 |
| 25 | Ga0070680_100363401 | 3300005336 | Bacteria | 1231 |
| 26 | Ga0070680_100375671 | 3300005336 | Bacteria | 1210 |
| 27 | Ga0070680_100466470 | 3300005336 | Bacteria | 1079 |
| 28 | Ga0070680_100624983 | 3300005336 | Bacteria | 925 |
| 29 | Ga0070680_101019198 | 3300005336 | Bacteria | 715 |
| 30 | Ga0070680_101137063 | 3300005336 | Bacteria | 675 |
| 31 | Ga0070682_100031446 | 3300005337 | Bacteria | 3210 |
| 32 | Ga0070682_100347102 | 3300005337 | Bacteria | 1105 |
| 33 | Ga0070682_101123379 | 3300005337 | Bacteria | 659 |
| 34 | Ga0068868_100488411 | 3300005338 | Bacteria | 1077 |
| 35 | Ga0070660_100087316 | 3300005339 | Bacteria | 2455 |
| 36 | Ga0070660_100322337 | 3300005339 | Bacteria | 1269 |
| 37 | Ga0070660_100583841 | 3300005339 | Bacteria | 933 |
| 38 | Ga0070660_101506886 | 3300005339 | Bacteria | 572 |
| 39 | Ga0070689_100098074 | 3300005340 | Bacteria | 2318 |
| 40 | Ga0070689_100320167 | 3300005340 | Bacteria | 1295 |
| 41 | Ga0070691_10178261 | 3300005341 | Bacteria | 1105 |
| 42 | Ga0070687_100202557 | 3300005343 | Bacteria | 1203 |
| 43 | Ga0070661_100103154 | 3300005344 | Bacteria | 2124 |
| 44 | Ga0070661_100241199 | 3300005344 | Bacteria | 1392 |
| 45 | Ga0070692_10027073 | 3300005345 | Bacteria | 2839 |
| 46 | Ga0070692_10491384 | 3300005345 | Bacteria | 793 |
| 47 | Ga0070668_100002900 | 3300005347 | Bacteria | 12663 |
| 48 | Ga0070668_100369390 | 3300005347 | Bacteria | 1218 |
| 49 | Ga0070669_100030781 | 3300005353 | Bacteria | 3874 |
| 50 | Ga0070669_101798354 | 3300005353 | Bacteria | 535 |
| 51 | Ga0070675_101509305 | 3300005354 | Bacteria | 620 |
| 52 | Ga0070671_100021033 | 3300005355 | Bacteria | 5325 |
| 53 | Ga0070674_100136314 | 3300005356 | Bacteria | 1836 |
| 54 | Ga0070674_100313986 | 3300005356 | Bacteria | 1254 |
| 55 | Ga0070674_100352446 | 3300005356 | Bacteria | 1189 |
| 56 | Ga0070674_100767046 | 3300005356 | Bacteria | 830 |
| 57 | Ga0070673_100005872 | 3300005364 | Bacteria | 7916 |
| 58 | Ga0070688_100721125 | 3300005365 | Bacteria | 774 |
| 59 | Ga0070659_100015723 | 3300005366 | Bacteria | 5670 |
| 60 | Ga0070659_100333228 | 3300005366 | Bacteria | 1270 |
| 61 | Ga0070659_100386821 | 3300005366 | Bacteria | 1179 |
| 62 | Ga0070659_101817722 | 3300005366 | Bacteria | 546 |
| 63 | Ga0070667_100006026 | 3300005367 | Bacteria | 10075 |
| 64 | Ga0070667_100021661 | 3300005367 | Bacteria | 5334 |
| 65 | Ga0070703_10015033 | 3300005406 | Bacteria | 2212 |
| 66 | Ga0070714_100498172 | 3300005435 | Bacteria | 1161 |
| 67 | Ga0070714_101104250 | 3300005435 | Bacteria | 773 |
| 68 | Ga0070713_100063224 | 3300005436 | Bacteria | 3102 |
| 69 | Ga0070710_10318990 | 3300005437 | Bacteria | 1019 |
| 70 | Ga0070701_10004746 | 3300005438 | Bacteria | 5548 |
| 71 | Ga0070701_10047674 | 3300005438 | Bacteria | 2207 |
| 72 | Ga0070711_100007302 | 3300005439 | Bacteria | 6720 |
| 73 | Ga0070705_100009475 | 3300005440 | Bacteria | 4843 |
| 74 | Ga0070705_101231193 | 3300005440 | Bacteria | 618 |
| 75 | Ga0070700_100000406 | 3300005441 | Bacteria | 22003 |
| 76 | Ga0070700_100779527 | 3300005441 | Bacteria | 768 |
| 77 | Ga0070694_100993214 | 3300005444 | Bacteria | 696 |
| 78 | Ga0070663_100033790 | 3300005455 | Bacteria | 3536 |
| 79 | Ga0070663_100260717 | 3300005455 | Bacteria | 1375 |
| 80 | Ga0070663_100522872 | 3300005455 | Bacteria | 988 |
| 81 | Ga0070678_100025304 | 3300005456 | Bacteria | 3990 |
| 82 | Ga0070662_100033899 | 3300005457 | Bacteria | 3598 |
| 83 | Ga0070681_10005943 | 3300005458 | Bacteria | 11814 |
| 84 | Ga0070681_10136451 | 3300005458 | Bacteria | 2384 |
| 85 | Ga0070681_10466558 | 3300005458 | Bacteria | 1175 |
| 86 | Ga0068867_100087869 | 3300005459 | Bacteria | 2354 |
| 87 | Ga0070685_10903264 | 3300005466 | Bacteria | 657 |
| 88 | Ga0070698_101341055 | 3300005471 | Bacteria | 666 |
| 89 | Ga0070679_100003650 | 3300005530 | Bacteria | 14087 |
| 90 | Ga0070679_100638187 | 3300005530 | Bacteria | 1008 |
| 91 | Ga0070684_100144067 | 3300005535 | Bacteria | 2156 |
| 92 | Ga0070684_100177198 | 3300005535 | Bacteria | 1938 |
| 93 | Ga0070684_101048408 | 3300005535 | Bacteria | 766 |
| 94 | Ga0070684_102035952 | 3300005535 | Bacteria | 542 |
| 95 | Ga0070697_101314041 | 3300005536 | Bacteria | 645 |
| 96 | Ga0068853_100135581 | 3300005539 | Bacteria | 2206 |
| 97 | Ga0068853_100138197 | 3300005539 | Bacteria | 2186 |
| 98 | Ga0068853_100661340 | 3300005539 | Bacteria | 995 |
| 99 | Ga0070672_100115779 | 3300005543 | Bacteria | 2189 |
| 100 | Ga0070672_100239782 | 3300005543 | Bacteria | 1525 |
| 101 | Ga0070672_100518096 | 3300005543 | Bacteria | 1033 |
| 102 | Ga0070672_102006595 | 3300005543 | Bacteria | 521 |
| 103 | Ga0070686_100492382 | 3300005544 | Bacteria | 950 |
| 104 | Ga0070695_100446010 | 3300005545 | Bacteria | 990 |
| 105 | Ga0070696_100311025 | 3300005546 | Bacteria | 1209 |
| 106 | Ga0070693_100118389 | 3300005547 | Bacteria | 1639 |
| 107 | Ga0070693_100369792 | 3300005547 | Bacteria | 986 |
| 108 | Ga0070665_100003227 | 3300005548 | Bacteria | 17526 |
| 109 | Ga0070665_100055978 | 3300005548 | Bacteria | 3955 |
| 110 | Ga0070665_100620528 | 3300005548 | Bacteria | 1094 |
| 111 | Ga0070665_100785740 | 3300005548 | Bacteria | 965 |
| 112 | Ga0070704_100037730 | 3300005549 | Bacteria | 3304 |
| 113 | Ga0068855_100021450 | 3300005563 | Bacteria | 7745 |
| 114 | Ga0068855_100057120 | 3300005563 | Bacteria | 4576 |
| 115 | Ga0068855_100059143 | 3300005563 | Bacteria | 4485 |
| 116 | Ga0068855_100424958 | 3300005563 | Bacteria | 1453 |
| 117 | Ga0068855_100835986 | 3300005563 | Bacteria | 976 |
| 118 | Ga0070664_100178256 | 3300005564 | Bacteria | 1888 |
| 119 | Ga0070664_100999770 | 3300005564 | Bacteria | 786 |
| 120 | Ga0068857_100452244 | 3300005577 | Bacteria | 1201 |
| 121 | Ga0068857_101249726 | 3300005577 | Bacteria | 720 |
| 122 | Ga0068854_100306816 | 3300005578 | Bacteria | 1286 |
| 123 | Ga0068854_101810675 | 3300005578 | Bacteria | 560 |
| 124 | Ga0068856_100088421 | 3300005614 | Bacteria | 3080 |
| 125 | Ga0068856_100147033 | 3300005614 | Bacteria | 2364 |
| 126 | Ga0068856_100174480 | 3300005614 | Bacteria | 2162 |
| 127 | Ga0068856_100651890 | 3300005614 | Bacteria | 1073 |
| 128 | Ga0068856_101404496 | 3300005614 | Bacteria | 712 |
| 129 | Ga0070702_100033494 | 3300005615 | Bacteria | 2826 |
| 130 | Ga0070702_100253317 | 3300005615 | Bacteria | 1194 |
| 131 | Ga0068852_100020158 | 3300005616 | Bacteria | 5297 |
| 132 | Ga0068852_100111044 | 3300005616 | Bacteria | 2492 |
| 133 | Ga0068852_100674790 | 3300005616 | Bacteria | 1042 |
| 134 | Ga0068859_100002361 | 3300005617 | Bacteria | 19217 |
| 135 | Ga0068859_100221522 | 3300005617 | Bacteria | 1980 |
| 136 | Ga0068859_100809523 | 3300005617 | Bacteria | 1024 |
| 137 | Ga0068864_100041671 | 3300005618 | Bacteria | 3927 |
| 138 | Ga0068866_10203000 | 3300005718 | Bacteria | 1186 |
| 139 | Ga0068861_100048872 | 3300005719 | Bacteria | 3200 |
| 140 | Ga0068861_100126857 | 3300005719 | Bacteria | 2066 |
| 141 | Ga0068861_101266966 | 3300005719 | Bacteria | 716 |
| 142 | Ga0068851_10058629 | 3300005834 | Bacteria | 1968 |
| 143 | Ga0068851_10619920 | 3300005834 | Bacteria | 660 |
| 144 | Ga0068870_10001067 | 3300005840 | Bacteria | 10886 |
| 145 | Ga0068870_10083920 | 3300005840 | Bacteria | 1767 |
| 146 | Ga0068863_100004882 | 3300005841 | Bacteria | 13214 |
| 147 | Ga0068863_100073740 | 3300005841 | Bacteria | 3229 |
| 148 | Ga0068858_100013689 | 3300005842 | Bacteria | 7655 |
| 149 | Ga0068858_100039448 | 3300005842 | Bacteria | 4379 |
| 150 | Ga0068858_102578238 | 3300005842 | Bacteria | 502 |
| 151 | Ga0068860_100000035 | 3300005843 | Bacteria | 238993 |
| 152 | Ga0068860_100042424 | 3300005843 | Bacteria | 4344 |
| 153 | Ga0068860_101758013 | 3300005843 | Bacteria | 642 |
| 154 | Ga0068862_100067953 | 3300005844 | Bacteria | 3074 |
| 155 | Ga0068862_101820475 | 3300005844 | Bacteria | 618 |
| 156 | Ga0081455_10002276 | 3300005937 | Bacteria | 22904 |
| 157 | Ga0081455_10025771 | 3300005937 | Bacteria | 5422 |
| 158 | Ga0081455_10041731 | 3300005937 | Bacteria | 4031 |
| 159 | Ga0081455_10583797 | 3300005937 | Bacteria | 732 |
| 160 | Ga0081538_10000036 | 3300005981 | Bacteria | 119944 |
| 161 | Ga0081538_10056572 | 3300005981 | Bacteria | 2296 |
| 162 | Ga0081538_10097228 | 3300005981 | Bacteria | 1497 |
| 163 | Ga0081540_1010407 | 3300005983 | Bacteria | 6304 |
| 164 | Ga0081539_10000643 | 3300005985 | Bacteria | 70438 |
| 165 | Ga0070717_10034948 | 3300006028 | Bacteria | 4065 |
| 166 | Ga0070717_11384185 | 3300006028 | Bacteria | 639 |
| 167 | Ga0075365_10024472 | 3300006038 | Bacteria | 3810 |
| 168 | Ga0075365_10060650 | 3300006038 | Bacteria | 2524 |
| 169 | Ga0075365_10431348 | 3300006038 | Bacteria | 931 |
| 170 | Ga0075365_10989443 | 3300006038 | Bacteria | 593 |
| 171 | Ga0075368_10205485 | 3300006042 | Bacteria | 834 |
| 172 | Ga0075363_100052481 | 3300006048 | Bacteria | 2176 |
| 173 | Ga0075363_100297682 | 3300006048 | Bacteria | 936 |
| 174 | Ga0075432_10063772 | 3300006058 | Bacteria | 1316 |
| 175 | Ga0070715_10817501 | 3300006163 | Bacteria | 567 |
| 176 | Ga0070712_100052549 | 3300006175 | Bacteria | 2842 |
| 177 | Ga0070712_100945669 | 3300006175 | Bacteria | 744 |
| 178 | Ga0075362_10726223 | 3300006177 | Bacteria | 519 |
| 179 | Ga0075367_10007402 | 3300006178 | Bacteria | 5617 |
| 180 | Ga0097621_100363228 | 3300006237 | Bacteria | 1290 |
| 181 | Ga0097621_100371584 | 3300006237 | Bacteria | 1276 |
| 182 | Ga0068871_100009798 | 3300006358 | Bacteria | 6951 |
| 183 | Ga0068871_100446913 | 3300006358 | Bacteria | 1158 |
| 184 | Ga0075428_100001304 | 3300006844 | Bacteria | 26458 |
| 185 | Ga0075428_100089562 | 3300006844 | Bacteria | 3356 |
| 186 | Ga0075428_100274270 | 3300006844 | Bacteria | 1815 |
| 187 | Ga0075430_100006263 | 3300006846 | Bacteria | 10034 |
| 188 | Ga0075430_100026196 | 3300006846 | Bacteria | 4962 |
| 189 | Ga0075431_100002908 | 3300006847 | Bacteria | 16573 |
| 190 | Ga0075431_100008250 | 3300006847 | Bacteria | 10415 |
| 191 | Ga0075431_100012439 | 3300006847 | Bacteria | 8590 |
| 192 | Ga0075433_10006767 | 3300006852 | Bacteria | 9086 |
| 193 | Ga0075433_10291184 | 3300006852 | Bacteria | 1446 |
| 194 | Ga0075434_100051928 | 3300006871 | Bacteria | 4073 |
| 195 | Ga0075434_100511789 | 3300006871 | Bacteria | 1221 |
| 196 | Ga0075429_100001324 | 3300006880 | Bacteria | 20208 |
| 197 | Ga0075429_100005562 | 3300006880 | Bacteria | 10857 |
| 198 | Ga0068865_100022810 | 3300006881 | Bacteria | 4090 |
| 199 | Ga0068865_100039489 | 3300006881 | Bacteria | 3201 |
| 200 | Ga0068865_101485019 | 3300006881 | Bacteria | 607 |
| 201 | Ga0068865_101684194 | 3300006881 | Bacteria | 571 |
| 202 | Ga0075436_100030843 | 3300006914 | Bacteria | 3689 |
| 203 | Ga0097620_100002361 | 3300006931 | Bacteria | 19217 |
| 204 | Ga0097620_100221504 | 3300006931 | Bacteria | 1980 |
| 205 | Ga0097620_100809550 | 3300006931 | Bacteria | 1024 |
| 206 | Ga0099826_10058874 | 3300006948 | Bacteria | 2516 |
| 207 | Ga0075435_100250842 | 3300007076 | Bacteria | 1506 |
| 208 | Ga0105251_10088971 | 3300009011 | Bacteria | 1420 |
| 209 | Ga0105240_10012487 | 3300009093 | Bacteria | 11721 |
| 210 | Ga0105240_10066086 | 3300009093 | Bacteria | 4488 |
| 211 | Ga0105240_10138708 | 3300009093 | Bacteria | 2910 |
| 212 | Ga0111539_10038306 | 3300009094 | Bacteria | 5783 |
| 213 | Ga0111539_10564347 | 3300009094 | Bacteria | 1326 |
| 214 | Ga0111539_11990147 | 3300009094 | Bacteria | 674 |
| 215 | Ga0105245_10034424 | 3300009098 | Bacteria | 4493 |
| 216 | Ga0105245_10066039 | 3300009098 | Bacteria | 3273 |
| 217 | Ga0105245_10907041 | 3300009098 | Bacteria | 923 |
| 218 | Ga0105245_11219824 | 3300009098 | Bacteria | 800 |
| 219 | Ga0105247_10003264 | 3300009101 | Bacteria | 10634 |
| 220 | Ga0105247_10013085 | 3300009101 | Bacteria | 4976 |
| 221 | Ga0105247_10110891 | 3300009101 | Bacteria | 1766 |
| 222 | Ga0114129_10026601 | 3300009147 | Bacteria | 8194 |
| 223 | Ga0114129_10080508 | 3300009147 | Bacteria | 4527 |
| 224 | Ga0105243_10017305 | 3300009148 | Bacteria | 5450 |
| 225 | Ga0105243_10029336 | 3300009148 | Bacteria | 4229 |
| 226 | Ga0105243_10421646 | 3300009148 | Bacteria | 1245 |
| 227 | Ga0105243_11390273 | 3300009148 | Bacteria | 722 |
| 228 | Ga0105241_10016040 | 3300009174 | Bacteria | 5491 |
| 229 | Ga0105241_10092112 | 3300009174 | Bacteria | 2393 |
| 230 | Ga0105241_10313472 | 3300009174 | Bacteria | 1350 |
| 231 | Ga0105241_10818451 | 3300009174 | Bacteria | 859 |
| 232 | Ga0105242_10090413 | 3300009176 | Bacteria | 2575 |
| 233 | Ga0105242_10411505 | 3300009176 | Bacteria | 1265 |
| 234 | Ga0105242_10534754 | 3300009176 | Bacteria | 1121 |
| 235 | Ga0105242_10704143 | 3300009176 | Bacteria | 988 |
| 236 | Ga0105248_10028128 | 3300009177 | Bacteria | 6262 |
| 237 | Ga0105248_10094722 | 3300009177 | Bacteria | 3362 |
| 238 | Ga0105248_11657239 | 3300009177 | Bacteria | 725 |
| 239 | Ga0105237_10091480 | 3300009545 | Bacteria | 3032 |
| 240 | Ga0105237_10261480 | 3300009545 | Bacteria | 1733 |
| 241 | Ga0105237_10935616 | 3300009545 | Bacteria | 874 |
| 242 | Ga0105237_11198280 | 3300009545 | Bacteria | 766 |
| 243 | Ga0105237_11547122 | 3300009545 | Bacteria | 670 |
| 244 | Ga0105237_12773299 | 3300009545 | Bacteria | 501 |
| 245 | Ga0105238_10130917 | 3300009551 | Bacteria | 2487 |
| 246 | Ga0105238_10413460 | 3300009551 | Bacteria | 1343 |
| 247 | Ga0105238_10433003 | 3300009551 | Bacteria | 1311 |
| 248 | Ga0105238_12241857 | 3300009551 | Bacteria | 581 |
| 249 | Ga0105249_10135602 | 3300009553 | Bacteria | 2355 |
| 250 | Ga0105249_10688100 | 3300009553 | Bacteria | 1082 |
| 251 | Ga0105249_11302646 | 3300009553 | Bacteria | 798 |
| 252 | Ga0105249_12470749 | 3300009553 | Bacteria | 592 |
| 253 | Ga0105239_10362082 | 3300010375 | Bacteria | 1638 |
| 254 | Ga0105239_10393835 | 3300010375 | Bacteria | 1567 |
| 255 | Ga0105239_10589429 | 3300010375 | Bacteria | 1268 |
| 256 | Ga0105239_10803279 | 3300010375 | Bacteria | 1078 |
| 257 | Ga0105239_10871389 | 3300010375 | Bacteria | 1033 |
| 258 | Ga0105246_10003223 | 3300011119 | Bacteria | 9905 |
| 259 | Ga0105246_10383410 | 3300011119 | Bacteria | 1162 |
| 260 | Ga0105246_10772831 | 3300011119 | Bacteria | 849 |
| 261 | Ga0157373_10168923 | 3300013100 | Bacteria | 1539 |
| 262 | Ga0157371_10365025 | 3300013102 | Bacteria | 1053 |
| 263 | Ga0157371_10604129 | 3300013102 | Bacteria | 816 |
| 264 | Ga0157370_10045502 | 3300013104 | Bacteria | 4210 |
| 265 | Ga0157370_10194714 | 3300013104 | Bacteria | 1881 |
| 266 | Ga0157370_10351827 | 3300013104 | Bacteria | 1358 |
| 267 | Ga0157370_10717088 | 3300013104 | Bacteria | 912 |
| 268 | Ga0157370_11449549 | 3300013104 | Bacteria | 617 |
| 269 | Ga0157370_11781084 | 3300013104 | Bacteria | 553 |
| 270 | Ga0157369_10018735 | 3300013105 | Bacteria | 7760 |
| 271 | Ga0157369_10040889 | 3300013105 | Bacteria | 5060 |
| 272 | Ga0157369_10087776 | 3300013105 | Bacteria | 3321 |
| 273 | Ga0157369_10137846 | 3300013105 | Bacteria | 2582 |
