F492898

General Info

Members Datasets Scaffolds Average Seq Length
1313 591 2626 102

Family's Representative Sequence

Representative Sequence 3300061719|Ga0466962_0003210|Ga0466962_0003210_1505_1846
Length 113
Sequence VIAVLGLVVGVVAGVAGLLVRPEVPAVVEPYLPIAVVAALDAVFGGLRAMLDGIFDDKVFVVSFLSNVVVAALIVFLGDKLGVGAQLSTGVVVVLGIRIFSNAAAIRRHVFRA

Samples

Sample ID Description Type Environment
1 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
134 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
135 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
136 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
144 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
210 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
216 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
219 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
220 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
221 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
222 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
223 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
224 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
227 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
228 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
229 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
238 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
239 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
240 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
241 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
242 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
243 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
250 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
251 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
252 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
253 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
256 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
257 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
258 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
267 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
268 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
269 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
270 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
271 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
272 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
273 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
274 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
275 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
276 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
277 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
278 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
279 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
280 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
281 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
282 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
283 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
284 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
285 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
288 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
289 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
290 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
291 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
292 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
293 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
294 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
295 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
296 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
297 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
298 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
299 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
300 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
301 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
302 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
303 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
304 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
305 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
306 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
312 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
313 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
314 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
315 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
316 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
317 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
318 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
319 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
320 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
321 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
322 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
323 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
324 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
325 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
326 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
327 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
328 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
329 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
330 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
331 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
332 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
333 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
334 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
335 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
336 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
337 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
338 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
339 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
340 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
341 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
342 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
343 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
344 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
345 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
346 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
347 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
348 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
349 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
350 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
351 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
352 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
353 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
354 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
355 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
356 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
357 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
358 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
359 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
360 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
361 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
362 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
363 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
364 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
365 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
366 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
367 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
368 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
369 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
370 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
371 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
372 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
373 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
374 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
375 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
376 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
377 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
378 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
379 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
380 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
381 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
382 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
383 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
384 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
385 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
386 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
387 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
388 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
389 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
390 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
391 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
392 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
393 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
394 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
395 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
396 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
397 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
398 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
399 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
400 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
401 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
402 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
403 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
404 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
405 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
406 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
407 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
408 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
409 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
410 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
411 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
412 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
413 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
414 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
415 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
416 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
417 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
418 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
419 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
420 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
421 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
422 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
423 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
424 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
425 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
426 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
427 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
429 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
431 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
432 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
433 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
439 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
440 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
441 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
444 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
445 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
446 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
447 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
448 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
449 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
450 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
451 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
452 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
453 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
454 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
455 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
457 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
458 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
459 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
460 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
461 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
462 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
463 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
464 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
465 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
466 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
467 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
468 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
469 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
470 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
471 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
472 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
473 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
474 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
475 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
476 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
477 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
478 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
479 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
480 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
481 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
482 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
483 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
484 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
485 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
486 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
487 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
488 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
489 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
490 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