| 274 | Ga0157369_10174224 | 3300013105 | Bacteria | 2265 |
| 275 | Ga0157369_10220041 | 3300013105 | Bacteria | 1988 |
| 276 | Ga0157369_11059610 | 3300013105 | Bacteria | 829 |
| 277 | Ga0157369_11539011 | 3300013105 | Bacteria | 676 |
| 278 | Ga0157374_10567314 | 3300013296 | Bacteria | 1143 |
| 279 | Ga0157374_11311054 | 3300013296 | Bacteria | 746 |
| 280 | Ga0157374_11977993 | 3300013296 | Bacteria | 609 |
| 281 | Ga0157374_12555383 | 3300013296 | Bacteria | 538 |
| 282 | Ga0157378_10271920 | 3300013297 | Bacteria | 1630 |
| 283 | Ga0163162_10014032 | 3300013306 | Bacteria | 7830 |
| 284 | Ga0163162_11056109 | 3300013306 | Bacteria | 919 |
| 285 | Ga0163162_11310563 | 3300013306 | Bacteria | 823 |
| 286 | Ga0157372_10045237 | 3300013307 | Bacteria | 4882 |
| 287 | Ga0157372_10055403 | 3300013307 | Bacteria | 4428 |
| 288 | Ga0157372_10060103 | 3300013307 | Bacteria | 4252 |
| 289 | Ga0157372_10111409 | 3300013307 | Bacteria | 3135 |
| 290 | Ga0157372_10202728 | 3300013307 | Bacteria | 2298 |
| 291 | Ga0157372_10240579 | 3300013307 | Bacteria | 2100 |
| 292 | Ga0157372_11867886 | 3300013307 | Bacteria | 691 |
| 293 | Ga0157375_10323885 | 3300013308 | Bacteria | 1706 |
| 294 | Ga0157375_10418780 | 3300013308 | Bacteria | 1505 |
| 295 | Ga0157375_10628424 | 3300013308 | Bacteria | 1231 |
| 296 | Ga0157375_11907443 | 3300013308 | Bacteria | 705 |
| 297 | Ga0163163_10068051 | 3300014325 | Bacteria | 3543 |
| 298 | Ga0163163_10647185 | 3300014325 | Bacteria | 1120 |
| 299 | Ga0163163_12596318 | 3300014325 | Bacteria | 564 |
| 300 | Ga0157380_10002480 | 3300014326 | Bacteria | 12441 |
| 301 | Ga0157380_10374551 | 3300014326 | Bacteria | 1341 |
| 302 | Ga0157380_11026518 | 3300014326 | Bacteria | 860 |
| 303 | Ga0182008_10003052 | 3300014497 | Bacteria | 10279 |
| 304 | Ga0182008_10093452 | 3300014497 | Bacteria | 1484 |
| 305 | Ga0182008_10153283 | 3300014497 | Bacteria | 1156 |
| 306 | Ga0157379_10023014 | 3300014968 | Bacteria | 5523 |
| 307 | Ga0157379_10276379 | 3300014968 | Bacteria | 1528 |
| 308 | Ga0157379_10932075 | 3300014968 | Bacteria | 825 |
| 309 | Ga0157379_11657985 | 3300014968 | Bacteria | 625 |
| 310 | Ga0157376_10113096 | 3300014969 | Bacteria | 2393 |
| 311 | Ga0157376_10413661 | 3300014969 | Bacteria | 1307 |
| 312 | Ga0157376_11070113 | 3300014969 | Bacteria | 831 |
| 313 | Ga0182006_1018487 | 3300015261 | Bacteria | 2944 |
| 314 | Ga0182007_10002246 | 3300015262 | Bacteria | 9746 |
| 315 | Ga0182005_1036209 | 3300015265 | Bacteria | 1342 |
| 316 | Ga0183367_1003 | 3300015688 | Bacteria | 814276 |
| 317 | Ga0163161_10023316 | 3300017792 | Bacteria | 4366 |
| 318 | Ga0163161_10268867 | 3300017792 | Bacteria | 1333 |
| 319 | Ga0163161_10745113 | 3300017792 | Bacteria | 819 |
| 320 | Ga0163161_11008509 | 3300017792 | Bacteria | 711 |
| 321 | Ga0163161_11566421 | 3300017792 | Bacteria | 580 |
| 322 | Ga0197907_10033713 | 3300020069 | Bacteria | 675 |
| 323 | Ga0206356_10468274 | 3300020070 | Bacteria | 1190 |
| 324 | Ga0206356_11002279 | 3300020070 | Bacteria | 889 |
| 325 | Ga0206356_11595527 | 3300020070 | Bacteria | 809 |
| 326 | Ga0206352_10982403 | 3300020078 | Bacteria | 716 |
| 327 | Ga0206352_11358692 | 3300020078 | Bacteria | 640 |
| 328 | Ga0206354_11337459 | 3300020081 | Bacteria | 1608 |
| 329 | Ga0206354_11619843 | 3300020081 | Bacteria | 2555 |
| 330 | Ga0206353_10029995 | 3300020082 | Bacteria | 774 |
| 331 | Ga0206353_10259526 | 3300020082 | Bacteria | 2005 |
| 332 | Ga0206353_10358891 | 3300020082 | Bacteria | 1278 |
| 333 | Ga0206353_10968491 | 3300020082 | Bacteria | 2139 |
| 334 | Ga0206353_11192181 | 3300020082 | Bacteria | 845 |
| 335 | Ga0206353_11246040 | 3300020082 | Bacteria | 1286 |
| 336 | Ga0206353_11341543 | 3300020082 | Bacteria | 1131 |
| 337 | Ga0213875_10122117 | 3300021388 | Bacteria | 1217 |
| 338 | Ga0213875_10399456 | 3300021388 | Bacteria | 655 |
| 339 | Ga0224712_10526188 | 3300022467 | Bacteria | 573 |
| 340 | Ga0209758_1011831 | 3300025297 | Bacteria | 4983 |
| 341 | Ga0207656_10203249 | 3300025321 | Bacteria | 957 |
| 342 | Ga0207655_1230742 | 3300025728 | Bacteria | 534 |
| 343 | Ga0207653_10013683 | 3300025885 | Bacteria | 2541 |
| 344 | Ga0207682_10089490 | 3300025893 | Bacteria | 1332 |
| 345 | Ga0207692_10071362 | 3300025898 | Bacteria | 1831 |
| 346 | Ga0207642_10020485 | 3300025899 | Bacteria | 2583 |
| 347 | Ga0207642_10207100 | 3300025899 | Bacteria | 1087 |
| 348 | Ga0207710_10018543 | 3300025900 | Bacteria | 2961 |
| 349 | Ga0207688_10005436 | 3300025901 | Bacteria | 6925 |
| 350 | Ga0207688_10022147 | 3300025901 | Bacteria | 3476 |
| 351 | Ga0207680_10007745 | 3300025903 | Bacteria | 5248 |
| 352 | Ga0207680_10013189 | 3300025903 | Bacteria | 4236 |
| 353 | Ga0207647_10075726 | 3300025904 | Bacteria | 2025 |
| 354 | Ga0207685_10154324 | 3300025905 | Bacteria | 1042 |
| 355 | Ga0207685_10617342 | 3300025905 | Bacteria | 583 |
| 356 | Ga0207699_10521729 | 3300025906 | Bacteria | 859 |
| 357 | Ga0207643_10001879 | 3300025908 | Bacteria | 11602 |
| 358 | Ga0207643_10071311 | 3300025908 | Bacteria | 2000 |
| 359 | Ga0207705_10008652 | 3300025909 | Bacteria | 7418 |
| 360 | Ga0207705_10126804 | 3300025909 | Bacteria | 1898 |
| 361 | Ga0207705_10212246 | 3300025909 | Bacteria | 1468 |
| 362 | Ga0207705_10337834 | 3300025909 | Bacteria | 1159 |
| 363 | Ga0207705_10417605 | 3300025909 | Bacteria | 1038 |
| 364 | Ga0207654_10015189 | 3300025911 | Bacteria | 3991 |
| 365 | Ga0207654_10328826 | 3300025911 | Bacteria | 1047 |
| 366 | Ga0207654_10331453 | 3300025911 | Bacteria | 1043 |
| 367 | Ga0207707_10106548 | 3300025912 | Bacteria | 2450 |
| 368 | Ga0207707_10276080 | 3300025912 | Bacteria | 1456 |
| 369 | Ga0207695_10048226 | 3300025913 | Bacteria | 4500 |
| 370 | Ga0207671_10513993 | 3300025914 | Bacteria | 955 |
| 371 | Ga0207671_10637901 | 3300025914 | Bacteria | 848 |
| 372 | Ga0207671_11121285 | 3300025914 | Bacteria | 617 |
| 373 | Ga0207693_10000761 | 3300025915 | Bacteria | 28954 |
| 374 | Ga0207693_10565252 | 3300025915 | Bacteria | 886 |
| 375 | Ga0207663_10359681 | 3300025916 | Bacteria | 1104 |
| 376 | Ga0207660_10189323 | 3300025917 | Bacteria | 1601 |
| 377 | Ga0207660_10596487 | 3300025917 | Bacteria | 899 |
| 378 | Ga0207660_10777114 | 3300025917 | Bacteria | 781 |
| 379 | Ga0207660_10974121 | 3300025917 | Bacteria | 692 |
| 380 | Ga0207662_10019622 | 3300025918 | Bacteria | 3850 |
| 381 | Ga0207662_10947410 | 3300025918 | Bacteria | 610 |
| 382 | Ga0207657_10030578 | 3300025919 | Bacteria | 4886 |
| 383 | Ga0207657_10072328 | 3300025919 | Bacteria | 2917 |
| 384 | Ga0207657_10148879 | 3300025919 | Bacteria | 1908 |
| 385 | Ga0207657_10265778 | 3300025919 | Bacteria | 1364 |
| 386 | Ga0207657_10352389 | 3300025919 | Bacteria | 1161 |
| 387 | Ga0207649_10213247 | 3300025920 | Bacteria | 1371 |
| 388 | Ga0207652_10014337 | 3300025921 | Bacteria | 6419 |
| 389 | Ga0207652_10191667 | 3300025921 | Bacteria | 1839 |
| 390 | Ga0207652_11691103 | 3300025921 | Bacteria | 537 |
| 391 | Ga0207681_10461190 | 3300025923 | Bacteria | 1035 |
| 392 | Ga0207650_10473129 | 3300025925 | Bacteria | 1045 |
| 393 | Ga0207659_10298618 | 3300025926 | Bacteria | 1322 |
| 394 | Ga0207659_11030345 | 3300025926 | Bacteria | 708 |
| 395 | Ga0207687_10057785 | 3300025927 | Bacteria | 2727 |
| 396 | Ga0207687_10435958 | 3300025927 | Bacteria | 1084 |
| 397 | Ga0207687_10889889 | 3300025927 | Bacteria | 762 |
| 398 | Ga0207687_10973556 | 3300025927 | Bacteria | 727 |
| 399 | Ga0207664_10004124 | 3300025929 | Bacteria | 9806 |
| 400 | Ga0207664_10275579 | 3300025929 | Bacteria | 1475 |
| 401 | Ga0207664_11673943 | 3300025929 | Bacteria | 558 |
| 402 | Ga0207644_10054720 | 3300025931 | Bacteria | 2875 |
| 403 | Ga0207690_10041933 | 3300025932 | Bacteria | 3002 |
| 404 | Ga0207690_10054124 | 3300025932 | Bacteria | 2697 |
| 405 | Ga0207706_10006255 | 3300025933 | Bacteria | 11067 |
| 406 | Ga0207686_10040933 | 3300025934 | Bacteria | 2821 |
| 407 | Ga0207686_10050863 | 3300025934 | Bacteria | 2579 |
| 408 | Ga0207709_10466789 | 3300025935 | Bacteria | 979 |
| 409 | Ga0207709_10593398 | 3300025935 | Bacteria | 876 |
| 410 | Ga0207709_10825308 | 3300025935 | Bacteria | 750 |
| 411 | Ga0207670_10253513 | 3300025936 | Bacteria | 1361 |
| 412 | Ga0207670_10357041 | 3300025936 | Bacteria | 1159 |
| 413 | Ga0207669_10089674 | 3300025937 | Bacteria | 1997 |
| 414 | Ga0207704_10041136 | 3300025938 | Bacteria | 2707 |
| 415 | Ga0207704_10107073 | 3300025938 | Bacteria | 1880 |
| 416 | Ga0207704_11595553 | 3300025938 | Bacteria | 560 |
| 417 | Ga0207665_10000422 | 3300025939 | Bacteria | 29175 |
| 418 | Ga0207691_10027476 | 3300025940 | Bacteria | 5334 |
| 419 | Ga0207691_10142229 | 3300025940 | Bacteria | 2114 |
| 420 | Ga0207691_10322125 | 3300025940 | Bacteria | 1325 |
| 421 | Ga0207691_10787429 | 3300025940 | Bacteria | 799 |
| 422 | Ga0207711_10102174 | 3300025941 | Bacteria | 2537 |
| 423 | Ga0207689_10008948 | 3300025942 | Bacteria | 8680 |
| 424 | Ga0207689_10367736 | 3300025942 | Bacteria | 1196 |
| 425 | Ga0207689_10939378 | 3300025942 | Bacteria | 730 |
| 426 | Ga0207661_10085644 | 3300025944 | Bacteria | 2613 |
| 427 | Ga0207661_10423064 | 3300025944 | Bacteria | 1210 |
| 428 | Ga0207661_10626118 | 3300025944 | Bacteria | 988 |
| 429 | Ga0207661_11530451 | 3300025944 | Bacteria | 611 |
| 430 | Ga0207661_12127299 | 3300025944 | Bacteria | 507 |
| 431 | Ga0207679_10437057 | 3300025945 | Bacteria | 1158 |
| 432 | Ga0207679_10826774 | 3300025945 | Bacteria | 845 |
| 433 | Ga0207667_10016618 | 3300025949 | Bacteria | 8307 |
| 434 | Ga0207667_10086751 | 3300025949 | Bacteria | 3238 |
| 435 | Ga0207667_11786271 | 3300025949 | Bacteria | 579 |
| 436 | Ga0207651_10161527 | 3300025960 | Bacteria | 1757 |
| 437 | Ga0207712_10021402 | 3300025961 | Bacteria | 4246 |
| 438 | Ga0207712_10027364 | 3300025961 | Bacteria | 3807 |
| 439 | Ga0207668_10034693 | 3300025972 | Bacteria | 3352 |
| 440 | Ga0207668_10168949 | 3300025972 | Bacteria | 1713 |
| 441 | Ga0207668_10436276 | 3300025972 | Bacteria | 1115 |
| 442 | Ga0207640_10084665 | 3300025981 | Bacteria | 2178 |
| 443 | Ga0207640_10461976 | 3300025981 | Bacteria | 1049 |
| 444 | Ga0207640_10734821 | 3300025981 | Bacteria | 849 |
| 445 | Ga0207658_10085070 | 3300025986 | Bacteria | 2435 |
| 446 | Ga0207658_10490683 | 3300025986 | Bacteria | 1093 |
| 447 | Ga0207677_10029126 | 3300026023 | Bacteria | 3504 |
| 448 | Ga0207677_12017061 | 3300026023 | Bacteria | 536 |
| 449 | Ga0207703_10026842 | 3300026035 | Bacteria | 4536 |
| 450 | Ga0207703_10132231 | 3300026035 | Bacteria | 2156 |
| 451 | Ga0207639_10152740 | 3300026041 | Bacteria | 1936 |
| 452 | Ga0207639_10799056 | 3300026041 | Bacteria | 879 |
| 453 | Ga0207639_10819544 | 3300026041 | Bacteria | 868 |
| 454 | Ga0207639_11695635 | 3300026041 | Bacteria | 592 |
| 455 | Ga0207678_10001278 | 3300026067 | Bacteria | 23260 |
| 456 | Ga0207678_10152307 | 3300026067 | Bacteria | 1975 |
| 457 | Ga0207678_10459733 | 3300026067 | Bacteria | 1107 |
| 458 | Ga0207678_10501361 | 3300026067 | Bacteria | 1058 |
| 459 | Ga0207678_10766732 | 3300026067 | Bacteria | 851 |
| 460 | Ga0207708_10011571 | 3300026075 | Bacteria | 6575 |
| 461 | Ga0207708_10064908 | 3300026075 | Bacteria | 2790 |
| 462 | Ga0207702_10186047 | 3300026078 | Bacteria | 1915 |
| 463 | Ga0207702_10485092 | 3300026078 | Bacteria | 1203 |
| 464 | Ga0207702_10531607 | 3300026078 | Bacteria | 1149 |
| 465 | Ga0207702_10547838 | 3300026078 | Bacteria | 1131 |
| 466 | Ga0207702_10750895 | 3300026078 | Bacteria | 963 |
| 467 | Ga0207641_10047443 | 3300026088 | Bacteria | 3622 |
| 468 | Ga0207641_10720561 | 3300026088 | Bacteria | 983 |
| 469 | Ga0207648_10010968 | 3300026089 | Bacteria | 8561 |
| 470 | Ga0207648_11959471 | 3300026089 | Bacteria | 547 |
| 471 | Ga0207676_10249253 | 3300026095 | Bacteria | 1598 |
| 472 | Ga0207676_10297790 | 3300026095 | Bacteria | 1472 |
| 473 | Ga0207676_10695211 | 3300026095 | Bacteria | 985 |
| 474 | Ga0207676_11082651 | 3300026095 | Bacteria | 792 |
| 475 | Ga0207674_10395498 | 3300026116 | Bacteria | 1336 |
| 476 | Ga0207674_10656676 | 3300026116 | Bacteria | 1013 |
| 477 | Ga0207675_100000862 | 3300026118 | Bacteria | 30299 |
| 478 | Ga0207675_100020738 | 3300026118 | Bacteria | 6127 |
| 479 | Ga0207675_100315973 | 3300026118 | Bacteria | 1524 |
| 480 | Ga0207683_10004856 | 3300026121 | Bacteria | 11575 |
| 481 | Ga0207683_11000267 | 3300026121 | Bacteria | 776 |
| 482 | Ga0207698_10251581 | 3300026142 | Bacteria | 1617 |
| 483 | Ga0207698_10265222 | 3300026142 | Bacteria | 1580 |
| 484 | Ga0207698_10433076 | 3300026142 | Bacteria | 1265 |
| 485 | Ga0207698_12274804 | 3300026142 | Bacteria | 554 |
| 486 | Ga0207428_10026948 | 3300027907 | Bacteria | 4788 |
| 487 | Ga0207428_10039472 | 3300027907 | Bacteria | 3834 |
| 488 | Ga0268266_10001967 | 3300028379 | Bacteria | 23057 |
| 489 | Ga0268266_10091476 | 3300028379 | Bacteria | 2668 |
| 490 | Ga0268265_11154206 | 3300028380 | Bacteria | 771 |
| 491 | Ga0268264_10000031 | 3300028381 | Bacteria | 409525 |
| 492 | Ga0307517_10019375 | 3300028786 | Bacteria | 8734 |
| 493 | Ga0307515_10123150 | 3300028794 | Bacteria | 2919 |
| 494 | Ga0307515_10291706 | 3300028794 | Bacteria | 1326 |
| 495 | Ga0307515_10377507 | 3300028794 | Bacteria | 1051 |
| 496 | Ga0307515_10778599 | 3300028794 | Bacteria | 578 |
| 497 | Ga0307511_10170176 | 3300030521 | Bacteria | 1199 |
| 498 | Ga0307512_10002110 | 3300030522 | Bacteria | 26116 |
| 499 | Ga0307512_10060866 | 3300030522 | Bacteria | 2914 |
| 500 | Ga0307512_10432447 | 3300030522 | Bacteria | 539 |
| 501 | Ga0307513_10007381 | 3300031456 | Bacteria | 14266 |
| 502 | Ga0307513_10010672 | 3300031456 | Bacteria | 11494 |
| 503 | Ga0307513_10032151 | 3300031456 | Bacteria | 5922 |
| 504 | Ga0307513_10340187 | 3300031456 | Bacteria | 1251 |
| 505 | Ga0307513_10738580 | 3300031456 | Bacteria | 690 |
| 506 | Ga0307408_101994187 | 3300031548 | Bacteria | 558 |
| 507 | Ga0307508_10027978 | 3300031616 | Bacteria | 5100 |
| 508 | Ga0307508_10239572 | 3300031616 | Bacteria | 1411 |
| 509 | Ga0307514_10023923 | 3300031649 | Bacteria | 4949 |
| 510 | Ga0307514_10143365 | 3300031649 | Bacteria | 1619 |
| 511 | Ga0316575_10100952 | 3300031665 | Bacteria | 1173 |
| 512 | Ga0316579_10044004 | 3300031691 | Bacteria | 2078 |
| 513 | Ga0316579_10207008 | 3300031691 | Bacteria | 949 |
| 514 | Ga0316576_10024631 | 3300031727 | Bacteria | 4203 |
| 515 | Ga0316576_10025917 | 3300031727 | Bacteria | 4108 |
| 516 | Ga0316576_10117753 | 3300031727 | Bacteria | 1993 |
| 517 | Ga0316576_10281019 | 3300031727 | Bacteria | 1246 |
| 518 | Ga0316578_10001886 | 3300031728 | Bacteria | 8849 |
| 519 | Ga0316578_10015230 | 3300031728 | Bacteria | 4131 |
| 520 | Ga0316578_10018168 | 3300031728 | Bacteria | 3846 |
| 521 | Ga0316578_10181487 | 3300031728 | Bacteria | 1268 |
| 522 | Ga0316578_10614932 | 3300031728 | Bacteria | 636 |
| 523 | Ga0307516_10009713 | 3300031730 | Bacteria | 10685 |
| 524 | Ga0307516_10068201 | 3300031730 | Bacteria | 3426 |
| 525 | Ga0307516_10234914 | 3300031730 | Bacteria | 1535 |
| 526 | Ga0307516_10456332 | 3300031730 | Bacteria | 934 |
| 527 | Ga0316577_10021049 | 3300031733 | Bacteria | 3616 |
| 528 | Ga0316577_10075467 | 3300031733 | Bacteria | 1882 |
| 529 | Ga0307413_10048253 | 3300031824 | Bacteria | 2544 |
| 530 | Ga0307413_10669635 | 3300031824 | Bacteria | 858 |
| 531 | Ga0307413_10831896 | 3300031824 | Bacteria | 778 |
| 532 | Ga0307410_10206833 | 3300031852 | Bacteria | 1502 |
| 533 | Ga0307410_10362754 | 3300031852 | Bacteria | 1161 |
| 534 | Ga0307410_10707731 | 3300031852 | Bacteria | 850 |
| 535 | Ga0307406_10072872 | 3300031901 | Bacteria | 2256 |
| 536 | Ga0307406_10285993 | 3300031901 | Bacteria | 1260 |
| 537 | Ga0307406_11131994 | 3300031901 | Bacteria | 677 |
| 538 | Ga0307407_10884813 | 3300031903 | Bacteria | 684 |
| 539 | Ga0307412_10583789 | 3300031911 | Bacteria | 944 |
| 540 | Ga0307409_100037961 | 3300031995 | Bacteria | 3557 |
| 541 | Ga0307409_100200923 | 3300031995 | Bacteria | 1783 |
| 542 | Ga0307409_100206187 | 3300031995 | Bacteria | 1763 |
| 543 | Ga0307409_101095167 | 3300031995 | Bacteria | 818 |
| 544 | Ga0307409_101670739 | 3300031995 | Bacteria | 665 |
| 545 | Ga0307409_101907747 | 3300031995 | Bacteria | 623 |
| 546 | Ga0307409_102207635 | 3300031995 | Bacteria | 580 |
| 547 | Ga0307416_100133084 | 3300032002 | Bacteria | 2243 |
| 548 | Ga0307416_100168408 | 3300032002 | Bacteria | 2036 |
| 549 | Ga0307414_10246508 | 3300032004 | Bacteria | 1482 |
| 550 | Ga0307411_10313990 | 3300032005 | Bacteria | 1263 |
| 551 | Ga0307411_10812345 | 3300032005 | Bacteria | 824 |
| 552 | Ga0307415_100006661 | 3300032126 | Bacteria | 6252 |
| 553 | Ga0307415_100622755 | 3300032126 | Bacteria | 963 |
| 554 | Ga0316583_10023364 | 3300032133 | Bacteria | 2210 |
| 555 | Ga0316583_10027161 | 3300032133 | Bacteria | 2043 |
| 556 | Ga0316585_10022745 | 3300032137 | Bacteria | 1930 |
| 557 | Ga0316585_10100688 | 3300032137 | Bacteria | 948 |
| 558 | Ga0316580_10034779 | 3300032139 | Bacteria | 1559 |
| 559 | Ga0316580_10038366 | 3300032139 | Bacteria | 1481 |
| 560 | Ga0316580_10121598 | 3300032139 | Bacteria | 799 |
| 561 | Ga0316580_10206343 | 3300032139 | Bacteria | 606 |
| 562 | Ga0373930_0048644 | 3300034816 | Bacteria | 921 |
| 563 | Ga0373958_0055269 | 3300034819 | Bacteria | 848 |
| 564 | Ga0373959_0032445 | 3300034820 | Bacteria | 1061 |
| 565 | Ga0373938_0016011 | 3300034957 | Bacteria | 1460 |
| 566 | Ga0373928_0008878 | 3300035084 | Bacteria | 1960 |
| 567 | Ga0373934_0372565 | 3300035086 | Bacteria | 595 |
| 568 | Ga0373932_0084710 | 3300035112 | Bacteria | 1007 |
| 569 | Ga0373941_0120182 | 3300035115 | Bacteria | 936 |
| 570 | Ga0373960_0004260 | 3300035121 | Bacteria | 3268 |
| 571 | Ga0373942_0075556 | 3300035207 | Bacteria | 992 |
| 572 | Ga0373962_0263856 | 3300035242 | Bacteria | 601 |
| 573 | Ga0316574_0002927 | 3300035398 | Bacteria | 8687 |
| 574 | Ga0316574_0006864 | 3300035398 | Bacteria | 6191 |
| 575 | Ga0316574_0028324 | 3300035398 | Bacteria | 3378 |
| 576 | Ga0316574_0039475 | 3300035398 | Bacteria | 2903 |
| 577 | Ga0316574_0181112 | 3300035398 | Bacteria | 1356 |
| 578 | Ga0373931_0396935 | 3300035691 | Bacteria | 872 |
| 579 | Ga0373935_0652500 | 3300035692 | Bacteria | 772 |
| 580 | Ga0373927_0769922 | 3300035695 | Bacteria | 636 |
| 581 | Ga0373947_0630113 | 3300035725 | Bacteria | 731 |
| 582 | Ga0373937_0104761 | 3300036401 | Bacteria | 2628 |
| 583 | Ga0316582_0004636 | 3300036647 | Bacteria | 6979 |
| 584 | Ga0316582_0005574 | 3300036647 | Bacteria | 6504 |
| 585 | Ga0316582_0228293 | 3300036647 | Bacteria | 1274 |
| 586 | Ga0316582_0950418 | 3300036647 | Bacteria | 587 |
| 587 | Ga0316584_0001080 | 3300036712 | Bacteria | 15945 |
| 588 | Ga0316584_0002346 | 3300036712 | Bacteria | 11933 |
| 589 | Ga0316584_0006442 | 3300036712 | Bacteria | 7945 |
| 590 | Ga0316584_0024754 | 3300036712 | Bacteria | 4397 |
| 591 | Ga0316584_0071727 | 3300036712 | Bacteria | 2595 |
| 592 | Ga0316584_0146750 | 3300036712 | Bacteria | 1757 |
| 593 | Ga0373925_0761311 | 3300037068 | Bacteria | 798 |
| 594 | Ga0373925_0974753 | 3300037068 | Bacteria | 698 |
| 595 | Ga0373925_1060720 | 3300037068 | Bacteria | 667 |
| 596 | Ga0373925_1444953 | 3300037068 | Bacteria | 563 |
| 597 | Ga0395899_0014945 | 3300037312 | Bacteria | 5921 |
| 598 | Ga0395899_0239675 | 3300037312 | Bacteria | 1249 |
| 599 | Ga0395900_0144673 | 3300037418 | Bacteria | 2432 |
| 600 | Ga0395900_0244171 | 3300037418 | Bacteria | 1800 |
| 601 | Ga0395900_0309186 | 3300037418 | Bacteria | 1564 |
| 602 | Ga0395898_0002926 | 3300037466 | Bacteria | 19415 |
| 603 | Ga0395898_0008650 | 3300037466 | Bacteria | 10739 |
| 604 | Ga0395898_0023615 | 3300037466 | Bacteria | 6210 |
| 605 | Ga0395898_0094206 | 3300037466 | Bacteria | 2878 |
| 606 | Ga0395898_0584518 | 3300037466 | Bacteria | 1059 |
| 607 | Ga0395898_0910125 | 3300037466 | Bacteria | 818 |
| 608 | Ga0395905_0012794 | 3300037471 | Bacteria | 8072 |
| 609 | Ga0395905_0307721 | 3300037471 | Bacteria | 1473 |
| 610 | Ga0395905_0355771 | 3300037471 | Bacteria | 1357 |
| 611 | Ga0436364_0312246 | 3300037853 | Bacteria | 1261 |
| 612 | Ga0436364_0487929 | 3300037853 | Bacteria | 785 |
| 613 | Ga0436364_0747706 | 3300037853 | Bacteria | 1285 |
| 614 | Ga0395901_0021839 | 3300038443 | Bacteria | 6559 |
| 615 | Ga0395901_0070161 | 3300038443 | Bacteria | 3650 |
| 616 | Ga0395901_0220702 | 3300038443 | Bacteria | 1982 |
| 617 | Ga0395901_1705059 | 3300038443 | Bacteria | 581 |
| 618 | Ga0439436_0004809 | 3300041404 | Bacteria | 4141 |
| 619 | Ga0439436_0035109 | 3300041404 | Bacteria | 1449 |
| 620 | Ga0439438_110365 | 3300041405 | Bacteria | 664 |
| 621 | Ga0439439_0002892 | 3300041406 | Bacteria | 3727 |
| 622 | Ga0439461_0179366 | 3300041410 | Bacteria | 560 |
| 623 | Ga0439466_0057028 | 3300041411 | Bacteria | 1266 |
| 624 | Ga0451787_443561 | 3300041441 | Bacteria | 513 |
| 625 | Ga0451789_0357655 | 3300041443 | Bacteria | 629 |
| 626 | Ga0451789_0403977 | 3300041443 | Bacteria | 700 |
| 627 | Ga0451791_1032014 | 3300041451 | Bacteria | 1910 |
| 628 | Ga0451793_1705097 | 3300041452 | Bacteria | 823 |
| 629 | Ga0451797_0119615 | 3300041453 | Bacteria | 1491 |
| 630 | Ga0451797_0425520 | 3300041453 | Bacteria | 1317 |
| 631 | Ga0451797_0900995 | 3300041453 | Bacteria | 739 |
| 632 | Ga0451795_1315360 | 3300041456 | Bacteria | 901 |
| 633 | Ga0451795_1425503 | 3300041456 | Bacteria | 656 |
| 634 | Ga0451795_1527499 | 3300041456 | Bacteria | 827 |
| 635 | Ga0451800_0913216 | 3300041459 | Bacteria | 882 |
| 636 | Ga0451800_1276582 | 3300041459 | Bacteria | 673 |
| 637 | Ga0451804_0978374 | 3300041463 | Bacteria | 1394 |
| 638 | Ga0451837_0844599 | 3300041494 | Bacteria | 1222 |
| 639 | Ga0451839_0451422 | 3300041496 | Bacteria | 522 |
| 640 | Ga0451839_0878520 | 3300041496 | Bacteria | 528 |
| 641 | Ga0451845_0934553 | 3300041501 | Bacteria | 522 |
| 642 | Ga0451847_0328072 | 3300041503 | Bacteria | 956 |
| 643 | Ga0451851_0409766 | 3300041507 | Bacteria | 564 |
| 644 | Ga0451843_1398884 | 3300041509 | Bacteria | 618 |
| 645 | Ga0451855_0876493 | 3300041511 | Bacteria | 609 |
| 646 | Ga0451853_0925178 | 3300041512 | Bacteria | 851 |
| 647 | Ga0451853_1111976 | 3300041512 | Bacteria | 523 |
| 648 | Ga0451853_1397591 | 3300041512 | Bacteria | 647 |
| 649 | Ga0451853_2120126 | 3300041512 | Bacteria | 1234 |
| 650 | Ga0451853_3106522 | 3300041512 | Bacteria | 514 |
| 651 | Ga0451853_3509953 | 3300041512 | Bacteria | 547 |
| 652 | Ga0439433_0001111 | 3300041999 | Bacteria | 5488 |
| 653 | Ga0439442_013843 | 3300042002 | Bacteria | 1657 |
| 654 | Ga0439448_0052233 | 3300042005 | Bacteria | 1339 |
| 655 | Ga0439448_0365740 | 3300042005 | Bacteria | 515 |
| 656 | Ga0439449_0019483 | 3300042007 | Bacteria | 2543 |
| 657 | Ga0439449_0091794 | 3300042007 | Bacteria | 1121 |
| 658 | Ga0439455_0010486 | 3300042012 | Bacteria | 2039 |
| 659 | Ga0439455_0025944 | 3300042012 | Bacteria | 1428 |
| 660 | Ga0439457_000050 | 3300042014 | Bacteria | 24506 |
| 661 | Ga0439457_001276 | 3300042014 | Bacteria | 7557 |
| 662 | Ga0439457_008844 | 3300042014 | Bacteria | 2362 |
| 663 | Ga0439462_0005042 | 3300042015 | Bacteria | 3240 |
| 664 | Ga0450894_000402 | 3300042131 | Bacteria | 7411 |
| 665 | Ga0450899_000036 | 3300042135 | Bacteria | 9998 |
| 666 | Ga0450900_042940 | 3300042136 | Bacteria | 680 |
| 667 | Ga0450903_000797 | 3300042138 | Bacteria | 6152 |
| 668 | Ga0450906_101925 | 3300042145 | Bacteria | 524 |
| 669 | Ga0439458_0006796 | 3300042157 | Bacteria | 2547 |
| 670 | Ga0466969_0010992 | 3300044656 | Bacteria | 4793 |
| 671 | Ga0466969_0013005 | 3300044656 | Bacteria | 4383 |
| 672 | Ga0466969_0030942 | 3300044656 | Bacteria | 2725 |
| 673 | Ga0466969_0110907 | 3300044656 | Bacteria | 1284 |
| 674 | Ga0466969_0220074 | 3300044656 | Bacteria | 864 |
| 675 | Ga0466972_0007258 | 3300044658 | Bacteria | 5565 |
| 676 | Ga0466972_0009587 | 3300044658 | Bacteria | 4860 |
| 677 | Ga0466972_0072859 | 3300044658 | Bacteria | 1638 |
| 678 | Ga0466972_0088945 | 3300044658 | Bacteria | 1466 |
| 679 | Ga0466972_0162133 | 3300044658 | Bacteria | 1050 |
| 680 | Ga0466972_0236880 | 3300044658 | Bacteria | 854 |
| 681 | Ga0466972_0532276 | 3300044658 | Bacteria | 554 |
| 682 | Ga0466972_0536432 | 3300044658 | Bacteria | 552 |
| 683 | Ga0466965_0001744 | 3300044683 | Bacteria | 8971 |
| 684 | Ga0466965_0010965 | 3300044683 | Bacteria | 4239 |
| 685 | Ga0466965_0043535 | 3300044683 | Bacteria | 2217 |
| 686 | Ga0466965_0057857 | 3300044683 | Bacteria | 1933 |
| 687 | Ga0466965_0169242 | 3300044683 | Bacteria | 1149 |
| 688 | Ga0466965_0282760 | 3300044683 | Bacteria | 896 |
| 689 | Ga0466966_0002073 | 3300044684 | Bacteria | 12998 |
| 690 | Ga0466966_0005617 | 3300044684 | Bacteria | 8244 |
| 691 | Ga0466966_0025000 | 3300044684 | Bacteria | 3904 |
| 692 | Ga0466966_0028829 | 3300044684 | Bacteria | 3614 |
| 693 | Ga0466966_0142757 | 3300044684 | Bacteria | 1463 |
| 694 | Ga0466966_0165133 | 3300044684 | Bacteria | 1347 |
| 695 | Ga0466966_0230017 | 3300044684 | Bacteria | 1119 |
| 696 | Ga0466966_0260620 | 3300044684 | Bacteria | 1044 |
| 697 | Ga0466966_0453423 | 3300044684 | Bacteria | 771 |
| 698 | Ga0466961_0008931 | 3300044693 | Bacteria | 6395 |
| 699 | Ga0466961_0014704 | 3300044693 | Bacteria | 5029 |
| 700 | Ga0466961_0014898 | 3300044693 | Bacteria | 4994 |
| 701 | Ga0466961_0045254 | 3300044693 | Bacteria | 2816 |
| 702 | Ga0466961_0053016 | 3300044693 | Bacteria | 2589 |
| 703 | Ga0466961_0132317 | 3300044693 | Bacteria | 1563 |
| 704 | Ga0466961_0202977 | 3300044693 | Bacteria | 1225 |
| 705 | Ga0466961_0247600 | 3300044693 | Bacteria | 1095 |
| 706 | Ga0466961_0262829 | 3300044693 | Bacteria | 1058 |
| 707 | Ga0466961_0366455 | 3300044693 | Bacteria | 876 |
| 708 | Ga0466961_0509618 | 3300044693 | Bacteria | 726 |
| 709 | Ga0466963_0000954 | 3300044694 | Bacteria | 14852 |
| 710 | Ga0466963_0001197 | 3300044694 | Bacteria | 13660 |
| 711 | Ga0466963_0002952 | 3300044694 | Bacteria | 9611 |
| 712 | Ga0466963_0027689 | 3300044694 | Bacteria | 3632 |
| 713 | Ga0466963_0036308 | 3300044694 | Bacteria | 3213 |
| 714 | Ga0466963_0042041 | 3300044694 | Bacteria | 2999 |
| 715 | Ga0466963_0083036 | 3300044694 | Bacteria | 2172 |
| 716 | Ga0466963_0172772 | 3300044694 | Bacteria | 1507 |
| 717 | Ga0466963_0207778 | 3300044694 | Bacteria | 1370 |
| 718 | Ga0466963_0784525 | 3300044694 | Bacteria | 672 |
| 719 | Ga0466963_0920574 | 3300044694 | Bacteria | 616 |
| 720 | Ga0466964_0033613 | 3300044706 | Bacteria | 2043 |
| 721 | Ga0466964_0050199 | 3300044706 | Bacteria | 1710 |
| 722 | Ga0466964_0059076 | 3300044706 | Bacteria | 1591 |
| 723 | Ga0466964_0155505 | 3300044706 | Bacteria | 1064 |
| 724 | Ga0466964_0559184 | 3300044706 | Bacteria | 622 |
| 725 | Ga0466971_0002834 | 3300044719 | Bacteria | 7346 |
| 726 | Ga0466971_0005350 | 3300044719 | Bacteria | 5565 |
| 727 | Ga0466971_0009159 | 3300044719 | Bacteria | 4329 |
| 728 | Ga0466971_0462942 | 3300044719 | Bacteria | 623 |
| 729 | Ga0466968_0130881 | 3300044735 | Bacteria | 1141 |
| 730 | Ga0466968_0299683 | 3300044735 | Bacteria | 773 |
| 731 | Ga0466968_0338362 | 3300044735 | Bacteria | 729 |
| 732 | Ga0466970_0002112 | 3300044765 | Bacteria | 9598 |
| 733 | Ga0466970_0006676 | 3300044765 | Bacteria | 5770 |
| 734 | Ga0466970_0056600 | 3300044765 | Bacteria | 2096 |
| 735 | Ga0466970_0139243 | 3300044765 | Bacteria | 1336 |
| 736 | Ga0466970_0216939 | 3300044765 | Bacteria | 1067 |
| 737 | Ga0466970_0318905 | 3300044765 | Bacteria | 878 |
| 738 | Ga0466970_0322202 | 3300044765 | Bacteria | 874 |
| 739 | Ga0466970_0586225 | 3300044765 | Bacteria | 646 |
| 740 | Ga0466957_0002224 | 3300044842 | Bacteria | 10399 |
| 741 | Ga0466957_0017495 | 3300044842 | Bacteria | 4199 |
| 742 | Ga0466957_0033658 | 3300044842 | Bacteria | 3075 |
| 743 | Ga0466957_0054096 | 3300044842 | Bacteria | 2449 |
| 744 | Ga0466957_0074321 | 3300044842 | Bacteria | 2107 |
| 745 | Ga0466957_0250016 | 3300044842 | Bacteria | 1179 |
| 746 | Ga0466960_0006393 | 3300044901 | Bacteria | 4726 |
| 747 | Ga0466960_0009062 | 3300044901 | Bacteria | 4093 |
| 748 | Ga0466960_0017315 | 3300044901 | Bacteria | 3140 |
| 749 | Ga0466960_0171892 | 3300044901 | Bacteria | 1170 |
| 750 | Ga0466960_0357114 | 3300044901 | Bacteria | 834 |
| 751 | Ga0466960_0750356 | 3300044901 | Bacteria | 588 |
| 752 | Ga0466959_0001862 | 3300045049 | Bacteria | 13254 |
| 753 | Ga0466959_0004316 | 3300045049 | Bacteria | 9490 |
| 754 | Ga0466959_0035444 | 3300045049 | Bacteria | 3689 |
| 755 | Ga0466959_0113081 | 3300045049 | Bacteria | 1936 |
| 756 | Ga0466959_0127788 | 3300045049 | Bacteria | 1803 |
| 757 | Ga0466959_0190193 | 3300045049 | Bacteria | 1433 |
| 758 | Ga0466959_0224473 | 3300045049 | Bacteria | 1302 |
| 759 | Ga0466959_0571240 | 3300045049 | Bacteria | 762 |
| 760 | Ga0466959_0922226 | 3300045049 | Bacteria | 582 |
| 761 | Ga0466959_1192868 | 3300045049 | Bacteria | 506 |
| 762 | Ga0466958_0002184 | 3300045836 | Bacteria | 9743 |
| 763 | Ga0466958_0005815 | 3300045836 | Bacteria | 6672 |
| 764 | Ga0466958_0008194 | 3300045836 | Bacteria | 5788 |
| 765 | Ga0466958_0015510 | 3300045836 | Bacteria | 4367 |
| 766 | Ga0466958_0037010 | 3300045836 | Bacteria | 2923 |
| 767 | Ga0466958_0139625 | 3300045836 | Bacteria | 1525 |
| 768 | Ga0466958_0243493 | 3300045836 | Bacteria | 1149 |
| 769 | Ga0466958_0245045 | 3300045836 | Bacteria | 1146 |
| 770 | Ga0466958_0353297 | 3300045836 | Bacteria | 946 |
| 771 | Ga0466958_0451233 | 3300045836 | Bacteria | 832 |
| 772 | Ga0466958_0576267 | 3300045836 | Bacteria | 732 |
| 773 | Ga0466958_0857445 | 3300045836 | Bacteria | 592 |
| 774 | Ga0466958_1031491 | 3300045836 | Bacteria | 537 |
| 775 | Ga0466967_0000613 | 3300045976 | Bacteria | 17801 |
| 776 | Ga0466967_0004827 | 3300045976 | Bacteria | 9193 |
| 777 | Ga0466967_0012903 | 3300045976 | Bacteria | 6424 |
| 778 | Ga0466967_0024495 | 3300045976 | Bacteria | 4963 |
| 779 | Ga0466967_0026875 | 3300045976 | Bacteria | 4777 |