491 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
492 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
493 2643221548 Streptomyces sp. Root55 Isolate Unclassified
494 2643221578 Streptomyces sp. Root63 Isolate Unclassified
495 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
496 2643221647 Streptomyces sp. Root369 Isolate Unclassified
497 2643221670 Streptomyces sp. Root431 Isolate Unclassified
498 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
499 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
500 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
501 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
502 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
503 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
504 2643221714 Streptomyces sp. Root264 Isolate Unclassified
505 2643221721 Oerskovia sp. Root918 Isolate Unclassified
506 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
507 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
508 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
509 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
510 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
511 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
512 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
513 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
514 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
515 2808606448 Streptomyces sp. 193411 Isolate Unclassified
516 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
517 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
518 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
519 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
520 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
521 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
522 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
523 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
524 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
525 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
526 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
527 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
528 2862574272 Streptomyces sp. AcE210 Isolate Nodule
529 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
530 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
531 2867369537 Streptomyces sp. Z26 Isolate Unclassified
532 2867428634 Streptomyces sp. RP5T Isolate Unclassified
533 2867475112 Streptomyces sp. TM32 Isolate Unclassified
534 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
535 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
536 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
537 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
538 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
539 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
540 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
541 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
542 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
543 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
544 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
545 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
546 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
547 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
548 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
549 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
550 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
551 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
552 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
553 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
554 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
555 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
556 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
557 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
558 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
559 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
560 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
561 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
562 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
563 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
564 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
565 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
566 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
567 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
568 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
569 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
570 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
571 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
572 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
573 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
574 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
575 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
576 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
577 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
578 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
579 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
580 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
581 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
582 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
583 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
584 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
585 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
586 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
587 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
588 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
589 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
590 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
591 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.71
Metatranscriptomes 1.29
Isolates 8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0.3
Rhizoplane 7.84
Rhizosphere 81.95
Stem 0
Stem Tuber 0
Unclassified 0.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466962_0003210 3300061719 Bacteria 7767
2 LJQas_1022420 3300000549 Bacteria 733
3 JGI24737J22298_10241717 3300001990 Bacteria 533
4 JGI24738J21930_10047848 3300002075 Bacteria 870
5 JGI24744J21845_10012255 3300002077 Bacteria 1743
6 JGI25406J46586_10004005 3300003203 Bacteria 6891
7 rootH2_10017275 3300003320 Bacteria 4833
8 rootH1_10088192 3300003323 Bacteria 2175
9 JGI25407J50210_10065969 3300003373 Bacteria 906
10 Ga0070658_10416434 3300005327 Bacteria 1155
11 Ga0070658_10951039 3300005327 Bacteria 747
12 Ga0070658_11399344 3300005327 Bacteria 607
13 Ga0070676_11176609 3300005328 Bacteria 582
14 Ga0070676_11240252 3300005328 Bacteria 568
15 Ga0070683_100057355 3300005329 Bacteria 3618
16 Ga0070683_100079089 3300005329 Bacteria 3077
17 Ga0070683_100099266 3300005329 Bacteria 2740
18 Ga0070683_100692307 3300005329 Bacteria 976
19 Ga0070683_101004593 3300005329 Bacteria 801
20 Ga0070683_101371616 3300005329 Bacteria 679
21 Ga0070670_101796132 3300005331 Bacteria 564
22 Ga0068869_100237561 3300005334 Bacteria 1451
23 Ga0070666_10003317 3300005335 Bacteria 9754
24 Ga0070666_10064975 3300005335 Bacteria 2475
25 Ga0070680_100363401 3300005336 Bacteria 1231
26 Ga0070680_100375671 3300005336 Bacteria 1210
27 Ga0070680_100466470 3300005336 Bacteria 1079
28 Ga0070680_100624983 3300005336 Bacteria 925
29 Ga0070680_101019198 3300005336 Bacteria 715
30 Ga0070680_101137063 3300005336 Bacteria 675
31 Ga0070682_100031446 3300005337 Bacteria 3210
32 Ga0070682_100347102 3300005337 Bacteria 1105
33 Ga0070682_101123379 3300005337 Bacteria 659
34 Ga0068868_100488411 3300005338 Bacteria 1077
35 Ga0070660_100087316 3300005339 Bacteria 2455
36 Ga0070660_100322337 3300005339 Bacteria 1269
37 Ga0070660_100583841 3300005339 Bacteria 933
38 Ga0070660_101506886 3300005339 Bacteria 572
39 Ga0070689_100098074 3300005340 Bacteria 2318
40 Ga0070689_100320167 3300005340 Bacteria 1295
41 Ga0070691_10178261 3300005341 Bacteria 1105
42 Ga0070687_100202557 3300005343 Bacteria 1203
43 Ga0070661_100103154 3300005344 Bacteria 2124
44 Ga0070661_100241199 3300005344 Bacteria 1392
45 Ga0070692_10027073 3300005345 Bacteria 2839
46 Ga0070692_10491384 3300005345 Bacteria 793
47 Ga0070668_100002900 3300005347 Bacteria 12663
48 Ga0070668_100369390 3300005347 Bacteria 1218
49 Ga0070669_100030781 3300005353 Bacteria 3874
50 Ga0070669_101798354 3300005353 Bacteria 535
51 Ga0070675_101509305 3300005354 Bacteria 620
52 Ga0070671_100021033 3300005355 Bacteria 5325
53 Ga0070674_100136314 3300005356 Bacteria 1836
54 Ga0070674_100313986 3300005356 Bacteria 1254
55 Ga0070674_100352446 3300005356 Bacteria 1189
56 Ga0070674_100767046 3300005356 Bacteria 830
57 Ga0070673_100005872 3300005364 Bacteria 7916
58 Ga0070688_100721125 3300005365 Bacteria 774
59 Ga0070659_100015723 3300005366 Bacteria 5670
60 Ga0070659_100333228 3300005366 Bacteria 1270
61 Ga0070659_100386821 3300005366 Bacteria 1179
62 Ga0070659_101817722 3300005366 Bacteria 546
63 Ga0070667_100006026 3300005367 Bacteria 10075
64 Ga0070667_100021661 3300005367 Bacteria 5334
65 Ga0070703_10015033 3300005406 Bacteria 2212
66 Ga0070714_100498172 3300005435 Bacteria 1161
67 Ga0070714_101104250 3300005435 Bacteria 773
68 Ga0070713_100063224 3300005436 Bacteria 3102
69 Ga0070710_10318990 3300005437 Bacteria 1019
70 Ga0070701_10004746 3300005438 Bacteria 5548
71 Ga0070701_10047674 3300005438 Bacteria 2207
72 Ga0070711_100007302 3300005439 Bacteria 6720
73 Ga0070705_100009475 3300005440 Bacteria 4843
74 Ga0070705_101231193 3300005440 Bacteria 618
75 Ga0070700_100000406 3300005441 Bacteria 22003
76 Ga0070700_100779527 3300005441 Bacteria 768
77 Ga0070694_100993214 3300005444 Bacteria 696
78 Ga0070663_100033790 3300005455 Bacteria 3536
79 Ga0070663_100260717 3300005455 Bacteria 1375
80 Ga0070663_100522872 3300005455 Bacteria 988
81 Ga0070678_100025304 3300005456 Bacteria 3990
82 Ga0070662_100033899 3300005457 Bacteria 3598
83 Ga0070681_10005943 3300005458 Bacteria 11814
84 Ga0070681_10136451 3300005458 Bacteria 2384
85 Ga0070681_10466558 3300005458 Bacteria 1175
86 Ga0068867_100087869 3300005459 Bacteria 2354
87 Ga0070685_10903264 3300005466 Bacteria 657
88 Ga0070698_101341055 3300005471 Bacteria 666
89 Ga0070679_100003650 3300005530 Bacteria 14087
90 Ga0070679_100638187 3300005530 Bacteria 1008
91 Ga0070684_100144067 3300005535 Bacteria 2156
92 Ga0070684_100177198 3300005535 Bacteria 1938
93 Ga0070684_101048408 3300005535 Bacteria 766
94 Ga0070684_102035952 3300005535 Bacteria 542
95 Ga0070697_101314041 3300005536 Bacteria 645
96 Ga0068853_100135581 3300005539 Bacteria 2206
97 Ga0068853_100138197 3300005539 Bacteria 2186
98 Ga0068853_100661340 3300005539 Bacteria 995
99 Ga0070672_100115779 3300005543 Bacteria 2189
100 Ga0070672_100239782 3300005543 Bacteria 1525
101 Ga0070672_100518096 3300005543 Bacteria 1033
102 Ga0070672_102006595 3300005543 Bacteria 521
103 Ga0070686_100492382 3300005544 Bacteria 950
104 Ga0070695_100446010 3300005545 Bacteria 990
105 Ga0070696_100311025 3300005546 Bacteria 1209
106 Ga0070693_100118389 3300005547 Bacteria 1639
107 Ga0070693_100369792 3300005547 Bacteria 986
108 Ga0070665_100003227 3300005548 Bacteria 17526
109 Ga0070665_100055978 3300005548 Bacteria 3955
110 Ga0070665_100620528 3300005548 Bacteria 1094
111 Ga0070665_100785740 3300005548 Bacteria 965
112 Ga0070704_100037730 3300005549 Bacteria 3304
113 Ga0068855_100021450 3300005563 Bacteria 7745
114 Ga0068855_100057120 3300005563 Bacteria 4576
115 Ga0068855_100059143 3300005563 Bacteria 4485
116 Ga0068855_100424958 3300005563 Bacteria 1453
117 Ga0068855_100835986 3300005563 Bacteria 976
118 Ga0070664_100178256 3300005564 Bacteria 1888
119 Ga0070664_100999770 3300005564 Bacteria 786
120 Ga0068857_100452244 3300005577 Bacteria 1201
121 Ga0068857_101249726 3300005577 Bacteria 720
122 Ga0068854_100306816 3300005578 Bacteria 1286
123 Ga0068854_101810675 3300005578 Bacteria 560
124 Ga0068856_100088421 3300005614 Bacteria 3080
125 Ga0068856_100147033 3300005614 Bacteria 2364
126 Ga0068856_100174480 3300005614 Bacteria 2162
127 Ga0068856_100651890 3300005614 Bacteria 1073
128 Ga0068856_101404496 3300005614 Bacteria 712
129 Ga0070702_100033494 3300005615 Bacteria 2826
130 Ga0070702_100253317 3300005615 Bacteria 1194
131 Ga0068852_100020158 3300005616 Bacteria 5297
132 Ga0068852_100111044 3300005616 Bacteria 2492
133 Ga0068852_100674790 3300005616 Bacteria 1042
134 Ga0068859_100002361 3300005617 Bacteria 19217
135 Ga0068859_100221522 3300005617 Bacteria 1980
136 Ga0068859_100809523 3300005617 Bacteria 1024
137 Ga0068864_100041671 3300005618 Bacteria 3927
138 Ga0068866_10203000 3300005718 Bacteria 1186
139 Ga0068861_100048872 3300005719 Bacteria 3200
140 Ga0068861_100126857 3300005719 Bacteria 2066
141 Ga0068861_101266966 3300005719 Bacteria 716
142 Ga0068851_10058629 3300005834 Bacteria 1968
143 Ga0068851_10619920 3300005834 Bacteria 660
144 Ga0068870_10001067 3300005840 Bacteria 10886
145 Ga0068870_10083920 3300005840 Bacteria 1767
146 Ga0068863_100004882 3300005841 Bacteria 13214
147 Ga0068863_100073740 3300005841 Bacteria 3229
148 Ga0068858_100013689 3300005842 Bacteria 7655
149 Ga0068858_100039448 3300005842 Bacteria 4379
150 Ga0068858_102578238 3300005842 Bacteria 502
151 Ga0068860_100000035 3300005843 Bacteria 238993
152 Ga0068860_100042424 3300005843 Bacteria 4344
153 Ga0068860_101758013 3300005843 Bacteria 642
154 Ga0068862_100067953 3300005844 Bacteria 3074
155 Ga0068862_101820475 3300005844 Bacteria 618
156 Ga0081455_10002276 3300005937 Bacteria 22904
157 Ga0081455_10025771 3300005937 Bacteria 5422
158 Ga0081455_10041731 3300005937 Bacteria 4031
159 Ga0081455_10583797 3300005937 Bacteria 732
160 Ga0081538_10000036 3300005981 Bacteria 119944
161 Ga0081538_10056572 3300005981 Bacteria 2296
162 Ga0081538_10097228 3300005981 Bacteria 1497
163 Ga0081540_1010407 3300005983 Bacteria 6304
164 Ga0081539_10000643 3300005985 Bacteria 70438
165 Ga0070717_10034948 3300006028 Bacteria 4065
166 Ga0070717_11384185 3300006028 Bacteria 639
167 Ga0075365_10024472 3300006038 Bacteria 3810