| 780 | Ga0466967_0033125 | 3300045976 | Bacteria | 4372 |
| 781 | Ga0466967_0038602 | 3300045976 | Bacteria | 4097 |
| 782 | Ga0466967_0077677 | 3300045976 | Bacteria | 2989 |
| 783 | Ga0466967_0198330 | 3300045976 | Bacteria | 1900 |
| 784 | Ga0466967_0236726 | 3300045976 | Bacteria | 1740 |
| 785 | Ga0466967_0282112 | 3300045976 | Bacteria | 1594 |
| 786 | Ga0466967_0282536 | 3300045976 | Bacteria | 1593 |
| 787 | Ga0466967_0305088 | 3300045976 | Bacteria | 1532 |
| 788 | Ga0466967_0347908 | 3300045976 | Bacteria | 1434 |
| 789 | Ga0466967_0931016 | 3300045976 | Bacteria | 864 |
| 790 | Ga0466967_1209721 | 3300045976 | Bacteria | 753 |
| 791 | Ga0466967_1299476 | 3300045976 | Bacteria | 724 |
| 792 | Ga0495617_064030 | 3300046452 | Bacteria | 1213 |
| 793 | Ga0495592_0010796 | 3300046454 | Bacteria | 6886 |
| 794 | Ga0495592_0022400 | 3300046454 | Bacteria | 4806 |
| 795 | Ga0495603_0006734 | 3300046455 | Bacteria | 6897 |
| 796 | Ga0495603_0008687 | 3300046455 | Bacteria | 6139 |
| 797 | Ga0495603_0111508 | 3300046455 | Bacteria | 1595 |
| 798 | Ga0495603_0236865 | 3300046455 | Bacteria | 1052 |
| 799 | Ga0495603_0743027 | 3300046455 | Bacteria | 560 |
| 800 | Ga0495629_0020481 | 3300046459 | Bacteria | 4722 |
| 801 | Ga0495629_0020977 | 3300046459 | Bacteria | 4663 |
| 802 | Ga0495629_0128249 | 3300046459 | Bacteria | 1767 |
| 803 | Ga0495629_0661569 | 3300046459 | Bacteria | 695 |
| 804 | Ga0495638_0062171 | 3300046460 | Bacteria | 2305 |
| 805 | Ga0495638_0298820 | 3300046460 | Bacteria | 868 |
| 806 | Ga0495641_0369414 | 3300046461 | Unclassified | 650 |
| 807 | Ga0495651_0017662 | 3300046462 | Bacteria | 5521 |
| 808 | Ga0495651_0513645 | 3300046462 | Bacteria | 765 |
| 809 | Ga0495651_0677473 | 3300046462 | Bacteria | 644 |
| 810 | Ga0495653_0017407 | 3300046463 | Bacteria | 5845 |
| 811 | Ga0495653_0191944 | 3300046463 | Bacteria | 1393 |
| 812 | Ga0495653_0692253 | 3300046463 | Bacteria | 620 |
| 813 | Ga0495580_0055417 | 3300046472 | Bacteria | 2794 |
| 814 | Ga0495582_0027862 | 3300046473 | Bacteria | 3099 |
| 815 | Ga0495605_0016124 | 3300046474 | Bacteria | 4049 |
| 816 | Ga0495639_0175425 | 3300046475 | Bacteria | 1042 |
| 817 | Ga0495662_0002146 | 3300046476 | Bacteria | 9900 |
| 818 | Ga0495662_0118393 | 3300046476 | Bacteria | 1299 |
| 819 | Ga0495662_0231207 | 3300046476 | Bacteria | 911 |
| 820 | Ga0495664_0000797 | 3300046477 | Bacteria | 16119 |
| 821 | Ga0495664_0195125 | 3300046477 | Bacteria | 1227 |
| 822 | Ga0495584_0057438 | 3300046491 | Bacteria | 1958 |
| 823 | Ga0495585_0117481 | 3300046492 | Bacteria | 1409 |
| 824 | Ga0495594_0020149 | 3300046499 | Bacteria | 3551 |
| 825 | Ga0495594_0069701 | 3300046499 | Bacteria | 1953 |
| 826 | Ga0495596_0076928 | 3300046500 | Bacteria | 1296 |
| 827 | Ga0495607_0165712 | 3300046501 | Bacteria | 1119 |
| 828 | Ga0495583_0066760 | 3300046506 | Bacteria | 1590 |
| 829 | Ga0495606_0017777 | 3300046507 | Bacteria | 5359 |
| 830 | Ga0495608_0055393 | 3300046511 | Bacteria | 2621 |
| 831 | Ga0495608_0140376 | 3300046511 | Bacteria | 1542 |
| 832 | Ga0495608_0352408 | 3300046511 | Bacteria | 906 |
| 833 | Ga0495610_0031610 | 3300046512 | Bacteria | 2760 |
| 834 | Ga0495616_0007914 | 3300046513 | Bacteria | 6338 |
| 835 | Ga0495618_0491756 | 3300046514 | Bacteria | 740 |
| 836 | Ga0495620_0050229 | 3300046515 | Bacteria | 1780 |
| 837 | Ga0495628_0020754 | 3300046516 | Bacteria | 5413 |
| 838 | Ga0495628_0106468 | 3300046516 | Bacteria | 2159 |
| 839 | Ga0495630_0020398 | 3300046517 | Bacteria | 4886 |
| 840 | Ga0495630_0394161 | 3300046517 | Bacteria | 1061 |
| 841 | Ga0495630_0568009 | 3300046517 | Bacteria | 870 |
| 842 | Ga0495630_1284813 | 3300046517 | Bacteria | 552 |
| 843 | Ga0495631_0007885 | 3300046518 | Bacteria | 5391 |
| 844 | Ga0495632_0132140 | 3300046519 | Bacteria | 1161 |
| 845 | Ga0495637_0046159 | 3300046520 | Bacteria | 1844 |
| 846 | Ga0495643_0003665 | 3300046522 | Bacteria | 11147 |
| 847 | Ga0495644_0394714 | 3300046523 | Bacteria | 547 |
| 848 | Ga0495648_0087820 | 3300046524 | Bacteria | 1749 |
| 849 | Ga0495648_0093943 | 3300046524 | Bacteria | 1671 |
| 850 | Ga0495666_0008690 | 3300046526 | Bacteria | 5090 |
| 851 | Ga0495666_0159991 | 3300046526 | Bacteria | 1044 |
| 852 | Ga0495642_0471103 | 3300046528 | Bacteria | 555 |
| 853 | Ga0495652_0019363 | 3300046529 | Bacteria | 6063 |
| 854 | Ga0495652_0054085 | 3300046529 | Bacteria | 3420 |
| 855 | Ga0495654_0051187 | 3300046530 | Bacteria | 2016 |
| 856 | Ga0495665_0010157 | 3300046531 | Bacteria | 5102 |
| 857 | Ga0495665_0500699 | 3300046531 | Bacteria | 612 |
| 858 | Ga0495640_0007906 | 3300046533 | Bacteria | 8361 |
| 859 | Ga0495640_0015041 | 3300046533 | Bacteria | 5830 |
| 860 | Ga0495586_0013757 | 3300046535 | Bacteria | 4294 |
| 861 | Ga0495586_0112687 | 3300046535 | Bacteria | 1515 |
| 862 | Ga0495587_0021595 | 3300046536 | Bacteria | 3970 |
| 863 | Ga0495587_0716083 | 3300046536 | Bacteria | 548 |
| 864 | Ga0495609_0008304 | 3300046538 | Bacteria | 5091 |
| 865 | Ga0495645_0007617 | 3300046543 | Bacteria | 7534 |
| 866 | Ga0495622_0004638 | 3300046557 | Bacteria | 6365 |
| 867 | Ga0495622_0149761 | 3300046557 | Bacteria | 1056 |
| 868 | Ga0495633_0007859 | 3300046558 | Bacteria | 6086 |
| 869 | Ga0495667_0442200 | 3300046559 | Bacteria | 817 |
| 870 | Ga0495667_0593051 | 3300046559 | Bacteria | 690 |
| 871 | Ga0495656_0225063 | 3300046615 | Bacteria | 939 |
| 872 | Ga0495668_0020084 | 3300046616 | Bacteria | 3842 |
| 873 | Ga0495634_0039030 | 3300046642 | Bacteria | 3235 |
| 874 | Ga0495634_0055224 | 3300046642 | Bacteria | 2656 |
| 875 | Ga0495625_0069468 | 3300046660 | Bacteria | 2475 |
| 876 | Ga0495625_0289440 | 3300046660 | Bacteria | 1051 |
| 877 | Ga0495625_0358849 | 3300046660 | Bacteria | 919 |
| 878 | Ga0495635_0038785 | 3300046663 | Bacteria | 3297 |
| 879 | Ga0495635_0411275 | 3300046663 | Bacteria | 897 |
| 880 | Ga0495635_0530260 | 3300046663 | Bacteria | 773 |
| 881 | Ga0495635_1035433 | 3300046663 | Bacteria | 521 |
| 882 | Ga0495661_0017676 | 3300046665 | Bacteria | 4704 |
| 883 | Ga0495588_0017413 | 3300046674 | Bacteria | 3489 |
| 884 | Ga0495588_0229898 | 3300046674 | Bacteria | 978 |
| 885 | Ga0495588_0249148 | 3300046674 | Bacteria | 936 |
| 886 | Ga0495657_0007696 | 3300046675 | Bacteria | 8293 |
| 887 | Ga0495657_0058682 | 3300046675 | Bacteria | 2554 |
| 888 | Ga0495657_0069403 | 3300046675 | Bacteria | 2306 |
| 889 | Ga0495657_0456715 | 3300046675 | Bacteria | 747 |
| 890 | Ga0495657_0734274 | 3300046675 | Bacteria | 566 |
| 891 | Ga0495599_0030957 | 3300046678 | Bacteria | 3358 |
| 892 | Ga0495599_0045948 | 3300046678 | Bacteria | 2739 |
| 893 | Ga0495623_0023639 | 3300046679 | Bacteria | 3964 |
| 894 | Ga0495623_0381190 | 3300046679 | Bacteria | 762 |
| 895 | Ga0495646_0022524 | 3300046680 | Bacteria | 3972 |
| 896 | Ga0495646_0143203 | 3300046680 | Bacteria | 1335 |
| 897 | Ga0495658_0144532 | 3300046683 | Bacteria | 1457 |
| 898 | Ga0495613_0001133 | 3300046689 | Bacteria | 20309 |
| 899 | Ga0495613_0044814 | 3300046689 | Bacteria | 3271 |
| 900 | Ga0495613_0066530 | 3300046689 | Bacteria | 2631 |
| 901 | Ga0495613_0117244 | 3300046689 | Bacteria | 1914 |
| 902 | Ga0495613_0124595 | 3300046689 | Bacteria | 1848 |
| 903 | Ga0495613_0445479 | 3300046689 | Bacteria | 878 |
| 904 | Ga0495613_0800271 | 3300046689 | Bacteria | 615 |
| 905 | Ga0495613_0988979 | 3300046689 | Bacteria | 541 |
| 906 | Ga0495624_0063855 | 3300046690 | Bacteria | 2301 |
| 907 | Ga0495624_0262369 | 3300046690 | Bacteria | 1044 |
| 908 | Ga0495670_0029319 | 3300046691 | Bacteria | 2731 |
| 909 | Ga0495671_0496321 | 3300046692 | Bacteria | 582 |
| 910 | Ga0495649_0009731 | 3300046694 | Bacteria | 5695 |
| 911 | Ga0495649_0050327 | 3300046694 | Bacteria | 2261 |
| 912 | Ga0495649_0058537 | 3300046694 | Bacteria | 2076 |
| 913 | Ga0495589_0002834 | 3300046794 | Bacteria | 9592 |
| 914 | Ga0495589_0140770 | 3300046794 | Bacteria | 1155 |
| 915 | Ga0495600_0051183 | 3300046809 | Bacteria | 2696 |
| 916 | Ga0495600_0085607 | 3300046809 | Bacteria | 2057 |
| 917 | Ga0495600_0429984 | 3300046809 | Bacteria | 818 |
| 918 | Ga0495600_0455125 | 3300046809 | Bacteria | 791 |
| 919 | Ga0495660_0512680 | 3300046810 | Bacteria | 511 |
| 920 | Ga0495581_0131487 | 3300047315 | Bacteria | 1458 |
| 921 | Ga0495581_0271904 | 3300047315 | Bacteria | 991 |
| 922 | Ga0495581_0435886 | 3300047315 | Bacteria | 763 |
| 923 | Ga0495604_0000717 | 3300047317 | Bacteria | 28071 |
| 924 | Ga0495636_0005011 | 3300047318 | Bacteria | 5198 |
| 925 | Ga0495636_0008796 | 3300047318 | Bacteria | 3979 |
| 926 | Ga0495636_0011721 | 3300047318 | Bacteria | 3473 |
| 927 | Ga0495636_0294265 | 3300047318 | Bacteria | 758 |
| 928 | Ga0495636_0481507 | 3300047318 | Bacteria | 598 |
| 929 | Ga0495674_0020148 | 3300047319 | Bacteria | 6179 |
| 930 | Ga0495674_0194464 | 3300047319 | Bacteria | 1685 |
| 931 | Ga0495674_0208180 | 3300047319 | Bacteria | 1621 |
| 932 | Ga0495674_0401256 | 3300047319 | Bacteria | 1107 |
| 933 | Ga0495674_0498450 | 3300047319 | Bacteria | 974 |
| 934 | Ga0495672_0470974 | 3300047320 | Bacteria | 563 |
| 935 | Ga0495676_0018902 | 3300047321 | Bacteria | 6071 |
| 936 | Ga0495676_0032816 | 3300047321 | Bacteria | 4379 |
| 937 | Ga0495676_0272373 | 3300047321 | Bacteria | 1148 |
| 938 | Ga0495680_0015876 | 3300047322 | Bacteria | 6482 |
| 939 | Ga0495683_0272494 | 3300047323 | Bacteria | 735 |
| 940 | Ga0495683_0444811 | 3300047323 | Bacteria | 532 |
| 941 | Ga0495687_001837 | 3300047443 | Bacteria | 18639 |
| 942 | Ga0495687_124828 | 3300047443 | Bacteria | 922 |
| 943 | Ga0495687_134558 | 3300047443 | Bacteria | 869 |
| 944 | Ga0495687_163189 | 3300047443 | Bacteria | 746 |
| 945 | Ga0495675_0012537 | 3300047444 | Bacteria | 5335 |
| 946 | Ga0495675_0033528 | 3300047444 | Bacteria | 3277 |
| 947 | Ga0495677_0060572 | 3300047445 | Bacteria | 1403 |
| 948 | Ga0495677_0347946 | 3300047445 | Bacteria | 585 |
| 949 | Ga0495685_006732 | 3300047447 | Bacteria | 3774 |
| 950 | Ga0495685_031531 | 3300047447 | Bacteria | 1821 |
| 951 | Ga0495685_071599 | 3300047447 | Bacteria | 1160 |
| 952 | Ga0495685_109534 | 3300047447 | Bacteria | 909 |
| 953 | Ga0495685_130021 | 3300047447 | Bacteria | 824 |
| 954 | Ga0495685_147366 | 3300047447 | Bacteria | 765 |
| 955 | Ga0495681_0038064 | 3300047470 | Bacteria | 2362 |
| 956 | Ga0495681_0246781 | 3300047470 | Bacteria | 706 |
| 957 | Ga0495684_0051912 | 3300047471 | Bacteria | 3128 |
| 958 | Ga0495684_0219199 | 3300047471 | Bacteria | 1396 |
| 959 | Ga0495686_0073074 | 3300047472 | Bacteria | 2107 |
| 960 | Ga0495686_0215328 | 3300047472 | Bacteria | 1095 |
| 961 | Ga0495593_0018986 | 3300047673 | Bacteria | 3858 |
| 962 | Ga0495593_0053424 | 3300047673 | Bacteria | 2132 |
| 963 | Ga0495602_0481595 | 3300048088 | Bacteria | 870 |
| 964 | Ga0495602_1125161 | 3300048088 | Bacteria | 514 |
| 965 | Ga0495614_0009183 | 3300048089 | Bacteria | 4380 |
| 966 | Ga0495614_0116815 | 3300048089 | Bacteria | 1174 |
| 967 | Ga0495614_0516140 | 3300048089 | Bacteria | 569 |
| 968 | Ga0495626_0013567 | 3300048091 | Bacteria | 4232 |
| 969 | Ga0495626_0249104 | 3300048091 | Bacteria | 713 |
| 970 | Ga0496100_0089905 | 3300048903 | Bacteria | 2093 |
| 971 | Ga0496100_0375421 | 3300048903 | Bacteria | 1079 |
| 972 | Ga0496100_0469993 | 3300048903 | Bacteria | 966 |
| 973 | Ga0496101_0104740 | 3300048904 | Bacteria | 2122 |
| 974 | Ga0496101_0395556 | 3300048904 | Bacteria | 1088 |
| 975 | Ga0496102_0000474 | 3300048905 | Bacteria | 44502 |
| 976 | Ga0496102_0052146 | 3300048905 | Bacteria | 3726 |
| 977 | Ga0496102_0079919 | 3300048905 | Bacteria | 3012 |
| 978 | Ga0496102_0094978 | 3300048905 | Bacteria | 2763 |
| 979 | Ga0496102_0382362 | 3300048905 | Bacteria | 1325 |
| 980 | Ga0496102_0415930 | 3300048905 | Bacteria | 1263 |
| 981 | Ga0496102_0701748 | 3300048905 | Bacteria | 935 |
| 982 | Ga0496102_1218214 | 3300048905 | Bacteria | 672 |
| 983 | Ga0496102_1302500 | 3300048905 | Bacteria | 646 |
| 984 | Ga0496102_1520970 | 3300048905 | Bacteria | 588 |
| 985 | Ga0496103_0000746 | 3300048906 | Bacteria | 24024 |
| 986 | Ga0496103_0057727 | 3300048906 | Bacteria | 2410 |
| 987 | Ga0496103_0109647 | 3300048906 | Bacteria | 1753 |
| 988 | Ga0496103_0129399 | 3300048906 | Bacteria | 1612 |
| 989 | Ga0496104_0004536 | 3300048907 | Bacteria | 12100 |
| 990 | Ga0496104_0004679 | 3300048907 | Bacteria | 11913 |
| 991 | Ga0496104_0088701 | 3300048907 | Bacteria | 2955 |
| 992 | Ga0496104_0191015 | 3300048907 | Bacteria | 1959 |
| 993 | Ga0496104_0328473 | 3300048907 | Bacteria | 1442 |
| 994 | Ga0496104_0403330 | 3300048907 | Bacteria | 1279 |
| 995 | Ga0496104_1596743 | 3300048907 | Bacteria | 555 |
| 996 | Ga0496105_0074948 | 3300048908 | Bacteria | 2795 |
| 997 | Ga0496105_0327804 | 3300048908 | Bacteria | 1226 |
| 998 | Ga0496105_0343704 | 3300048908 | Bacteria | 1193 |
| 999 | Ga0496105_0370273 | 3300048908 | Bacteria | 1141 |
| 1000 | Ga0496105_0678064 | 3300048908 | Bacteria | 793 |
| 1001 | Ga0496106_0100021 | 3300048909 | Bacteria | 2248 |
| 1002 | Ga0496106_0142541 | 3300048909 | Bacteria | 1886 |
| 1003 | Ga0496107_0048969 | 3300048910 | Bacteria | 3045 |
| 1004 | Ga0496107_0650679 | 3300048910 | Bacteria | 777 |
| 1005 | Ga0496107_0679550 | 3300048910 | Bacteria | 758 |
| 1006 | Ga0496107_0684246 | 3300048910 | Bacteria | 755 |
| 1007 | Ga0496107_0741838 | 3300048910 | Bacteria | 721 |
| 1008 | Ga0496108_0007637 | 3300048911 | Bacteria | 8755 |
| 1009 | Ga0496108_0016478 | 3300048911 | Bacteria | 6031 |
| 1010 | Ga0496108_0043231 | 3300048911 | Bacteria | 3764 |
| 1011 | Ga0496108_0079265 | 3300048911 | Bacteria | 2780 |
| 1012 | Ga0496108_0079926 | 3300048911 | Bacteria | 2769 |
| 1013 | Ga0496108_0106569 | 3300048911 | Bacteria | 2393 |
| 1014 | Ga0496108_0260215 | 3300048911 | Bacteria | 1510 |
| 1015 | Ga0496109_0014032 | 3300048912 | Bacteria | 6965 |
| 1016 | Ga0496109_0080432 | 3300048912 | Bacteria | 3002 |
| 1017 | Ga0496109_0094738 | 3300048912 | Bacteria | 2763 |
| 1018 | Ga0496109_0193109 | 3300048912 | Bacteria | 1913 |
| 1019 | Ga0496109_0202587 | 3300048912 | Bacteria | 1866 |
| 1020 | Ga0496109_0238702 | 3300048912 | Bacteria | 1710 |
| 1021 | Ga0496109_0725810 | 3300048912 | Bacteria | 931 |
| 1022 | Ga0496109_0968468 | 3300048912 | Bacteria | 788 |
| 1023 | Ga0496110_0004391 | 3300048913 | Bacteria | 10921 |
| 1024 | Ga0496110_0011291 | 3300048913 | Bacteria | 7303 |
| 1025 | Ga0496110_0023092 | 3300048913 | Bacteria | 5290 |
| 1026 | Ga0496110_0253267 | 3300048913 | Bacteria | 1602 |
| 1027 | Ga0496110_0325865 | 3300048913 | Bacteria | 1399 |
| 1028 | Ga0496110_0411533 | 3300048913 | Bacteria | 1233 |
| 1029 | Ga0496110_0568193 | 3300048913 | Bacteria | 1030 |
| 1030 | Ga0496110_0977177 | 3300048913 | Bacteria | 754 |
| 1031 | Ga0496111_0027325 | 3300048914 | Bacteria | 4035 |
| 1032 | Ga0496111_0067648 | 3300048914 | Bacteria | 2595 |
| 1033 | Ga0496111_0086817 | 3300048914 | Bacteria | 2289 |