168 Ga0075365_10060650 3300006038 Bacteria 2524
169 Ga0075365_10431348 3300006038 Bacteria 931
170 Ga0075365_10989443 3300006038 Bacteria 593
171 Ga0075368_10205485 3300006042 Bacteria 834
172 Ga0075363_100052481 3300006048 Bacteria 2176
173 Ga0075363_100297682 3300006048 Bacteria 936
174 Ga0075432_10063772 3300006058 Bacteria 1316
175 Ga0070715_10817501 3300006163 Bacteria 567
176 Ga0070712_100052549 3300006175 Bacteria 2842
177 Ga0070712_100945669 3300006175 Bacteria 744
178 Ga0075362_10726223 3300006177 Bacteria 519
179 Ga0075367_10007402 3300006178 Bacteria 5617
180 Ga0097621_100363228 3300006237 Bacteria 1290
181 Ga0097621_100371584 3300006237 Bacteria 1276
182 Ga0068871_100009798 3300006358 Bacteria 6951
183 Ga0068871_100446913 3300006358 Bacteria 1158
184 Ga0075428_100001304 3300006844 Bacteria 26458
185 Ga0075428_100089562 3300006844 Bacteria 3356
186 Ga0075428_100274270 3300006844 Bacteria 1815
187 Ga0075430_100006263 3300006846 Bacteria 10034
188 Ga0075430_100026196 3300006846 Bacteria 4962
189 Ga0075431_100002908 3300006847 Bacteria 16573
190 Ga0075431_100008250 3300006847 Bacteria 10415
191 Ga0075431_100012439 3300006847 Bacteria 8590
192 Ga0075433_10006767 3300006852 Bacteria 9086
193 Ga0075433_10291184 3300006852 Bacteria 1446
194 Ga0075434_100051928 3300006871 Bacteria 4073
195 Ga0075434_100511789 3300006871 Bacteria 1221
196 Ga0075429_100001324 3300006880 Bacteria 20208
197 Ga0075429_100005562 3300006880 Bacteria 10857
198 Ga0068865_100022810 3300006881 Bacteria 4090
199 Ga0068865_100039489 3300006881 Bacteria 3201
200 Ga0068865_101485019 3300006881 Bacteria 607
201 Ga0068865_101684194 3300006881 Bacteria 571
202 Ga0075436_100030843 3300006914 Bacteria 3689
203 Ga0097620_100002361 3300006931 Bacteria 19217
204 Ga0097620_100221504 3300006931 Bacteria 1980
205 Ga0097620_100809550 3300006931 Bacteria 1024
206 Ga0099826_10058874 3300006948 Bacteria 2516
207 Ga0075435_100250842 3300007076 Bacteria 1506
208 Ga0105251_10088971 3300009011 Bacteria 1420
209 Ga0105240_10012487 3300009093 Bacteria 11721
210 Ga0105240_10066086 3300009093 Bacteria 4488
211 Ga0105240_10138708 3300009093 Bacteria 2910
212 Ga0111539_10038306 3300009094 Bacteria 5783
213 Ga0111539_10564347 3300009094 Bacteria 1326
214 Ga0111539_11990147 3300009094 Bacteria 674
215 Ga0105245_10034424 3300009098 Bacteria 4493
216 Ga0105245_10066039 3300009098 Bacteria 3273
217 Ga0105245_10907041 3300009098 Bacteria 923
218 Ga0105245_11219824 3300009098 Bacteria 800
219 Ga0105247_10003264 3300009101 Bacteria 10634
220 Ga0105247_10013085 3300009101 Bacteria 4976
221 Ga0105247_10110891 3300009101 Bacteria 1766
222 Ga0114129_10026601 3300009147 Bacteria 8194
223 Ga0114129_10080508 3300009147 Bacteria 4527
224 Ga0105243_10017305 3300009148 Bacteria 5450
225 Ga0105243_10029336 3300009148 Bacteria 4229
226 Ga0105243_10421646 3300009148 Bacteria 1245
227 Ga0105243_11390273 3300009148 Bacteria 722
228 Ga0105241_10016040 3300009174 Bacteria 5491
229 Ga0105241_10092112 3300009174 Bacteria 2393
230 Ga0105241_10313472 3300009174 Bacteria 1350
231 Ga0105241_10818451 3300009174 Bacteria 859
232 Ga0105242_10090413 3300009176 Bacteria 2575
233 Ga0105242_10411505 3300009176 Bacteria 1265
234 Ga0105242_10534754 3300009176 Bacteria 1121
235 Ga0105242_10704143 3300009176 Bacteria 988
236 Ga0105248_10028128 3300009177 Bacteria 6262
237 Ga0105248_10094722 3300009177 Bacteria 3362
238 Ga0105248_11657239 3300009177 Bacteria 725
239 Ga0105237_10091480 3300009545 Bacteria 3032
240 Ga0105237_10261480 3300009545 Bacteria 1733
241 Ga0105237_10935616 3300009545 Bacteria 874
242 Ga0105237_11198280 3300009545 Bacteria 766
243 Ga0105237_11547122 3300009545 Bacteria 670
244 Ga0105237_12773299 3300009545 Bacteria 501
245 Ga0105238_10130917 3300009551 Bacteria 2487
246 Ga0105238_10413460 3300009551 Bacteria 1343
247 Ga0105238_10433003 3300009551 Bacteria 1311
248 Ga0105238_12241857 3300009551 Bacteria 581
249 Ga0105249_10135602 3300009553 Bacteria 2355
250 Ga0105249_10688100 3300009553 Bacteria 1082
251 Ga0105249_11302646 3300009553 Bacteria 798
252 Ga0105249_12470749 3300009553 Bacteria 592
253 Ga0105239_10362082 3300010375 Bacteria 1638
254 Ga0105239_10393835 3300010375 Bacteria 1567
255 Ga0105239_10589429 3300010375 Bacteria 1268
256 Ga0105239_10803279 3300010375 Bacteria 1078
257 Ga0105239_10871389 3300010375 Bacteria 1033
258 Ga0105246_10003223 3300011119 Bacteria 9905
259 Ga0105246_10383410 3300011119 Bacteria 1162
260 Ga0105246_10772831 3300011119 Bacteria 849
261 Ga0157373_10168923 3300013100 Bacteria 1539
262 Ga0157371_10365025 3300013102 Bacteria 1053
263 Ga0157371_10604129 3300013102 Bacteria 816
264 Ga0157370_10045502 3300013104 Bacteria 4210
265 Ga0157370_10194714 3300013104 Bacteria 1881
266 Ga0157370_10351827 3300013104 Bacteria 1358
267 Ga0157370_10717088 3300013104 Bacteria 912
268 Ga0157370_11449549 3300013104 Bacteria 617
269 Ga0157370_11781084 3300013104 Bacteria 553
270 Ga0157369_10018735 3300013105 Bacteria 7760
271 Ga0157369_10040889 3300013105 Bacteria 5060
272 Ga0157369_10087776 3300013105 Bacteria 3321
273 Ga0157369_10137846 3300013105 Bacteria 2582
274 Ga0157369_10174224 3300013105 Bacteria 2265
275 Ga0157369_10220041 3300013105 Bacteria 1988
276 Ga0157369_11059610 3300013105 Bacteria 829
277 Ga0157369_11539011 3300013105 Bacteria 676
278 Ga0157374_10567314 3300013296 Bacteria 1143
279 Ga0157374_11311054 3300013296 Bacteria 746
280 Ga0157374_11977993 3300013296 Bacteria 609
281 Ga0157374_12555383 3300013296 Bacteria 538
282 Ga0157378_10271920 3300013297 Bacteria 1630
283 Ga0163162_10014032 3300013306 Bacteria 7830
284 Ga0163162_11056109 3300013306 Bacteria 919
285 Ga0163162_11310563 3300013306 Bacteria 823
286 Ga0157372_10045237 3300013307 Bacteria 4882
287 Ga0157372_10055403 3300013307 Bacteria 4428
288 Ga0157372_10060103 3300013307 Bacteria 4252
289 Ga0157372_10111409 3300013307 Bacteria 3135
290 Ga0157372_10202728 3300013307 Bacteria 2298
291 Ga0157372_10240579 3300013307 Bacteria 2100
292 Ga0157372_11867886 3300013307 Bacteria 691
293 Ga0157375_10323885 3300013308 Bacteria 1706
294 Ga0157375_10418780 3300013308 Bacteria 1505
295 Ga0157375_10628424 3300013308 Bacteria 1231
296 Ga0157375_11907443 3300013308 Bacteria 705
297 Ga0163163_10068051 3300014325 Bacteria 3543
298 Ga0163163_10647185 3300014325 Bacteria 1120
299 Ga0163163_12596318 3300014325 Bacteria 564
300 Ga0157380_10002480 3300014326 Bacteria 12441
301 Ga0157380_10374551 3300014326 Bacteria 1341
302 Ga0157380_11026518 3300014326 Bacteria 860
303 Ga0182008_10003052 3300014497 Bacteria 10279
304 Ga0182008_10093452 3300014497 Bacteria 1484
305 Ga0182008_10153283 3300014497 Bacteria 1156
306 Ga0157379_10023014 3300014968 Bacteria 5523
307 Ga0157379_10276379 3300014968 Bacteria 1528
308 Ga0157379_10932075 3300014968 Bacteria 825
309 Ga0157379_11657985 3300014968 Bacteria 625
310 Ga0157376_10113096 3300014969 Bacteria 2393
311 Ga0157376_10413661 3300014969 Bacteria 1307
312 Ga0157376_11070113 3300014969 Bacteria 831
313 Ga0182006_1018487 3300015261 Bacteria 2944
314 Ga0182007_10002246 3300015262 Bacteria 9746
315 Ga0182005_1036209 3300015265 Bacteria 1342
316 Ga0183367_1003 3300015688 Bacteria 814276
317 Ga0163161_10023316 3300017792 Bacteria 4366
318 Ga0163161_10268867 3300017792 Bacteria 1333
319 Ga0163161_10745113 3300017792 Bacteria 819
320 Ga0163161_11008509 3300017792 Bacteria 711
321 Ga0163161_11566421 3300017792 Bacteria 580
322 Ga0197907_10033713 3300020069 Bacteria 675
323 Ga0206356_10468274 3300020070 Bacteria 1190
324 Ga0206356_11002279 3300020070 Bacteria 889
325 Ga0206356_11595527 3300020070 Bacteria 809
326 Ga0206352_10982403 3300020078 Bacteria 716
327 Ga0206352_11358692 3300020078 Bacteria 640
328 Ga0206354_11337459 3300020081 Bacteria 1608
329 Ga0206354_11619843 3300020081 Bacteria 2555
330 Ga0206353_10029995 3300020082 Bacteria 774
331 Ga0206353_10259526 3300020082 Bacteria 2005
332 Ga0206353_10358891 3300020082 Bacteria 1278
333 Ga0206353_10968491 3300020082 Bacteria 2139
334 Ga0206353_11192181 3300020082 Bacteria 845
335 Ga0206353_11246040 3300020082 Bacteria 1286
336 Ga0206353_11341543 3300020082 Bacteria 1131
337 Ga0213875_10122117 3300021388 Bacteria 1217
338 Ga0213875_10399456 3300021388 Bacteria 655
339 Ga0224712_10526188 3300022467 Bacteria 573
340 Ga0209758_1011831 3300025297 Bacteria 4983
341 Ga0207656_10203249 3300025321 Bacteria 957
342 Ga0207655_1230742 3300025728 Bacteria 534
343 Ga0207653_10013683 3300025885 Bacteria 2541
344 Ga0207682_10089490 3300025893 Bacteria 1332
345 Ga0207692_10071362 3300025898 Bacteria 1831
346 Ga0207642_10020485 3300025899 Bacteria 2583
347 Ga0207642_10207100 3300025899 Bacteria 1087
348 Ga0207710_10018543 3300025900 Bacteria 2961
349 Ga0207688_10005436 3300025901 Bacteria 6925
350 Ga0207688_10022147 3300025901 Bacteria 3476
351 Ga0207680_10007745 3300025903 Bacteria 5248
352 Ga0207680_10013189 3300025903 Bacteria 4236
353 Ga0207647_10075726 3300025904 Bacteria 2025
354 Ga0207685_10154324 3300025905 Bacteria 1042
355 Ga0207685_10617342 3300025905 Bacteria 583
356 Ga0207699_10521729 3300025906 Bacteria 859
357 Ga0207643_10001879 3300025908 Bacteria 11602
358 Ga0207643_10071311 3300025908 Bacteria 2000
359 Ga0207705_10008652 3300025909 Bacteria 7418
360 Ga0207705_10126804 3300025909 Bacteria 1898
361 Ga0207705_10212246 3300025909 Bacteria 1468
362 Ga0207705_10337834 3300025909 Bacteria 1159
363 Ga0207705_10417605 3300025909 Bacteria 1038
364 Ga0207654_10015189 3300025911 Bacteria 3991
365 Ga0207654_10328826 3300025911 Bacteria 1047
366 Ga0207654_10331453 3300025911 Bacteria 1043
367 Ga0207707_10106548 3300025912 Bacteria 2450
368 Ga0207707_10276080 3300025912 Bacteria 1456
369 Ga0207695_10048226 3300025913 Bacteria 4500
370 Ga0207671_10513993 3300025914 Bacteria 955
371 Ga0207671_10637901 3300025914 Bacteria 848
372 Ga0207671_11121285 3300025914 Bacteria 617
373 Ga0207693_10000761 3300025915 Bacteria 28954
374 Ga0207693_10565252 3300025915 Bacteria 886
375 Ga0207663_10359681 3300025916 Bacteria 1104
376 Ga0207660_10189323 3300025917 Bacteria 1601
377 Ga0207660_10596487 3300025917 Bacteria 899
378 Ga0207660_10777114 3300025917 Bacteria 781
379 Ga0207660_10974121 3300025917 Bacteria 692
380 Ga0207662_10019622 3300025918 Bacteria 3850
381 Ga0207662_10947410 3300025918 Bacteria 610
382 Ga0207657_10030578 3300025919 Bacteria 4886
383 Ga0207657_10072328 3300025919 Bacteria 2917
384 Ga0207657_10148879 3300025919 Bacteria 1908
385 Ga0207657_10265778 3300025919 Bacteria 1364
386 Ga0207657_10352389 3300025919 Bacteria 1161
387 Ga0207649_10213247 3300025920 Bacteria 1371
388 Ga0207652_10014337 3300025921 Bacteria 6419
389 Ga0207652_10191667 3300025921 Bacteria 1839
390 Ga0207652_11691103 3300025921 Bacteria 537
391 Ga0207681_10461190 3300025923 Bacteria 1035
392 Ga0207650_10473129 3300025925 Bacteria 1045
393 Ga0207659_10298618 3300025926 Bacteria 1322
394 Ga0207659_11030345 3300025926 Bacteria 708
395 Ga0207687_10057785 3300025927 Bacteria 2727
396 Ga0207687_10435958 3300025927 Bacteria 1084
397 Ga0207687_10889889 3300025927 Bacteria 762
398 Ga0207687_10973556 3300025927 Bacteria 727
399 Ga0207664_10004124 3300025929 Bacteria 9806
400 Ga0207664_10275579 3300025929 Bacteria 1475
401 Ga0207664_11673943 3300025929 Bacteria 558
402 Ga0207644_10054720 3300025931 Bacteria 2875
403 Ga0207690_10041933 3300025932 Bacteria 3002
404 Ga0207690_10054124 3300025932 Bacteria 2697
405 Ga0207706_10006255 3300025933 Bacteria 11067
406 Ga0207686_10040933 3300025934 Bacteria 2821
407 Ga0207686_10050863 3300025934 Bacteria 2579
408 Ga0207709_10466789 3300025935 Bacteria 979
409 Ga0207709_10593398 3300025935 Bacteria 876
410 Ga0207709_10825308 3300025935 Bacteria 750
411 Ga0207670_10253513 3300025936 Bacteria 1361
412 Ga0207670_10357041 3300025936 Bacteria 1159
413 Ga0207669_10089674 3300025937 Bacteria 1997
414 Ga0207704_10041136 3300025938 Bacteria 2707
415 Ga0207704_10107073 3300025938 Bacteria 1880
416 Ga0207704_11595553 3300025938 Bacteria 560
417 Ga0207665_10000422 3300025939 Bacteria 29175
418 Ga0207691_10027476 3300025940 Bacteria 5334
419 Ga0207691_10142229 3300025940 Bacteria 2114
420 Ga0207691_10322125 3300025940 Bacteria 1325
421 Ga0207691_10787429 3300025940 Bacteria 799
422 Ga0207711_10102174 3300025941 Bacteria 2537
423 Ga0207689_10008948 3300025942 Bacteria 8680
424 Ga0207689_10367736 3300025942 Bacteria 1196
425 Ga0207689_10939378 3300025942 Bacteria 730
426 Ga0207661_10085644 3300025944 Bacteria 2613
427 Ga0207661_10423064 3300025944 Bacteria 1210
428 Ga0207661_10626118 3300025944 Bacteria 988
429 Ga0207661_11530451 3300025944 Bacteria 611
430 Ga0207661_12127299 3300025944 Bacteria 507
431 Ga0207679_10437057 3300025945 Bacteria 1158
432 Ga0207679_10826774 3300025945 Bacteria 845
433 Ga0207667_10016618 3300025949 Bacteria 8307
434 Ga0207667_10086751 3300025949 Bacteria 3238
435 Ga0207667_11786271 3300025949 Bacteria 579
436 Ga0207651_10161527 3300025960 Bacteria 1757
437 Ga0207712_10021402 3300025961 Bacteria 4246
438 Ga0207712_10027364 3300025961 Bacteria 3807
439 Ga0207668_10034693 3300025972 Bacteria 3352
440 Ga0207668_10168949 3300025972 Bacteria 1713
441 Ga0207668_10436276 3300025972 Bacteria 1115
442 Ga0207640_10084665 3300025981 Bacteria 2178
443 Ga0207640_10461976 3300025981 Bacteria 1049
444 Ga0207640_10734821 3300025981 Bacteria 849
445 Ga0207658_10085070 3300025986 Bacteria 2435
446 Ga0207658_10490683 3300025986 Bacteria 1093
447 Ga0207677_10029126 3300026023 Bacteria 3504
448 Ga0207677_12017061 3300026023 Bacteria 536
449 Ga0207703_10026842 3300026035 Bacteria 4536
450 Ga0207703_10132231 3300026035 Bacteria 2156
451 Ga0207639_10152740 3300026041 Bacteria 1936
452 Ga0207639_10799056 3300026041 Bacteria 879
453 Ga0207639_10819544 3300026041 Bacteria 868
454 Ga0207639_11695635 3300026041 Bacteria 592
455 Ga0207678_10001278 3300026067 Bacteria 23260
456 Ga0207678_10152307 3300026067 Bacteria 1975
457 Ga0207678_10459733 3300026067 Bacteria 1107
458 Ga0207678_10501361 3300026067 Bacteria 1058
459 Ga0207678_10766732 3300026067 Bacteria 851
460 Ga0207708_10011571 3300026075 Bacteria 6575
461 Ga0207708_10064908 3300026075 Bacteria 2790
462 Ga0207702_10186047 3300026078 Bacteria 1915
463 Ga0207702_10485092 3300026078 Bacteria 1203
464 Ga0207702_10531607 3300026078 Bacteria 1149
465 Ga0207702_10547838 3300026078 Bacteria 1131
466 Ga0207702_10750895 3300026078 Bacteria 963
467 Ga0207641_10047443 3300026088 Bacteria 3622
468 Ga0207641_10720561 3300026088 Bacteria 983
469 Ga0207648_10010968 3300026089 Bacteria 8561
470 Ga0207648_11959471 3300026089 Bacteria 547
471 Ga0207676_10249253 3300026095 Bacteria 1598
472 Ga0207676_10297790 3300026095 Bacteria 1472
473 Ga0207676_10695211 3300026095 Bacteria 985
474 Ga0207676_11082651 3300026095 Bacteria 792
475 Ga0207674_10395498 3300026116 Bacteria 1336
476 Ga0207674_10656676 3300026116 Bacteria 1013
477 Ga0207675_100000862 3300026118 Bacteria 30299
478 Ga0207675_100020738 3300026118 Bacteria 6127
479 Ga0207675_100315973 3300026118 Bacteria 1524
480 Ga0207683_10004856 3300026121 Bacteria 11575
481 Ga0207683_11000267 3300026121 Bacteria 776
482 Ga0207698_10251581 3300026142 Bacteria 1617
483 Ga0207698_10265222 3300026142 Bacteria 1580
484 Ga0207698_10433076 3300026142 Bacteria 1265
485 Ga0207698_12274804 3300026142 Bacteria 554
486 Ga0207428_10026948 3300027907 Bacteria 4788
487 Ga0207428_10039472 3300027907 Bacteria 3834
488 Ga0268266_10001967 3300028379 Bacteria 23057
489 Ga0268266_10091476 3300028379 Bacteria 2668
490 Ga0268265_11154206 3300028380 Bacteria 771
491 Ga0268264_10000031 3300028381 Bacteria 409525
492 Ga0307517_10019375 3300028786 Bacteria 8734
493 Ga0307515_10123150 3300028794 Bacteria 2919
494 Ga0307515_10291706 3300028794 Bacteria 1326
495 Ga0307515_10377507 3300028794 Bacteria 1051
496 Ga0307515_10778599 3300028794 Bacteria 578
497 Ga0307511_10170176 3300030521 Bacteria 1199
498 Ga0307512_10002110 3300030522 Bacteria 26116
499 Ga0307512_10060866 3300030522 Bacteria 2914
500 Ga0307512_10432447 3300030522 Bacteria 539
501 Ga0307513_10007381 3300031456 Bacteria 14266
502 Ga0307513_10010672 3300031456 Bacteria 11494
503 Ga0307513_10032151 3300031456 Bacteria 5922
504 Ga0307513_10340187 3300031456 Bacteria 1251
505 Ga0307513_10738580 3300031456 Bacteria 690
506 Ga0307408_101994187 3300031548 Bacteria 558
507 Ga0307508_10027978 3300031616 Bacteria 5100
508 Ga0307508_10239572 3300031616 Bacteria 1411
509 Ga0307514_10023923 3300031649 Bacteria 4949
510 Ga0307514_10143365 3300031649 Bacteria 1619
511 Ga0316575_10100952 3300031665 Bacteria 1173
512 Ga0316579_10044004 3300031691 Bacteria 2078
513 Ga0316579_10207008 3300031691 Bacteria 949
514 Ga0316576_10024631 3300031727 Bacteria 4203
515 Ga0316576_10025917 3300031727 Bacteria 4108
516 Ga0316576_10117753 3300031727 Bacteria 1993
517 Ga0316576_10281019 3300031727 Bacteria 1246
518 Ga0316578_10001886 3300031728 Bacteria 8849
519 Ga0316578_10015230 3300031728 Bacteria 4131
520 Ga0316578_10018168 3300031728 Bacteria 3846
521 Ga0316578_10181487 3300031728 Bacteria 1268
522 Ga0316578_10614932 3300031728 Bacteria 636
523 Ga0307516_10009713 3300031730 Bacteria 10685
524 Ga0307516_10068201 3300031730 Bacteria 3426
525 Ga0307516_10234914 3300031730 Bacteria 1535
526 Ga0307516_10456332 3300031730 Bacteria 934
527 Ga0316577_10021049 3300031733 Bacteria 3616
528 Ga0316577_10075467 3300031733 Bacteria 1882
529 Ga0307413_10048253 3300031824 Bacteria 2544
530 Ga0307413_10669635 3300031824 Bacteria 858
531 Ga0307413_10831896 3300031824 Bacteria 778
532 Ga0307410_10206833 3300031852 Bacteria 1502
533 Ga0307410_10362754 3300031852 Bacteria 1161
534 Ga0307410_10707731 3300031852 Bacteria 850
535 Ga0307406_10072872 3300031901 Bacteria 2256
536 Ga0307406_10285993 3300031901 Bacteria 1260
537 Ga0307406_11131994 3300031901 Bacteria 677
538 Ga0307407_10884813 3300031903 Bacteria 684
539 Ga0307412_10583789 3300031911 Bacteria 944
540 Ga0307409_100037961 3300031995 Bacteria 3557
541 Ga0307409_100200923 3300031995 Bacteria 1783
542 Ga0307409_100206187 3300031995 Bacteria 1763
543 Ga0307409_101095167 3300031995 Bacteria 818
544 Ga0307409_101670739 3300031995 Bacteria 665
545 Ga0307409_101907747 3300031995 Bacteria 623
546 Ga0307409_102207635 3300031995 Bacteria 580
547 Ga0307416_100133084 3300032002 Bacteria 2243
548 Ga0307416_100168408 3300032002 Bacteria 2036
549 Ga0307414_10246508 3300032004 Bacteria 1482
550 Ga0307411_10313990 3300032005 Bacteria 1263
551 Ga0307411_10812345 3300032005 Bacteria 824
552 Ga0307415_100006661 3300032126 Bacteria 6252
553 Ga0307415_100622755 3300032126 Bacteria 963
554 Ga0316583_10023364 3300032133 Bacteria 2210
555 Ga0316583_10027161 3300032133 Bacteria 2043
556 Ga0316585_10022745 3300032137 Bacteria 1930
557 Ga0316585_10100688 3300032137 Bacteria 948
558 Ga0316580_10034779 3300032139 Bacteria 1559
559 Ga0316580_10038366 3300032139 Bacteria 1481
560 Ga0316580_10121598 3300032139 Bacteria 799
561 Ga0316580_10206343 3300032139 Bacteria 606
562 Ga0373930_0048644 3300034816 Bacteria 921
563 Ga0373958_0055269 3300034819 Bacteria 848
564 Ga0373959_0032445 3300034820 Bacteria 1061
565 Ga0373938_0016011 3300034957 Bacteria 1460
566 Ga0373928_0008878 3300035084 Bacteria 1960
567 Ga0373934_0372565 3300035086 Bacteria 595
568 Ga0373932_0084710 3300035112 Bacteria 1007
569 Ga0373941_0120182 3300035115 Bacteria 936
570 Ga0373960_0004260 3300035121 Bacteria 3268
571 Ga0373942_0075556 3300035207 Bacteria 992
572 Ga0373962_0263856 3300035242 Bacteria 601
573 Ga0316574_0002927 3300035398 Bacteria 8687
574 Ga0316574_0006864 3300035398 Bacteria 6191
575 Ga0316574_0028324 3300035398 Bacteria 3378
576 Ga0316574_0039475 3300035398 Bacteria 2903
577 Ga0316574_0181112 3300035398 Bacteria 1356
578 Ga0373931_0396935 3300035691 Bacteria 872
579 Ga0373935_0652500 3300035692 Bacteria 772
580 Ga0373927_0769922 3300035695 Bacteria 636
581 Ga0373947_0630113 3300035725 Bacteria 731
582 Ga0373937_0104761 3300036401 Bacteria 2628
583 Ga0316582_0004636 3300036647 Bacteria 6979
584 Ga0316582_0005574 3300036647 Bacteria 6504
585 Ga0316582_0228293 3300036647 Bacteria 1274
586 Ga0316582_0950418 3300036647 Bacteria 587
587 Ga0316584_0001080 3300036712 Bacteria 15945
588 Ga0316584_0002346 3300036712 Bacteria 11933
589 Ga0316584_0006442 3300036712 Bacteria 7945
590 Ga0316584_0024754 3300036712 Bacteria 4397
591 Ga0316584_0071727 3300036712 Bacteria 2595
592 Ga0316584_0146750 3300036712 Bacteria 1757
593 Ga0373925_0761311 3300037068 Bacteria 798
594 Ga0373925_0974753 3300037068 Bacteria 698
595 Ga0373925_1060720 3300037068 Bacteria 667
596 Ga0373925_1444953 3300037068 Bacteria 563
597 Ga0395899_0014945 3300037312 Bacteria 5921
598 Ga0395899_0239675 3300037312 Bacteria 1249
599 Ga0395900_0144673 3300037418 Bacteria 2432
600 Ga0395900_0244171 3300037418 Bacteria 1800
601 Ga0395900_0309186 3300037418 Bacteria 1564
602 Ga0395898_0002926 3300037466 Bacteria 19415
603 Ga0395898_0008650 3300037466 Bacteria 10739
604 Ga0395898_0023615 3300037466 Bacteria 6210
605 Ga0395898_0094206 3300037466 Bacteria 2878
606 Ga0395898_0584518 3300037466 Bacteria 1059
607 Ga0395898_0910125 3300037466 Bacteria 818
608 Ga0395905_0012794 3300037471 Bacteria 8072
609 Ga0395905_0307721 3300037471 Bacteria 1473
610 Ga0395905_0355771 3300037471 Bacteria 1357
611 Ga0436364_0312246 3300037853 Bacteria 1261
612 Ga0436364_0487929 3300037853 Bacteria 785
613 Ga0436364_0747706 3300037853 Bacteria 1285
614 Ga0395901_0021839 3300038443 Bacteria 6559
615 Ga0395901_0070161 3300038443 Bacteria 3650
616 Ga0395901_0220702 3300038443 Bacteria 1982
617 Ga0395901_1705059 3300038443 Bacteria 581
618 Ga0439436_0004809 3300041404 Bacteria 4141
619 Ga0439436_0035109 3300041404 Bacteria 1449
620 Ga0439438_110365 3300041405 Bacteria 664
621 Ga0439439_0002892 3300041406 Bacteria 3727
622 Ga0439461_0179366 3300041410 Bacteria 560
623 Ga0439466_0057028 3300041411 Bacteria 1266
624 Ga0451787_443561 3300041441 Bacteria 513
625 Ga0451789_0357655 3300041443 Bacteria 629
626 Ga0451789_0403977 3300041443 Bacteria 700
627 Ga0451791_1032014 3300041451 Bacteria 1910
628 Ga0451793_1705097 3300041452 Bacteria 823
629 Ga0451797_0119615 3300041453 Bacteria 1491
630 Ga0451797_0425520 3300041453 Bacteria 1317
631 Ga0451797_0900995 3300041453 Bacteria 739
632 Ga0451795_1315360 3300041456 Bacteria 901
633 Ga0451795_1425503 3300041456 Bacteria 656
634 Ga0451795_1527499 3300041456 Bacteria 827
635 Ga0451800_0913216 3300041459 Bacteria 882
636 Ga0451800_1276582 3300041459 Bacteria 673
637 Ga0451804_0978374 3300041463 Bacteria 1394
638 Ga0451837_0844599 3300041494 Bacteria 1222
639 Ga0451839_0451422 3300041496 Bacteria 522
640 Ga0451839_0878520 3300041496 Bacteria 528
641 Ga0451845_0934553 3300041501 Bacteria 522
642 Ga0451847_0328072 3300041503 Bacteria 956
643 Ga0451851_0409766 3300041507 Bacteria 564
644 Ga0451843_1398884 3300041509 Bacteria 618
645 Ga0451855_0876493 3300041511 Bacteria 609
646 Ga0451853_0925178 3300041512 Bacteria 851
647 Ga0451853_1111976 3300041512 Bacteria 523
648 Ga0451853_1397591 3300041512 Bacteria 647
649 Ga0451853_2120126 3300041512 Bacteria 1234
650 Ga0451853_3106522 3300041512 Bacteria 514
651 Ga0451853_3509953 3300041512 Bacteria 547
652 Ga0439433_0001111 3300041999 Bacteria 5488
653 Ga0439442_013843 3300042002 Bacteria 1657
654 Ga0439448_0052233 3300042005 Bacteria 1339
655 Ga0439448_0365740 3300042005 Bacteria 515
656 Ga0439449_0019483 3300042007 Bacteria 2543
657 Ga0439449_0091794 3300042007 Bacteria 1121
658 Ga0439455_0010486 3300042012 Bacteria 2039
659 Ga0439455_0025944 3300042012 Bacteria 1428
660 Ga0439457_000050 3300042014 Bacteria 24506
661 Ga0439457_001276 3300042014 Bacteria 7557
662 Ga0439457_008844 3300042014 Bacteria 2362
663 Ga0439462_0005042 3300042015 Bacteria 3240
664 Ga0450894_000402 3300042131 Bacteria 7411
665 Ga0450899_000036 3300042135 Bacteria 9998
666 Ga0450900_042940 3300042136 Bacteria 680
667 Ga0450903_000797 3300042138 Bacteria 6152
668 Ga0450906_101925 3300042145 Bacteria 524
669 Ga0439458_0006796 3300042157 Bacteria 2547
670 Ga0466969_0010992 3300044656 Bacteria 4793
671 Ga0466969_0013005 3300044656 Bacteria 4383
672 Ga0466969_0030942 3300044656 Bacteria 2725
673 Ga0466969_0110907 3300044656 Bacteria 1284
674 Ga0466969_0220074 3300044656 Bacteria 864
675 Ga0466972_0007258 3300044658 Bacteria 5565
676 Ga0466972_0009587 3300044658 Bacteria 4860
677 Ga0466972_0072859 3300044658 Bacteria 1638
678 Ga0466972_0088945 3300044658 Bacteria 1466
679 Ga0466972_0162133 3300044658 Bacteria 1050
680 Ga0466972_0236880 3300044658 Bacteria 854
681 Ga0466972_0532276 3300044658 Bacteria 554
682 Ga0466972_0536432 3300044658 Bacteria 552
683 Ga0466965_0001744 3300044683 Bacteria 8971
684 Ga0466965_0010965 3300044683 Bacteria 4239
685 Ga0466965_0043535 3300044683 Bacteria 2217
686 Ga0466965_0057857 3300044683 Bacteria 1933
687 Ga0466965_0169242 3300044683 Bacteria 1149
688 Ga0466965_0282760 3300044683 Bacteria 896
689 Ga0466966_0002073 3300044684 Bacteria 12998
690 Ga0466966_0005617 3300044684 Bacteria 8244
691 Ga0466966_0025000 3300044684 Bacteria 3904
692 Ga0466966_0028829 3300044684 Bacteria 3614
693 Ga0466966_0142757 3300044684 Bacteria 1463
694 Ga0466966_0165133 3300044684 Bacteria 1347
695 Ga0466966_0230017 3300044684 Bacteria 1119
696 Ga0466966_0260620 3300044684 Bacteria 1044
697 Ga0466966_0453423 3300044684 Bacteria 771
698 Ga0466961_0008931 3300044693 Bacteria 6395
699 Ga0466961_0014704 3300044693 Bacteria 5029
700 Ga0466961_0014898 3300044693 Bacteria 4994
701 Ga0466961_0045254 3300044693 Bacteria 2816
702 Ga0466961_0053016 3300044693 Bacteria 2589
703 Ga0466961_0132317 3300044693 Bacteria 1563
704 Ga0466961_0202977 3300044693 Bacteria 1225
705 Ga0466961_0247600 3300044693 Bacteria 1095
706 Ga0466961_0262829 3300044693 Bacteria 1058
707 Ga0466961_0366455 3300044693 Bacteria 876
708 Ga0466961_0509618 3300044693 Bacteria 726
709 Ga0466963_0000954 3300044694 Bacteria 14852
710 Ga0466963_0001197 3300044694 Bacteria 13660
711 Ga0466963_0002952 3300044694 Bacteria 9611
712 Ga0466963_0027689 3300044694 Bacteria 3632
713 Ga0466963_0036308 3300044694 Bacteria 3213
714 Ga0466963_0042041 3300044694 Bacteria 2999
715 Ga0466963_0083036 3300044694 Bacteria 2172
716 Ga0466963_0172772 3300044694 Bacteria 1507
717 Ga0466963_0207778 3300044694 Bacteria 1370
718 Ga0466963_0784525 3300044694 Bacteria 672
719 Ga0466963_0920574 3300044694 Bacteria 616
720 Ga0466964_0033613 3300044706 Bacteria 2043
721 Ga0466964_0050199 3300044706 Bacteria 1710
722 Ga0466964_0059076 3300044706 Bacteria 1591
723 Ga0466964_0155505 3300044706 Bacteria 1064
724 Ga0466964_0559184 3300044706 Bacteria 622
725 Ga0466971_0002834 3300044719 Bacteria 7346
726 Ga0466971_0005350 3300044719 Bacteria 5565
727 Ga0466971_0009159 3300044719 Bacteria 4329
728 Ga0466971_0462942 3300044719 Bacteria 623
729 Ga0466968_0130881 3300044735 Bacteria 1141
730 Ga0466968_0299683 3300044735 Bacteria 773
731 Ga0466968_0338362 3300044735 Bacteria 729
732 Ga0466970_0002112 3300044765 Bacteria 9598
733 Ga0466970_0006676 3300044765 Bacteria 5770
734 Ga0466970_0056600 3300044765 Bacteria 2096
735 Ga0466970_0139243 3300044765 Bacteria 1336
736 Ga0466970_0216939 3300044765 Bacteria 1067
737 Ga0466970_0318905 3300044765 Bacteria 878
738 Ga0466970_0322202 3300044765 Bacteria 874
739 Ga0466970_0586225 3300044765 Bacteria 646
740 Ga0466957_0002224 3300044842 Bacteria 10399
741 Ga0466957_0017495 3300044842 Bacteria 4199
742 Ga0466957_0033658 3300044842 Bacteria 3075
743 Ga0466957_0054096 3300044842 Bacteria 2449
744 Ga0466957_0074321 3300044842 Bacteria 2107
745 Ga0466957_0250016 3300044842 Bacteria 1179
746 Ga0466960_0006393 3300044901 Bacteria 4726
747 Ga0466960_0009062 3300044901 Bacteria 4093
748 Ga0466960_0017315 3300044901 Bacteria 3140
749 Ga0466960_0171892 3300044901 Bacteria 1170
750 Ga0466960_0357114 3300044901 Bacteria 834
751 Ga0466960_0750356 3300044901 Bacteria 588
752 Ga0466959_0001862 3300045049 Bacteria 13254
753 Ga0466959_0004316 3300045049 Bacteria 9490
754 Ga0466959_0035444 3300045049 Bacteria 3689
755 Ga0466959_0113081 3300045049 Bacteria 1936
756 Ga0466959_0127788 3300045049 Bacteria 1803
757 Ga0466959_0190193 3300045049 Bacteria 1433
758 Ga0466959_0224473 3300045049 Bacteria 1302
759 Ga0466959_0571240 3300045049 Bacteria 762
760 Ga0466959_0922226 3300045049 Bacteria 582