| 1034 | Ga0496111_0124914 | 3300048914 | Bacteria | 1902 |
| 1035 | Ga0496111_0491673 | 3300048914 | Bacteria | 903 |
| 1036 | Ga0496111_0513307 | 3300048914 | Bacteria | 882 |
| 1037 | Ga0496111_0677513 | 3300048914 | Bacteria | 751 |
| 1038 | Ga0496112_0049608 | 3300048915 | Bacteria | 4115 |
| 1039 | Ga0496112_0557159 | 3300048915 | Bacteria | 1080 |
| 1040 | Ga0496113_0036651 | 3300048916 | Bacteria | 3595 |
| 1041 | Ga0496113_0148211 | 3300048916 | Bacteria | 1850 |
| 1042 | Ga0496113_0238090 | 3300048916 | Bacteria | 1452 |
| 1043 | Ga0496113_0307134 | 3300048916 | Bacteria | 1270 |
| 1044 | Ga0496113_1032153 | 3300048916 | Bacteria | 647 |
| 1045 | Ga0496114_0002482 | 3300048917 | Bacteria | 14092 |
| 1046 | Ga0496114_0016483 | 3300048917 | Bacteria | 5956 |
| 1047 | Ga0496114_0143077 | 3300048917 | Bacteria | 2072 |
| 1048 | Ga0496114_0143609 | 3300048917 | Bacteria | 2068 |
| 1049 | Ga0496114_0164995 | 3300048917 | Bacteria | 1928 |
| 1050 | Ga0496114_0223148 | 3300048917 | Bacteria | 1654 |
| 1051 | Ga0496114_0235128 | 3300048917 | Bacteria | 1610 |
| 1052 | Ga0496114_0267192 | 3300048917 | Bacteria | 1507 |
| 1053 | Ga0496114_0296399 | 3300048917 | Bacteria | 1427 |
| 1054 | Ga0496114_1173759 | 3300048917 | Bacteria | 653 |
| 1055 | Ga0496115_0007736 | 3300048918 | Bacteria | 7925 |
| 1056 | Ga0496115_0357708 | 3300048918 | Bacteria | 1190 |
| 1057 | Ga0496115_0586262 | 3300048918 | Bacteria | 888 |
| 1058 | Ga0496117_0094345 | 3300048920 | Bacteria | 1915 |
| 1059 | Ga0496117_0202037 | 3300048920 | Bacteria | 1122 |
| 1060 | Ga0496118_0059415 | 3300048921 | Bacteria | 2847 |
| 1061 | Ga0496118_0094560 | 3300048921 | Bacteria | 2043 |
| 1062 | Ga0496118_0627843 | 3300048921 | Bacteria | 509 |
| 1063 | Ga0496119_0025963 | 3300048922 | Bacteria | 4076 |
| 1064 | Ga0496119_0055002 | 3300048922 | Bacteria | 2420 |
| 1065 | Ga0496120_0367002 | 3300048923 | Bacteria | 643 |
| 1066 | Ga0496121_0017831 | 3300048924 | Bacteria | 7211 |
| 1067 | Ga0496121_0315754 | 3300048924 | Bacteria | 1054 |
| 1068 | Ga0496122_0001555 | 3300048925 | Bacteria | 36330 |
| 1069 | Ga0496123_0400097 | 3300048926 | Bacteria | 625 |
| 1070 | Ga0496124_0655792 | 3300048927 | Bacteria | 673 |
| 1071 | Ga0496125_0000025 | 3300048928 | Bacteria | 440074 |
| 1072 | Ga0496126_0000036 | 3300048929 | Bacteria | 354901 |
| 1073 | Ga0501306_018232 | 3300049127 | Bacteria | 958 |
| 1074 | Ga0495682_0170173 | 3300049460 | Bacteria | 775 |
| 1075 | Ga0501031_0246011 | 3300049568 | Bacteria | 1162 |
| 1076 | Ga0501032_0009780 | 3300049569 | Bacteria | 6938 |
| 1077 | Ga0501032_0015007 | 3300049569 | Bacteria | 5477 |
| 1078 | Ga0501032_0019341 | 3300049569 | Bacteria | 4765 |
| 1079 | Ga0501032_0098368 | 3300049569 | Bacteria | 1939 |
| 1080 | Ga0501033_0033436 | 3300049570 | Bacteria | 3859 |
| 1081 | Ga0501033_0089909 | 3300049570 | Bacteria | 2246 |
| 1082 | Ga0501033_0100027 | 3300049570 | Bacteria | 2116 |
| 1083 | Ga0501033_0177710 | 3300049570 | Bacteria | 1527 |
| 1084 | Ga0501034_0027557 | 3300049571 | Bacteria | 5779 |
| 1085 | Ga0501034_0063804 | 3300049571 | Bacteria | 3698 |
| 1086 | Ga0501034_0145647 | 3300049571 | Bacteria | 2346 |
| 1087 | Ga0501034_0192787 | 3300049571 | Bacteria | 1999 |
| 1088 | Ga0501034_0472586 | 3300049571 | Bacteria | 1170 |
| 1089 | Ga0501034_1439012 | 3300049571 | Bacteria | 564 |
| 1090 | Ga0501036_0032656 | 3300049572 | Bacteria | 4400 |
| 1091 | Ga0501036_0592988 | 3300049572 | Bacteria | 919 |
| 1092 | Ga0501036_1465239 | 3300049572 | Bacteria | 553 |
| 1093 | Ga0501037_0105593 | 3300049573 | Bacteria | 2030 |
| 1094 | Ga0501037_0383282 | 3300049573 | Bacteria | 966 |
| 1095 | Ga0501037_0399266 | 3300049573 | Bacteria | 943 |
| 1096 | Ga0501037_0876991 | 3300049573 | Bacteria | 589 |
| 1097 | Ga0501038_0003594 | 3300049574 | Bacteria | 14429 |
| 1098 | Ga0501038_0007999 | 3300049574 | Bacteria | 9745 |
| 1099 | Ga0501038_0058002 | 3300049574 | Bacteria | 3321 |
| 1100 | Ga0501038_0067229 | 3300049574 | Bacteria | 3049 |
| 1101 | Ga0501039_0027902 | 3300049575 | Bacteria | 4342 |
| 1102 | Ga0501039_0430332 | 3300049575 | Bacteria | 1036 |
| 1103 | Ga0501039_0468282 | 3300049575 | Bacteria | 989 |
| 1104 | Ga0501040_0241799 | 3300049576 | Bacteria | 1287 |
| 1105 | Ga0501040_0292869 | 3300049576 | Bacteria | 1163 |
| 1106 | Ga0501042_0594422 | 3300049578 | Bacteria | 805 |
| 1107 | Ga0501043_0094641 | 3300049579 | Bacteria | 2348 |
| 1108 | Ga0501043_0209419 | 3300049579 | Bacteria | 1511 |
| 1109 | Ga0501043_0410947 | 3300049579 | Bacteria | 1021 |
| 1110 | Ga0501046_0023316 | 3300049580 | Bacteria | 5093 |
| 1111 | Ga0501047_0000191 | 3300049581 | Bacteria | 74396 |
| 1112 | Ga0501047_0005402 | 3300049581 | Bacteria | 12015 |
| 1113 | Ga0501047_0037162 | 3300049581 | Bacteria | 4708 |
| 1114 | Ga0501047_0049715 | 3300049581 | Bacteria | 4048 |
| 1115 | Ga0501047_0056593 | 3300049581 | Bacteria | 3792 |
| 1116 | Ga0501047_0074133 | 3300049581 | Bacteria | 3276 |
| 1117 | Ga0501047_0523684 | 3300049581 | Bacteria | 1011 |
| 1118 | Ga0501048_0000405 | 3300049582 | Bacteria | 30043 |
| 1119 | Ga0501048_0087368 | 3300049582 | Bacteria | 2200 |
| 1120 | Ga0501048_0157469 | 3300049582 | Bacteria | 1607 |
| 1121 | Ga0501048_0401781 | 3300049582 | Bacteria | 979 |
| 1122 | Ga0501067_0041498 | 3300049583 | Bacteria | 2555 |
| 1123 | Ga0501067_0144006 | 3300049583 | Bacteria | 1328 |
| 1124 | Ga0501067_0781863 | 3300049583 | Bacteria | 537 |
| 1125 | Ga0501069_0012307 | 3300049585 | Bacteria | 4548 |
| 1126 | Ga0501069_0136480 | 3300049585 | Bacteria | 1406 |
| 1127 | Ga0501069_0539436 | 3300049585 | Bacteria | 697 |
| 1128 | Ga0501070_0108433 | 3300049586 | Bacteria | 2294 |
| 1129 | Ga0501070_0241375 | 3300049586 | Bacteria | 1479 |
| 1130 | Ga0501070_0790646 | 3300049586 | Bacteria | 746 |
| 1131 | Ga0501070_1041937 | 3300049586 | Bacteria | 633 |
| 1132 | Ga0501070_1380007 | 3300049586 | Bacteria | 536 |
| 1133 | Ga0501071_0550997 | 3300049587 | Bacteria | 886 |
| 1134 | Ga0501072_0508384 | 3300049588 | Bacteria | 953 |
| 1135 | Ga0501074_0101418 | 3300049590 | Bacteria | 2060 |
| 1136 | Ga0501075_0715309 | 3300049591 | Bacteria | 763 |
| 1137 | Ga0501235_031949 | 3300049669 | Bacteria | 1190 |
| 1138 | Ga0501080_0031855 | 3300049742 | Bacteria | 4913 |
| 1139 | Ga0501080_0617989 | 3300049742 | Bacteria | 961 |
| 1140 | Ga0501083_0024967 | 3300049744 | Bacteria | 4139 |
| 1141 | Ga0501083_0980639 | 3300049744 | Bacteria | 550 |
| 1142 | Ga0501282_002540 | 3300049778 | Bacteria | 1978 |
| 1143 | Ga0501035_0034700 | 3300049822 | Bacteria | 4582 |
| 1144 | Ga0501035_0089814 | 3300049822 | Bacteria | 2705 |
| 1145 | Ga0501035_0097433 | 3300049822 | Bacteria | 2583 |
| 1146 | Ga0501035_0210569 | 3300049822 | Bacteria | 1663 |
| 1147 | Ga0501035_0227026 | 3300049822 | Bacteria | 1592 |
| 1148 | Ga0501035_1023312 | 3300049822 | Bacteria | 648 |
| 1149 | Ga0501044_0011203 | 3300049823 | Bacteria | 9724 |
| 1150 | Ga0501044_0024862 | 3300049823 | Bacteria | 6353 |
| 1151 | Ga0501044_0097788 | 3300049823 | Bacteria | 2956 |
| 1152 | Ga0501044_0106072 | 3300049823 | Bacteria | 2822 |
| 1153 | Ga0501044_0217659 | 3300049823 | Bacteria | 1861 |
| 1154 | Ga0501044_0222055 | 3300049823 | Bacteria | 1840 |
| 1155 | Ga0501044_0901185 | 3300049823 | Bacteria | 759 |
| 1156 | Ga0501045_0032328 | 3300049824 | Bacteria | 3792 |
| 1157 | Ga0501045_0581642 | 3300049824 | Bacteria | 830 |
| 1158 | nmdc:mga03n38_36630_c1 | 3300050490 | Bacteria | 2110 |
| 1159 | nmdc:mga03n38_477_c1 | 3300050490 | Bacteria | 10014 |
| 1160 | nmdc:mga0yw44_1049157_c1 | 3300050492 | Bacteria | 551 |
| 1161 | nmdc:mga0yw44_130712_c1 | 3300050492 | Bacteria | 1625 |
| 1162 | nmdc:mga0yw44_187909_c1 | 3300050492 | Bacteria | 1362 |
| 1163 | nmdc:mga06z11_11001_c1 | 3300050494 | Bacteria | 3881 |
| 1164 | nmdc:mga04h51_203941_c1 | 3300050495 | Bacteria | 778 |
| 1165 | nmdc:mga07m45_451589_c1 | 3300050496 | Bacteria | 745 |
| 1166 | nmdc:mga05p37_24408_c1 | 3300050507 | Bacteria | 7347 |
| 1167 | nmdc:mga05p37_440_c1 | 3300050507 | Bacteria | 45174 |
| 1168 | nmdc:mga09592_278_c1 | 3300050508 | Bacteria | 37149 |
| 1169 | nmdc:mga09592_281623_c1 | 3300050508 | Bacteria | 1442 |
| 1170 | nmdc:mga09592_7319_c1 | 3300050508 | Bacteria | 8974 |
| 1171 | nmdc:mga0qj67_20014_c1 | 3300050509 | Bacteria | 5121 |
| 1172 | nmdc:mga0qj67_2876_c1 | 3300050509 | Bacteria | 12357 |
| 1173 | nmdc:mga0qj67_79740_c1 | 3300050509 | Bacteria | 2622 |
| 1174 | nmdc:mga06r32_29384_c1 | 3300050510 | Bacteria | 5151 |
| 1175 | nmdc:mga06r32_4205_c1 | 3300050510 | Bacteria | 12899 |
| 1176 | nmdc:mga06r32_434_c1 | 3300050510 | Bacteria | 35341 |
| 1177 | nmdc:mga08y16_14165_c1 | 3300050511 | Bacteria | 8391 |
| 1178 | nmdc:mga08y16_9696_c1 | 3300050511 | Bacteria | 10110 |
| 1179 | nmdc:mga0n895_502919_c1 | 3300050512 | Bacteria | 1221 |
| 1180 | nmdc:mga0n895_707851_c1 | 3300050512 | Bacteria | 1003 |
| 1181 | nmdc:mga08x19_284937_c1 | 3300050514 | Bacteria | 1145 |
| 1182 | nmdc:mga0a205_137541_c1 | 3300050515 | Bacteria | 2343 |
| 1183 | Ga0495601_0011311 | 3300053077 | Bacteria | 5333 |
| 1184 | Ga0495612_0494029 | 3300053078 | Bacteria | 561 |
| 1185 | Ga0495655_0003679 | 3300053083 | Bacteria | 2552 |
| 1186 | Ga0495655_0040412 | 3300053083 | Bacteria | 1187 |
| 1187 | Ga0495595_0049668 | 3300053084 | Bacteria | 1941 |
| 1188 | Ga0495595_0208890 | 3300053084 | Bacteria | 973 |
| 1189 | Ga0495619_0021775 | 3300053085 | Bacteria | 4095 |
| 1190 | Ga0500578_0176366 | 3300053086 | Bacteria | 1319 |
| 1191 | Ga0500553_158493 | 3300053101 | Bacteria | 856 |
| 1192 | Ga0500593_171213 | 3300053117 | Bacteria | 818 |
| 1193 | Ga0500652_171790 | 3300053131 | Bacteria | 892 |
| 1194 | Ga0500573_0175236 | 3300053140 | Bacteria | 1157 |
| 1195 | Ga0500604_0022630 | 3300053151 | Bacteria | 1786 |
| 1196 | Ga0500616_0012396 | 3300053153 | Bacteria | 4989 |
| 1197 | Ga0501084_0706142 | 3300054114 | Bacteria | 850 |
| 1198 | Ga0501084_0771280 | 3300054114 | Bacteria | 810 |
| 1199 | Ga0590075_069645 | 3300059424 | Bacteria | 908 |
| 1200 | Ga0590077_056836 | 3300059426 | Bacteria | 884 |
| 1201 | Ga0501082_0001608 | 3300060353 | Bacteria | 19895 |
| 1202 | Ga0501082_0866832 | 3300060353 | Bacteria | 790 |
| 1203 | Ga0501082_0867170 | 3300060353 | Bacteria | 790 |
| 1204 | Ga0466962_0002858 | 3300061719 | Bacteria | 8229 |
| 1205 | Ga0466962_0017111 | 3300061719 | Bacteria | 3493 |
| 1206 | Ga0466962_0092535 | 3300061719 | Bacteria | 1449 |
| 1207 | Ga0466962_0291938 | 3300061719 | Bacteria | 806 |
| 1208 | Ga0530510_0458111 | 3300061734 | Bacteria | 965 |
| 1209 | 2554259658 | 2554235005 | Bacteria | 6457341 |
| 1210 | 2585297862 | 2582581312 | Bacteria | 7308206 |
| 1211 | 2585310920 | 2582581313 | Bacteria | 10042643 |
| 1212 | 2585316071 | 2582581314 | Bacteria | 11452267 |
| 1213 | 2616703006 | 2616644814 | Bacteria | 11555299 |
| 1214 | 2616905332 | 2616644941 | Bacteria | 8510691 |
| 1215 | 2643764564 | 2643221548 | Bacteria | 8053412 |
| 1216 | 2643905221 | 2643221578 | Bacteria | 9213798 |
| 1217 | 2643942720 | 2643221587 | Bacteria | 7586415 |
| 1218 | 2644264156 | 2643221647 | Bacteria | 10741251 |
| 1219 | 2644385888 | 2643221670 | Bacteria | 6497041 |
| 1220 | 2644403279 | 2643221673 | Bacteria | 9196637 |
| 1221 | 2644430179 | 2643221677 | Bacteria | 7584031 |
| 1222 | 2644438173 | 2643221678 | Bacteria | 9540101 |
| 1223 | 2644458377 | 2643221682 | Bacteria | 6743283 |
| 1224 | 2644503901 | 2643221690 | Bacteria | 4654705 |
| 1225 | 2644527036 | 2643221694 | Bacteria | 4392972 |
| 1226 | 2644629905 | 2643221714 | Bacteria | 9015452 |
| 1227 | 2644666359 | 2643221721 | Bacteria | 4486924 |
| 1228 | 2644670231 | 2643221722 | Bacteria | 4247614 |
| 1229 | 2734976218 | 2734482000 | Bacteria | 5525167 |
| 1230 | 2784586633 | 2784132148 | Bacteria | 8627943 |
| 1231 | 2785345865 | 2784746763 | Bacteria | 9783172 |
| 1232 | 2785367024 | 2784746768 | Bacteria | 10036182 |
| 1233 | 2786668061 | 2786546132 | Bacteria | 10419719 |
| 1234 | 2804843616 | 2802429296 | Bacteria | 7227771 |
| 1235 | 2808847527 | 2808606359 | Bacteria | 9866990 |
| 1236 | 2808918259 | 2808606375 | Bacteria | 9466072 |
| 1237 | 2809230160 | 2808606448 | Bacteria | 8656184 |
| 1238 | 2811846850 | 2808606982 | Bacteria | 7791042 |
| 1239 | 2812360441 | 2811994879 | Bacteria | 9313447 |
| 1240 | 2812365145 | 2811994880 | Bacteria | 4147780 |
| 1241 | 2812482534 | 2811994917 | Bacteria | 7761064 |
| 1242 | 2819699773 | 2818991463 | Bacteria | 7948711 |
| 1243 | 2839988550 | 2839986021 | Bacteria | 3685650 |
| 1244 | 2852643300 | 2852635781 | Bacteria | 8251373 |
| 1245 | 2862181425 | 2862178590 | Bacteria | 8583590 |
| 1246 | 2862289786 | 2862281513 | Bacteria | 9621493 |
| 1247 | 2862294123 | 2862290372 | Bacteria | 7471434 |
| 1248 | 2862392545 | 2862382967 | Bacteria | 10317375 |
| 1249 | 2862508466 | 2862507626 | Bacteria | 9425308 |
| 1250 | 2862580102 | 2862574272 | Bacteria | 10567477 |
| 1251 | 2862709638 | 2862705112 | Bacteria | 6563286 |
| 1252 | 2863407096 | 2863404153 | Bacteria | 9672205 |
| 1253 | 2867375225 | 2867369537 | Bacteria | 6501581 |
| 1254 | 2867435054 | 2867428634 | Bacteria | 9590268 |
| 1255 | 2867475993 | 2867475112 | Bacteria | 6909112 |
| 1256 | 2873157803 | 2873151551 | Bacteria | 8625867 |
| 1257 | 2875392585 | 2875391855 | Bacteria | 7600475 |
| 1258 | 2877683519 | 2877676314 | Bacteria | 9512378 |
| 1259 | 2884995474 | 2884994152 | Bacteria | 4492978 |
| 1260 | 2912722629 | 2912715099 | Bacteria | 9460473 |
| 1261 | 2912726311 | 2912723979 | Bacteria | 8557534 |
| 1262 | 2912758726 | 2912757875 | Bacteria | 7940295 |
| 1263 | 2918502395 | 2918501144 | Bacteria | 8668083 |
| 1264 | 2919474483 | 2919468124 | Bacteria | 9133025 |
| 1265 | 2935394170 | 2935390628 | Bacteria | 7043367 |
| 1266 | 2935891050 | 2935890801 | Bacteria | 4593001 |
| 1267 | 2946052131 | 2946045630 | Bacteria | 8527308 |
| 1268 | 2946065448 | 2946064051 | Bacteria | 8957905 |
| 1269 | 2946073811 | 2946072368 | Bacteria | 8999607 |
| 1270 | 2947231959 | 2947224130 | Bacteria | 9938529 |
| 1271 | 2954008974 | 2954002825 | Bacteria | 9173742 |
| 1272 | 2954388775 | 2954380949 | Bacteria | 10050426 |
| 1273 | 2954674349 | 2954673503 | Bacteria | 9685905 |
| 1274 | 2954689782 | 2954682443 | Bacteria | 9862841 |
| 1275 | 2954699566 | 2954691527 | Bacteria | 10720516 |
| 1276 | 2954702651 | 2954701450 | Bacteria | 10834262 |
| 1277 | 2954718504 | 2954711539 | Bacteria | 10867210 |
| 1278 | 2954728475 | 2954721474 | Bacteria | 10456478 |
| 1279 | 2954733335 | 2954731030 | Bacteria | 10243860 |
| 1280 | 2954747371 | 2954740390 | Bacteria | 10229294 |
| 1281 | 2954752218 | 2954749733 | Bacteria | 10366972 |
| 1282 | 2954766485 | 2954759201 | Bacteria | 9358192 |
| 1283 | 2966604546 | 2966598605 | Bacteria | 7676064 |
| 1284 | 2990045457 | 2990044586 | Bacteria | 6603797 |
| 1285 | 2990060260 | 2990059506 | Bacteria | 9321252 |
| 1286 | 2990093382 | 2990088156 | Bacteria | 6657676 |
| 1287 | 2997451917 | 2997451912 | Bacteria | 8492419 |
| 1288 | 2997603425 | 2997600082 | Bacteria | 9896405 |
| 1289 | 3003004122 | 3002998708 | Bacteria | 11715108 |
| 1290 | 3006327560 | 3006321560 | Bacteria | 8247479 |
| 1291 | 3006399457 | 3006393351 | Bacteria | 6615579 |
| 1292 | 3006430708 | 3006425503 | Bacteria | 6491253 |
| 1293 | 3006489357 | 3006486233 | Bacteria | 8157040 |
| 1294 | 3006498345 | 3006493962 | Bacteria | 8825450 |
| 1295 | 8008486931 | 8008485437 | Bacteria | 7198341 |
| 1296 | 8008561185 | 8008558824 | Bacteria | 10610750 |
| 1297 | 8008580869 | 8008574985 | Bacteria | 7815457 |
| 1298 | 8023630936 | 8023623736 | Bacteria | 8593882 |
| 1299 | 8025418331 | 8025413630 | Bacteria | 7014048 |
| 1300 | 8025482366 | 8025478263 | Bacteria | 8209203 |
| 1301 | 8025526188 | 8025524527 | Bacteria | 7197316 |
| 1302 | 8025533894 | 8025530807 | Bacteria | 8495698 |
| 1303 | 8033686646 | 8033684223 | Bacteria | 6906479 |
| 1304 | 8047901208 | 8047893842 | Bacteria | 11723082 |
| 1305 | 8048135610 | 8048127548 | Bacteria | 11053136 |
| 1306 | 8048357693 | 8048356638 | Bacteria | 11044339 |
| 1307 | 8048378148 | 8048369669 | Bacteria | 11666822 |
| 1308 | 8048387246 | 8048379754 | Bacteria | 11877923 |
| 1309 | 8048409970 | 8048406513 | Bacteria | 8936924 |
| 1310 | 8054166910 | 8054160619 | Bacteria | 7783213 |
| 1311 | 8056454226 | 8056447290 | Bacteria | 7680491 |
| 1312 | 8056670094 | 8056667051 | Bacteria | 6953971 |
| 1313 | 8056832440 | 8056829672 | Bacteria | 9045328 |
| 1314 | Ga0466962_0003210 | |||
| 1315 | LJQas_1022420 | |||
| 1316 | JGI24737J22298_10241717 | |||
| 1317 | JGI24738J21930_10047848 | |||
| 1318 | JGI24744J21845_10012255 | |||
| 1319 | JGI25406J46586_10004005 | |||
| 1320 | rootH2_10017275 | |||
| 1321 | rootH1_10088192 | |||
| 1322 | JGI25407J50210_10065969 | |||
| 1323 | Ga0070658_10416434 | |||
| 1324 | Ga0070658_10951039 | |||
| 1325 | Ga0070658_11399344 | |||
| 1326 | Ga0070676_11176609 | |||
| 1327 | Ga0070676_11240252 | |||
| 1328 | Ga0070683_100057355 | |||
| 1329 | Ga0070683_100079089 | |||
| 1330 | Ga0070683_100099266 | |||
| 1331 | Ga0070683_100692307 | |||
| 1332 | Ga0070683_101004593 | |||
| 1333 | Ga0070683_101371616 | |||
| 1334 | Ga0070670_101796132 | |||
| 1335 | Ga0068869_100237561 | |||
| 1336 | Ga0070666_10003317 | |||
| 1337 | Ga0070666_10064975 | |||
| 1338 | Ga0070680_100363401 | |||
| 1339 | Ga0070680_100375671 | |||
| 1340 | Ga0070680_100466470 | |||
| 1341 | Ga0070680_100624983 | |||
| 1342 | Ga0070680_101019198 | |||
| 1343 | Ga0070680_101137063 | |||
| 1344 | Ga0070682_100031446 | |||
| 1345 | Ga0070682_100347102 | |||
| 1346 | Ga0070682_101123379 | |||
| 1347 | Ga0068868_100488411 | |||
| 1348 | Ga0070660_100087316 | |||
| 1349 | Ga0070660_100322337 | |||
| 1350 | Ga0070660_100583841 | |||
| 1351 | Ga0070660_101506886 | |||
| 1352 | Ga0070689_100098074 | |||
| 1353 | Ga0070689_100320167 | |||
| 1354 | Ga0070691_10178261 | |||
| 1355 | Ga0070687_100202557 | |||
| 1356 | Ga0070661_100103154 | |||
| 1357 | Ga0070661_100241199 | |||
| 1358 | Ga0070692_10027073 | |||
| 1359 | Ga0070692_10491384 | |||
| 1360 | Ga0070668_100002900 | |||
| 1361 | Ga0070668_100369390 | |||
| 1362 | Ga0070669_100030781 | |||
| 1363 | Ga0070669_101798354 | |||
| 1364 | Ga0070675_101509305 | |||
| 1365 | Ga0070671_100021033 | |||
| 1366 | Ga0070674_100136314 | |||
| 1367 | Ga0070674_100313986 | |||
| 1368 | Ga0070674_100352446 | |||
| 1369 | Ga0070674_100767046 | |||
| 1370 | Ga0070673_100005872 | |||
| 1371 | Ga0070688_100721125 | |||
| 1372 | Ga0070659_100015723 | |||
| 1373 | Ga0070659_100333228 | |||
| 1374 | Ga0070659_100386821 | |||
| 1375 | Ga0070659_101817722 | |||
| 1376 | Ga0070667_100006026 | |||
| 1377 | Ga0070667_100021661 | |||
| 1378 | Ga0070703_10015033 | |||
| 1379 | Ga0070714_100498172 | |||
| 1380 | Ga0070714_101104250 | |||
| 1381 | Ga0070713_100063224 | |||
| 1382 | Ga0070710_10318990 | |||
| 1383 | Ga0070701_10004746 | |||
| 1384 | Ga0070701_10047674 | |||
| 1385 | Ga0070711_100007302 | |||
| 1386 | Ga0070705_100009475 | |||
| 1387 | Ga0070705_101231193 | |||
| 1388 | Ga0070700_100000406 | |||
| 1389 | Ga0070700_100779527 | |||
| 1390 | Ga0070694_100993214 | |||
| 1391 | Ga0070663_100033790 | |||
| 1392 | Ga0070663_100260717 | |||
| 1393 | Ga0070663_100522872 | |||
| 1394 | Ga0070678_100025304 | |||
| 1395 | Ga0070662_100033899 | |||
| 1396 | Ga0070681_10005943 | |||
| 1397 | Ga0070681_10136451 | |||
| 1398 | Ga0070681_10466558 | |||
| 1399 | Ga0068867_100087869 | |||
| 1400 | Ga0070685_10903264 | |||
| 1401 | Ga0070698_101341055 | |||
| 1402 | Ga0070679_100003650 | |||
| 1403 | Ga0070679_100638187 | |||
| 1404 | Ga0070684_100144067 | |||
| 1405 | Ga0070684_100177198 | |||
| 1406 | Ga0070684_101048408 | |||
| 1407 | Ga0070684_102035952 | |||
| 1408 | Ga0070697_101314041 | |||
| 1409 | Ga0068853_100135581 | |||
| 1410 | Ga0068853_100138197 | |||
| 1411 | Ga0068853_100661340 | |||
| 1412 | Ga0070672_100115779 | |||
| 1413 | Ga0070672_100239782 | |||
| 1414 | Ga0070672_100518096 | |||
| 1415 | Ga0070672_102006595 | |||
| 1416 | Ga0070686_100492382 | |||
| 1417 | Ga0070695_100446010 | |||
| 1418 | Ga0070696_100311025 | |||
| 1419 | Ga0070693_100118389 | |||
| 1420 | Ga0070693_100369792 | |||
| 1421 | Ga0070665_100003227 | |||
| 1422 | Ga0070665_100055978 | |||
| 1423 | Ga0070665_100620528 | |||
| 1424 | Ga0070665_100785740 | |||
| 1425 | Ga0070704_100037730 | |||
| 1426 | Ga0068855_100021450 | |||
| 1427 | Ga0068855_100057120 | |||
| 1428 | Ga0068855_100059143 | |||
| 1429 | Ga0068855_100424958 | |||
| 1430 | Ga0068855_100835986 | |||
| 1431 | Ga0070664_100178256 | |||
| 1432 | Ga0070664_100999770 | |||
| 1433 | Ga0068857_100452244 | |||
| 1434 | Ga0068857_101249726 | |||
| 1435 | Ga0068854_100306816 | |||
| 1436 | Ga0068854_101810675 | |||
| 1437 | Ga0068856_100088421 | |||
| 1438 | Ga0068856_100147033 | |||
| 1439 | Ga0068856_100174480 | |||
| 1440 | Ga0068856_100651890 | |||
| 1441 | Ga0068856_101404496 | |||
| 1442 | Ga0070702_100033494 | |||
| 1443 | Ga0070702_100253317 | |||
| 1444 | Ga0068852_100020158 | |||
| 1445 | Ga0068852_100111044 | |||
| 1446 | Ga0068852_100674790 | |||
| 1447 | Ga0068859_100002361 | |||
| 1448 | Ga0068859_100221522 | |||
| 1449 | Ga0068859_100809523 | |||
| 1450 | Ga0068864_100041671 | |||
| 1451 | Ga0068866_10203000 | |||
| 1452 | Ga0068861_100048872 | |||
| 1453 | Ga0068861_100126857 | |||
| 1454 | Ga0068861_101266966 | |||
| 1455 | Ga0068851_10058629 | |||
| 1456 | Ga0068851_10619920 | |||
| 1457 | Ga0068870_10001067 | |||
| 1458 | Ga0068870_10083920 | |||
| 1459 | Ga0068863_100004882 | |||
| 1460 | Ga0068863_100073740 | |||
| 1461 | Ga0068858_100013689 | |||
| 1462 | Ga0068858_100039448 | |||
| 1463 | Ga0068858_102578238 | |||
| 1464 | Ga0068860_100000035 | |||
| 1465 | Ga0068860_100042424 | |||
| 1466 | Ga0068860_101758013 | |||
| 1467 | Ga0068862_100067953 | |||
| 1468 | Ga0068862_101820475 | |||
| 1469 | Ga0081455_10002276 | |||
| 1470 | Ga0081455_10025771 | |||
| 1471 | Ga0081455_10041731 | |||
| 1472 | Ga0081455_10583797 | |||
| 1473 | Ga0081538_10000036 | |||
| 1474 | Ga0081538_10056572 | |||
| 1475 | Ga0081538_10097228 | |||
| 1476 | Ga0081540_1010407 | |||
| 1477 | Ga0081539_10000643 | |||
| 1478 | Ga0070717_10034948 | |||
| 1479 | Ga0070717_11384185 | |||
| 1480 | Ga0075365_10024472 | |||
| 1481 | Ga0075365_10060650 | |||
| 1482 | Ga0075365_10431348 | |||
| 1483 | Ga0075365_10989443 | |||
| 1484 | Ga0075368_10205485 | |||
| 1485 | Ga0075363_100052481 | |||
| 1486 | Ga0075363_100297682 | |||
| 1487 | Ga0075432_10063772 | |||
| 1488 | Ga0070715_10817501 | |||
| 1489 | Ga0070712_100052549 | |||
| 1490 | Ga0070712_100945669 | |||
| 1491 | Ga0075362_10726223 | |||
| 1492 | Ga0075367_10007402 | |||
| 1493 | Ga0097621_100363228 | |||
| 1494 | Ga0097621_100371584 | |||
| 1495 | Ga0068871_100009798 | |||
| 1496 | Ga0068871_100446913 | |||
| 1497 | Ga0075428_100001304 | |||
| 1498 | Ga0075428_100089562 | |||
| 1499 | Ga0075428_100274270 | |||
| 1500 | Ga0075430_100006263 | |||
| 1501 | Ga0075430_100026196 | |||
| 1502 | Ga0075431_100002908 | |||
| 1503 | Ga0075431_100008250 | |||
| 1504 | Ga0075431_100012439 | |||
| 1505 | Ga0075433_10006767 | |||
| 1506 | Ga0075433_10291184 | |||
| 1507 | Ga0075434_100051928 | |||
| 1508 | Ga0075434_100511789 | |||
| 1509 | Ga0075429_100001324 | |||
| 1510 | Ga0075429_100005562 | |||
| 1511 | Ga0068865_100022810 | |||
| 1512 | Ga0068865_100039489 | |||
| 1513 | Ga0068865_101485019 | |||
| 1514 | Ga0068865_101684194 | |||
| 1515 | Ga0075436_100030843 | |||
| 1516 | Ga0097620_100002361 | |||
| 1517 | Ga0097620_100221504 | |||
| 1518 | Ga0097620_100809550 | |||
| 1519 | Ga0099826_10058874 | |||
| 1520 | Ga0075435_100250842 | |||
| 1521 | Ga0105251_10088971 | |||
| 1522 | Ga0105240_10012487 | |||
| 1523 | Ga0105240_10066086 | |||
| 1524 | Ga0105240_10138708 | |||
| 1525 | Ga0111539_10038306 | |||
| 1526 | Ga0111539_10564347 | |||
| 1527 | Ga0111539_11990147 | |||
| 1528 | Ga0105245_10034424 | |||
| 1529 | Ga0105245_10066039 | |||
| 1530 | Ga0105245_10907041 | |||
| 1531 | Ga0105245_11219824 | |||
| 1532 | Ga0105247_10003264 | |||
| 1533 | Ga0105247_10013085 | |||
| 1534 | Ga0105247_10110891 | |||
| 1535 | Ga0114129_10026601 | |||
| 1536 | Ga0114129_10080508 | |||
| 1537 | Ga0105243_10017305 | |||
| 1538 | Ga0105243_10029336 | |||
| 1539 | Ga0105243_10421646 | |||
| 1540 | Ga0105243_11390273 | |||
| 1541 | Ga0105241_10016040 | |||
| 1542 | Ga0105241_10092112 | |||
| 1543 | Ga0105241_10313472 | |||
| 1544 | Ga0105241_10818451 | |||
| 1545 | Ga0105242_10090413 | |||
| 1546 | Ga0105242_10411505 | |||
| 1547 | Ga0105242_10534754 | |||
| 1548 | Ga0105242_10704143 | |||
| 1549 | Ga0105248_10028128 | |||
| 1550 | Ga0105248_10094722 | |||
| 1551 | Ga0105248_11657239 | |||
| 1552 | Ga0105237_10091480 | |||
| 1553 | Ga0105237_10261480 | |||
| 1554 | Ga0105237_10935616 | |||
| 1555 | Ga0105237_11198280 | |||
| 1556 | Ga0105237_11547122 | |||
| 1557 | Ga0105237_12773299 | |||
| 1558 | Ga0105238_10130917 | |||
| 1559 | Ga0105238_10413460 | |||
| 1560 | Ga0105238_10433003 | |||
| 1561 | Ga0105238_12241857 | |||
| 1562 | Ga0105249_10135602 | |||
| 1563 | Ga0105249_10688100 | |||
| 1564 | Ga0105249_11302646 | |||
| 1565 | Ga0105249_12470749 | |||
| 1566 | Ga0105239_10362082 | |||
| 1567 | Ga0105239_10393835 | |||
| 1568 | Ga0105239_10589429 | |||
| 1569 | Ga0105239_10803279 | |||
| 1570 | Ga0105239_10871389 | |||
| 1571 | Ga0105246_10003223 | |||
| 1572 | Ga0105246_10383410 | |||
| 1573 | Ga0105246_10772831 | |||
| 1574 | Ga0157373_10168923 | |||
| 1575 | Ga0157371_10365025 | |||
| 1576 | Ga0157371_10604129 | |||
| 1577 | Ga0157370_10045502 | |||
| 1578 | Ga0157370_10194714 | |||
| 1579 | Ga0157370_10351827 | |||
| 1580 | Ga0157370_10717088 | |||
| 1581 | Ga0157370_11449549 | |||
| 1582 | Ga0157370_11781084 | |||
| 1583 | Ga0157369_10018735 | |||
| 1584 | Ga0157369_10040889 | |||
| 1585 | Ga0157369_10087776 | |||
| 1586 | Ga0157369_10137846 | |||
| 1587 | Ga0157369_10174224 | |||
| 1588 | Ga0157369_10220041 | |||
| 1589 | Ga0157369_11059610 | |||
| 1590 | Ga0157369_11539011 | |||
| 1591 | Ga0157374_10567314 | |||
| 1592 | Ga0157374_11311054 | |||
| 1593 | Ga0157374_11977993 | |||
| 1594 | Ga0157374_12555383 | |||
| 1595 | Ga0157378_10271920 | |||
| 1596 | Ga0163162_10014032 | |||
| 1597 | Ga0163162_11056109 | |||
| 1598 | Ga0163162_11310563 | |||
| 1599 | Ga0157372_10045237 | |||
| 1600 | Ga0157372_10055403 | |||
| 1601 | Ga0157372_10060103 | |||
| 1602 | Ga0157372_10111409 | |||
| 1603 | Ga0157372_10202728 | |||
| 1604 | Ga0157372_10240579 | |||
| 1605 | Ga0157372_11867886 | |||
| 1606 | Ga0157375_10323885 | |||
| 1607 | Ga0157375_10418780 | |||
| 1608 | Ga0157375_10628424 | |||
| 1609 | Ga0157375_11907443 | |||
| 1610 | Ga0163163_10068051 | |||
| 1611 | Ga0163163_10647185 | |||
| 1612 | Ga0163163_12596318 | |||
| 1613 | Ga0157380_10002480 | |||
| 1614 | Ga0157380_10374551 | |||
| 1615 | Ga0157380_11026518 | |||
| 1616 | Ga0182008_10003052 | |||
| 1617 | Ga0182008_10093452 | |||
| 1618 | Ga0182008_10153283 | |||
| 1619 | Ga0157379_10023014 | |||
| 1620 | Ga0157379_10276379 | |||
| 1621 | Ga0157379_10932075 | |||
| 1622 | Ga0157379_11657985 | |||
| 1623 | Ga0157376_10113096 | |||
| 1624 | Ga0157376_10413661 | |||
| 1625 | Ga0157376_11070113 | |||
| 1626 | Ga0182006_1018487 | |||
| 1627 | Ga0182007_10002246 | |||
| 1628 | Ga0182005_1036209 | |||
| 1629 | Ga0183367_1003 | |||
| 1630 | Ga0163161_10023316 | |||
| 1631 | Ga0163161_10268867 | |||
| 1632 | Ga0163161_10745113 | |||
| 1633 | Ga0163161_11008509 | |||
| 1634 | Ga0163161_11566421 | |||
| 1635 | Ga0197907_10033713 | |||
| 1636 | Ga0206356_10468274 | |||
| 1637 | Ga0206356_11002279 | |||
| 1638 | Ga0206356_11595527 | |||
| 1639 | Ga0206352_10982403 | |||
| 1640 | Ga0206352_11358692 | |||
| 1641 | Ga0206354_11337459 | |||
| 1642 | Ga0206354_11619843 | |||
| 1643 | Ga0206353_10029995 | |||
| 1644 | Ga0206353_10259526 | |||
| 1645 | Ga0206353_10358891 | |||
| 1646 | Ga0206353_10968491 | |||
| 1647 | Ga0206353_11192181 | |||
| 1648 | Ga0206353_11246040 | |||
| 1649 | Ga0206353_11341543 | |||
| 1650 | Ga0213875_10122117 | |||
| 1651 | Ga0213875_10399456 | |||
| 1652 | Ga0224712_10526188 | |||
| 1653 | Ga0209758_1011831 | |||
| 1654 | Ga0207656_10203249 | |||
| 1655 | Ga0207655_1230742 | |||
| 1656 | Ga0207653_10013683 | |||
| 1657 | Ga0207682_10089490 | |||
| 1658 | Ga0207692_10071362 | |||
| 1659 | Ga0207642_10020485 | |||
| 1660 | Ga0207642_10207100 | |||
| 1661 | Ga0207710_10018543 | |||
| 1662 | Ga0207688_10005436 | |||
| 1663 | Ga0207688_10022147 | |||
| 1664 | Ga0207680_10007745 | |||
| 1665 | Ga0207680_10013189 | |||
| 1666 | Ga0207647_10075726 | |||
| 1667 | Ga0207685_10154324 | |||
| 1668 | Ga0207685_10617342 | |||
| 1669 | Ga0207699_10521729 | |||
| 1670 | Ga0207643_10001879 | |||
| 1671 | Ga0207643_10071311 | |||
| 1672 | Ga0207705_10008652 | |||
| 1673 | Ga0207705_10126804 | |||
| 1674 | Ga0207705_10212246 | |||
| 1675 | Ga0207705_10337834 | |||
| 1676 | Ga0207705_10417605 | |||
| 1677 | Ga0207654_10015189 | |||
| 1678 | Ga0207654_10328826 | |||
| 1679 | Ga0207654_10331453 | |||
| 1680 | Ga0207707_10106548 | |||
| 1681 | Ga0207707_10276080 | |||
| 1682 | Ga0207695_10048226 | |||
| 1683 | Ga0207671_10513993 | |||
| 1684 | Ga0207671_10637901 | |||
| 1685 | Ga0207671_11121285 | |||
| 1686 | Ga0207693_10000761 | |||
| 1687 | Ga0207693_10565252 | |||
| 1688 | Ga0207663_10359681 | |||
| 1689 | Ga0207660_10189323 | |||
| 1690 | Ga0207660_10596487 | |||
| 1691 | Ga0207660_10777114 | |||
| 1692 | Ga0207660_10974121 | |||
| 1693 | Ga0207662_10019622 | |||
| 1694 | Ga0207662_10947410 | |||
| 1695 | Ga0207657_10030578 | |||
| 1696 | Ga0207657_10072328 | |||
| 1697 | Ga0207657_10148879 | |||
| 1698 | Ga0207657_10265778 | |||
| 1699 | Ga0207657_10352389 | |||
| 1700 | Ga0207649_10213247 | |||
| 1701 | Ga0207652_10014337 | |||
| 1702 | Ga0207652_10191667 | |||
| 1703 | Ga0207652_11691103 | |||
| 1704 | Ga0207681_10461190 | |||
| 1705 | Ga0207650_10473129 | |||