761 Ga0466959_1192868 3300045049 Bacteria 506
762 Ga0466958_0002184 3300045836 Bacteria 9743
763 Ga0466958_0005815 3300045836 Bacteria 6672
764 Ga0466958_0008194 3300045836 Bacteria 5788
765 Ga0466958_0015510 3300045836 Bacteria 4367
766 Ga0466958_0037010 3300045836 Bacteria 2923
767 Ga0466958_0139625 3300045836 Bacteria 1525
768 Ga0466958_0243493 3300045836 Bacteria 1149
769 Ga0466958_0245045 3300045836 Bacteria 1146
770 Ga0466958_0353297 3300045836 Bacteria 946
771 Ga0466958_0451233 3300045836 Bacteria 832
772 Ga0466958_0576267 3300045836 Bacteria 732
773 Ga0466958_0857445 3300045836 Bacteria 592
774 Ga0466958_1031491 3300045836 Bacteria 537
775 Ga0466967_0000613 3300045976 Bacteria 17801
776 Ga0466967_0004827 3300045976 Bacteria 9193
777 Ga0466967_0012903 3300045976 Bacteria 6424
778 Ga0466967_0024495 3300045976 Bacteria 4963
779 Ga0466967_0026875 3300045976 Bacteria 4777
780 Ga0466967_0033125 3300045976 Bacteria 4372
781 Ga0466967_0038602 3300045976 Bacteria 4097
782 Ga0466967_0077677 3300045976 Bacteria 2989
783 Ga0466967_0198330 3300045976 Bacteria 1900
784 Ga0466967_0236726 3300045976 Bacteria 1740
785 Ga0466967_0282112 3300045976 Bacteria 1594
786 Ga0466967_0282536 3300045976 Bacteria 1593
787 Ga0466967_0305088 3300045976 Bacteria 1532
788 Ga0466967_0347908 3300045976 Bacteria 1434
789 Ga0466967_0931016 3300045976 Bacteria 864
790 Ga0466967_1209721 3300045976 Bacteria 753
791 Ga0466967_1299476 3300045976 Bacteria 724
792 Ga0495617_064030 3300046452 Bacteria 1213
793 Ga0495592_0010796 3300046454 Bacteria 6886
794 Ga0495592_0022400 3300046454 Bacteria 4806
795 Ga0495603_0006734 3300046455 Bacteria 6897
796 Ga0495603_0008687 3300046455 Bacteria 6139
797 Ga0495603_0111508 3300046455 Bacteria 1595
798 Ga0495603_0236865 3300046455 Bacteria 1052
799 Ga0495603_0743027 3300046455 Bacteria 560
800 Ga0495629_0020481 3300046459 Bacteria 4722
801 Ga0495629_0020977 3300046459 Bacteria 4663
802 Ga0495629_0128249 3300046459 Bacteria 1767
803 Ga0495629_0661569 3300046459 Bacteria 695
804 Ga0495638_0062171 3300046460 Bacteria 2305
805 Ga0495638_0298820 3300046460 Bacteria 868
806 Ga0495641_0369414 3300046461 Unclassified 650
807 Ga0495651_0017662 3300046462 Bacteria 5521
808 Ga0495651_0513645 3300046462 Bacteria 765
809 Ga0495651_0677473 3300046462 Bacteria 644
810 Ga0495653_0017407 3300046463 Bacteria 5845
811 Ga0495653_0191944 3300046463 Bacteria 1393
812 Ga0495653_0692253 3300046463 Bacteria 620
813 Ga0495580_0055417 3300046472 Bacteria 2794
814 Ga0495582_0027862 3300046473 Bacteria 3099
815 Ga0495605_0016124 3300046474 Bacteria 4049
816 Ga0495639_0175425 3300046475 Bacteria 1042
817 Ga0495662_0002146 3300046476 Bacteria 9900
818 Ga0495662_0118393 3300046476 Bacteria 1299
819 Ga0495662_0231207 3300046476 Bacteria 911
820 Ga0495664_0000797 3300046477 Bacteria 16119
821 Ga0495664_0195125 3300046477 Bacteria 1227
822 Ga0495584_0057438 3300046491 Bacteria 1958
823 Ga0495585_0117481 3300046492 Bacteria 1409
824 Ga0495594_0020149 3300046499 Bacteria 3551
825 Ga0495594_0069701 3300046499 Bacteria 1953
826 Ga0495596_0076928 3300046500 Bacteria 1296
827 Ga0495607_0165712 3300046501 Bacteria 1119
828 Ga0495583_0066760 3300046506 Bacteria 1590
829 Ga0495606_0017777 3300046507 Bacteria 5359
830 Ga0495608_0055393 3300046511 Bacteria 2621
831 Ga0495608_0140376 3300046511 Bacteria 1542
832 Ga0495608_0352408 3300046511 Bacteria 906
833 Ga0495610_0031610 3300046512 Bacteria 2760
834 Ga0495616_0007914 3300046513 Bacteria 6338
835 Ga0495618_0491756 3300046514 Bacteria 740
836 Ga0495620_0050229 3300046515 Bacteria 1780
837 Ga0495628_0020754 3300046516 Bacteria 5413
838 Ga0495628_0106468 3300046516 Bacteria 2159
839 Ga0495630_0020398 3300046517 Bacteria 4886
840 Ga0495630_0394161 3300046517 Bacteria 1061
841 Ga0495630_0568009 3300046517 Bacteria 870
842 Ga0495630_1284813 3300046517 Bacteria 552
843 Ga0495631_0007885 3300046518 Bacteria 5391
844 Ga0495632_0132140 3300046519 Bacteria 1161
845 Ga0495637_0046159 3300046520 Bacteria 1844
846 Ga0495643_0003665 3300046522 Bacteria 11147
847 Ga0495644_0394714 3300046523 Bacteria 547
848 Ga0495648_0087820 3300046524 Bacteria 1749
849 Ga0495648_0093943 3300046524 Bacteria 1671
850 Ga0495666_0008690 3300046526 Bacteria 5090
851 Ga0495666_0159991 3300046526 Bacteria 1044
852 Ga0495642_0471103 3300046528 Bacteria 555
853 Ga0495652_0019363 3300046529 Bacteria 6063
854 Ga0495652_0054085 3300046529 Bacteria 3420
855 Ga0495654_0051187 3300046530 Bacteria 2016
856 Ga0495665_0010157 3300046531 Bacteria 5102
857 Ga0495665_0500699 3300046531 Bacteria 612
858 Ga0495640_0007906 3300046533 Bacteria 8361
859 Ga0495640_0015041 3300046533 Bacteria 5830
860 Ga0495586_0013757 3300046535 Bacteria 4294
861 Ga0495586_0112687 3300046535 Bacteria 1515
862 Ga0495587_0021595 3300046536 Bacteria 3970
863 Ga0495587_0716083 3300046536 Bacteria 548
864 Ga0495609_0008304 3300046538 Bacteria 5091
865 Ga0495645_0007617 3300046543 Bacteria 7534
866 Ga0495622_0004638 3300046557 Bacteria 6365
867 Ga0495622_0149761 3300046557 Bacteria 1056
868 Ga0495633_0007859 3300046558 Bacteria 6086
869 Ga0495667_0442200 3300046559 Bacteria 817
870 Ga0495667_0593051 3300046559 Bacteria 690
871 Ga0495656_0225063 3300046615 Bacteria 939
872 Ga0495668_0020084 3300046616 Bacteria 3842
873 Ga0495634_0039030 3300046642 Bacteria 3235
874 Ga0495634_0055224 3300046642 Bacteria 2656
875 Ga0495625_0069468 3300046660 Bacteria 2475
876 Ga0495625_0289440 3300046660 Bacteria 1051
877 Ga0495625_0358849 3300046660 Bacteria 919
878 Ga0495635_0038785 3300046663 Bacteria 3297
879 Ga0495635_0411275 3300046663 Bacteria 897
880 Ga0495635_0530260 3300046663 Bacteria 773
881 Ga0495635_1035433 3300046663 Bacteria 521
882 Ga0495661_0017676 3300046665 Bacteria 4704
883 Ga0495588_0017413 3300046674 Bacteria 3489
884 Ga0495588_0229898 3300046674 Bacteria 978
885 Ga0495588_0249148 3300046674 Bacteria 936
886 Ga0495657_0007696 3300046675 Bacteria 8293
887 Ga0495657_0058682 3300046675 Bacteria 2554
888 Ga0495657_0069403 3300046675 Bacteria 2306
889 Ga0495657_0456715 3300046675 Bacteria 747
890 Ga0495657_0734274 3300046675 Bacteria 566
891 Ga0495599_0030957 3300046678 Bacteria 3358
892 Ga0495599_0045948 3300046678 Bacteria 2739
893 Ga0495623_0023639 3300046679 Bacteria 3964
894 Ga0495623_0381190 3300046679 Bacteria 762
895 Ga0495646_0022524 3300046680 Bacteria 3972
896 Ga0495646_0143203 3300046680 Bacteria 1335
897 Ga0495658_0144532 3300046683 Bacteria 1457
898 Ga0495613_0001133 3300046689 Bacteria 20309
899 Ga0495613_0044814 3300046689 Bacteria 3271
900 Ga0495613_0066530 3300046689 Bacteria 2631
901 Ga0495613_0117244 3300046689 Bacteria 1914
902 Ga0495613_0124595 3300046689 Bacteria 1848
903 Ga0495613_0445479 3300046689 Bacteria 878
904 Ga0495613_0800271 3300046689 Bacteria 615
905 Ga0495613_0988979 3300046689 Bacteria 541
906 Ga0495624_0063855 3300046690 Bacteria 2301
907 Ga0495624_0262369 3300046690 Bacteria 1044
908 Ga0495670_0029319 3300046691 Bacteria 2731
909 Ga0495671_0496321 3300046692 Bacteria 582
910 Ga0495649_0009731 3300046694 Bacteria 5695
911 Ga0495649_0050327 3300046694 Bacteria 2261
912 Ga0495649_0058537 3300046694 Bacteria 2076
913 Ga0495589_0002834 3300046794 Bacteria 9592
914 Ga0495589_0140770 3300046794 Bacteria 1155
915 Ga0495600_0051183 3300046809 Bacteria 2696
916 Ga0495600_0085607 3300046809 Bacteria 2057
917 Ga0495600_0429984 3300046809 Bacteria 818
918 Ga0495600_0455125 3300046809 Bacteria 791
919 Ga0495660_0512680 3300046810 Bacteria 511
920 Ga0495581_0131487 3300047315 Bacteria 1458
921 Ga0495581_0271904 3300047315 Bacteria 991
922 Ga0495581_0435886 3300047315 Bacteria 763
923 Ga0495604_0000717 3300047317 Bacteria 28071
924 Ga0495636_0005011 3300047318 Bacteria 5198
925 Ga0495636_0008796 3300047318 Bacteria 3979
926 Ga0495636_0011721 3300047318 Bacteria 3473
927 Ga0495636_0294265 3300047318 Bacteria 758
928 Ga0495636_0481507 3300047318 Bacteria 598
929 Ga0495674_0020148 3300047319 Bacteria 6179
930 Ga0495674_0194464 3300047319 Bacteria 1685
931 Ga0495674_0208180 3300047319 Bacteria 1621
932 Ga0495674_0401256 3300047319 Bacteria 1107
933 Ga0495674_0498450 3300047319 Bacteria 974
934 Ga0495672_0470974 3300047320 Bacteria 563
935 Ga0495676_0018902 3300047321 Bacteria 6071
936 Ga0495676_0032816 3300047321 Bacteria 4379
937 Ga0495676_0272373 3300047321 Bacteria 1148
938 Ga0495680_0015876 3300047322 Bacteria 6482
939 Ga0495683_0272494 3300047323 Bacteria 735
940 Ga0495683_0444811 3300047323 Bacteria 532
941 Ga0495687_001837 3300047443 Bacteria 18639
942 Ga0495687_124828 3300047443 Bacteria 922
943 Ga0495687_134558 3300047443 Bacteria 869
944 Ga0495687_163189 3300047443 Bacteria 746
945 Ga0495675_0012537 3300047444 Bacteria 5335
946 Ga0495675_0033528 3300047444 Bacteria 3277
947 Ga0495677_0060572 3300047445 Bacteria 1403
948 Ga0495677_0347946 3300047445 Bacteria 585
949 Ga0495685_006732 3300047447 Bacteria 3774
950 Ga0495685_031531 3300047447 Bacteria 1821
951 Ga0495685_071599 3300047447 Bacteria 1160
952 Ga0495685_109534 3300047447 Bacteria 909
953 Ga0495685_130021 3300047447 Bacteria 824
954 Ga0495685_147366 3300047447 Bacteria 765
955 Ga0495681_0038064 3300047470 Bacteria 2362
956 Ga0495681_0246781 3300047470 Bacteria 706
957 Ga0495684_0051912 3300047471 Bacteria 3128
958 Ga0495684_0219199 3300047471 Bacteria 1396
959 Ga0495686_0073074 3300047472 Bacteria 2107
960 Ga0495686_0215328 3300047472 Bacteria 1095
961 Ga0495593_0018986 3300047673 Bacteria 3858
962 Ga0495593_0053424 3300047673 Bacteria 2132
963 Ga0495602_0481595 3300048088 Bacteria 870
964 Ga0495602_1125161 3300048088 Bacteria 514
965 Ga0495614_0009183 3300048089 Bacteria 4380
966 Ga0495614_0116815 3300048089 Bacteria 1174
967 Ga0495614_0516140 3300048089 Bacteria 569
968 Ga0495626_0013567 3300048091 Bacteria 4232
969 Ga0495626_0249104 3300048091 Bacteria 713
970 Ga0496100_0089905 3300048903 Bacteria 2093
971 Ga0496100_0375421 3300048903 Bacteria 1079
972 Ga0496100_0469993 3300048903 Bacteria 966
973 Ga0496101_0104740 3300048904 Bacteria 2122
974 Ga0496101_0395556 3300048904 Bacteria 1088
975 Ga0496102_0000474 3300048905 Bacteria 44502
976 Ga0496102_0052146 3300048905 Bacteria 3726
977 Ga0496102_0079919 3300048905 Bacteria 3012
978 Ga0496102_0094978 3300048905 Bacteria 2763
979 Ga0496102_0382362 3300048905 Bacteria 1325
980 Ga0496102_0415930 3300048905 Bacteria 1263
981 Ga0496102_0701748 3300048905 Bacteria 935
982 Ga0496102_1218214 3300048905 Bacteria 672
983 Ga0496102_1302500 3300048905 Bacteria 646
984 Ga0496102_1520970 3300048905 Bacteria 588
985 Ga0496103_0000746 3300048906 Bacteria 24024
986 Ga0496103_0057727 3300048906 Bacteria 2410
987 Ga0496103_0109647 3300048906 Bacteria 1753
988 Ga0496103_0129399 3300048906 Bacteria 1612
989 Ga0496104_0004536 3300048907 Bacteria 12100
990 Ga0496104_0004679 3300048907 Bacteria 11913
991 Ga0496104_0088701 3300048907 Bacteria 2955
992 Ga0496104_0191015 3300048907 Bacteria 1959
993 Ga0496104_0328473 3300048907 Bacteria 1442
994 Ga0496104_0403330 3300048907 Bacteria 1279
995 Ga0496104_1596743 3300048907 Bacteria 555
996 Ga0496105_0074948 3300048908 Bacteria 2795
997 Ga0496105_0327804 3300048908 Bacteria 1226
998 Ga0496105_0343704 3300048908 Bacteria 1193
999 Ga0496105_0370273 3300048908 Bacteria 1141
1000 Ga0496105_0678064 3300048908 Bacteria 793
1001 Ga0496106_0100021 3300048909 Bacteria 2248
1002 Ga0496106_0142541 3300048909 Bacteria 1886
1003 Ga0496107_0048969 3300048910 Bacteria 3045
1004 Ga0496107_0650679 3300048910 Bacteria 777
1005 Ga0496107_0679550 3300048910 Bacteria 758
1006 Ga0496107_0684246 3300048910 Bacteria 755
1007 Ga0496107_0741838 3300048910 Bacteria 721
1008 Ga0496108_0007637 3300048911 Bacteria 8755
1009 Ga0496108_0016478 3300048911 Bacteria 6031
1010 Ga0496108_0043231 3300048911 Bacteria 3764
1011 Ga0496108_0079265 3300048911 Bacteria 2780
1012 Ga0496108_0079926 3300048911 Bacteria 2769
1013 Ga0496108_0106569 3300048911 Bacteria 2393
1014 Ga0496108_0260215 3300048911 Bacteria 1510
1015 Ga0496109_0014032 3300048912 Bacteria 6965
1016 Ga0496109_0080432 3300048912 Bacteria 3002
1017 Ga0496109_0094738 3300048912 Bacteria 2763
1018 Ga0496109_0193109 3300048912 Bacteria 1913
1019 Ga0496109_0202587 3300048912 Bacteria 1866
1020 Ga0496109_0238702 3300048912 Bacteria 1710
1021 Ga0496109_0725810 3300048912 Bacteria 931
1022 Ga0496109_0968468 3300048912 Bacteria 788
1023 Ga0496110_0004391 3300048913 Bacteria 10921
1024 Ga0496110_0011291 3300048913 Bacteria 7303
1025 Ga0496110_0023092 3300048913 Bacteria 5290
1026 Ga0496110_0253267 3300048913 Bacteria 1602
1027 Ga0496110_0325865 3300048913 Bacteria 1399
1028 Ga0496110_0411533 3300048913 Bacteria 1233
1029 Ga0496110_0568193 3300048913 Bacteria 1030
1030 Ga0496110_0977177 3300048913 Bacteria 754
1031 Ga0496111_0027325 3300048914 Bacteria 4035
1032 Ga0496111_0067648 3300048914 Bacteria 2595
1033 Ga0496111_0086817 3300048914 Bacteria 2289
1034 Ga0496111_0124914 3300048914 Bacteria 1902
1035 Ga0496111_0491673 3300048914 Bacteria 903
1036 Ga0496111_0513307 3300048914 Bacteria 882
1037 Ga0496111_0677513 3300048914 Bacteria 751
1038 Ga0496112_0049608 3300048915 Bacteria 4115
1039 Ga0496112_0557159 3300048915 Bacteria 1080
1040 Ga0496113_0036651 3300048916 Bacteria 3595
1041 Ga0496113_0148211 3300048916 Bacteria 1850
1042 Ga0496113_0238090 3300048916 Bacteria 1452
1043 Ga0496113_0307134 3300048916 Bacteria 1270
1044 Ga0496113_1032153 3300048916 Bacteria 647
1045 Ga0496114_0002482 3300048917 Bacteria 14092
1046 Ga0496114_0016483 3300048917 Bacteria 5956
1047 Ga0496114_0143077 3300048917 Bacteria 2072
1048 Ga0496114_0143609 3300048917 Bacteria 2068
1049 Ga0496114_0164995 3300048917 Bacteria 1928
1050 Ga0496114_0223148 3300048917 Bacteria 1654
1051 Ga0496114_0235128 3300048917 Bacteria 1610
1052 Ga0496114_0267192 3300048917 Bacteria 1507
1053 Ga0496114_0296399 3300048917 Bacteria 1427
1054 Ga0496114_1173759 3300048917 Bacteria 653
1055 Ga0496115_0007736 3300048918 Bacteria 7925
1056 Ga0496115_0357708 3300048918 Bacteria 1190
1057 Ga0496115_0586262 3300048918 Bacteria 888
1058 Ga0496117_0094345 3300048920 Bacteria 1915
1059 Ga0496117_0202037 3300048920 Bacteria 1122
1060 Ga0496118_0059415 3300048921 Bacteria 2847
1061 Ga0496118_0094560 3300048921 Bacteria 2043
1062 Ga0496118_0627843 3300048921 Bacteria 509
1063 Ga0496119_0025963 3300048922 Bacteria 4076
1064 Ga0496119_0055002 3300048922 Bacteria 2420
1065 Ga0496120_0367002 3300048923 Bacteria 643
1066 Ga0496121_0017831 3300048924 Bacteria 7211
1067 Ga0496121_0315754 3300048924 Bacteria 1054
1068 Ga0496122_0001555 3300048925 Bacteria 36330
1069 Ga0496123_0400097 3300048926 Bacteria 625
1070 Ga0496124_0655792 3300048927 Bacteria 673
1071 Ga0496125_0000025 3300048928 Bacteria 440074
1072 Ga0496126_0000036 3300048929 Bacteria 354901
1073 Ga0501306_018232 3300049127 Bacteria 958
1074 Ga0495682_0170173 3300049460 Bacteria 775
1075 Ga0501031_0246011 3300049568 Bacteria 1162
1076 Ga0501032_0009780 3300049569 Bacteria 6938
1077 Ga0501032_0015007 3300049569 Bacteria 5477
1078 Ga0501032_0019341 3300049569 Bacteria 4765
1079 Ga0501032_0098368 3300049569 Bacteria 1939
1080 Ga0501033_0033436 3300049570 Bacteria 3859
1081 Ga0501033_0089909 3300049570 Bacteria 2246
1082 Ga0501033_0100027 3300049570 Bacteria 2116
1083 Ga0501033_0177710 3300049570 Bacteria 1527
1084 Ga0501034_0027557 3300049571 Bacteria 5779
1085 Ga0501034_0063804 3300049571 Bacteria 3698
1086 Ga0501034_0145647 3300049571 Bacteria 2346
1087 Ga0501034_0192787 3300049571 Bacteria 1999
1088 Ga0501034_0472586 3300049571 Bacteria 1170
1089 Ga0501034_1439012 3300049571 Bacteria 564
1090 Ga0501036_0032656 3300049572 Bacteria 4400
1091 Ga0501036_0592988 3300049572 Bacteria 919
1092 Ga0501036_1465239 3300049572 Bacteria 553
1093 Ga0501037_0105593 3300049573 Bacteria 2030
1094 Ga0501037_0383282 3300049573 Bacteria 966
1095 Ga0501037_0399266 3300049573 Bacteria 943
1096 Ga0501037_0876991 3300049573 Bacteria 589
1097 Ga0501038_0003594 3300049574 Bacteria 14429
1098 Ga0501038_0007999 3300049574 Bacteria 9745
1099 Ga0501038_0058002 3300049574 Bacteria 3321
1100 Ga0501038_0067229 3300049574 Bacteria 3049
1101 Ga0501039_0027902 3300049575 Bacteria 4342
1102 Ga0501039_0430332 3300049575 Bacteria 1036
1103 Ga0501039_0468282 3300049575 Bacteria 989
1104 Ga0501040_0241799 3300049576 Bacteria 1287
1105 Ga0501040_0292869 3300049576 Bacteria 1163
1106 Ga0501042_0594422 3300049578 Bacteria 805
1107 Ga0501043_0094641 3300049579 Bacteria 2348
1108 Ga0501043_0209419 3300049579 Bacteria 1511
1109 Ga0501043_0410947 3300049579 Bacteria 1021
1110 Ga0501046_0023316 3300049580 Bacteria 5093
1111 Ga0501047_0000191 3300049581 Bacteria 74396
1112 Ga0501047_0005402 3300049581 Bacteria 12015
1113 Ga0501047_0037162 3300049581 Bacteria 4708
1114 Ga0501047_0049715 3300049581 Bacteria 4048
1115 Ga0501047_0056593 3300049581 Bacteria 3792
1116 Ga0501047_0074133 3300049581 Bacteria 3276
1117 Ga0501047_0523684 3300049581 Bacteria 1011
1118 Ga0501048_0000405 3300049582 Bacteria 30043
1119 Ga0501048_0087368 3300049582 Bacteria 2200
1120 Ga0501048_0157469 3300049582 Bacteria 1607
1121 Ga0501048_0401781 3300049582 Bacteria 979
1122 Ga0501067_0041498 3300049583 Bacteria 2555
1123 Ga0501067_0144006 3300049583 Bacteria 1328
1124 Ga0501067_0781863 3300049583 Bacteria 537
1125 Ga0501069_0012307 3300049585 Bacteria 4548
1126 Ga0501069_0136480 3300049585 Bacteria 1406
1127 Ga0501069_0539436 3300049585 Bacteria 697
1128 Ga0501070_0108433 3300049586 Bacteria 2294
1129 Ga0501070_0241375 3300049586 Bacteria 1479
1130 Ga0501070_0790646 3300049586 Bacteria 746
1131 Ga0501070_1041937 3300049586 Bacteria 633
1132 Ga0501070_1380007 3300049586 Bacteria 536
1133 Ga0501071_0550997 3300049587 Bacteria 886
1134 Ga0501072_0508384 3300049588 Bacteria 953
1135 Ga0501074_0101418 3300049590 Bacteria 2060
1136 Ga0501075_0715309 3300049591 Bacteria 763
1137 Ga0501235_031949 3300049669 Bacteria 1190
1138 Ga0501080_0031855 3300049742 Bacteria 4913
1139 Ga0501080_0617989 3300049742 Bacteria 961
1140 Ga0501083_0024967 3300049744 Bacteria 4139
1141 Ga0501083_0980639 3300049744 Bacteria 550
1142 Ga0501282_002540 3300049778 Bacteria 1978
1143 Ga0501035_0034700 3300049822 Bacteria 4582
1144 Ga0501035_0089814 3300049822 Bacteria 2705
1145 Ga0501035_0097433 3300049822 Bacteria 2583
1146 Ga0501035_0210569 3300049822 Bacteria 1663
1147 Ga0501035_0227026 3300049822 Bacteria 1592
1148 Ga0501035_1023312 3300049822 Bacteria 648
1149 Ga0501044_0011203 3300049823 Bacteria 9724
1150 Ga0501044_0024862 3300049823 Bacteria 6353
1151 Ga0501044_0097788 3300049823 Bacteria 2956
1152 Ga0501044_0106072 3300049823 Bacteria 2822
1153 Ga0501044_0217659 3300049823 Bacteria 1861
1154 Ga0501044_0222055 3300049823 Bacteria 1840
1155 Ga0501044_0901185 3300049823 Bacteria 759
1156 Ga0501045_0032328 3300049824 Bacteria 3792
1157 Ga0501045_0581642 3300049824 Bacteria 830
1158 nmdc:mga03n38_36630_c1 3300050490 Bacteria 2110
1159 nmdc:mga03n38_477_c1 3300050490 Bacteria 10014
1160 nmdc:mga0yw44_1049157_c1 3300050492 Bacteria 551
1161 nmdc:mga0yw44_130712_c1 3300050492 Bacteria 1625
1162 nmdc:mga0yw44_187909_c1 3300050492 Bacteria 1362
1163 nmdc:mga06z11_11001_c1 3300050494 Bacteria 3881
1164 nmdc:mga04h51_203941_c1 3300050495 Bacteria 778
1165 nmdc:mga07m45_451589_c1 3300050496 Bacteria 745
1166 nmdc:mga05p37_24408_c1 3300050507 Bacteria 7347
1167 nmdc:mga05p37_440_c1 3300050507 Bacteria 45174
1168 nmdc:mga09592_278_c1 3300050508 Bacteria 37149
1169 nmdc:mga09592_281623_c1 3300050508 Bacteria 1442
1170 nmdc:mga09592_7319_c1 3300050508 Bacteria 8974
1171 nmdc:mga0qj67_20014_c1 3300050509 Bacteria 5121
1172 nmdc:mga0qj67_2876_c1 3300050509 Bacteria 12357
1173 nmdc:mga0qj67_79740_c1 3300050509 Bacteria 2622
1174 nmdc:mga06r32_29384_c1 3300050510 Bacteria 5151
1175 nmdc:mga06r32_4205_c1 3300050510 Bacteria 12899
1176 nmdc:mga06r32_434_c1 3300050510 Bacteria 35341
1177 nmdc:mga08y16_14165_c1 3300050511 Bacteria 8391
1178 nmdc:mga08y16_9696_c1 3300050511 Bacteria 10110
1179 nmdc:mga0n895_502919_c1 3300050512 Bacteria 1221
1180 nmdc:mga0n895_707851_c1 3300050512 Bacteria 1003
1181 nmdc:mga08x19_284937_c1 3300050514 Bacteria 1145
1182 nmdc:mga0a205_137541_c1 3300050515 Bacteria 2343
1183 Ga0495601_0011311 3300053077 Bacteria 5333
1184 Ga0495612_0494029 3300053078 Bacteria 561
1185 Ga0495655_0003679 3300053083 Bacteria 2552
1186 Ga0495655_0040412 3300053083 Bacteria 1187
1187 Ga0495595_0049668 3300053084 Bacteria 1941
1188 Ga0495595_0208890 3300053084 Bacteria 973
1189 Ga0495619_0021775 3300053085 Bacteria 4095
1190 Ga0500578_0176366 3300053086 Bacteria 1319
1191 Ga0500553_158493 3300053101 Bacteria 856
1192 Ga0500593_171213 3300053117 Bacteria 818
1193 Ga0500652_171790 3300053131 Bacteria 892
1194 Ga0500573_0175236 3300053140 Bacteria 1157
1195 Ga0500604_0022630 3300053151 Bacteria 1786
1196 Ga0500616_0012396 3300053153 Bacteria 4989
1197 Ga0501084_0706142 3300054114 Bacteria 850
1198 Ga0501084_0771280 3300054114 Bacteria 810
1199 Ga0590075_069645 3300059424 Bacteria 908
1200 Ga0590077_056836 3300059426 Bacteria 884
1201 Ga0501082_0001608 3300060353 Bacteria 19895
1202 Ga0501082_0866832 3300060353 Bacteria 790
1203 Ga0501082_0867170 3300060353 Bacteria 790
1204 Ga0466962_0002858 3300061719 Bacteria 8229
1205 Ga0466962_0017111 3300061719 Bacteria 3493
1206 Ga0466962_0092535 3300061719 Bacteria 1449
1207 Ga0466962_0291938 3300061719 Bacteria 806
1208 Ga0530510_0458111 3300061734 Bacteria 965
1209 2554259658 2554235005 Bacteria 6457341
1210 2585297862 2582581312 Bacteria 7308206
1211 2585310920 2582581313 Bacteria 10042643
1212 2585316071 2582581314 Bacteria 11452267
1213 2616703006 2616644814 Bacteria 11555299
1214 2616905332 2616644941 Bacteria 8510691
1215 2643764564 2643221548 Bacteria 8053412
1216 2643905221 2643221578 Bacteria 9213798
1217 2643942720 2643221587 Bacteria 7586415
1218 2644264156 2643221647 Bacteria 10741251
1219 2644385888 2643221670 Bacteria 6497041
1220 2644403279 2643221673 Bacteria 9196637
1221 2644430179 2643221677 Bacteria 7584031
1222 2644438173 2643221678 Bacteria 9540101
1223 2644458377 2643221682 Bacteria 6743283
1224 2644503901 2643221690 Bacteria 4654705
1225 2644527036 2643221694 Bacteria 4392972
1226 2644629905 2643221714 Bacteria 9015452
1227 2644666359 2643221721 Bacteria 4486924
1228 2644670231 2643221722 Bacteria 4247614
1229 2734976218 2734482000 Bacteria 5525167
1230 2784586633 2784132148 Bacteria 8627943
1231 2785345865 2784746763 Bacteria 9783172
1232 2785367024 2784746768 Bacteria 10036182
1233 2786668061 2786546132 Bacteria 10419719
1234 2804843616 2802429296 Bacteria 7227771
1235 2808847527 2808606359 Bacteria 9866990
1236 2808918259 2808606375 Bacteria 9466072
1237 2809230160 2808606448 Bacteria 8656184
1238 2811846850 2808606982 Bacteria 7791042
1239 2812360441 2811994879 Bacteria 9313447
1240 2812365145 2811994880 Bacteria 4147780
1241 2812482534 2811994917 Bacteria 7761064
1242 2819699773 2818991463 Bacteria 7948711
1243 2839988550 2839986021 Bacteria 3685650
1244 2852643300 2852635781 Bacteria 8251373
1245 2862181425 2862178590 Bacteria 8583590
1246 2862289786 2862281513 Bacteria 9621493
1247 2862294123 2862290372 Bacteria 7471434
1248 2862392545 2862382967 Bacteria 10317375
1249 2862508466 2862507626 Bacteria 9425308
1250 2862580102 2862574272 Bacteria 10567477
1251 2862709638 2862705112 Bacteria 6563286
1252 2863407096 2863404153 Bacteria 9672205
1253 2867375225 2867369537 Bacteria 6501581
1254 2867435054 2867428634 Bacteria 9590268
1255 2867475993 2867475112 Bacteria 6909112
1256 2873157803 2873151551 Bacteria 8625867
1257 2875392585 2875391855 Bacteria 7600475
1258 2877683519 2877676314 Bacteria 9512378
1259 2884995474 2884994152 Bacteria 4492978
1260 2912722629 2912715099 Bacteria 9460473
1261 2912726311 2912723979 Bacteria 8557534
1262 2912758726 2912757875 Bacteria 7940295
1263 2918502395 2918501144 Bacteria 8668083
1264 2919474483 2919468124 Bacteria 9133025
1265 2935394170 2935390628 Bacteria 7043367
1266 2935891050 2935890801 Bacteria 4593001
1267 2946052131 2946045630 Bacteria 8527308
1268 2946065448 2946064051 Bacteria 8957905
1269 2946073811 2946072368 Bacteria 8999607
1270 2947231959 2947224130 Bacteria 9938529
1271 2954008974 2954002825 Bacteria 9173742
1272 2954388775 2954380949 Bacteria 10050426
1273 2954674349 2954673503 Bacteria 9685905
1274 2954689782 2954682443 Bacteria 9862841
1275 2954699566 2954691527 Bacteria 10720516
1276 2954702651 2954701450 Bacteria 10834262
1277 2954718504 2954711539 Bacteria 10867210
1278 2954728475 2954721474 Bacteria 10456478
1279 2954733335 2954731030 Bacteria 10243860
1280 2954747371 2954740390 Bacteria 10229294
1281 2954752218 2954749733 Bacteria 10366972
1282 2954766485 2954759201 Bacteria 9358192
1283 2966604546 2966598605 Bacteria 7676064
1284 2990045457 2990044586 Bacteria 6603797
1285 2990060260 2990059506 Bacteria 9321252
1286 2990093382 2990088156 Bacteria 6657676
1287 2997451917 2997451912 Bacteria 8492419
1288 2997603425 2997600082 Bacteria 9896405
1289 3003004122 3002998708 Bacteria 11715108
1290 3006327560 3006321560 Bacteria 8247479
1291 3006399457 3006393351 Bacteria 6615579
1292 3006430708 3006425503 Bacteria 6491253
1293 3006489357 3006486233 Bacteria 8157040
1294 3006498345 3006493962 Bacteria 8825450
1295 8008486931 8008485437 Bacteria 7198341
1296 8008561185 8008558824 Bacteria 10610750
1297 8008580869 8008574985 Bacteria 7815457
1298 8023630936 8023623736 Bacteria 8593882
1299 8025418331 8025413630 Bacteria 7014048
1300 8025482366 8025478263 Bacteria 8209203
1301 8025526188 8025524527 Bacteria 7197316
1302 8025533894 8025530807 Bacteria 8495698
1303 8033686646 8033684223 Bacteria 6906479
1304 8047901208 8047893842 Bacteria 11723082
1305 8048135610 8048127548 Bacteria 11053136
1306 8048357693 8048356638 Bacteria 11044339
1307 8048378148 8048369669 Bacteria 11666822
1308 8048387246 8048379754 Bacteria 11877923
1309 8048409970 8048406513 Bacteria 8936924
1310 8054166910 8054160619 Bacteria 7783213
1311 8056454226 8056447290 Bacteria 7680491
1312 8056670094 8056667051 Bacteria 6953971
1313 8056832440 8056829672 Bacteria 9045328
1314 Ga0466962_0003210
1315 LJQas_1022420
1316 JGI24737J22298_10241717
1317 JGI24738J21930_10047848
1318 JGI24744J21845_10012255
1319 JGI25406J46586_10004005
1320 rootH2_10017275
1321 rootH1_10088192
1322 JGI25407J50210_10065969
1323 Ga0070658_10416434
1324 Ga0070658_10951039
1325 Ga0070658_11399344
1326 Ga0070676_11176609
1327 Ga0070676_11240252
1328 Ga0070683_100057355
1329 Ga0070683_100079089
1330 Ga0070683_100099266
1331 Ga0070683_100692307
1332 Ga0070683_101004593
1333 Ga0070683_101371616
1334 Ga0070670_101796132
1335 Ga0068869_100237561
1336 Ga0070666_10003317
1337 Ga0070666_10064975
1338 Ga0070680_100363401
1339 Ga0070680_100375671
1340 Ga0070680_100466470
1341 Ga0070680_100624983
1342 Ga0070680_101019198
1343 Ga0070680_101137063
1344 Ga0070682_100031446
1345 Ga0070682_100347102
1346 Ga0070682_101123379
1347 Ga0068868_100488411
1348 Ga0070660_100087316
1349 Ga0070660_100322337
1350 Ga0070660_100583841
1351 Ga0070660_101506886
1352 Ga0070689_100098074
1353 Ga0070689_100320167
1354 Ga0070691_10178261
1355 Ga0070687_100202557
1356 Ga0070661_100103154
1357 Ga0070661_100241199
1358 Ga0070692_10027073
1359 Ga0070692_10491384
1360 Ga0070668_100002900
1361 Ga0070668_100369390
1362 Ga0070669_100030781
1363 Ga0070669_101798354
1364 Ga0070675_101509305
1365 Ga0070671_100021033
1366 Ga0070674_100136314
1367 Ga0070674_100313986
1368 Ga0070674_100352446
1369 Ga0070674_100767046
1370 Ga0070673_100005872
1371 Ga0070688_100721125
1372 Ga0070659_100015723
1373 Ga0070659_100333228
1374 Ga0070659_100386821
1375 Ga0070659_101817722
1376 Ga0070667_100006026
1377 Ga0070667_100021661
1378 Ga0070703_10015033
1379 Ga0070714_100498172
1380 Ga0070714_101104250
1381 Ga0070713_100063224
1382 Ga0070710_10318990
1383 Ga0070701_10004746
1384 Ga0070701_10047674
1385 Ga0070711_100007302
1386 Ga0070705_100009475
1387 Ga0070705_101231193
1388 Ga0070700_100000406
1389 Ga0070700_100779527
1390 Ga0070694_100993214
1391 Ga0070663_100033790
1392 Ga0070663_100260717
1393 Ga0070663_100522872
1394 Ga0070678_100025304
1395 Ga0070662_100033899
1396 Ga0070681_10005943
1397 Ga0070681_10136451
1398 Ga0070681_10466558
1399 Ga0068867_100087869
1400 Ga0070685_10903264
1401 Ga0070698_101341055
1402 Ga0070679_100003650
1403 Ga0070679_100638187
1404 Ga0070684_100144067
1405 Ga0070684_100177198
1406 Ga0070684_101048408
1407 Ga0070684_102035952
1408 Ga0070697_101314041
1409 Ga0068853_100135581
1410 Ga0068853_100138197
1411 Ga0068853_100661340
1412 Ga0070672_100115779
1413 Ga0070672_100239782
1414 Ga0070672_100518096
1415 Ga0070672_102006595
1416 Ga0070686_100492382
1417 Ga0070695_100446010
1418 Ga0070696_100311025
1419 Ga0070693_100118389
1420 Ga0070693_100369792
1421 Ga0070665_100003227
1422 Ga0070665_100055978
1423 Ga0070665_100620528
1424 Ga0070665_100785740
1425 Ga0070704_100037730
1426 Ga0068855_100021450
1427 Ga0068855_100057120
1428 Ga0068855_100059143
1429 Ga0068855_100424958
1430 Ga0068855_100835986
1431 Ga0070664_100178256
1432 Ga0070664_100999770
1433 Ga0068857_100452244
1434 Ga0068857_101249726
1435 Ga0068854_100306816
1436 Ga0068854_101810675
1437 Ga0068856_100088421
1438 Ga0068856_100147033
1439 Ga0068856_100174480
1440 Ga0068856_100651890
1441 Ga0068856_101404496
1442 Ga0070702_100033494
1443 Ga0070702_100253317
1444 Ga0068852_100020158
1445 Ga0068852_100111044
1446 Ga0068852_100674790
1447 Ga0068859_100002361
1448 Ga0068859_100221522
1449 Ga0068859_100809523
1450 Ga0068864_100041671
1451 Ga0068866_10203000
1452 Ga0068861_100048872
1453 Ga0068861_100126857
1454 Ga0068861_101266966
1455 Ga0068851_10058629
1456 Ga0068851_10619920
1457 Ga0068870_10001067
1458 Ga0068870_10083920
1459 Ga0068863_100004882
1460 Ga0068863_100073740
1461 Ga0068858_100013689
1462 Ga0068858_100039448
1463 Ga0068858_102578238
1464 Ga0068860_100000035
1465 Ga0068860_100042424
1466 Ga0068860_101758013
1467 Ga0068862_100067953
1468 Ga0068862_101820475
1469 Ga0081455_10002276
1470 Ga0081455_10025771
1471 Ga0081455_10041731
1472 Ga0081455_10583797
1473 Ga0081538_10000036
1474 Ga0081538_10056572
1475 Ga0081538_10097228
1476 Ga0081540_1010407
1477 Ga0081539_10000643
1478 Ga0070717_10034948
1479 Ga0070717_11384185
1480 Ga0075365_10024472
1481 Ga0075365_10060650
1482 Ga0075365_10431348
1483 Ga0075365_10989443
1484 Ga0075368_10205485
1485 Ga0075363_100052481
1486 Ga0075363_100297682
1487 Ga0075432_10063772
1488 Ga0070715_10817501
1489 Ga0070712_100052549
1490 Ga0070712_100945669
1491 Ga0075362_10726223
1492 Ga0075367_10007402
1493 Ga0097621_100363228
1494 Ga0097621_100371584
1495 Ga0068871_100009798
1496 Ga0068871_100446913
1497 Ga0075428_100001304
1498 Ga0075428_100089562
1499 Ga0075428_100274270
1500 Ga0075430_100006263
1501 Ga0075430_100026196
1502 Ga0075431_100002908
1503 Ga0075431_100008250
1504 Ga0075431_100012439
1505 Ga0075433_10006767
1506 Ga0075433_10291184
1507 Ga0075434_100051928
1508 Ga0075434_100511789
1509 Ga0075429_100001324
1510 Ga0075429_100005562
1511 Ga0068865_100022810
1512 Ga0068865_100039489
1513 Ga0068865_101485019
1514 Ga0068865_101684194
1515 Ga0075436_100030843
1516 Ga0097620_100002361
1517 Ga0097620_100221504
1518 Ga0097620_100809550
1519 Ga0099826_10058874
1520 Ga0075435_100250842
1521 Ga0105251_10088971
1522 Ga0105240_10012487
1523 Ga0105240_10066086
1524 Ga0105240_10138708
1525 Ga0111539_10038306
1526 Ga0111539_10564347
1527 Ga0111539_11990147
1528 Ga0105245_10034424
1529 Ga0105245_10066039
1530 Ga0105245_10907041
1531 Ga0105245_11219824
1532 Ga0105247_10003264
1533 Ga0105247_10013085
1534 Ga0105247_10110891
1535 Ga0114129_10026601
1536 Ga0114129_10080508
1537 Ga0105243_10017305
1538 Ga0105243_10029336
1539 Ga0105243_10421646
1540 Ga0105243_11390273
1541 Ga0105241_10016040
1542 Ga0105241_10092112
1543 Ga0105241_10313472
1544 Ga0105241_10818451
1545 Ga0105242_10090413
1546 Ga0105242_10411505
1547 Ga0105242_10534754
1548 Ga0105242_10704143
1549 Ga0105248_10028128
1550 Ga0105248_10094722
1551 Ga0105248_11657239
1552 Ga0105237_10091480
1553 Ga0105237_10261480
1554 Ga0105237_10935616
1555 Ga0105237_11198280
1556 Ga0105237_11547122
1557 Ga0105237_12773299
1558 Ga0105238_10130917
1559 Ga0105238_10413460
1560 Ga0105238_10433003
1561 Ga0105238_12241857
1562 Ga0105249_10135602
1563 Ga0105249_10688100
1564 Ga0105249_11302646
1565 Ga0105249_12470749
1566 Ga0105239_10362082
1567 Ga0105239_10393835
1568 Ga0105239_10589429
1569 Ga0105239_10803279
1570 Ga0105239_10871389
1571 Ga0105246_10003223
1572 Ga0105246_10383410
1573 Ga0105246_10772831
1574 Ga0157373_10168923
1575 Ga0157371_10365025
1576 Ga0157371_10604129
1577 Ga0157370_10045502
1578 Ga0157370_10194714
1579 Ga0157370_10351827
1580 Ga0157370_10717088
1581 Ga0157370_11449549
1582 Ga0157370_11781084
1583 Ga0157369_10018735
1584 Ga0157369_10040889
1585 Ga0157369_10087776
1586 Ga0157369_10137846
1587 Ga0157369_10174224
1588 Ga0157369_10220041
1589 Ga0157369_11059610
1590 Ga0157369_11539011
1591 Ga0157374_10567314
1592 Ga0157374_11311054
1593 Ga0157374_11977993
1594 Ga0157374_12555383
1595 Ga0157378_10271920
1596 Ga0163162_10014032
1597 Ga0163162_11056109
1598 Ga0163162_11310563
1599 Ga0157372_10045237
1600 Ga0157372_10055403
1601 Ga0157372_10060103
1602 Ga0157372_10111409
1603 Ga0157372_10202728
1604 Ga0157372_10240579
1605 Ga0157372_11867886
1606 Ga0157375_10323885
1607 Ga0157375_10418780
1608 Ga0157375_10628424
1609 Ga0157375_11907443
1610 Ga0163163_10068051
1611 Ga0163163_10647185
1612 Ga0163163_12596318
1613 Ga0157380_10002480
1614 Ga0157380_10374551
1615 Ga0157380_11026518
1616 Ga0182008_10003052
1617 Ga0182008_10093452
1618 Ga0182008_10153283
1619 Ga0157379_10023014
1620 Ga0157379_10276379
1621 Ga0157379_10932075
1622 Ga0157379_11657985
1623 Ga0157376_10113096
1624 Ga0157376_10413661
1625 Ga0157376_11070113
1626 Ga0182006_1018487
1627 Ga0182007_10002246
1628 Ga0182005_1036209
1629 Ga0183367_1003
1630 Ga0163161_10023316
1631 Ga0163161_10268867
1632 Ga0163161_10745113
1633 Ga0163161_11008509
1634 Ga0163161_11566421
1635 Ga0197907_10033713
1636 Ga0206356_10468274
1637 Ga0206356_11002279
1638 Ga0206356_11595527
1639 Ga0206352_10982403
1640 Ga0206352_11358692
1641 Ga0206354_11337459
1642 Ga0206354_11619843
1643 Ga0206353_10029995
1644 Ga0206353_10259526
1645 Ga0206353_10358891
1646 Ga0206353_10968491
1647 Ga0206353_11192181
1648 Ga0206353_11246040
1649 Ga0206353_11341543
1650 Ga0213875_10122117
1651 Ga0213875_10399456
1652 Ga0224712_10526188
1653 Ga0209758_1011831
1654 Ga0207656_10203249
1655 Ga0207655_1230742
1656 Ga0207653_10013683
1657 Ga0207682_10089490
1658 Ga0207692_10071362
1659 Ga0207642_10020485
1660 Ga0207642_10207100
1661 Ga0207710_10018543
1662 Ga0207688_10005436
1663 Ga0207688_10022147
1664 Ga0207680_10007745
1665 Ga0207680_10013189
1666 Ga0207647_10075726
1667 Ga0207685_10154324
1668 Ga0207685_10617342
1669 Ga0207699_10521729
1670 Ga0207643_10001879
1671 Ga0207643_10071311
1672 Ga0207705_10008652
1673 Ga0207705_10126804
1674 Ga0207705_10212246
1675 Ga0207705_10337834
1676 Ga0207705_10417605
1677 Ga0207654_10015189
1678 Ga0207654_10328826
1679 Ga0207654_10331453
1680 Ga0207707_10106548
1681 Ga0207707_10276080
1682 Ga0207695_10048226
1683 Ga0207671_10513993
1684 Ga0207671_10637901
1685 Ga0207671_11121285
1686 Ga0207693_10000761
1687 Ga0207693_10565252
1688 Ga0207663_10359681
1689 Ga0207660_10189323
1690 Ga0207660_10596487
1691 Ga0207660_10777114
1692 Ga0207660_10974121
1693 Ga0207662_10019622
1694 Ga0207662_10947410
1695 Ga0207657_10030578
1696 Ga0207657_10072328
1697 Ga0207657_10148879
1698 Ga0207657_10265778
1699 Ga0207657_10352389
1700 Ga0207649_10213247
1701 Ga0207652_10014337
1702 Ga0207652_10191667
1703 Ga0207652_11691103
1704 Ga0207681_10461190
1705 Ga0207650_10473129
1706 Ga0207659_10298618
1707 Ga0207659_11030345
1708 Ga0207687_10057785
1709 Ga0207687_10435958
1710 Ga0207687_10889889
1711 Ga0207687_10973556
1712 Ga0207664_10004124
1713 Ga0207664_10275579
1714 Ga0207664_11673943
1715 Ga0207644_10054720
1716 Ga0207690_10041933
1717 Ga0207690_10054124
1718 Ga0207706_10006255
1719 Ga0207686_10040933
1720 Ga0207686_10050863
1721 Ga0207709_10466789
1722 Ga0207709_10593398
1723 Ga0207709_10825308
1724 Ga0207670_10253513
1725 Ga0207670_10357041
1726 Ga0207669_10089674
1727 Ga0207704_10041136
1728 Ga0207704_10107073
1729 Ga0207704_11595553
1730 Ga0207665_10000422
1731 Ga0207691_10027476
1732 Ga0207691_10142229
1733 Ga0207691_10322125
1734 Ga0207691_10787429
1735 Ga0207711_10102174
1736 Ga0207689_10008948
1737 Ga0207689_10367736
1738 Ga0207689_10939378
1739 Ga0207661_10085644
1740 Ga0207661_10423064
1741 Ga0207661_10626118
1742 Ga0207661_11530451
1743 Ga0207661_12127299
1744 Ga0207679_10437057
1745 Ga0207679_10826774
1746 Ga0207667_10016618
1747 Ga0207667_10086751
1748 Ga0207667_11786271
1749 Ga0207651_10161527
1750 Ga0207712_10021402
1751 Ga0207712_10027364
1752 Ga0207668_10034693
1753 Ga0207668_10168949
1754 Ga0207668_10436276
1755 Ga0207640_10084665
1756 Ga0207640_10461976
1757 Ga0207640_10734821
1758 Ga0207658_10085070
1759 Ga0207658_10490683
1760 Ga0207677_10029126
1761 Ga0207677_12017061
1762 Ga0207703_10026842
1763 Ga0207703_10132231
1764 Ga0207639_10152740
1765 Ga0207639_10799056
1766 Ga0207639_10819544
1767 Ga0207639_11695635
1768 Ga0207678_10001278
1769 Ga0207678_10152307
1770 Ga0207678_10459733
1771 Ga0207678_10501361
1772 Ga0207678_10766732
1773 Ga0207708_10011571
1774 Ga0207708_10064908
1775 Ga0207702_10186047
1776 Ga0207702_10485092
1777 Ga0207702_10531607
1778 Ga0207702_10547838
1779 Ga0207702_10750895
1780 Ga0207641_10047443
1781 Ga0207641_10720561
1782 Ga0207648_10010968
1783 Ga0207648_11959471
1784 Ga0207676_10249253
1785 Ga0207676_10297790
1786 Ga0207676_10695211
1787 Ga0207676_11082651
1788 Ga0207674_10395498
1789 Ga0207674_10656676
1790 Ga0207675_100000862
1791 Ga0207675_100020738
1792 Ga0207675_100315973
1793 Ga0207683_10004856
1794 Ga0207683_11000267
1795 Ga0207698_10251581
1796 Ga0207698_10265222
1797 Ga0207698_10433076
1798 Ga0207698_12274804
1799 Ga0207428_10026948
1800 Ga0207428_10039472
1801 Ga0268266_10001967
1802 Ga0268266_10091476
1803 Ga0268265_11154206
1804 Ga0268264_10000031
1805 Ga0307517_10019375
1806 Ga0307515_10123150
1807 Ga0307515_10291706
1808 Ga0307515_10377507
1809 Ga0307515_10778599
1810 Ga0307511_10170176
1811 Ga0307512_10002110
1812 Ga0307512_10060866
1813 Ga0307512_10432447
1814 Ga0307513_10007381
1815 Ga0307513_10010672
1816 Ga0307513_10032151
1817 Ga0307513_10340187
1818 Ga0307513_10738580
1819 Ga0307408_101994187
1820 Ga0307508_10027978
1821 Ga0307508_10239572
1822 Ga0307514_10023923
1823 Ga0307514_10143365
1824 Ga0316575_10100952
1825 Ga0316579_10044004
1826 Ga0316579_10207008
1827 Ga0316576_10024631
1828 Ga0316576_10025917
1829 Ga0316576_10117753
1830 Ga0316576_10281019
1831 Ga0316578_10001886
1832 Ga0316578_10015230
1833 Ga0316578_10018168
1834 Ga0316578_10181487
1835 Ga0316578_10614932
1836 Ga0307516_10009713
1837 Ga0307516_10068201
1838 Ga0307516_10234914
1839 Ga0307516_10456332
1840 Ga0316577_10021049
1841 Ga0316577_10075467
1842 Ga0307413_10048253
1843 Ga0307413_10669635
1844 Ga0307413_10831896
1845 Ga0307410_10206833
1846 Ga0307410_10362754
1847 Ga0307410_10707731
1848 Ga0307406_10072872
1849 Ga0307406_10285993
1850 Ga0307406_11131994
1851 Ga0307407_10884813
1852 Ga0307412_10583789
1853 Ga0307409_100037961
1854 Ga0307409_100200923
1855 Ga0307409_100206187
1856 Ga0307409_101095167
1857 Ga0307409_101670739
1858 Ga0307409_101907747
1859 Ga0307409_102207635
1860 Ga0307416_100133084
1861 Ga0307416_100168408
1862 Ga0307414_10246508
1863 Ga0307411_10313990
1864 Ga0307411_10812345
1865 Ga0307415_100006661
1866 Ga0307415_100622755
1867 Ga0316583_10023364
1868 Ga0316583_10027161
1869 Ga0316585_10022745
1870 Ga0316585_10100688
1871 Ga0316580_10034779
1872 Ga0316580_10038366
1873 Ga0316580_10121598
1874 Ga0316580_10206343
1875 Ga0373930_0048644
1876 Ga0373958_0055269
1877 Ga0373959_0032445
1878 Ga0373938_0016011
1879 Ga0373928_0008878
1880 Ga0373934_0372565
1881 Ga0373932_0084710
1882 Ga0373941_0120182
1883 Ga0373960_0004260
1884 Ga0373942_0075556
1885 Ga0373962_0263856
1886 Ga0316574_0002927
1887 Ga0316574_0006864
1888 Ga0316574_0028324
1889 Ga0316574_0039475
1890 Ga0316574_0181112
1891 Ga0373931_0396935
1892 Ga0373935_0652500
1893 Ga0373927_0769922
1894 Ga0373947_0630113
1895 Ga0373937_0104761
1896 Ga0316582_0004636
1897 Ga0316582_0005574
1898 Ga0316582_0228293
1899 Ga0316582_0950418
1900 Ga0316584_0001080
1901 Ga0316584_0002346
1902 Ga0316584_0006442
1903 Ga0316584_0024754
1904 Ga0316584_0071727
1905 Ga0316584_0146750
1906 Ga0373925_0761311
1907 Ga0373925_0974753
1908 Ga0373925_1060720
1909 Ga0373925_1444953
1910 Ga0395899_0014945
1911 Ga0395899_0239675
1912 Ga0395900_0144673
1913 Ga0395900_0244171
1914 Ga0395900_0309186
1915 Ga0395898_0002926
1916 Ga0395898_0008650
1917 Ga0395898_0023615
1918 Ga0395898_0094206
1919 Ga0395898_0584518
1920 Ga0395898_0910125
1921 Ga0395905_0012794
1922 Ga0395905_0307721
1923 Ga0395905_0355771
1924 Ga0436364_0312246
1925 Ga0436364_0487929
1926 Ga0436364_0747706
1927 Ga0395901_0021839
1928 Ga0395901_0070161
1929 Ga0395901_0220702
1930 Ga0395901_1705059
1931 Ga0439436_0004809
1932 Ga0439436_0035109
1933 Ga0439438_110365
1934 Ga0439439_0002892
1935 Ga0439461_0179366
1936 Ga0439466_0057028
1937 Ga0451787_443561
1938 Ga0451789_0357655
1939 Ga0451789_0403977
1940 Ga0451791_1032014
1941 Ga0451793_1705097
1942 Ga0451797_0119615
1943 Ga0451797_0425520
1944 Ga0451797_0900995
1945 Ga0451795_1315360
1946 Ga0451795_1425503
1947 Ga0451795_1527499
1948 Ga0451800_0913216
1949 Ga0451800_1276582
1950 Ga0451804_0978374
1951 Ga0451837_0844599
1952 Ga0451839_0451422
1953 Ga0451839_0878520
1954 Ga0451845_0934553
1955 Ga0451847_0328072
1956 Ga0451851_0409766
1957 Ga0451843_1398884
1958 Ga0451855_0876493
1959 Ga0451853_0925178
1960 Ga0451853_1111976
1961 Ga0451853_1397591
1962 Ga0451853_2120126
1963 Ga0451853_3106522
1964 Ga0451853_3509953
1965 Ga0439433_0001111
1966 Ga0439442_013843
1967 Ga0439448_0052233
1968 Ga0439448_0365740
1969 Ga0439449_0019483
1970 Ga0439449_0091794
1971 Ga0439455_0010486
1972 Ga0439455_0025944
1973 Ga0439457_000050
1974 Ga0439457_001276
1975 Ga0439457_008844
1976 Ga0439462_0005042
1977 Ga0450894_000402
1978 Ga0450899_000036
1979 Ga0450900_042940
1980 Ga0450903_000797
1981 Ga0450906_101925
1982 Ga0439458_0006796
1983 Ga0466969_0010992
1984 Ga0466969_0013005
1985 Ga0466969_0030942
1986 Ga0466969_0110907
1987 Ga0466969_0220074
1988 Ga0466972_0007258
1989 Ga0466972_0009587
1990 Ga0466972_0072859
1991 Ga0466972_0088945
1992 Ga0466972_0162133
1993 Ga0466972_0236880
1994 Ga0466972_0532276
1995 Ga0466972_0536432
1996 Ga0466965_0001744
1997 Ga0466965_0010965
1998 Ga0466965_0043535
1999 Ga0466965_0057857
2000 Ga0466965_0169242
2001 Ga0466965_0282760
2002 Ga0466966_0002073
2003 Ga0466966_0005617
2004 Ga0466966_0025000
2005 Ga0466966_0028829
2006 Ga0466966_0142757
2007 Ga0466966_0165133
2008 Ga0466966_0230017
2009 Ga0466966_0260620
2010 Ga0466966_0453423
2011 Ga0466961_0008931
2012 Ga0466961_0014704
2013 Ga0466961_0014898
2014 Ga0466961_0045254
2015 Ga0466961_0053016
2016 Ga0466961_0132317
2017 Ga0466961_0202977
2018 Ga0466961_0247600
2019 Ga0466961_0262829
2020 Ga0466961_0366455
2021 Ga0466961_0509618
2022 Ga0466963_0000954
2023 Ga0466963_0001197
2024 Ga0466963_0002952
2025 Ga0466963_0027689
2026 Ga0466963_0036308
2027 Ga0466963_0042041
2028 Ga0466963_0083036
2029 Ga0466963_0172772
2030 Ga0466963_0207778
2031 Ga0466963_0784525
2032 Ga0466963_0920574
2033 Ga0466964_0033613
2034 Ga0466964_0050199
2035 Ga0466964_0059076
2036 Ga0466964_0155505
2037 Ga0466964_0559184
2038 Ga0466971_0002834
2039 Ga0466971_0005350
2040 Ga0466971_0009159
2041 Ga0466971_0462942
2042 Ga0466968_0130881
2043 Ga0466968_0299683
2044 Ga0466968_0338362
2045 Ga0466970_0002112
2046 Ga0466970_0006676
2047 Ga0466970_0056600
2048 Ga0466970_0139243
2049 Ga0466970_0216939
2050 Ga0466970_0318905
2051 Ga0466970_0322202
2052 Ga0466970_0586225
2053 Ga0466957_0002224
2054 Ga0466957_0017495
2055 Ga0466957_0033658
2056 Ga0466957_0054096
2057 Ga0466957_0074321
2058 Ga0466957_0250016
2059 Ga0466960_0006393
2060 Ga0466960_0009062
2061 Ga0466960_0017315
2062 Ga0466960_0171892
2063 Ga0466960_0357114
2064 Ga0466960_0750356
2065 Ga0466959_0001862
2066 Ga0466959_0004316
2067 Ga0466959_0035444
2068 Ga0466959_0113081
2069 Ga0466959_0127788
2070 Ga0466959_0190193
2071 Ga0466959_0224473
2072 Ga0466959_0571240
2073 Ga0466959_0922226
2074 Ga0466959_1192868
2075 Ga0466958_0002184
2076 Ga0466958_0005815
2077 Ga0466958_0008194
2078 Ga0466958_0015510
2079 Ga0466958_0037010
2080 Ga0466958_0139625
2081 Ga0466958_0243493
2082 Ga0466958_0245045
2083 Ga0466958_0353297
2084 Ga0466958_0451233
2085 Ga0466958_0576267
2086 Ga0466958_0857445
2087 Ga0466958_1031491
2088 Ga0466967_0000613
2089 Ga0466967_0004827
2090 Ga0466967_0012903
2091 Ga0466967_0024495
2092 Ga0466967_0026875
2093 Ga0466967_0033125
2094 Ga0466967_0038602
2095 Ga0466967_0077677
2096 Ga0466967_0198330
2097 Ga0466967_0236726
2098 Ga0466967_0282112
2099 Ga0466967_0282536
2100 Ga0466967_0305088
2101 Ga0466967_0347908
2102 Ga0466967_0931016
2103 Ga0466967_1209721
2104 Ga0466967_1299476
2105 Ga0495617_064030
2106 Ga0495592_0010796
2107 Ga0495592_0022400
2108 Ga0495603_0006734
2109 Ga0495603_0008687
2110 Ga0495603_0111508
2111 Ga0495603_0236865
2112 Ga0495603_0743027
2113 Ga0495629_0020481
2114 Ga0495629_0020977
2115 Ga0495629_0128249
2116 Ga0495629_0661569
2117 Ga0495638_0062171
2118 Ga0495638_0298820
2119 Ga0495641_0369414
2120 Ga0495651_0017662
2121 Ga0495651_0513645
2122 Ga0495651_0677473
2123 Ga0495653_0017407
2124 Ga0495653_0191944
2125 Ga0495653_0692253
2126 Ga0495580_0055417
2127 Ga0495582_0027862
2128 Ga0495605_0016124
2129 Ga0495639_0175425
2130 Ga0495662_0002146
2131 Ga0495662_0118393
2132 Ga0495662_0231207
2133 Ga0495664_0000797
2134 Ga0495664_0195125
2135 Ga0495584_0057438
2136 Ga0495585_0117481
2137 Ga0495594_0020149
2138 Ga0495594_0069701
2139 Ga0495596_0076928
2140 Ga0495607_0165712
2141 Ga0495583_0066760
2142 Ga0495606_0017777
2143 Ga0495608_0055393
2144 Ga0495608_0140376
2145 Ga0495608_0352408
2146 Ga0495610_0031610
2147 Ga0495616_0007914
2148 Ga0495618_0491756
2149 Ga0495620_0050229
2150 Ga0495628_0020754
2151 Ga0495628_0106468
2152 Ga0495630_0020398
2153 Ga0495630_0394161
2154 Ga0495630_0568009
2155 Ga0495630_1284813
2156 Ga0495631_0007885
2157 Ga0495632_0132140
2158 Ga0495637_0046159
2159 Ga0495643_0003665
2160 Ga0495644_0394714
2161 Ga0495648_0087820
2162 Ga0495648_0093943
2163 Ga0495666_0008690
2164 Ga0495666_0159991
2165 Ga0495642_0471103
2166 Ga0495652_0019363
2167 Ga0495652_0054085
2168 Ga0495654_0051187
2169 Ga0495665_0010157
2170 Ga0495665_0500699
2171 Ga0495640_0007906
2172 Ga0495640_0015041
2173 Ga0495586_0013757
2174 Ga0495586_0112687
2175 Ga0495587_0021595
2176 Ga0495587_0716083
2177 Ga0495609_0008304
2178 Ga0495645_0007617
2179 Ga0495622_0004638
2180 Ga0495622_0149761
2181 Ga0495633_0007859
2182 Ga0495667_0442200
2183 Ga0495667_0593051
2184 Ga0495656_0225063
2185 Ga0495668_0020084
2186 Ga0495634_0039030
2187 Ga0495634_0055224
2188 Ga0495625_0069468
2189 Ga0495625_0289440
2190 Ga0495625_0358849
2191 Ga0495635_0038785
2192 Ga0495635_0411275
2193 Ga0495635_0530260
2194 Ga0495635_1035433
2195 Ga0495661_0017676
2196 Ga0495588_0017413
2197 Ga0495588_0229898
2198 Ga0495588_0249148
2199 Ga0495657_0007696
2200 Ga0495657_0058682
2201 Ga0495657_0069403
2202 Ga0495657_0456715
2203 Ga0495657_0734274
2204 Ga0495599_0030957
2205 Ga0495599_0045948
2206 Ga0495623_0023639
2207 Ga0495623_0381190
2208 Ga0495646_0022524
2209 Ga0495646_0143203
2210 Ga0495658_0144532
2211 Ga0495613_0001133
2212 Ga0495613_0044814
2213 Ga0495613_0066530
2214 Ga0495613_0117244
2215 Ga0495613_0124595
2216 Ga0495613_0445479
2217 Ga0495613_0800271
2218 Ga0495613_0988979
2219 Ga0495624_0063855
2220 Ga0495624_0262369
2221 Ga0495670_0029319
2222 Ga0495671_0496321
2223 Ga0495649_0009731
2224 Ga0495649_0050327
2225 Ga0495649_0058537
2226 Ga0495589_0002834
2227 Ga0495589_0140770
2228 Ga0495600_0051183
2229 Ga0495600_0085607
2230 Ga0495600_0429984
2231 Ga0495600_0455125
2232 Ga0495660_0512680
2233 Ga0495581_0131487
2234 Ga0495581_0271904
2235 Ga0495581_0435886
2236 Ga0495604_0000717
2237 Ga0495636_0005011
2238 Ga0495636_0008796
2239 Ga0495636_0011721
2240 Ga0495636_0294265
2241 Ga0495636_0481507
2242 Ga0495674_0020148
2243 Ga0495674_0194464
2244 Ga0495674_0208180
2245 Ga0495674_0401256
2246 Ga0495674_0498450
2247 Ga0495672_0470974
2248 Ga0495676_0018902
2249 Ga0495676_0032816
2250 Ga0495676_0272373
2251 Ga0495680_0015876
2252 Ga0495683_0272494
2253 Ga0495683_0444811
2254 Ga0495687_001837
2255 Ga0495687_124828
2256 Ga0495687_134558
2257 Ga0495687_163189
2258 Ga0495675_0012537
2259 Ga0495675_0033528
2260 Ga0495677_0060572
2261 Ga0495677_0347946
2262 Ga0495685_006732
2263 Ga0495685_031531
2264 Ga0495685_071599
2265 Ga0495685_109534
2266 Ga0495685_130021
2267 Ga0495685_147366
2268 Ga0495681_0038064
2269 Ga0495681_0246781
2270 Ga0495684_0051912
2271 Ga0495684_0219199
2272 Ga0495686_0073074
2273 Ga0495686_0215328
2274 Ga0495593_0018986
2275 Ga0495593_0053424
2276 Ga0495602_0481595
2277 Ga0495602_1125161
2278 Ga0495614_0009183
2279 Ga0495614_0116815
2280 Ga0495614_0516140
2281 Ga0495626_0013567
2282 Ga0495626_0249104
2283 Ga0496100_0089905
2284 Ga0496100_0375421
2285 Ga0496100_0469993
2286 Ga0496101_0104740
2287 Ga0496101_0395556
2288 Ga0496102_0000474
2289 Ga0496102_0052146
2290 Ga0496102_0079919
2291 Ga0496102_0094978
2292 Ga0496102_0382362
2293 Ga0496102_0415930
2294 Ga0496102_0701748
2295 Ga0496102_1218214
2296 Ga0496102_1302500
2297 Ga0496102_1520970
2298 Ga0496103_0000746
2299 Ga0496103_0057727
2300 Ga0496103_0109647
2301 Ga0496103_0129399
2302 Ga0496104_0004536
2303 Ga0496104_0004679
2304 Ga0496104_0088701
2305 Ga0496104_0191015
2306 Ga0496104_0328473
2307 Ga0496104_0403330
2308 Ga0496104_1596743
2309 Ga0496105_0074948
2310 Ga0496105_0327804
2311 Ga0496105_0343704
2312 Ga0496105_0370273
2313 Ga0496105_0678064
2314 Ga0496106_0100021
2315 Ga0496106_0142541
2316 Ga0496107_0048969
2317 Ga0496107_0650679
2318 Ga0496107_0679550
2319 Ga0496107_0684246
2320 Ga0496107_0741838
2321 Ga0496108_0007637
2322 Ga0496108_0016478
2323 Ga0496108_0043231
2324 Ga0496108_0079265
2325 Ga0496108_0079926
2326 Ga0496108_0106569
2327 Ga0496108_0260215
2328 Ga0496109_0014032
2329 Ga0496109_0080432
2330 Ga0496109_0094738
2331 Ga0496109_0193109
2332 Ga0496109_0202587
2333 Ga0496109_0238702
2334 Ga0496109_0725810
2335 Ga0496109_0968468
2336 Ga0496110_0004391
2337 Ga0496110_0011291
2338 Ga0496110_0023092
2339 Ga0496110_0253267
2340 Ga0496110_0325865
2341 Ga0496110_0411533
2342 Ga0496110_0568193
2343 Ga0496110_0977177
2344 Ga0496111_0027325
2345 Ga0496111_0067648
2346 Ga0496111_0086817
2347 Ga0496111_0124914
2348 Ga0496111_0491673
2349 Ga0496111_0513307
2350 Ga0496111_0677513
2351 Ga0496112_0049608
2352 Ga0496112_0557159
2353 Ga0496113_0036651
2354 Ga0496113_0148211
2355 Ga0496113_0238090
2356 Ga0496113_0307134
2357 Ga0496113_1032153
2358 Ga0496114_0002482
2359 Ga0496114_0016483
2360 Ga0496114_0143077
2361 Ga0496114_0143609
2362 Ga0496114_0164995
2363 Ga0496114_0223148
2364 Ga0496114_0235128
2365 Ga0496114_0267192
2366 Ga0496114_0296399
2367 Ga0496114_1173759
2368 Ga0496115_0007736
2369 Ga0496115_0357708
2370 Ga0496115_0586262
2371 Ga0496117_0094345
2372 Ga0496117_0202037
2373 Ga0496118_0059415
2374 Ga0496118_0094560
2375 Ga0496118_0627843
2376 Ga0496119_0025963
2377 Ga0496119_0055002
2378 Ga0496120_0367002
2379 Ga0496121_0017831
2380 Ga0496121_0315754
2381 Ga0496122_0001555
2382 Ga0496123_0400097
2383 Ga0496124_0655792
2384 Ga0496125_0000025
2385 Ga0496126_0000036
2386 Ga0501306_018232
2387 Ga0495682_0170173
2388 Ga0501031_0246011
2389 Ga0501032_0009780
2390 Ga0501032_0015007
2391 Ga0501032_0019341
2392 Ga0501032_0098368
2393 Ga0501033_0033436
2394 Ga0501033_0089909
2395 Ga0501033_0100027
2396 Ga0501033_0177710
2397 Ga0501034_0027557
2398 Ga0501034_0063804
2399 Ga0501034_0145647
2400 Ga0501034_0192787
2401 Ga0501034_0472586
2402 Ga0501034_1439012
2403 Ga0501036_0032656
2404 Ga0501036_0592988
2405 Ga0501036_1465239
2406 Ga0501037_0105593
2407 Ga0501037_0383282
2408 Ga0501037_0399266
2409 Ga0501037_0876991
2410 Ga0501038_0003594
2411 Ga0501038_0007999
2412 Ga0501038_0058002
2413 Ga0501038_0067229
2414 Ga0501039_0027902
2415 Ga0501039_0430332
2416 Ga0501039_0468282
2417 Ga0501040_0241799
2418 Ga0501040_0292869
2419 Ga0501042_0594422
2420 Ga0501043_0094641
2421 Ga0501043_0209419
2422 Ga0501043_0410947
2423 Ga0501046_0023316
2424 Ga0501047_0000191
2425 Ga0501047_0005402
2426 Ga0501047_0037162
2427 Ga0501047_0049715
2428 Ga0501047_0056593
2429 Ga0501047_0074133
2430 Ga0501047_0523684
2431 Ga0501048_0000405
2432 Ga0501048_0087368
2433 Ga0501048_0157469
2434 Ga0501048_0401781
2435 Ga0501067_0041498
2436 Ga0501067_0144006
2437 Ga0501067_0781863
2438 Ga0501069_0012307
2439 Ga0501069_0136480
2440 Ga0501069_0539436
2441 Ga0501070_0108433
2442 Ga0501070_0241375
2443 Ga0501070_0790646
2444 Ga0501070_1041937
2445 Ga0501070_1380007
2446 Ga0501071_0550997
2447 Ga0501072_0508384
2448 Ga0501074_0101418
2449 Ga0501075_0715309
2450 Ga0501235_031949
2451 Ga0501080_0031855
2452 Ga0501080_0617989
2453 Ga0501083_0024967
2454 Ga0501083_0980639
2455 Ga0501282_002540
2456 Ga0501035_0034700
2457 Ga0501035_0089814
2458 Ga0501035_0097433
2459 Ga0501035_0210569
2460 Ga0501035_0227026
2461 Ga0501035_1023312
2462 Ga0501044_0011203
2463 Ga0501044_0024862
2464 Ga0501044_0097788
2465 Ga0501044_0106072
2466 Ga0501044_0217659
2467 Ga0501044_0222055
2468 Ga0501044_0901185
2469 Ga0501045_0032328
2470 Ga0501045_0581642
2471 nmdc:mga03n38_36630_c1
2472 nmdc:mga03n38_477_c1
2473 nmdc:mga0yw44_1049157_c1
2474 nmdc:mga0yw44_130712_c1
2475 nmdc:mga0yw44_187909_c1
2476 nmdc:mga06z11_11001_c1
2477 nmdc:mga04h51_203941_c1
2478 nmdc:mga07m45_451589_c1
2479 nmdc:mga05p37_24408_c1
2480 nmdc:mga05p37_440_c1
2481 nmdc:mga09592_278_c1
2482 nmdc:mga09592_281623_c1
2483 nmdc:mga09592_7319_c1
2484 nmdc:mga0qj67_20014_c1
2485 nmdc:mga0qj67_2876_c1
2486 nmdc:mga0qj67_79740_c1
2487 nmdc:mga06r32_29384_c1
2488 nmdc:mga06r32_4205_c1
2489 nmdc:mga06r32_434_c1
2490 nmdc:mga08y16_14165_c1
2491 nmdc:mga08y16_9696_c1
2492 nmdc:mga0n895_502919_c1
2493 nmdc:mga0n895_707851_c1
2494 nmdc:mga08x19_284937_c1
2495 nmdc:mga0a205_137541_c1
2496 Ga0495601_0011311
2497 Ga0495612_0494029
2498 Ga0495655_0003679
2499 Ga0495655_0040412
2500 Ga0495595_0049668
2501 Ga0495595_0208890
2502 Ga0495619_0021775
2503 Ga0500578_0176366
2504 Ga0500553_158493
2505 Ga0500593_171213
2506 Ga0500652_171790
2507 Ga0500573_0175236
2508 Ga0500604_0022630
2509 Ga0500616_0012396
2510 Ga0501084_0706142
2511 Ga0501084_0771280
2512 Ga0590075_069645
2513 Ga0590077_056836
2514 Ga0501082_0001608
2515 Ga0501082_0866832
2516 Ga0501082_0867170
2517 Ga0466962_0002858
2518 Ga0466962_0017111
2519 Ga0466962_0092535
2520 Ga0466962_0291938
2521 Ga0530510_0458111
2522 2554259658
2523 2585297862
2524 2585310920
2525 2585316071
2526 2616703006
2527 2616905332
2528 2643764564
2529 2643905221
2530 2643942720
2531 2644264156
2532 2644385888
2533 2644403279
2534 2644430179
2535 2644438173
2536 2644458377
2537 2644503901
2538 2644527036
2539 2644629905
2540 2644666359
2541 2644670231
2542 2734976218
2543 2784586633
2544 2785345865
2545 2785367024
2546 2786668061
2547 2804843616
2548 2808847527
2549 2808918259
2550 2809230160
2551 2811846850
2552 2812360441
2553 2812365145
2554 2812482534
2555 2819699773
2556 2839988550
2557 2852643300
2558 2862181425
2559 2862289786
2560 2862294123
2561 2862392545
2562 2862508466
2563 2862580102
2564 2862709638
2565 2863407096
2566 2867375225
2567 2867435054
2568 2867475993
2569 2873157803
2570 2875392585
2571 2877683519
2572 2884995474
2573 2912722629
2574 2912726311
2575 2912758726
2576 2918502395
2577 2919474483
2578 2935394170
2579 2935891050
2580 2946052131
2581 2946065448
2582 2946073811
2583 2947231959
2584 2954008974
2585 2954388775
2586 2954674349
2587 2954689782
2588 2954699566
2589 2954702651
2590 2954718504
2591 2954728475
2592 2954733335
2593 2954747371
2594 2954752218
2595 2954766485
2596 2966604546
2597 2990045457
2598 2990060260
2599 2990093382
2600 2997451917
2601 2997603425
2602 3003004122
2603 3006327560
2604 3006399457
2605 3006430708
2606 3006489357
2607 3006498345
2608 8008486931
2609 8008561185
2610 8008580869
2611 8023630936
2612 8025418331
2613 8025482366
2614 8025526188
2615 8025533894
2616 8033686646
2617 8047901208
2618 8048135610
2619 8048357693
2620 8048378148
2621 8048387246
2622 8048409970
2623 8054166910
2624 8056454226
2625 8056670094
2626 8056832440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06947

DUF1290

Protein of unknown function (DUF1290)

24

111

0.98

Map