| 1706 | Ga0207659_10298618 | |||
| 1707 | Ga0207659_11030345 | |||
| 1708 | Ga0207687_10057785 | |||
| 1709 | Ga0207687_10435958 | |||
| 1710 | Ga0207687_10889889 | |||
| 1711 | Ga0207687_10973556 | |||
| 1712 | Ga0207664_10004124 | |||
| 1713 | Ga0207664_10275579 | |||
| 1714 | Ga0207664_11673943 | |||
| 1715 | Ga0207644_10054720 | |||
| 1716 | Ga0207690_10041933 | |||
| 1717 | Ga0207690_10054124 | |||
| 1718 | Ga0207706_10006255 | |||
| 1719 | Ga0207686_10040933 | |||
| 1720 | Ga0207686_10050863 | |||
| 1721 | Ga0207709_10466789 | |||
| 1722 | Ga0207709_10593398 | |||
| 1723 | Ga0207709_10825308 | |||
| 1724 | Ga0207670_10253513 | |||
| 1725 | Ga0207670_10357041 | |||
| 1726 | Ga0207669_10089674 | |||
| 1727 | Ga0207704_10041136 | |||
| 1728 | Ga0207704_10107073 | |||
| 1729 | Ga0207704_11595553 | |||
| 1730 | Ga0207665_10000422 | |||
| 1731 | Ga0207691_10027476 | |||
| 1732 | Ga0207691_10142229 | |||
| 1733 | Ga0207691_10322125 | |||
| 1734 | Ga0207691_10787429 | |||
| 1735 | Ga0207711_10102174 | |||
| 1736 | Ga0207689_10008948 | |||
| 1737 | Ga0207689_10367736 | |||
| 1738 | Ga0207689_10939378 | |||
| 1739 | Ga0207661_10085644 | |||
| 1740 | Ga0207661_10423064 | |||
| 1741 | Ga0207661_10626118 | |||
| 1742 | Ga0207661_11530451 | |||
| 1743 | Ga0207661_12127299 | |||
| 1744 | Ga0207679_10437057 | |||
| 1745 | Ga0207679_10826774 | |||
| 1746 | Ga0207667_10016618 | |||
| 1747 | Ga0207667_10086751 | |||
| 1748 | Ga0207667_11786271 | |||
| 1749 | Ga0207651_10161527 | |||
| 1750 | Ga0207712_10021402 | |||
| 1751 | Ga0207712_10027364 | |||
| 1752 | Ga0207668_10034693 | |||
| 1753 | Ga0207668_10168949 | |||
| 1754 | Ga0207668_10436276 | |||
| 1755 | Ga0207640_10084665 | |||
| 1756 | Ga0207640_10461976 | |||
| 1757 | Ga0207640_10734821 | |||
| 1758 | Ga0207658_10085070 | |||
| 1759 | Ga0207658_10490683 | |||
| 1760 | Ga0207677_10029126 | |||
| 1761 | Ga0207677_12017061 | |||
| 1762 | Ga0207703_10026842 | |||
| 1763 | Ga0207703_10132231 | |||
| 1764 | Ga0207639_10152740 | |||
| 1765 | Ga0207639_10799056 | |||
| 1766 | Ga0207639_10819544 | |||
| 1767 | Ga0207639_11695635 | |||
| 1768 | Ga0207678_10001278 | |||
| 1769 | Ga0207678_10152307 | |||
| 1770 | Ga0207678_10459733 | |||
| 1771 | Ga0207678_10501361 | |||
| 1772 | Ga0207678_10766732 | |||
| 1773 | Ga0207708_10011571 | |||
| 1774 | Ga0207708_10064908 | |||
| 1775 | Ga0207702_10186047 | |||
| 1776 | Ga0207702_10485092 | |||
| 1777 | Ga0207702_10531607 | |||
| 1778 | Ga0207702_10547838 | |||
| 1779 | Ga0207702_10750895 | |||
| 1780 | Ga0207641_10047443 | |||
| 1781 | Ga0207641_10720561 | |||
| 1782 | Ga0207648_10010968 | |||
| 1783 | Ga0207648_11959471 | |||
| 1784 | Ga0207676_10249253 | |||
| 1785 | Ga0207676_10297790 | |||
| 1786 | Ga0207676_10695211 | |||
| 1787 | Ga0207676_11082651 | |||
| 1788 | Ga0207674_10395498 | |||
| 1789 | Ga0207674_10656676 | |||
| 1790 | Ga0207675_100000862 | |||
| 1791 | Ga0207675_100020738 | |||
| 1792 | Ga0207675_100315973 | |||
| 1793 | Ga0207683_10004856 | |||
| 1794 | Ga0207683_11000267 | |||
| 1795 | Ga0207698_10251581 | |||
| 1796 | Ga0207698_10265222 | |||
| 1797 | Ga0207698_10433076 | |||
| 1798 | Ga0207698_12274804 | |||
| 1799 | Ga0207428_10026948 | |||
| 1800 | Ga0207428_10039472 | |||
| 1801 | Ga0268266_10001967 | |||
| 1802 | Ga0268266_10091476 | |||
| 1803 | Ga0268265_11154206 | |||
| 1804 | Ga0268264_10000031 | |||
| 1805 | Ga0307517_10019375 | |||
| 1806 | Ga0307515_10123150 | |||
| 1807 | Ga0307515_10291706 | |||
| 1808 | Ga0307515_10377507 | |||
| 1809 | Ga0307515_10778599 | |||
| 1810 | Ga0307511_10170176 | |||
| 1811 | Ga0307512_10002110 | |||
| 1812 | Ga0307512_10060866 | |||
| 1813 | Ga0307512_10432447 | |||
| 1814 | Ga0307513_10007381 | |||
| 1815 | Ga0307513_10010672 | |||
| 1816 | Ga0307513_10032151 | |||
| 1817 | Ga0307513_10340187 | |||
| 1818 | Ga0307513_10738580 | |||
| 1819 | Ga0307408_101994187 | |||
| 1820 | Ga0307508_10027978 | |||
| 1821 | Ga0307508_10239572 | |||
| 1822 | Ga0307514_10023923 | |||
| 1823 | Ga0307514_10143365 | |||
| 1824 | Ga0316575_10100952 | |||
| 1825 | Ga0316579_10044004 | |||
| 1826 | Ga0316579_10207008 | |||
| 1827 | Ga0316576_10024631 | |||
| 1828 | Ga0316576_10025917 | |||
| 1829 | Ga0316576_10117753 | |||
| 1830 | Ga0316576_10281019 | |||
| 1831 | Ga0316578_10001886 | |||
| 1832 | Ga0316578_10015230 | |||
| 1833 | Ga0316578_10018168 | |||
| 1834 | Ga0316578_10181487 | |||
| 1835 | Ga0316578_10614932 | |||
| 1836 | Ga0307516_10009713 | |||
| 1837 | Ga0307516_10068201 | |||
| 1838 | Ga0307516_10234914 | |||
| 1839 | Ga0307516_10456332 | |||
| 1840 | Ga0316577_10021049 | |||
| 1841 | Ga0316577_10075467 | |||
| 1842 | Ga0307413_10048253 | |||
| 1843 | Ga0307413_10669635 | |||
| 1844 | Ga0307413_10831896 | |||
| 1845 | Ga0307410_10206833 | |||
| 1846 | Ga0307410_10362754 | |||
| 1847 | Ga0307410_10707731 | |||
| 1848 | Ga0307406_10072872 | |||
| 1849 | Ga0307406_10285993 | |||
| 1850 | Ga0307406_11131994 | |||
| 1851 | Ga0307407_10884813 | |||
| 1852 | Ga0307412_10583789 | |||
| 1853 | Ga0307409_100037961 | |||
| 1854 | Ga0307409_100200923 | |||
| 1855 | Ga0307409_100206187 | |||
| 1856 | Ga0307409_101095167 | |||
| 1857 | Ga0307409_101670739 | |||
| 1858 | Ga0307409_101907747 | |||
| 1859 | Ga0307409_102207635 | |||
| 1860 | Ga0307416_100133084 | |||
| 1861 | Ga0307416_100168408 | |||
| 1862 | Ga0307414_10246508 | |||
| 1863 | Ga0307411_10313990 | |||
| 1864 | Ga0307411_10812345 | |||
| 1865 | Ga0307415_100006661 | |||
| 1866 | Ga0307415_100622755 | |||
| 1867 | Ga0316583_10023364 | |||
| 1868 | Ga0316583_10027161 | |||
| 1869 | Ga0316585_10022745 | |||
| 1870 | Ga0316585_10100688 | |||
| 1871 | Ga0316580_10034779 | |||
| 1872 | Ga0316580_10038366 | |||
| 1873 | Ga0316580_10121598 | |||
| 1874 | Ga0316580_10206343 | |||
| 1875 | Ga0373930_0048644 | |||
| 1876 | Ga0373958_0055269 | |||
| 1877 | Ga0373959_0032445 | |||
| 1878 | Ga0373938_0016011 | |||
| 1879 | Ga0373928_0008878 | |||
| 1880 | Ga0373934_0372565 | |||
| 1881 | Ga0373932_0084710 | |||
| 1882 | Ga0373941_0120182 | |||
| 1883 | Ga0373960_0004260 | |||
| 1884 | Ga0373942_0075556 | |||
| 1885 | Ga0373962_0263856 | |||
| 1886 | Ga0316574_0002927 | |||
| 1887 | Ga0316574_0006864 | |||
| 1888 | Ga0316574_0028324 | |||
| 1889 | Ga0316574_0039475 | |||
| 1890 | Ga0316574_0181112 | |||
| 1891 | Ga0373931_0396935 | |||
| 1892 | Ga0373935_0652500 | |||
| 1893 | Ga0373927_0769922 | |||
| 1894 | Ga0373947_0630113 | |||
| 1895 | Ga0373937_0104761 | |||
| 1896 | Ga0316582_0004636 | |||
| 1897 | Ga0316582_0005574 | |||
| 1898 | Ga0316582_0228293 | |||
| 1899 | Ga0316582_0950418 | |||
| 1900 | Ga0316584_0001080 | |||
| 1901 | Ga0316584_0002346 | |||
| 1902 | Ga0316584_0006442 | |||
| 1903 | Ga0316584_0024754 | |||
| 1904 | Ga0316584_0071727 | |||
| 1905 | Ga0316584_0146750 | |||
| 1906 | Ga0373925_0761311 | |||
| 1907 | Ga0373925_0974753 | |||
| 1908 | Ga0373925_1060720 | |||
| 1909 | Ga0373925_1444953 | |||
| 1910 | Ga0395899_0014945 | |||
| 1911 | Ga0395899_0239675 | |||
| 1912 | Ga0395900_0144673 | |||
| 1913 | Ga0395900_0244171 | |||
| 1914 | Ga0395900_0309186 | |||
| 1915 | Ga0395898_0002926 | |||
| 1916 | Ga0395898_0008650 | |||
| 1917 | Ga0395898_0023615 | |||
| 1918 | Ga0395898_0094206 | |||
| 1919 | Ga0395898_0584518 | |||
| 1920 | Ga0395898_0910125 | |||
| 1921 | Ga0395905_0012794 | |||
| 1922 | Ga0395905_0307721 | |||
| 1923 | Ga0395905_0355771 | |||
| 1924 | Ga0436364_0312246 | |||
| 1925 | Ga0436364_0487929 | |||
| 1926 | Ga0436364_0747706 | |||
| 1927 | Ga0395901_0021839 | |||
| 1928 | Ga0395901_0070161 | |||
| 1929 | Ga0395901_0220702 | |||
| 1930 | Ga0395901_1705059 | |||
| 1931 | Ga0439436_0004809 | |||
| 1932 | Ga0439436_0035109 | |||
| 1933 | Ga0439438_110365 | |||
| 1934 | Ga0439439_0002892 | |||
| 1935 | Ga0439461_0179366 | |||
| 1936 | Ga0439466_0057028 | |||
| 1937 | Ga0451787_443561 | |||
| 1938 | Ga0451789_0357655 | |||
| 1939 | Ga0451789_0403977 | |||
| 1940 | Ga0451791_1032014 | |||
| 1941 | Ga0451793_1705097 | |||
| 1942 | Ga0451797_0119615 | |||
| 1943 | Ga0451797_0425520 | |||
| 1944 | Ga0451797_0900995 | |||
| 1945 | Ga0451795_1315360 | |||
| 1946 | Ga0451795_1425503 | |||
| 1947 | Ga0451795_1527499 | |||
| 1948 | Ga0451800_0913216 | |||
| 1949 | Ga0451800_1276582 | |||
| 1950 | Ga0451804_0978374 | |||
| 1951 | Ga0451837_0844599 | |||
| 1952 | Ga0451839_0451422 | |||
| 1953 | Ga0451839_0878520 | |||
| 1954 | Ga0451845_0934553 | |||
| 1955 | Ga0451847_0328072 | |||
| 1956 | Ga0451851_0409766 | |||
| 1957 | Ga0451843_1398884 | |||
| 1958 | Ga0451855_0876493 | |||
| 1959 | Ga0451853_0925178 | |||
| 1960 | Ga0451853_1111976 | |||
| 1961 | Ga0451853_1397591 | |||
| 1962 | Ga0451853_2120126 | |||
| 1963 | Ga0451853_3106522 | |||
| 1964 | Ga0451853_3509953 | |||
| 1965 | Ga0439433_0001111 | |||
| 1966 | Ga0439442_013843 | |||
| 1967 | Ga0439448_0052233 | |||
| 1968 | Ga0439448_0365740 | |||
| 1969 | Ga0439449_0019483 | |||
| 1970 | Ga0439449_0091794 | |||
| 1971 | Ga0439455_0010486 | |||
| 1972 | Ga0439455_0025944 | |||
| 1973 | Ga0439457_000050 | |||
| 1974 | Ga0439457_001276 | |||
| 1975 | Ga0439457_008844 | |||
| 1976 | Ga0439462_0005042 | |||
| 1977 | Ga0450894_000402 | |||
| 1978 | Ga0450899_000036 | |||
| 1979 | Ga0450900_042940 | |||
| 1980 | Ga0450903_000797 | |||
| 1981 | Ga0450906_101925 | |||
| 1982 | Ga0439458_0006796 | |||
| 1983 | Ga0466969_0010992 | |||
| 1984 | Ga0466969_0013005 | |||
| 1985 | Ga0466969_0030942 | |||
| 1986 | Ga0466969_0110907 | |||
| 1987 | Ga0466969_0220074 | |||
| 1988 | Ga0466972_0007258 | |||
| 1989 | Ga0466972_0009587 | |||
| 1990 | Ga0466972_0072859 | |||
| 1991 | Ga0466972_0088945 | |||
| 1992 | Ga0466972_0162133 | |||
| 1993 | Ga0466972_0236880 | |||
| 1994 | Ga0466972_0532276 | |||
| 1995 | Ga0466972_0536432 | |||
| 1996 | Ga0466965_0001744 | |||
| 1997 | Ga0466965_0010965 | |||
| 1998 | Ga0466965_0043535 | |||
| 1999 | Ga0466965_0057857 | |||
| 2000 | Ga0466965_0169242 | |||
| 2001 | Ga0466965_0282760 | |||
| 2002 | Ga0466966_0002073 | |||
| 2003 | Ga0466966_0005617 | |||
| 2004 | Ga0466966_0025000 | |||
| 2005 | Ga0466966_0028829 | |||
| 2006 | Ga0466966_0142757 | |||
| 2007 | Ga0466966_0165133 | |||
| 2008 | Ga0466966_0230017 | |||
| 2009 | Ga0466966_0260620 | |||
| 2010 | Ga0466966_0453423 | |||
| 2011 | Ga0466961_0008931 | |||
| 2012 | Ga0466961_0014704 | |||
| 2013 | Ga0466961_0014898 | |||
| 2014 | Ga0466961_0045254 | |||
| 2015 | Ga0466961_0053016 | |||
| 2016 | Ga0466961_0132317 | |||
| 2017 | Ga0466961_0202977 | |||
| 2018 | Ga0466961_0247600 | |||
| 2019 | Ga0466961_0262829 | |||
| 2020 | Ga0466961_0366455 | |||
| 2021 | Ga0466961_0509618 | |||
| 2022 | Ga0466963_0000954 | |||
| 2023 | Ga0466963_0001197 | |||
| 2024 | Ga0466963_0002952 | |||
| 2025 | Ga0466963_0027689 | |||
| 2026 | Ga0466963_0036308 | |||
| 2027 | Ga0466963_0042041 | |||
| 2028 | Ga0466963_0083036 | |||
| 2029 | Ga0466963_0172772 | |||
| 2030 | Ga0466963_0207778 | |||
| 2031 | Ga0466963_0784525 | |||
| 2032 | Ga0466963_0920574 | |||
| 2033 | Ga0466964_0033613 | |||
| 2034 | Ga0466964_0050199 | |||
| 2035 | Ga0466964_0059076 | |||
| 2036 | Ga0466964_0155505 | |||
| 2037 | Ga0466964_0559184 | |||
| 2038 | Ga0466971_0002834 | |||
| 2039 | Ga0466971_0005350 | |||
| 2040 | Ga0466971_0009159 | |||
| 2041 | Ga0466971_0462942 | |||
| 2042 | Ga0466968_0130881 | |||
| 2043 | Ga0466968_0299683 | |||
| 2044 | Ga0466968_0338362 | |||
| 2045 | Ga0466970_0002112 | |||
| 2046 | Ga0466970_0006676 | |||
| 2047 | Ga0466970_0056600 | |||
| 2048 | Ga0466970_0139243 | |||
| 2049 | Ga0466970_0216939 | |||
| 2050 | Ga0466970_0318905 | |||
| 2051 | Ga0466970_0322202 | |||
| 2052 | Ga0466970_0586225 | |||
| 2053 | Ga0466957_0002224 | |||
| 2054 | Ga0466957_0017495 | |||
| 2055 | Ga0466957_0033658 | |||
| 2056 | Ga0466957_0054096 | |||
| 2057 | Ga0466957_0074321 | |||
| 2058 | Ga0466957_0250016 | |||
| 2059 | Ga0466960_0006393 | |||
| 2060 | Ga0466960_0009062 | |||
| 2061 | Ga0466960_0017315 | |||
| 2062 | Ga0466960_0171892 | |||
| 2063 | Ga0466960_0357114 | |||
| 2064 | Ga0466960_0750356 | |||
| 2065 | Ga0466959_0001862 | |||
| 2066 | Ga0466959_0004316 | |||
| 2067 | Ga0466959_0035444 | |||
| 2068 | Ga0466959_0113081 | |||
| 2069 | Ga0466959_0127788 | |||
| 2070 | Ga0466959_0190193 | |||
| 2071 | Ga0466959_0224473 | |||
| 2072 | Ga0466959_0571240 | |||
| 2073 | Ga0466959_0922226 | |||
| 2074 | Ga0466959_1192868 | |||
| 2075 | Ga0466958_0002184 | |||
| 2076 | Ga0466958_0005815 | |||
| 2077 | Ga0466958_0008194 | |||
| 2078 | Ga0466958_0015510 | |||
| 2079 | Ga0466958_0037010 | |||
| 2080 | Ga0466958_0139625 | |||
| 2081 | Ga0466958_0243493 | |||
| 2082 | Ga0466958_0245045 | |||
| 2083 | Ga0466958_0353297 | |||
| 2084 | Ga0466958_0451233 | |||
| 2085 | Ga0466958_0576267 | |||
| 2086 | Ga0466958_0857445 | |||
| 2087 | Ga0466958_1031491 | |||
| 2088 | Ga0466967_0000613 | |||
| 2089 | Ga0466967_0004827 | |||
| 2090 | Ga0466967_0012903 | |||
| 2091 | Ga0466967_0024495 | |||
| 2092 | Ga0466967_0026875 | |||
| 2093 | Ga0466967_0033125 | |||
| 2094 | Ga0466967_0038602 | |||
| 2095 | Ga0466967_0077677 | |||
| 2096 | Ga0466967_0198330 | |||
| 2097 | Ga0466967_0236726 | |||
| 2098 | Ga0466967_0282112 | |||
| 2099 | Ga0466967_0282536 | |||
| 2100 | Ga0466967_0305088 | |||
| 2101 | Ga0466967_0347908 | |||
| 2102 | Ga0466967_0931016 | |||
| 2103 | Ga0466967_1209721 | |||
| 2104 | Ga0466967_1299476 | |||
| 2105 | Ga0495617_064030 | |||
| 2106 | Ga0495592_0010796 | |||
| 2107 | Ga0495592_0022400 | |||
| 2108 | Ga0495603_0006734 | |||
| 2109 | Ga0495603_0008687 | |||
| 2110 | Ga0495603_0111508 | |||
| 2111 | Ga0495603_0236865 | |||
| 2112 | Ga0495603_0743027 | |||
| 2113 | Ga0495629_0020481 | |||
| 2114 | Ga0495629_0020977 | |||
| 2115 | Ga0495629_0128249 | |||
| 2116 | Ga0495629_0661569 | |||
| 2117 | Ga0495638_0062171 | |||
| 2118 | Ga0495638_0298820 | |||
| 2119 | Ga0495641_0369414 | |||
| 2120 | Ga0495651_0017662 | |||
| 2121 | Ga0495651_0513645 | |||
| 2122 | Ga0495651_0677473 | |||
| 2123 | Ga0495653_0017407 | |||
| 2124 | Ga0495653_0191944 | |||
| 2125 | Ga0495653_0692253 | |||
| 2126 | Ga0495580_0055417 | |||
| 2127 | Ga0495582_0027862 | |||
| 2128 | Ga0495605_0016124 | |||
| 2129 | Ga0495639_0175425 | |||
| 2130 | Ga0495662_0002146 | |||
| 2131 | Ga0495662_0118393 | |||
| 2132 | Ga0495662_0231207 | |||
| 2133 | Ga0495664_0000797 | |||
| 2134 | Ga0495664_0195125 | |||
| 2135 | Ga0495584_0057438 | |||
| 2136 | Ga0495585_0117481 | |||
| 2137 | Ga0495594_0020149 | |||
| 2138 | Ga0495594_0069701 | |||
| 2139 | Ga0495596_0076928 | |||
| 2140 | Ga0495607_0165712 | |||
| 2141 | Ga0495583_0066760 | |||
| 2142 | Ga0495606_0017777 | |||
| 2143 | Ga0495608_0055393 | |||
| 2144 | Ga0495608_0140376 | |||
| 2145 | Ga0495608_0352408 | |||
| 2146 | Ga0495610_0031610 | |||
| 2147 | Ga0495616_0007914 | |||
| 2148 | Ga0495618_0491756 | |||
| 2149 | Ga0495620_0050229 | |||
| 2150 | Ga0495628_0020754 | |||
| 2151 | Ga0495628_0106468 | |||
| 2152 | Ga0495630_0020398 | |||
| 2153 | Ga0495630_0394161 | |||
| 2154 | Ga0495630_0568009 | |||
| 2155 | Ga0495630_1284813 | |||
| 2156 | Ga0495631_0007885 | |||
| 2157 | Ga0495632_0132140 | |||
| 2158 | Ga0495637_0046159 | |||
| 2159 | Ga0495643_0003665 | |||
| 2160 | Ga0495644_0394714 | |||
| 2161 | Ga0495648_0087820 | |||
| 2162 | Ga0495648_0093943 | |||
| 2163 | Ga0495666_0008690 | |||
| 2164 | Ga0495666_0159991 | |||
| 2165 | Ga0495642_0471103 | |||
| 2166 | Ga0495652_0019363 | |||
| 2167 | Ga0495652_0054085 | |||
| 2168 | Ga0495654_0051187 | |||
| 2169 | Ga0495665_0010157 | |||
| 2170 | Ga0495665_0500699 | |||
| 2171 | Ga0495640_0007906 | |||
| 2172 | Ga0495640_0015041 | |||
| 2173 | Ga0495586_0013757 | |||
| 2174 | Ga0495586_0112687 | |||
| 2175 | Ga0495587_0021595 | |||
| 2176 | Ga0495587_0716083 | |||
| 2177 | Ga0495609_0008304 | |||
| 2178 | Ga0495645_0007617 | |||
| 2179 | Ga0495622_0004638 | |||
| 2180 | Ga0495622_0149761 | |||
| 2181 | Ga0495633_0007859 | |||
| 2182 | Ga0495667_0442200 | |||
| 2183 | Ga0495667_0593051 | |||
| 2184 | Ga0495656_0225063 | |||
| 2185 | Ga0495668_0020084 | |||
| 2186 | Ga0495634_0039030 | |||
| 2187 | Ga0495634_0055224 | |||
| 2188 | Ga0495625_0069468 | |||
| 2189 | Ga0495625_0289440 | |||
| 2190 | Ga0495625_0358849 | |||
| 2191 | Ga0495635_0038785 | |||
| 2192 | Ga0495635_0411275 | |||
| 2193 | Ga0495635_0530260 | |||
| 2194 | Ga0495635_1035433 | |||
| 2195 | Ga0495661_0017676 | |||
| 2196 | Ga0495588_0017413 | |||
| 2197 | Ga0495588_0229898 | |||
| 2198 | Ga0495588_0249148 | |||
| 2199 | Ga0495657_0007696 | |||
| 2200 | Ga0495657_0058682 | |||
| 2201 | Ga0495657_0069403 | |||
| 2202 | Ga0495657_0456715 | |||
| 2203 | Ga0495657_0734274 | |||
| 2204 | Ga0495599_0030957 | |||
| 2205 | Ga0495599_0045948 | |||
| 2206 | Ga0495623_0023639 | |||
| 2207 | Ga0495623_0381190 | |||
| 2208 | Ga0495646_0022524 | |||
| 2209 | Ga0495646_0143203 | |||
| 2210 | Ga0495658_0144532 | |||
| 2211 | Ga0495613_0001133 | |||
| 2212 | Ga0495613_0044814 | |||
| 2213 | Ga0495613_0066530 | |||
| 2214 | Ga0495613_0117244 | |||
| 2215 | Ga0495613_0124595 | |||
| 2216 | Ga0495613_0445479 | |||
| 2217 | Ga0495613_0800271 | |||
| 2218 | Ga0495613_0988979 | |||
| 2219 | Ga0495624_0063855 | |||
| 2220 | Ga0495624_0262369 | |||
| 2221 | Ga0495670_0029319 | |||
| 2222 | Ga0495671_0496321 | |||
| 2223 | Ga0495649_0009731 | |||
| 2224 | Ga0495649_0050327 | |||
| 2225 | Ga0495649_0058537 | |||
| 2226 | Ga0495589_0002834 | |||
| 2227 | Ga0495589_0140770 | |||
| 2228 | Ga0495600_0051183 | |||
| 2229 | Ga0495600_0085607 | |||
| 2230 | Ga0495600_0429984 | |||
| 2231 | Ga0495600_0455125 | |||
| 2232 | Ga0495660_0512680 | |||
| 2233 | Ga0495581_0131487 | |||
| 2234 | Ga0495581_0271904 | |||
| 2235 | Ga0495581_0435886 | |||
| 2236 | Ga0495604_0000717 | |||
| 2237 | Ga0495636_0005011 | |||
| 2238 | Ga0495636_0008796 | |||
| 2239 | Ga0495636_0011721 | |||
| 2240 | Ga0495636_0294265 | |||
| 2241 | Ga0495636_0481507 | |||
| 2242 | Ga0495674_0020148 | |||
| 2243 | Ga0495674_0194464 | |||
| 2244 | Ga0495674_0208180 | |||
| 2245 | Ga0495674_0401256 | |||
| 2246 | Ga0495674_0498450 | |||
| 2247 | Ga0495672_0470974 | |||
| 2248 | Ga0495676_0018902 | |||
| 2249 | Ga0495676_0032816 | |||
| 2250 | Ga0495676_0272373 | |||
| 2251 | Ga0495680_0015876 | |||
| 2252 | Ga0495683_0272494 | |||
| 2253 | Ga0495683_0444811 | |||
| 2254 | Ga0495687_001837 | |||
| 2255 | Ga0495687_124828 | |||
| 2256 | Ga0495687_134558 | |||
| 2257 | Ga0495687_163189 | |||
| 2258 | Ga0495675_0012537 | |||
| 2259 | Ga0495675_0033528 | |||
| 2260 | Ga0495677_0060572 | |||
| 2261 | Ga0495677_0347946 | |||
| 2262 | Ga0495685_006732 | |||
| 2263 | Ga0495685_031531 | |||
| 2264 | Ga0495685_071599 | |||
| 2265 | Ga0495685_109534 | |||
| 2266 | Ga0495685_130021 | |||
| 2267 | Ga0495685_147366 | |||
| 2268 | Ga0495681_0038064 | |||
| 2269 | Ga0495681_0246781 | |||
| 2270 | Ga0495684_0051912 | |||
| 2271 | Ga0495684_0219199 | |||
| 2272 | Ga0495686_0073074 | |||
| 2273 | Ga0495686_0215328 | |||
| 2274 | Ga0495593_0018986 | |||
| 2275 | Ga0495593_0053424 | |||
| 2276 | Ga0495602_0481595 | |||
| 2277 | Ga0495602_1125161 | |||
| 2278 | Ga0495614_0009183 | |||
| 2279 | Ga0495614_0116815 | |||
| 2280 | Ga0495614_0516140 | |||
| 2281 | Ga0495626_0013567 | |||
| 2282 | Ga0495626_0249104 | |||
| 2283 | Ga0496100_0089905 | |||
| 2284 | Ga0496100_0375421 | |||
| 2285 | Ga0496100_0469993 | |||
| 2286 | Ga0496101_0104740 | |||
| 2287 | Ga0496101_0395556 | |||
| 2288 | Ga0496102_0000474 | |||
| 2289 | Ga0496102_0052146 | |||
| 2290 | Ga0496102_0079919 | |||
| 2291 | Ga0496102_0094978 | |||
| 2292 | Ga0496102_0382362 | |||
| 2293 | Ga0496102_0415930 | |||
| 2294 | Ga0496102_0701748 | |||
| 2295 | Ga0496102_1218214 | |||
| 2296 | Ga0496102_1302500 | |||
| 2297 | Ga0496102_1520970 | |||
| 2298 | Ga0496103_0000746 | |||
| 2299 | Ga0496103_0057727 | |||
| 2300 | Ga0496103_0109647 | |||
| 2301 | Ga0496103_0129399 | |||
| 2302 | Ga0496104_0004536 | |||
| 2303 | Ga0496104_0004679 | |||
| 2304 | Ga0496104_0088701 | |||
| 2305 | Ga0496104_0191015 | |||
| 2306 | Ga0496104_0328473 | |||
| 2307 | Ga0496104_0403330 | |||
| 2308 | Ga0496104_1596743 | |||
| 2309 | Ga0496105_0074948 | |||
| 2310 | Ga0496105_0327804 | |||
| 2311 | Ga0496105_0343704 | |||
| 2312 | Ga0496105_0370273 | |||
| 2313 | Ga0496105_0678064 | |||
| 2314 | Ga0496106_0100021 | |||
| 2315 | Ga0496106_0142541 | |||
| 2316 | Ga0496107_0048969 | |||
| 2317 | Ga0496107_0650679 | |||
| 2318 | Ga0496107_0679550 | |||
| 2319 | Ga0496107_0684246 | |||
| 2320 | Ga0496107_0741838 | |||
| 2321 | Ga0496108_0007637 | |||
| 2322 | Ga0496108_0016478 | |||
| 2323 | Ga0496108_0043231 | |||
| 2324 | Ga0496108_0079265 | |||
| 2325 | Ga0496108_0079926 | |||
| 2326 | Ga0496108_0106569 | |||
| 2327 | Ga0496108_0260215 | |||
| 2328 | Ga0496109_0014032 | |||
| 2329 | Ga0496109_0080432 | |||
| 2330 | Ga0496109_0094738 | |||
| 2331 | Ga0496109_0193109 | |||
| 2332 | Ga0496109_0202587 | |||
| 2333 | Ga0496109_0238702 | |||
| 2334 | Ga0496109_0725810 | |||
| 2335 | Ga0496109_0968468 | |||
| 2336 | Ga0496110_0004391 | |||
| 2337 | Ga0496110_0011291 | |||
| 2338 | Ga0496110_0023092 | |||
| 2339 | Ga0496110_0253267 | |||
| 2340 | Ga0496110_0325865 | |||
| 2341 | Ga0496110_0411533 | |||
| 2342 | Ga0496110_0568193 | |||
| 2343 | Ga0496110_0977177 | |||
| 2344 | Ga0496111_0027325 | |||
| 2345 | Ga0496111_0067648 | |||
| 2346 | Ga0496111_0086817 | |||
| 2347 | Ga0496111_0124914 | |||
| 2348 | Ga0496111_0491673 | |||
| 2349 | Ga0496111_0513307 | |||
| 2350 | Ga0496111_0677513 | |||
| 2351 | Ga0496112_0049608 | |||
| 2352 | Ga0496112_0557159 | |||
| 2353 | Ga0496113_0036651 | |||
| 2354 | Ga0496113_0148211 | |||
| 2355 | Ga0496113_0238090 | |||
| 2356 | Ga0496113_0307134 | |||
| 2357 | Ga0496113_1032153 | |||
| 2358 | Ga0496114_0002482 | |||
| 2359 | Ga0496114_0016483 | |||
| 2360 | Ga0496114_0143077 | |||
| 2361 | Ga0496114_0143609 | |||
| 2362 | Ga0496114_0164995 | |||
| 2363 | Ga0496114_0223148 | |||
| 2364 | Ga0496114_0235128 | |||
| 2365 | Ga0496114_0267192 | |||
| 2366 | Ga0496114_0296399 | |||
| 2367 | Ga0496114_1173759 | |||
| 2368 | Ga0496115_0007736 | |||
| 2369 | Ga0496115_0357708 | |||
| 2370 | Ga0496115_0586262 | |||
| 2371 | Ga0496117_0094345 | |||
| 2372 | Ga0496117_0202037 | |||
| 2373 | Ga0496118_0059415 | |||
| 2374 | Ga0496118_0094560 | |||
| 2375 | Ga0496118_0627843 | |||
| 2376 | Ga0496119_0025963 | |||
| 2377 | Ga0496119_0055002 | |||
| 2378 | Ga0496120_0367002 | |||
| 2379 | Ga0496121_0017831 | |||
| 2380 | Ga0496121_0315754 | |||
| 2381 | Ga0496122_0001555 | |||
| 2382 | Ga0496123_0400097 | |||
| 2383 | Ga0496124_0655792 | |||
| 2384 | Ga0496125_0000025 | |||
| 2385 | Ga0496126_0000036 | |||
| 2386 | Ga0501306_018232 | |||
| 2387 | Ga0495682_0170173 | |||
| 2388 | Ga0501031_0246011 | |||
| 2389 | Ga0501032_0009780 | |||
| 2390 | Ga0501032_0015007 | |||
| 2391 | Ga0501032_0019341 | |||
| 2392 | Ga0501032_0098368 | |||
| 2393 | Ga0501033_0033436 | |||
| 2394 | Ga0501033_0089909 | |||
| 2395 | Ga0501033_0100027 | |||
| 2396 | Ga0501033_0177710 | |||
| 2397 | Ga0501034_0027557 | |||
| 2398 | Ga0501034_0063804 | |||
| 2399 | Ga0501034_0145647 | |||
| 2400 | Ga0501034_0192787 | |||
| 2401 | Ga0501034_0472586 | |||
| 2402 | Ga0501034_1439012 | |||
| 2403 | Ga0501036_0032656 | |||
| 2404 | Ga0501036_0592988 | |||
| 2405 | Ga0501036_1465239 | |||
| 2406 | Ga0501037_0105593 | |||
| 2407 | Ga0501037_0383282 | |||
| 2408 | Ga0501037_0399266 | |||
| 2409 | Ga0501037_0876991 | |||
| 2410 | Ga0501038_0003594 | |||
| 2411 | Ga0501038_0007999 | |||
| 2412 | Ga0501038_0058002 | |||
| 2413 | Ga0501038_0067229 | |||
| 2414 | Ga0501039_0027902 | |||
| 2415 | Ga0501039_0430332 | |||
| 2416 | Ga0501039_0468282 | |||
| 2417 | Ga0501040_0241799 | |||
| 2418 | Ga0501040_0292869 | |||
| 2419 | Ga0501042_0594422 | |||
| 2420 | Ga0501043_0094641 | |||
| 2421 | Ga0501043_0209419 | |||
| 2422 | Ga0501043_0410947 | |||
| 2423 | Ga0501046_0023316 | |||
| 2424 | Ga0501047_0000191 | |||
| 2425 | Ga0501047_0005402 | |||
| 2426 | Ga0501047_0037162 | |||
| 2427 | Ga0501047_0049715 | |||
| 2428 | Ga0501047_0056593 | |||
| 2429 | Ga0501047_0074133 | |||
| 2430 | Ga0501047_0523684 | |||
| 2431 | Ga0501048_0000405 | |||
| 2432 | Ga0501048_0087368 | |||
| 2433 | Ga0501048_0157469 | |||
| 2434 | Ga0501048_0401781 | |||
| 2435 | Ga0501067_0041498 | |||
| 2436 | Ga0501067_0144006 | |||
| 2437 | Ga0501067_0781863 | |||
| 2438 | Ga0501069_0012307 | |||
| 2439 | Ga0501069_0136480 | |||
| 2440 | Ga0501069_0539436 | |||
| 2441 | Ga0501070_0108433 | |||
| 2442 | Ga0501070_0241375 | |||
| 2443 | Ga0501070_0790646 | |||
| 2444 | Ga0501070_1041937 | |||
| 2445 | Ga0501070_1380007 | |||
| 2446 | Ga0501071_0550997 | |||
| 2447 | Ga0501072_0508384 | |||
| 2448 | Ga0501074_0101418 | |||
| 2449 | Ga0501075_0715309 | |||
| 2450 | Ga0501235_031949 | |||
| 2451 | Ga0501080_0031855 | |||
| 2452 | Ga0501080_0617989 | |||
| 2453 | Ga0501083_0024967 | |||
| 2454 | Ga0501083_0980639 | |||
| 2455 | Ga0501282_002540 | |||
| 2456 | Ga0501035_0034700 | |||
| 2457 | Ga0501035_0089814 | |||
| 2458 | Ga0501035_0097433 | |||
| 2459 | Ga0501035_0210569 | |||
| 2460 | Ga0501035_0227026 | |||
| 2461 | Ga0501035_1023312 | |||
| 2462 | Ga0501044_0011203 | |||
| 2463 | Ga0501044_0024862 | |||
| 2464 | Ga0501044_0097788 | |||
| 2465 | Ga0501044_0106072 | |||
| 2466 | Ga0501044_0217659 | |||
| 2467 | Ga0501044_0222055 | |||
| 2468 | Ga0501044_0901185 | |||
| 2469 | Ga0501045_0032328 | |||
| 2470 | Ga0501045_0581642 | |||
| 2471 | nmdc:mga03n38_36630_c1 | |||
| 2472 | nmdc:mga03n38_477_c1 | |||
| 2473 | nmdc:mga0yw44_1049157_c1 | |||
| 2474 | nmdc:mga0yw44_130712_c1 | |||
| 2475 | nmdc:mga0yw44_187909_c1 | |||
| 2476 | nmdc:mga06z11_11001_c1 | |||
| 2477 | nmdc:mga04h51_203941_c1 | |||
| 2478 | nmdc:mga07m45_451589_c1 | |||
| 2479 | nmdc:mga05p37_24408_c1 | |||
| 2480 | nmdc:mga05p37_440_c1 | |||
| 2481 | nmdc:mga09592_278_c1 | |||
| 2482 | nmdc:mga09592_281623_c1 | |||
| 2483 | nmdc:mga09592_7319_c1 | |||
| 2484 | nmdc:mga0qj67_20014_c1 | |||
| 2485 | nmdc:mga0qj67_2876_c1 | |||
| 2486 | nmdc:mga0qj67_79740_c1 | |||
| 2487 | nmdc:mga06r32_29384_c1 | |||
| 2488 | nmdc:mga06r32_4205_c1 | |||
| 2489 | nmdc:mga06r32_434_c1 | |||
| 2490 | nmdc:mga08y16_14165_c1 | |||
| 2491 | nmdc:mga08y16_9696_c1 | |||
| 2492 | nmdc:mga0n895_502919_c1 | |||
| 2493 | nmdc:mga0n895_707851_c1 | |||
| 2494 | nmdc:mga08x19_284937_c1 | |||
| 2495 | nmdc:mga0a205_137541_c1 | |||
| 2496 | Ga0495601_0011311 | |||
| 2497 | Ga0495612_0494029 | |||
| 2498 | Ga0495655_0003679 | |||
| 2499 | Ga0495655_0040412 | |||
| 2500 | Ga0495595_0049668 | |||
| 2501 | Ga0495595_0208890 | |||
| 2502 | Ga0495619_0021775 | |||
| 2503 | Ga0500578_0176366 | |||
| 2504 | Ga0500553_158493 | |||
| 2505 | Ga0500593_171213 | |||
| 2506 | Ga0500652_171790 | |||
| 2507 | Ga0500573_0175236 | |||
| 2508 | Ga0500604_0022630 | |||
| 2509 | Ga0500616_0012396 | |||
| 2510 | Ga0501084_0706142 | |||
| 2511 | Ga0501084_0771280 | |||
| 2512 | Ga0590075_069645 | |||
| 2513 | Ga0590077_056836 | |||
| 2514 | Ga0501082_0001608 | |||
| 2515 | Ga0501082_0866832 | |||
| 2516 | Ga0501082_0867170 | |||
| 2517 | Ga0466962_0002858 | |||
| 2518 | Ga0466962_0017111 | |||
| 2519 | Ga0466962_0092535 | |||
| 2520 | Ga0466962_0291938 | |||
| 2521 | Ga0530510_0458111 | |||
| 2522 | 2554259658 | |||
| 2523 | 2585297862 | |||
| 2524 | 2585310920 | |||
| 2525 | 2585316071 | |||
| 2526 | 2616703006 | |||
| 2527 | 2616905332 | |||
| 2528 | 2643764564 | |||
| 2529 | 2643905221 | |||
| 2530 | 2643942720 | |||
| 2531 | 2644264156 | |||
| 2532 | 2644385888 | |||
| 2533 | 2644403279 | |||
| 2534 | 2644430179 | |||
| 2535 | 2644438173 | |||
| 2536 | 2644458377 | |||
| 2537 | 2644503901 | |||
| 2538 | 2644527036 | |||
| 2539 | 2644629905 | |||
| 2540 | 2644666359 | |||
| 2541 | 2644670231 | |||
| 2542 | 2734976218 | |||
| 2543 | 2784586633 | |||
| 2544 | 2785345865 | |||
| 2545 | 2785367024 | |||
| 2546 | 2786668061 | |||
| 2547 | 2804843616 | |||
| 2548 | 2808847527 | |||
| 2549 | 2808918259 | |||
| 2550 | 2809230160 | |||
| 2551 | 2811846850 | |||
| 2552 | 2812360441 | |||
| 2553 | 2812365145 | |||
| 2554 | 2812482534 | |||
| 2555 | 2819699773 | |||
| 2556 | 2839988550 | |||
| 2557 | 2852643300 | |||
| 2558 | 2862181425 | |||
| 2559 | 2862289786 | |||
| 2560 | 2862294123 | |||
| 2561 | 2862392545 | |||
| 2562 | 2862508466 | |||
| 2563 | 2862580102 | |||
| 2564 | 2862709638 | |||
| 2565 | 2863407096 | |||
| 2566 | 2867375225 | |||
| 2567 | 2867435054 | |||
| 2568 | 2867475993 | |||
| 2569 | 2873157803 | |||
| 2570 | 2875392585 | |||
| 2571 | 2877683519 | |||
| 2572 | 2884995474 | |||
| 2573 | 2912722629 | |||
| 2574 | 2912726311 | |||
| 2575 | 2912758726 | |||
| 2576 | 2918502395 | |||
| 2577 | 2919474483 | |||
| 2578 | 2935394170 | |||
| 2579 | 2935891050 | |||
| 2580 | 2946052131 | |||
| 2581 | 2946065448 | |||
| 2582 | 2946073811 | |||
| 2583 | 2947231959 | |||
| 2584 | 2954008974 | |||
| 2585 | 2954388775 | |||
| 2586 | 2954674349 | |||
| 2587 | 2954689782 | |||
| 2588 | 2954699566 | |||
| 2589 | 2954702651 | |||
| 2590 | 2954718504 | |||
| 2591 | 2954728475 | |||
| 2592 | 2954733335 | |||
| 2593 | 2954747371 | |||
| 2594 | 2954752218 | |||
| 2595 | 2954766485 | |||
| 2596 | 2966604546 | |||
| 2597 | 2990045457 | |||
| 2598 | 2990060260 | |||
| 2599 | 2990093382 | |||
| 2600 | 2997451917 | |||
| 2601 | 2997603425 | |||
| 2602 | 3003004122 | |||
| 2603 | 3006327560 | |||
| 2604 | 3006399457 | |||
| 2605 | 3006430708 | |||
| 2606 | 3006489357 | |||
| 2607 | 3006498345 | |||
| 2608 | 8008486931 | |||
| 2609 | 8008561185 | |||
| 2610 | 8008580869 | |||
| 2611 | 8023630936 | |||
| 2612 | 8025418331 | |||
| 2613 | 8025482366 | |||
| 2614 | 8025526188 | |||
| 2615 | 8025533894 | |||
| 2616 | 8033686646 | |||
| 2617 | 8047901208 | |||
| 2618 | 8048135610 | |||
| 2619 | 8048357693 | |||
| 2620 | 8048378148 | |||
| 2621 | 8048387246 | |||
| 2622 | 8048409970 | |||
| 2623 | 8054166910 | |||
| 2624 | 8056454226 | |||
| 2625 | 8056670094 | |||
| 2626 | 8056832440 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy