F492800

General Info

Members Datasets Scaffolds Average Seq Length
1304 383 2608 204

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0012348|Ga0500641_0012348_568_1254
Length 228
Sequence MFTGLIESVGRISALEEIVGGTRLRIATELAGGLRNGDSLAVNGVCLTVTETRGPAAAALSASSTNLQTGALDNGLGEVAADVSPETLRVSTLGDLEPFTLVNLERPMAADGRFGGHIVQGHVDGTGTIEALDEEGDFYWLTVSFPPELAPYFIYKGSVAVDGISLTVADLQADRFKIQIIPHTWQHTHLQAARVGTRVNLECDLVGKYVMRAIEVRASMLSAPTPRT

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
184 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
185 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
202 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
203 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
204 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
205 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
206 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
207 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
208 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
209 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
213 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
226 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
227 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
228 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
234 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
235 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
236 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
237 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
238 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
239 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
240 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
241 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
242 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
243 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
244 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
245 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
246 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
247 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
248 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
251 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
252 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
255 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
267 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
274 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
281 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
303 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
304 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
305 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
306 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
307 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
321 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
330 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
331 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
335 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
336 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
337 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
338 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
339 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
340 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
341 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
342 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
343 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
344 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
345 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
346 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
354 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
360 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
364 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
365 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
366 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
367 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
368 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
375 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
376 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 0
Rhizoplane 3.37
Rhizosphere 93.63
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0012348 3300053096 Bacteria 3117
2 LJQas_1016145 3300000549 Bacteria 872
3 JGI24743J22301_10059014 3300001991 Bacteria 789
4 Ga0065712_10093353 3300005290 Bacteria 2296
5 Ga0065712_10145869 3300005290 Bacteria 1409
6 Ga0065712_10172999 3300005290 Bacteria 1233
7 Ga0065712_10207622 3300005290 Bacteria 1077
8 Ga0065715_10024404 3300005293 Bacteria 2259
9 Ga0065715_10208870 3300005293 Bacteria 1324
10 Ga0065715_10277538 3300005293 Bacteria 1095
11 Ga0065715_10408964 3300005293 Bacteria 872
12 Ga0065715_10563385 3300005293 Bacteria 732
13 Ga0065707_10102589 3300005295 Bacteria 2788
14 Ga0065707_10125759 3300005295 Bacteria 2017
15 Ga0065707_10168558 3300005295 Bacteria 1502
16 Ga0065707_10310702 3300005295 Bacteria 985
17 Ga0065707_10361758 3300005295 Bacteria 903
18 Ga0070658_10117399 3300005327 Bacteria 2209
19 Ga0070658_10287742 3300005327 Bacteria 1400
20 Ga0070658_10607495 3300005327 Bacteria 948
21 Ga0070658_10881550 3300005327 Bacteria 778
22 Ga0070676_10011985 3300005328 Bacteria 4725
23 Ga0070676_10039428 3300005328 Bacteria 2731
24 Ga0070683_100000214 3300005329 Bacteria 39384
25 Ga0070683_100066257 3300005329 Bacteria 3364
26 Ga0070683_100125452 3300005329 Bacteria 2427
27 Ga0070683_100183911 3300005329 Bacteria 1984
28 Ga0070683_100210993 3300005329 Unclassified 1845
29 Ga0070690_100002920 3300005330 Bacteria 9229
30 Ga0070690_100057024 3300005330 Bacteria 2506
31 Ga0070690_100282161 3300005330 Bacteria 1185
32 Ga0070670_100009351 3300005331 Bacteria 8365
33 Ga0070670_100026024 3300005331 Bacteria 5036
34 Ga0070670_100058688 3300005331 Bacteria 3303
35 Ga0070670_100072819 3300005331 Bacteria 2951
36 Ga0070670_101174209 3300005331 Bacteria 701
37 Ga0068869_100034060 3300005334 Bacteria 3601
38 Ga0068869_100137796 3300005334 Bacteria 1882
39 Ga0068869_100173313 3300005334 Bacteria 1687
40 Ga0070666_10132747 3300005335 Bacteria 1731
41 Ga0070666_10461034 3300005335 Bacteria 918
42 Ga0070680_100073176 3300005336 Bacteria 2817
43 Ga0070680_100167305 3300005336 Bacteria 1849
44 Ga0070680_100288976 3300005336 Bacteria 1389
45 Ga0070680_100387767 3300005336 Bacteria 1190
46 Ga0070682_100181672 3300005337 Bacteria 1470
47 Ga0070682_100399624 3300005337 Bacteria 1039
48 Ga0068868_100127194 3300005338 Bacteria 2083
49 Ga0068868_100333540 3300005338 Bacteria 1295
50 Ga0068868_100431499 3300005338 Bacteria 1143
51 Ga0068868_100646827 3300005338 Unclassified 941
52 Ga0068868_100713319 3300005338 Bacteria 898
53 Ga0070660_100004679 3300005339 Bacteria 9476
54 Ga0070689_100000003 3300005340 Bacteria 579260
55 Ga0070689_100108572 3300005340 Bacteria 2204
56 Ga0070689_100310569 3300005340 Bacteria 1314
57 Ga0070689_100601929 3300005340 Bacteria 952
58 Ga0070689_100924714 3300005340 Bacteria 773
59 Ga0070691_10002242 3300005341 Bacteria 8548
60 Ga0070691_10190717 3300005341 Bacteria 1072
61 Ga0070691_10281076 3300005341 Bacteria 903
62 Ga0070687_100007355 3300005343 Bacteria 4584
63 Ga0070687_100010885 3300005343 Bacteria 3957
64 Ga0070687_100067866 3300005343 Bacteria 1905
65 Ga0070687_100359653 3300005343 Unclassified 942
66 Ga0070692_10067636 3300005345 Bacteria 1897
67 Ga0070692_10178594 3300005345 Bacteria 1229
68 Ga0070668_100076502 3300005347 Bacteria 2614
69 Ga0070668_100433087 3300005347 Bacteria 1128
70 Ga0070668_101106406 3300005347 Unclassified 715
71 Ga0070669_100002325 3300005353 Bacteria 13747
72 Ga0070669_100010935 3300005353 Bacteria 6445
73 Ga0070669_100137324 3300005353 Bacteria 1881
74 Ga0070669_100259171 3300005353 Bacteria 1387
75 Ga0070669_100273669 3300005353 Bacteria 1351
76 Ga0070669_100315825 3300005353 Bacteria 1260
77 Ga0070675_100000496 3300005354 Bacteria 26949
78 Ga0070675_100089228 3300005354 Bacteria 2581
79 Ga0070675_100101819 3300005354 Bacteria 2420
80 Ga0070675_100343233 3300005354 Bacteria 1323
81 Ga0070675_100406876 3300005354 Bacteria 1215
82 Ga0070675_100430612 3300005354 Bacteria 1181
83 Ga0070675_100617562 3300005354 Bacteria 984
84 Ga0070675_100695173 3300005354 Bacteria 926
85 Ga0070671_100007284 3300005355 Bacteria 8839
86 Ga0070671_100010668 3300005355 Bacteria 7375
87 Ga0070671_100025978 3300005355 Bacteria 4809
88 Ga0070671_100329158 3300005355 Bacteria 1302
89 Ga0070671_100567717 3300005355 Bacteria 979
90 Ga0070671_100581682 3300005355 Bacteria 967
91 Ga0070674_100002893 3300005356 Bacteria 9505
92 Ga0070674_100012993 3300005356 Bacteria 5131
93 Ga0070674_100034657 3300005356 Bacteria 3373
94 Ga0070674_100041786 3300005356 Bacteria 3110
95 Ga0070674_100049355 3300005356 Bacteria 2893
96 Ga0070674_100051566 3300005356 Bacteria 2836
97 Ga0070674_100178574 3300005356 Bacteria 1624
98 Ga0070674_100187635 3300005356 Bacteria 1588
99 Ga0070674_100481384 3300005356 Bacteria 1030
100 Ga0070673_100000582 3300005364 Bacteria 19800
101 Ga0070673_100070690 3300005364 Bacteria 2802
102 Ga0070673_100151069 3300005364 Bacteria 1967
103 Ga0070673_100314611 3300005364 Bacteria 1382
104 Ga0070673_100323243 3300005364 Bacteria 1363
105 Ga0070673_100985300 3300005364 Bacteria 784
106 Ga0070688_100074129 3300005365 Bacteria 2185
107 Ga0070688_100125023 3300005365 Bacteria 1728
108 Ga0070688_100316784 3300005365 Bacteria 1132
109 Ga0070688_100478276 3300005365 Bacteria 936
110 Ga0070688_100647672 3300005365 Bacteria 813
111 Ga0070659_100267448 3300005366 Bacteria 1420
112 Ga0070667_100074506 3300005367 Bacteria 2896
113 Ga0070667_100187983 3300005367 Bacteria 1829
114 Ga0070667_100238862 3300005367 Bacteria 1622
115 Ga0070703_10203850 3300005406 Bacteria 778
116 Ga0070709_10016794 3300005434 Bacteria 4187
117 Ga0070709_10182888 3300005434 Bacteria 1473
118 Ga0070714_100828073 3300005435 Bacteria 897
119 Ga0070713_100021116 3300005436 Bacteria 5002
120 Ga0070713_100042802 3300005436 Bacteria 3699
121 Ga0070713_100050344 3300005436 Bacteria 3441
122 Ga0070713_100105264 3300005436 Bacteria 2451
123 Ga0070713_100431225 3300005436 Bacteria 1235
124 Ga0070701_10029762 3300005438 Bacteria 2696
125 Ga0070701_10047647 3300005438 Bacteria 2208
126 Ga0070701_10051354 3300005438 Bacteria 2139
127 Ga0070701_10066267 3300005438 Bacteria 1918
128 Ga0070711_100570014 3300005439 Bacteria 941
129 Ga0070705_100006858 3300005440 Bacteria 5598
130 Ga0070705_100009299 3300005440 Bacteria 4882
131 Ga0070705_100013151 3300005440 Bacteria 4226
132 Ga0070705_100027005 3300005440 Bacteria 3130
133 Ga0070705_100173152 3300005440 Bacteria 1455
134 Ga0070705_100466025 3300005440 Unclassified 951
135 Ga0070700_100001354 3300005441 Bacteria 12177
136 Ga0070700_100040008 3300005441 Bacteria 2867
137 Ga0070700_100094589 3300005441 Bacteria 1957
138 Ga0070700_100174655 3300005441 Bacteria 1490
139 Ga0070700_100285383 3300005441 Bacteria 1199
140 Ga0070700_100563292 3300005441 Bacteria 887
141 Ga0070694_100000869 3300005444 Bacteria 17020
142 Ga0070694_100004661 3300005444 Bacteria 8246
143 Ga0070694_100105377 3300005444 Bacteria 2001
144 Ga0070694_100116676 3300005444 Bacteria 1910
145 Ga0070694_100828786 3300005444 Bacteria 760
146 Ga0070708_100108394 3300005445 Bacteria 2551
147 Ga0070708_100523825 3300005445 Bacteria 1118
148 Ga0070708_100572317 3300005445 Bacteria 1065
149 Ga0070663_100088822 3300005455 Bacteria 2286
150 Ga0070663_100122891 3300005455 Bacteria 1963
151 Ga0070678_100113327 3300005456 Bacteria 2125
152 Ga0070678_100199596 3300005456 Bacteria 1650
153 Ga0070678_100232531 3300005456 Bacteria 1537
154 Ga0070678_100564350 3300005456 Bacteria 1012
155 Ga0070678_100589574 3300005456 Bacteria 991
156 Ga0070678_101147457 3300005456 Bacteria 719
157 Ga0070662_100097137 3300005457 Bacteria 2223
158 Ga0070662_100745748 3300005457 Bacteria 830
159 Ga0070681_10001417 3300005458 Bacteria 21068
160 Ga0070681_10051010 3300005458 Bacteria 4127
161 Ga0070681_10100981 3300005458 Bacteria 2831
162 Ga0070681_10114660 3300005458 Bacteria 2633
163 Ga0070681_10327387 3300005458 Bacteria 1442
164 Ga0068867_100015602 3300005459 Bacteria 5391
165 Ga0068867_100275039 3300005459 Bacteria 1379
166 Ga0068867_100279043 3300005459 Unclassified 1370
167 Ga0070706_100270403 3300005467 Bacteria 1586
168 Ga0070706_100283144 3300005467 Bacteria 1547
169 Ga0070706_100286586 3300005467 Bacteria 1537
170 Ga0070706_100724667 3300005467 Bacteria 922
171 Ga0070707_100033298 3300005468 Bacteria 4913
172 Ga0070707_100068866 3300005468 Bacteria 3406
173 Ga0070707_100145707 3300005468 Bacteria 2305
174 Ga0070707_100226648 3300005468 Bacteria 1820
175 Ga0070707_100491284 3300005468 Bacteria 1189
176 Ga0070707_101043674 3300005468 Bacteria 783
177 Ga0070698_100002146 3300005471 Bacteria 21864
178 Ga0070698_100018933 3300005471 Bacteria 7242
179 Ga0070698_100246824 3300005471 Bacteria 1718
180 Ga0070698_100315138 3300005471 Bacteria 1495
181 Ga0070698_100415688 3300005471 Bacteria 1279
182 Ga0070698_100696405 3300005471 Bacteria 958
183 Ga0070698_100943443 3300005471 Bacteria 809
184 Ga0070699_100002056 3300005518 Bacteria 18203
185 Ga0070699_100002059 3300005518 Bacteria 18198
186 Ga0070699_100014233 3300005518 Bacteria 6844
187 Ga0070699_100024910 3300005518 Bacteria 5158
188 Ga0070699_100067180 3300005518 Bacteria 3113
189 Ga0070699_100175372 3300005518 Bacteria 1901
190 Ga0070699_100424840 3300005518 Bacteria 1203
191 Ga0070679_100027590 3300005530 Bacteria 5590
192 Ga0070679_100044862 3300005530 Bacteria 4404
193 Ga0070679_100046595 3300005530 Bacteria 4321
194 Ga0070679_100088544 3300005530 Bacteria 3083
195 Ga0070679_100166627 3300005530 Bacteria 2177
196 Ga0070679_100202865 3300005530 Bacteria 1948
197 Ga0070679_100274651 3300005530 Bacteria 1639
198 Ga0070679_100477184 3300005530 Bacteria 1191
199 Ga0070684_100000085 3300005535 Bacteria 61530
200 Ga0070684_100066615 3300005535 Bacteria 3161
201 Ga0070684_100102808 3300005535 Bacteria 2555
202 Ga0070684_100149783 3300005535 Unclassified 2113
203 Ga0070684_100470012 3300005535 Bacteria 1163
204 Ga0070684_100835128 3300005535 Bacteria 862
205 Ga0070697_100105431 3300005536 Bacteria 2345
206 Ga0070697_100375276 3300005536 Bacteria 1231
207 Ga0070697_100390728 3300005536 Bacteria 1206
208 Ga0070697_100616884 3300005536 Bacteria 954
209 Ga0070697_100848555 3300005536 Bacteria 809
210 Ga0070697_101187556 3300005536 Bacteria 680
211 Ga0068853_100341656 3300005539 Bacteria 1391
212 Ga0068853_100526767 3300005539 Bacteria 1118
213 Ga0070672_100104004 3300005543 Bacteria 2307
214 Ga0070672_100160273 3300005543 Bacteria 1866
215 Ga0070672_100250025 3300005543 Bacteria 1493
216 Ga0070672_100255300 3300005543 Bacteria 1477
217 Ga0070672_100272037 3300005543 Bacteria 1431
218 Ga0070672_100457976 3300005543 Bacteria 1099
219 Ga0070686_100001752 3300005544 Bacteria 12145
220 Ga0070686_100107462 3300005544 Bacteria 1895
221 Ga0070686_100434140 3300005544 Bacteria 1006
222 Ga0070686_100624921 3300005544 Bacteria 851
223 Ga0070695_100000366 3300005545 Bacteria 23127
224 Ga0070695_100011373 3300005545 Bacteria 5324
225 Ga0070695_100017832 3300005545 Bacteria 4307
226 Ga0070695_100032183 3300005545 Bacteria 3278
227 Ga0070695_100072734 3300005545 Bacteria 2255
228 Ga0070695_100154207 3300005545 Bacteria 1606
229 Ga0070695_100357308 3300005545 Unclassified 1096
230 Ga0070695_100373435 3300005545 Bacteria 1074
231 Ga0070695_100531771 3300005545 Bacteria 914
232 Ga0070696_100012267 3300005546 Bacteria 5743
233 Ga0070696_100015130 3300005546 Bacteria 5180
234 Ga0070696_100042496 3300005546 Bacteria 3142
235 Ga0070696_100232395 3300005546 Bacteria 1388
236 Ga0070693_100060767 3300005547 Bacteria 2194
237 Ga0070665_100053364 3300005548 Bacteria 4054
238 Ga0070665_100362806 3300005548 Bacteria 1455
239 Ga0070665_100598391 3300005548 Bacteria 1116
240 Ga0070665_100664587 3300005548 Bacteria 1055
241 Ga0070704_100004578 3300005549 Bacteria 7994
242 Ga0070704_100007489 3300005549 Bacteria 6497
243 Ga0070704_100016140 3300005549 Bacteria 4712
244 Ga0070704_100030468 3300005549 Bacteria 3616
245 Ga0070704_100073190 3300005549 Bacteria 2495
246 Ga0070704_100080612 3300005549 Bacteria 2395
247 Ga0070704_100160301 3300005549 Bacteria 1778
248 Ga0070704_100235195 3300005549 Bacteria 1497
249 Ga0070704_100405454 3300005549 Bacteria 1164
250 Ga0070704_100589007 3300005549 Bacteria 976
251 Ga0070704_100983892 3300005549 Bacteria 762
252 Ga0068855_100006981 3300005563 Bacteria 13708
253 Ga0068855_100100317 3300005563 Bacteria 3334
254 Ga0068855_100215776 3300005563 Bacteria 2154
255 Ga0070664_100001505 3300005564 Bacteria 18574
256 Ga0070664_100005787 3300005564 Bacteria 9974
257 Ga0070664_100099866 3300005564 Bacteria 2523
258 Ga0070664_100623673 3300005564 Archaea 1001
259 Ga0068854_100006488 3300005578 Bacteria 7444
260 Ga0068854_100063858 3300005578 Bacteria 2674
261 Ga0068854_100077546 3300005578 Bacteria 2446
262 Ga0068854_100799729 3300005578 Unclassified 822
263 Ga0068856_100135181 3300005614 Bacteria 2471
264 Ga0070702_100001630 3300005615 Bacteria 9293
265 Ga0070702_100173818 3300005615 Bacteria 1404
266 Ga0070702_100257014 3300005615 Bacteria 1187
267 Ga0070702_100345397 3300005615 Bacteria 1046
268 Ga0070702_100697068 3300005615 Bacteria 773
269 Ga0068852_100133711 3300005616 Bacteria 2287
270 Ga0068852_100872755 3300005616 Bacteria 916
271 Ga0068852_101115197 3300005616 Bacteria 809
272 Ga0068859_100128619 3300005617 Bacteria 2603
273 Ga0068859_100302622 3300005617 Bacteria 1692
274 Ga0068859_100566660 3300005617 Bacteria 1230
275 Ga0068859_100796925 3300005617 Bacteria 1033
276 Ga0068859_101207454 3300005617 Bacteria 833
277 Ga0068859_101320285 3300005617 Bacteria 795
278 Ga0068864_100010958 3300005618 Bacteria 7495
279 Ga0068864_100156874 3300005618 Bacteria 2066
280 Ga0068864_100214886 3300005618 Bacteria 1772
281 Ga0068864_100409450 3300005618 Bacteria 1290
282 Ga0068864_100452696 3300005618 Bacteria 1228
283 Ga0068866_10091092 3300005718 Bacteria 1661
284 Ga0068866_10551393 3300005718 Bacteria 771
285 Ga0068861_100021221 3300005719 Bacteria 4667
286 Ga0068861_100053380 3300005719 Bacteria 3074
287 Ga0068861_100218040 3300005719 Bacteria 1611
288 Ga0068861_100420095 3300005719 Unclassified 1191
289 Ga0068861_100424394 3300005719 Bacteria 1185
290 Ga0068861_100536288 3300005719 Bacteria 1064
291 Ga0068870_10180352 3300005840 Bacteria 1267
292 Ga0068863_100004361 3300005841 Bacteria 13946
293 Ga0068863_100160298 3300005841 Bacteria 2155
294 Ga0068863_100247858 3300005841 Bacteria 1720
295 Ga0068863_100832986 3300005841 Bacteria 921
296 Ga0068858_100120573 3300005842 Bacteria 2452
297 Ga0068858_100134023 3300005842 Bacteria 2323
298 Ga0068858_100143056 3300005842 Bacteria 2246
299 Ga0068858_100589676 3300005842 Bacteria 1078
300 Ga0068860_100258645 3300005843 Bacteria 1696
301 Ga0068860_100741025 3300005843 Bacteria 994
302 Ga0068860_101203053 3300005843 Bacteria 778
303 Ga0068862_100011467 3300005844 Bacteria 7316
304 Ga0068862_100047767 3300005844 Bacteria 3654
305 Ga0068862_100199029 3300005844 Bacteria 1806
306 Ga0081539_10105508 3300005985 Bacteria 1428
307 Ga0070717_10075101 3300006028 Bacteria 2827
308 Ga0075365_10007714 3300006038 Bacteria 6055
309 Ga0075368_10070276 3300006042 Bacteria 1413
310 Ga0075368_10077322 3300006042 Bacteria 1351
311 Ga0075363_100023452 3300006048 Bacteria 3128
312 Ga0075364_10005697 3300006051 Bacteria 7264
313 Ga0075364_10007143 3300006051 Bacteria 6607
314 Ga0075364_10688346 3300006051 Bacteria 698
315 Ga0070715_10046415 3300006163 Bacteria 1847
316 Ga0075362_10000285 3300006177 Bacteria 14268
317 Ga0075367_10017091 3300006178 Bacteria 3975
318 Ga0075367_10146345 3300006178 Bacteria 1465
319 Ga0075367_10489200 3300006178 Bacteria 780
320 Ga0075366_10005792 3300006195 Bacteria 6714
321 Ga0075366_10044549 3300006195 Bacteria 2629
322 Ga0097621_100002994 3300006237 Bacteria 11605
323 Ga0097621_100057572 3300006237 Bacteria 3179
324 Ga0097621_100091146 3300006237 Bacteria 2551
325 Ga0097621_100471158 3300006237 Bacteria 1134
326 Ga0097621_100789932 3300006237 Bacteria 879
327 Ga0075370_10014580 3300006353 Bacteria 4195
328 Ga0075370_10024065 3300006353 Bacteria 3360
329 Ga0068871_100000122 3300006358 Bacteria 48841
330 Ga0068871_100015919 3300006358 Bacteria 5647
331 Ga0068871_100049413 3300006358 Bacteria 3400
332 Ga0068871_100069807 3300006358 Bacteria 2886
333 Ga0068871_100162883 3300006358 Bacteria 1908
334 Ga0068871_100179529 3300006358 Bacteria 1819
335 Ga0068871_100439295 3300006358 Bacteria 1168
336 Ga0068871_100606862 3300006358 Unclassified 996
337 Ga0068871_100611278 3300006358 Bacteria 992
338 Ga0068871_100855084 3300006358 Bacteria 841
339 Ga0075428_100044419 3300006844 Bacteria 4883
340 Ga0075428_100048821 3300006844 Bacteria 4644
341 Ga0075428_100155689 3300006844 Bacteria 2483
342 Ga0075428_100284253 3300006844 Bacteria 1780
343 Ga0075428_101021790 3300006844 Bacteria 875
344 Ga0075430_100001106 3300006846 Bacteria 21428
345 Ga0075430_100005530 3300006846 Bacteria 10675
346 Ga0075430_100019001 3300006846 Bacteria 5847
347 Ga0075431_100014341 3300006847 Bacteria 8016
348 Ga0075431_100057234 3300006847 Bacteria 4021
349 Ga0075431_100061713 3300006847 Bacteria 3868
350 Ga0075431_100090938 3300006847 Bacteria 3150
351 Ga0075431_100091402 3300006847 Bacteria 3142
352 Ga0075431_100285386 3300006847 Bacteria 1671
353 Ga0075431_100350197 3300006847 Bacteria 1485
354 Ga0075431_100970436 3300006847 Bacteria 818
355 Ga0075433_10006695 3300006852 Bacteria 9126
356 Ga0075433_10050792 3300006852 Bacteria 3610
357 Ga0075433_10051614 3300006852 Bacteria 3582
358 Ga0075433_10052079 3300006852 Bacteria 3566
359 Ga0075433_10058208 3300006852 Bacteria 3380
360 Ga0075433_10090364 3300006852 Bacteria 2707
361 Ga0075433_10096326 3300006852 Bacteria 2619
362 Ga0075433_10142172 3300006852 Bacteria 2133
363 Ga0075433_10146890 3300006852 Bacteria 2096
364 Ga0075433_10174726 3300006852 Bacteria 1911
365 Ga0075433_10222416 3300006852 Bacteria 1677
366 Ga0075433_10233206 3300006852 Bacteria 1634
367 Ga0075433_10258847 3300006852 Bacteria 1543
368 Ga0075433_10418434 3300006852 Bacteria 1182
369 Ga0075434_100006471 3300006871 Bacteria 10736
370 Ga0075434_100029146 3300006871 Bacteria 5428
371 Ga0075434_100038875 3300006871 Bacteria 4714
372 Ga0075434_100158528 3300006871 Bacteria 2283
373 Ga0075434_100229907 3300006871 Bacteria 1874
374 Ga0075434_100270417 3300006871 Bacteria 1719
375 Ga0075434_100270950 3300006871 Bacteria 1717
376 Ga0075434_100311982 3300006871 Bacteria 1593
377 Ga0075434_100351567 3300006871 Bacteria 1495
378 Ga0075434_100359066 3300006871 Bacteria 1478
379 Ga0075434_100587963 3300006871 Bacteria 1132
380 Ga0075429_100010325 3300006880 Bacteria 8079
381 Ga0075429_100022102 3300006880 Bacteria 5517
382 Ga0075429_100753629 3300006880 Bacteria 853
383 Ga0075429_100910085 3300006880 Unclassified 770
384 Ga0068865_100002576 3300006881 Bacteria 10758
385 Ga0068865_100147360 3300006881 Bacteria 1782
386 Ga0068865_100314476 3300006881 Bacteria 1257
387 Ga0068865_100453006 3300006881 Bacteria 1061
388 Ga0068865_100892032 3300006881 Bacteria 773
389 Ga0075436_100024164 3300006914 Bacteria 4177
390 Ga0075436_100056854 3300006914 Bacteria 2702
391 Ga0075436_100125851 3300006914 Bacteria 1795
392 Ga0075436_100224562 3300006914 Bacteria 1333
393 Ga0075436_100266922 3300006914 Bacteria 1221
394 Ga0075436_100516584 3300006914 Bacteria 875
395 Ga0097620_100128613 3300006931 Bacteria 2603
396 Ga0097620_100302624 3300006931 Bacteria 1692
397 Ga0097620_100566663 3300006931 Bacteria 1230
398 Ga0097620_100796974 3300006931 Bacteria 1033
399 Ga0097620_101207210 3300006931 Bacteria 833
400 Ga0097620_101320424 3300006931 Bacteria 795
401 Ga0075435_100000436 3300007076 Bacteria 25536
402 Ga0075435_100003662 3300007076 Bacteria 10464
403 Ga0075435_100012910 3300007076 Bacteria 6196
404 Ga0075435_100014905 3300007076 Bacteria 5830
405 Ga0075435_100016846 3300007076 Bacteria 5517
406 Ga0075435_100051069 3300007076 Bacteria 3330
407 Ga0075435_100063832 3300007076 Bacteria 2991
408 Ga0075435_100083652 3300007076 Bacteria 2624
409 Ga0075435_100174867 3300007076 Bacteria 1813
410 Ga0075435_100190660 3300007076 Bacteria 1735
411 Ga0075435_100245681 3300007076 Bacteria 1523
412 Ga0075435_100279632 3300007076 Bacteria 1425
413 Ga0075435_100678569 3300007076 Bacteria 895
414 Ga0075435_100753553 3300007076 Bacteria 847
415 Ga0075435_100787380 3300007076 Unclassified 828
416 Ga0075435_101088374 3300007076 Bacteria 699
417 Ga0105250_10089903 3300009092 Bacteria 1248
418 Ga0105240_10394810 3300009093 Bacteria 1559
419 Ga0105240_10991496 3300009093 Bacteria 899
420 Ga0111539_10001278 3300009094 Bacteria 33608
421 Ga0111539_10001538 3300009094 Bacteria 30724
422 Ga0111539_10002608 3300009094 Bacteria 23892
423 Ga0111539_10003691 3300009094 Bacteria 20148
424 Ga0111539_10029839 3300009094 Bacteria 6635
425 Ga0111539_10033012 3300009094 Bacteria 6284
426 Ga0111539_10089985 3300009094 Bacteria 3607
427 Ga0111539_10113521 3300009094 Bacteria 3178
428 Ga0111539_10170192 3300009094 Bacteria 2545
429 Ga0111539_10228217 3300009094 Bacteria 2168
430 Ga0111539_10261477 3300009094 Bacteria 2014
431 Ga0111539_10412964 3300009094 Bacteria 1572
432 Ga0111539_10554238 3300009094 Bacteria 1339
433 Ga0111539_10608913 3300009094 Bacteria 1272
434 Ga0111539_10701148 3300009094 Bacteria 1178
435 Ga0111539_11033232 3300009094 Bacteria 955
436 Ga0111539_11164274 3300009094 Bacteria 896
437 Ga0111539_11553881 3300009094 Bacteria 767
438 Ga0105245_10000225 3300009098 Bacteria 53752
439 Ga0105245_10093750 3300009098 Bacteria 2767
440 Ga0105245_10192382 3300009098 Bacteria 1955
441 Ga0105245_10663086 3300009098 Bacteria 1074
442 Ga0105247_10002063 3300009101 Bacteria 13915
443 Ga0105247_10115213 3300009101 Bacteria 1734
444 Ga0114129_10000321 3300009147 Bacteria 56314
445 Ga0114129_10000632 3300009147 Bacteria 43859
446 Ga0114129_10002823 3300009147 Bacteria 24241
447 Ga0114129_10004917 3300009147 Bacteria 18865
448 Ga0114129_10005465 3300009147 Bacteria 17963
449 Ga0114129_10007113 3300009147 Bacteria 15921
450 Ga0114129_10007213 3300009147 Bacteria 15821
451 Ga0114129_10024433 3300009147 Bacteria 8562
452 Ga0114129_10025016 3300009147 Bacteria 8464
453 Ga0114129_10027021 3300009147 Bacteria 8125
454 Ga0114129_10028163 3300009147 Bacteria 7960
455 Ga0114129_10044574 3300009147 Bacteria 6239
456 Ga0114129_10073122 3300009147 Bacteria 4776
457 Ga0114129_10077771 3300009147 Bacteria 4615
458 Ga0114129_10087902 3300009147 Bacteria 4309
459 Ga0114129_10152124 3300009147 Bacteria 3166
460 Ga0114129_10165269 3300009147 Bacteria 3021
461 Ga0114129_10218636 3300009147 Bacteria 2572
462 Ga0114129_10267946 3300009147 Bacteria 2286
463 Ga0114129_10327740 3300009147 Bacteria 2034
464 Ga0114129_10365486 3300009147 Bacteria 1908
465 Ga0114129_10413732 3300009147 Bacteria 1775
466 Ga0114129_10464944 3300009147 Bacteria 1657
467 Ga0114129_10948288 3300009147 Bacteria 1087
468 Ga0114129_10974916 3300009147 Bacteria 1069
469 Ga0105243_10021824 3300009148 Bacteria 4861
470 Ga0105243_10106553 3300009148 Bacteria 2337
471 Ga0105243_10297300 3300009148 Bacteria 1462
472 Ga0105243_10331955 3300009148 Bacteria 1389
473 Ga0105241_10654334 3300009174 Bacteria 955
474 Ga0105242_10064739 3300009176 Bacteria 3014
475 Ga0105242_10205167 3300009176 Bacteria 1753
476 Ga0105242_10332824 3300009176 Bacteria 1397
477 Ga0105242_10430589 3300009176 Bacteria 1238
478 Ga0105248_10005909 3300009177 Bacteria 13456
479 Ga0105248_10012693 3300009177 Bacteria 9297
480 Ga0105248_10082611 3300009177 Bacteria 3613
481 Ga0105248_10093851 3300009177 Bacteria 3380
482 Ga0105248_10177565 3300009177 Bacteria 2400
483 Ga0105248_10416803 3300009177 Bacteria 1512
484 Ga0105248_10424537 3300009177 Bacteria 1497
485 Ga0105248_10425795 3300009177 Bacteria 1495
486 Ga0105248_10483466 3300009177 Bacteria 1396
487 Ga0105248_10734843 3300009177 Bacteria 1114
488 Ga0105248_10801348 3300009177 Bacteria 1063
489 Ga0105248_10898577 3300009177 Unclassified 1000
490 Ga0105248_11164630 3300009177 Bacteria 871
491 Ga0105248_11234970 3300009177 Bacteria 845
492 Ga0105249_10113100 3300009553 Bacteria 2568
493 Ga0105249_10317853 3300009553 Bacteria 1567
494 Ga0105249_10390359 3300009553 Bacteria 1420
495 Ga0105249_10940874 3300009553 Bacteria 932
496 Ga0105239_10102380 3300010375 Bacteria 3169
497 Ga0105246_10123842 3300011119 Bacteria 1920
498 Ga0157374_10065263 3300013296 Bacteria 3418
499 Ga0157378_10043866 3300013297 Bacteria 3970
500 Ga0157378_10144237 3300013297 Bacteria 2214
501 Ga0157378_10580939 3300013297 Bacteria 1129
502 Ga0157378_11587245 3300013297 Unclassified 700
503 Ga0163162_10231079 3300013306 Bacteria 1980
504 Ga0163162_10294026 3300013306 Bacteria 1756
505 Ga0163162_10295368 3300013306 Bacteria 1752
506 Ga0157375_10282178 3300013308 Bacteria 1824
507 Ga0157375_10373059 3300013308 Bacteria 1593
508 Ga0157375_10462509 3300013308 Bacteria 1434
509 Ga0157375_10891436 3300013308 Bacteria 1034
510 Ga0157375_11055128 3300013308 Bacteria 950
511 Ga0157375_11418533 3300013308 Unclassified 818
512 Ga0163163_10018932 3300014325 Bacteria 6459
513 Ga0163163_10019727 3300014325 Bacteria 6338
514 Ga0163163_10119322 3300014325 Bacteria 2671
515 Ga0163163_10125267 3300014325 Bacteria 2607
516 Ga0163163_10128894 3300014325 Bacteria 2569
517 Ga0163163_10191702 3300014325 Bacteria 2092
518 Ga0163163_10234447 3300014325 Bacteria 1885
519 Ga0163163_10665381 3300014325 Bacteria 1105
520 Ga0157380_10062317 3300014326 Bacteria 2987
521 Ga0157380_10071192 3300014326 Bacteria 2812
522 Ga0157380_10081924 3300014326 Bacteria 2641
523 Ga0157380_10101066 3300014326 Bacteria 2402
524 Ga0157380_10192720 3300014326 Bacteria 1801
525 Ga0157380_10279565 3300014326 Bacteria 1527
526 Ga0157380_10318681 3300014326 Bacteria 1440
527 Ga0157380_10382163 3300014326 Bacteria 1329
528 Ga0157380_10430444 3300014326 Bacteria 1261
529 Ga0157380_10631328 3300014326 Bacteria 1065
530 Ga0157380_10875238 3300014326 Bacteria 922
531 Ga0157380_10953090 3300014326 Bacteria 888
532 Ga0157377_10095126 3300014745 Bacteria 1765
533 Ga0157379_10013078 3300014968 Bacteria 7269
534 Ga0157379_10051800 3300014968 Bacteria 3665
535 Ga0157379_10221754 3300014968 Unclassified 1713
536 Ga0157379_10341408 3300014968 Bacteria 1370
537 Ga0157379_10349041 3300014968 Bacteria 1354
538 Ga0157379_10484172 3300014968 Bacteria 1145
539 Ga0157376_10038520 3300014969 Bacteria 3890
540 Ga0157376_10092620 3300014969 Bacteria 2621
541 Ga0157376_10525698 3300014969 Bacteria 1167
542 Ga0157376_10696710 3300014969 Bacteria 1020
543 Ga0163161_10200820 3300017792 Unclassified 1536
544 Ga0213876_10003164 3300021384 Bacteria 9477
545 Ga0207682_10017655 3300025893 Bacteria 2786
546 Ga0207642_10081584 3300025899 Bacteria 1572
547 Ga0207642_10123412 3300025899 Bacteria 1340
548 Ga0207642_10229181 3300025899 Bacteria 1043
549 Ga0207710_10009464 3300025900 Bacteria 4098
550 Ga0207710_10257521 3300025900 Unclassified 874
551 Ga0207688_10121761 3300025901 Bacteria 1523
552 Ga0207688_10348005 3300025901 Unclassified 913
553 Ga0207680_10031786 3300025903 Bacteria 2993
554 Ga0207680_10241671 3300025903 Bacteria 1244
555 Ga0207680_10602721 3300025903 Bacteria 786
556 Ga0207647_10036643 3300025904 Bacteria 3115
557 Ga0207699_10107827 3300025906 Bacteria 1780
558 Ga0207699_10198582 3300025906 Bacteria 1358
559 Ga0207645_10007009 3300025907 Bacteria 8023
560 Ga0207645_10013629 3300025907 Bacteria 5469
561 Ga0207645_10033237 3300025907 Bacteria 3316
562 Ga0207645_10292096 3300025907 Bacteria 1084
563 Ga0207645_10303441 3300025907 Bacteria 1063
564 Ga0207684_10097824 3300025910 Bacteria 2506
565 Ga0207684_10336569 3300025910 Bacteria 1300
566 Ga0207684_10364328 3300025910 Bacteria 1244
567 Ga0207654_10426602 3300025911 Bacteria 926
568 Ga0207707_10015384 3300025912 Bacteria 6663
569 Ga0207707_10020605 3300025912 Bacteria 5760
570 Ga0207707_10122981 3300025912 Bacteria 2269
571 Ga0207707_10169789 3300025912 Bacteria 1906
572 Ga0207707_10386784 3300025912 Bacteria 1202
573 Ga0207707_10666891 3300025912 Bacteria 876
574 Ga0207695_10195243 3300025913 Bacteria 1940
575 Ga0207693_10333338 3300025915 Bacteria 1188
576 Ga0207693_10389854 3300025915 Bacteria 1089
577 Ga0207663_10048204 3300025916 Bacteria 2635
578 Ga0207660_10143890 3300025917 Bacteria 1825
579 Ga0207660_10211180 3300025917 Bacteria 1520
580 Ga0207662_10015205 3300025918 Bacteria 4328
581 Ga0207662_10041195 3300025918 Bacteria 2718
582 Ga0207662_10129643 3300025918 Unclassified 1589
583 Ga0207662_10169520 3300025918 Bacteria 1399
584 Ga0207662_10692042 3300025918 Unclassified 714
585 Ga0207657_10011789 3300025919 Bacteria 8655
586 Ga0207657_10368169 3300025919 Bacteria 1132
587 Ga0207649_10246664 3300025920 Bacteria 1284
588 Ga0207652_10006944 3300025921 Bacteria 9120
589 Ga0207652_10036961 3300025921 Bacteria 4131
590 Ga0207652_10052747 3300025921 Bacteria 3492
591 Ga0207652_10146912 3300025921 Bacteria 2110
592 Ga0207652_10203250 3300025921 Bacteria 1783
593 Ga0207652_10415992 3300025921 Bacteria 1213
594 Ga0207652_10484717 3300025921 Bacteria 1114
595 Ga0207652_10696896 3300025921 Bacteria 906
596 Ga0207646_10047536 3300025922 Bacteria 3849
597 Ga0207646_10614396 3300025922 Bacteria 975
598 Ga0207681_10010366 3300025923 Bacteria 5702
599 Ga0207681_10010678 3300025923 Bacteria 5634
600 Ga0207681_10038422 3300025923 Bacteria 3171
601 Ga0207681_10243719 3300025923 Bacteria 1400
602 Ga0207681_10267045 3300025923 Bacteria 1342
603 Ga0207681_10655393 3300025923 Bacteria 871
604 Ga0207694_10577865 3300025924 Bacteria 944
605 Ga0207650_10000805 3300025925 Bacteria 24084
606 Ga0207650_10023660 3300025925 Bacteria 4360
607 Ga0207650_10036209 3300025925 Bacteria 3589
608 Ga0207650_10840857 3300025925 Bacteria 779
609 Ga0207659_10000167 3300025926 Bacteria 39314
610 Ga0207659_10014392 3300025926 Bacteria 5100
611 Ga0207659_10078092 3300025926 Bacteria 2439
612 Ga0207659_10108617 3300025926 Bacteria 2105
613 Ga0207659_10219821 3300025926 Bacteria 1527
614 Ga0207659_10289734 3300025926 Bacteria 1341
615 Ga0207659_10556895 3300025926 Bacteria 975
616 Ga0207659_10589562 3300025926 Bacteria 947
617 Ga0207659_10795036 3300025926 Bacteria 813
618 Ga0207687_10001207 3300025927 Bacteria 17694
619 Ga0207687_10074289 3300025927 Bacteria 2436
620 Ga0207687_10184586 3300025927 Bacteria 1618
621 Ga0207687_10337033 3300025927 Bacteria 1225
622 Ga0207700_10085289 3300025928 Bacteria 2479
623 Ga0207700_10092145 3300025928 Bacteria 2395
624 Ga0207700_10187250 3300025928 Bacteria 1737
625 Ga0207700_10427135 3300025928 Bacteria 1165
626 Ga0207700_10855539 3300025928 Bacteria 814
627 Ga0207644_10005413 3300025931 Bacteria 8324
628 Ga0207644_10098397 3300025931 Bacteria 2193
629 Ga0207644_10248226 3300025931 Bacteria 1419
630 Ga0207644_10457959 3300025931 Bacteria 1048
631 Ga0207706_10063762 3300025933 Bacteria 3244
632 Ga0207706_10205041 3300025933 Unclassified 1729
633 Ga0207706_10447829 3300025933 Bacteria 1117
634 Ga0207686_10008198 3300025934 Bacteria 5638
635 Ga0207686_10135303 3300025934 Bacteria 1696
636 Ga0207686_10338578 3300025934 Bacteria 1129
637 Ga0207709_10041464 3300025935 Bacteria 2762
638 Ga0207709_10468928 3300025935 Bacteria 977
639 Ga0207670_10000015 3300025936 Bacteria 177646
640 Ga0207670_10107695 3300025936 Bacteria 2002
641 Ga0207670_10383600 3300025936 Bacteria 1120
642 Ga0207670_10841161 3300025936 Bacteria 766
643 Ga0207669_10022496 3300025937 Bacteria 3350
644 Ga0207669_10069542 3300025937 Bacteria 2203
645 Ga0207669_10188263 3300025937 Bacteria 1486
646 Ga0207704_10205913 3300025938 Bacteria 1444
647 Ga0207704_10502334 3300025938 Bacteria 978
648 Ga0207691_10013615 3300025940 Bacteria 7773
649 Ga0207691_10099285 3300025940 Bacteria 2599
650 Ga0207691_10115305 3300025940 Bacteria 2386
651 Ga0207691_10160294 3300025940 Bacteria 1974
652 Ga0207691_10259341 3300025940 Bacteria 1499
653 Ga0207691_10295218 3300025940 Bacteria 1393
654 Ga0207691_10316969 3300025940 Bacteria 1337
655 Ga0207691_10435930 3300025940 Unclassified 1116
656 Ga0207711_10008539 3300025941 Bacteria 8569
657 Ga0207711_10014300 3300025941 Bacteria 6590
658 Ga0207711_10126003 3300025941 Bacteria 2291
659 Ga0207711_10221801 3300025941 Bacteria 1729
660 Ga0207711_10289348 3300025941 Bacteria 1510
661 Ga0207711_10396661 3300025941 Bacteria 1282
662 Ga0207711_10501701 3300025941 Bacteria 1131
663 Ga0207711_10880083 3300025941 Bacteria 833
664 Ga0207689_10073965 3300025942 Bacteria 2800
665 Ga0207689_10098110 3300025942 Bacteria 2406
666 Ga0207689_10200294 3300025942 Bacteria 1648
667 Ga0207689_10241283 3300025942 Bacteria 1494
668 Ga0207689_10546072 3300025942 Bacteria 973
669 Ga0207661_10000923 3300025944 Bacteria 19287
670 Ga0207661_10045146 3300025944 Bacteria 3486
671 Ga0207661_10148669 3300025944 Bacteria 2023
672 Ga0207679_10001230 3300025945 Bacteria 16262
673 Ga0207679_10235769 3300025945 Bacteria 1547
674 Ga0207679_10518576 3300025945 Bacteria 1066
675 Ga0207679_10539889 3300025945 Bacteria 1045
676 Ga0207679_10581964 3300025945 Archaea 1007
677 Ga0207667_10133369 3300025949 Bacteria 2558
678 Ga0207651_10022628 3300025960 Bacteria 3848
679 Ga0207651_10117209 3300025960 Bacteria 2012
680 Ga0207651_10155102 3300025960 Bacteria 1788
681 Ga0207651_10216024 3300025960 Bacteria 1547
682 Ga0207651_10318185 3300025960 Unclassified 1300
683 Ga0207651_10436724 3300025960 Bacteria 1120
684 Ga0207651_10467216 3300025960 Bacteria 1085
685 Ga0207651_10529010 3300025960 Bacteria 1023
686 Ga0207712_10077639 3300025961 Bacteria 2407
687 Ga0207712_10113385 3300025961 Bacteria 2038
688 Ga0207712_10395353 3300025961 Bacteria 1160
689 Ga0207712_11193075 3300025961 Bacteria 679
690 Ga0207668_10035334 3300025972 Bacteria 3326
691 Ga0207668_10350734 3300025972 Bacteria 1234
692 Ga0207668_10691601 3300025972 Bacteria 896
693 Ga0207640_10029494 3300025981 Bacteria 3369
694 Ga0207640_10041720 3300025981 Bacteria 2920
695 Ga0207658_10091748 3300025986 Bacteria 2358
696 Ga0207658_10179578 3300025986 Bacteria 1751
697 Ga0207658_10493495 3300025986 Bacteria 1090
698 Ga0207677_10169449 3300026023 Bacteria 1706
699 Ga0207703_10023595 3300026035 Bacteria 4835
700 Ga0207703_10056737 3300026035 Bacteria 3191
701 Ga0207703_10270206 3300026035 Unclassified 1540
702 Ga0207703_10549069 3300026035 Bacteria 1089
703 Ga0207703_10689315 3300026035 Bacteria 971
704 Ga0207639_10644292 3300026041 Bacteria 980
705 Ga0207639_10790687 3300026041 Bacteria 884
706 Ga0207639_11258050 3300026041 Bacteria 694
707 Ga0207678_10087135 3300026067 Bacteria 2668
708 Ga0207678_10114873 3300026067 Bacteria 2296
709 Ga0207708_10007428 3300026075 Bacteria 8100
710 Ga0207708_10013381 3300026075 Bacteria 6130
711 Ga0207708_10018940 3300026075 Bacteria 5184
712 Ga0207708_10024327 3300026075 Bacteria 4581
713 Ga0207708_10065707 3300026075 Unclassified 2773
714 Ga0207708_10112063 3300026075 Bacteria 2119
715 Ga0207708_10158927 3300026075 Bacteria 1784
716 Ga0207708_10189998 3300026075 Bacteria 1634
717 Ga0207708_10208871 3300026075 Bacteria 1560
718 Ga0207708_10599781 3300026075 Bacteria 933
719 Ga0207708_10830162 3300026075 Bacteria 797
720 Ga0207702_10085324 3300026078 Bacteria 2751
721 Ga0207702_10167508 3300026078 Bacteria 2011
722 Ga0207702_10777606 3300026078 Bacteria 946
723 Ga0207641_10003071 3300026088 Bacteria 15056
724 Ga0207641_10229120 3300026088 Bacteria 1726
725 Ga0207641_10720795 3300026088 Bacteria 983
726 Ga0207648_10018303 3300026089 Bacteria 6346
727 Ga0207648_10029472 3300026089 Bacteria 4867
728 Ga0207648_10078540 3300026089 Bacteria 2879
729 Ga0207648_10099978 3300026089 Bacteria 2540
730 Ga0207648_10468939 3300026089 Bacteria 1149
731 Ga0207676_10042570 3300026095 Bacteria 3493
732 Ga0207676_10206848 3300026095 Bacteria 1738
733 Ga0207676_10304757 3300026095 Bacteria 1456
734 Ga0207675_100003256 3300026118 Bacteria 15906
735 Ga0207675_100064531 3300026118 Bacteria 3422
736 Ga0207675_100070261 3300026118 Bacteria 3272
737 Ga0207675_100084401 3300026118 Bacteria 2980
738 Ga0207675_100084920 3300026118 Bacteria 2971
739 Ga0207675_100170182 3300026118 Bacteria 2082
740 Ga0207675_100190676 3300026118 Bacteria 1966
741 Ga0207675_100441573 3300026118 Unclassified 1288
742 Ga0207683_10036957 3300026121 Bacteria 4252
743 Ga0207683_10140461 3300026121 Bacteria 2176
744 Ga0207683_10548579 3300026121 Bacteria 1069
745 Ga0207683_10632521 3300026121 Bacteria 991
746 Ga0207698_10295462 3300026142 Bacteria 1506
747 Ga0207698_10495348 3300026142 Bacteria 1188
748 Ga0207698_10808889 3300026142 Bacteria 940
749 Ga0207698_11277536 3300026142 Unclassified 749
750 Ga0207428_10001696 3300027907 Bacteria 22617
751 Ga0207428_10005045 3300027907 Bacteria 12402
752 Ga0207428_10007759 3300027907 Bacteria 9766
753 Ga0207428_10008023 3300027907 Bacteria 9582
754 Ga0207428_10060333 3300027907 Bacteria 3005
755 Ga0207428_10076486 3300027907 Bacteria 2621
756 Ga0268266_10272483 3300028379 Bacteria 1571
757 Ga0268266_10572410 3300028379 Bacteria 1083
758 Ga0268265_10108453 3300028380 Bacteria 2260
759 Ga0268265_10203723 3300028380 Bacteria 1718
760 Ga0268265_10260762 3300028380 Bacteria 1541
761 Ga0268265_10434821 3300028380 Bacteria 1222
762 Ga0268264_10038958 3300028381 Bacteria 3926
763 Ga0268264_10132157 3300028381 Bacteria 2214
764 Ga0268264_10185373 3300028381 Bacteria 1893
765 Ga0265318_10022316 3300028577 Bacteria 2533
766 Ga0265336_10076994 3300028666 Bacteria 996
767 Ga0265332_10276996 3300031238 Bacteria 693
768 Ga0265316_10467880 3300031344 Bacteria 903
769 Ga0307408_100014846 3300031548 Bacteria 5179
770 Ga0307408_100322936 3300031548 Bacteria 1301
771 Ga0307408_100607019 3300031548 Bacteria 973
772 Ga0307408_101211812 3300031548 Bacteria 704
773 Ga0265314_10058113 3300031711 Bacteria 2652
774 Ga0265314_10291724 3300031711 Bacteria 918
775 Ga0316576_10237184 3300031727 Bacteria 1371
776 Ga0307405_10268156 3300031731 Bacteria 1279
777 Ga0307405_10380276 3300031731 Unclassified 1099
778 Ga0307413_10200052 3300031824 Bacteria 1442
779 Ga0307410_10243123 3300031852 Bacteria 1396
780 Ga0307406_10118720 3300031901 Bacteria 1834
781 Ga0307406_10129400 3300031901 Bacteria 1770
782 Ga0307406_10681177 3300031901 Bacteria 856
783 Ga0307407_10528714 3300031903 Bacteria 868
784 Ga0307412_10024228 3300031911 Bacteria 3745
785 Ga0307412_10226251 3300031911 Bacteria 1437
786 Ga0307412_10438349 3300031911 Bacteria 1073
787 Ga0307412_10558324 3300031911 Bacteria 963
788 Ga0307409_100263166 3300031995 Bacteria 1584
789 Ga0307409_100417713 3300031995 Bacteria 1286
790 Ga0307409_100911771 3300031995 Bacteria 893
791 Ga0307409_101452583 3300031995 Bacteria 713
792 Ga0307416_100016739 3300032002 Bacteria 5107
793 Ga0307416_100061958 3300032002 Bacteria 3056
794 Ga0307416_100098230 3300032002 Bacteria 2539
795 Ga0307416_100111776 3300032002 Bacteria 2410
796 Ga0307416_100386393 3300032002 Bacteria 1432
797 Ga0307416_100600508 3300032002 Bacteria 1180
798 Ga0307416_100654321 3300032002 Bacteria 1136
799 Ga0307416_101405133 3300032002 Archaea 804
800 Ga0307416_101931152 3300032002 Bacteria 693
801 Ga0307414_10201321 3300032004 Bacteria 1620
802 Ga0307411_10118055 3300032005 Bacteria 1913
803 Ga0307411_10207060 3300032005 Bacteria 1511
804 Ga0307411_10966096 3300032005 Bacteria 761
805 Ga0307415_100044964 3300032126 Bacteria 2957
806 Ga0307415_100098943 3300032126 Bacteria 2133
807 Ga0307415_100424029 3300032126 Bacteria 1143
808 Ga0373948_0000627 3300034817 Bacteria 4556
809 Ga0373950_0000692 3300034818 Bacteria 4158
810 Ga0373959_0000568 3300034820 Bacteria 6496
811 Ga0373938_0002621 3300034957 Bacteria 2902
812 Ga0373928_0003110 3300035084 Bacteria 3186
813 Ga0373928_0122250 3300035084 Bacteria 699
814 Ga0373929_0000691 3300035085 Bacteria 6525
815 Ga0373949_0003668 3300035090 Bacteria 3604
816 Ga0373951_0001601 3300035091 Bacteria 5939
817 Ga0373951_0077508 3300035091 Bacteria 855
818 Ga0373923_0012797 3300035111 Bacteria 3114
819 Ga0373932_0000337 3300035112 Bacteria 14304
820 Ga0373932_0066230 3300035112 Bacteria 1110
821 Ga0373936_0039253 3300035113 Bacteria 1894
822 Ga0373936_0061684 3300035113 Bacteria 1532
823 Ga0373939_0035652 3300035114 Bacteria 1467
824 Ga0373939_0183176 3300035114 Unclassified 782
825 Ga0373941_0003248 3300035115 Bacteria 3665
826 Ga0373941_0008215 3300035115 Bacteria 2585
827 Ga0373941_0016589 3300035115 Bacteria 2005
828 Ga0373941_0075863 3300035115 Bacteria 1126
829 Ga0373941_0136807 3300035115 Unclassified 888
830 Ga0373945_0008026 3300035116 Bacteria 3428
831 Ga0373954_0183532 3300035118 Bacteria 1026
832 Ga0373956_0186997 3300035119 Unclassified 980
833 Ga0373960_0003490 3300035121 Bacteria 3565
834 Ga0373943_0053757 3300035170 Bacteria 1990
835 Ga0373943_0248122 3300035170 Bacteria 999
836 Ga0373946_0051439 3300035171 Bacteria 1724
837 Ga0373946_0062881 3300035171 Bacteria 1584
838 Ga0373946_0150092 3300035171 Bacteria 1087
839 Ga0373955_0025317 3300035172 Bacteria 3046
840 Ga0373955_0093914 3300035172 Bacteria 1713
841 Ga0373955_0095465 3300035172 Bacteria 1701
842 Ga0373955_0106235 3300035172 Bacteria 1618
843 Ga0373955_0475938 3300035172 Bacteria 762
844 Ga0373942_0001277 3300035207 Bacteria 6592
845 Ga0373961_0000257 3300035241 Bacteria 24679
846 Ga0373962_0001671 3300035242 Bacteria 5270
847 Ga0373962_0041882 3300035242 Bacteria 1293
848 Ga0373924_0007565 3300035410 Bacteria 3924
849 Ga0373924_0108947 3300035410 Bacteria 1196
850 Ga0373924_0168333 3300035410 Bacteria 962
851 Ga0373935_0233128 3300035692 Bacteria 1283
852 Ga0373935_0239596 3300035692 Bacteria 1266
853 Ga0373935_0448182 3300035692 Bacteria 932
854 Ga0373927_0535812 3300035695 Bacteria 774
855 Ga0373933_0002856 3300035724 Bacteria 9645
856 Ga0373947_0059290 3300035725 Bacteria 2321
857 Ga0373947_0079282 3300035725 Bacteria 2029
858 Ga0373947_0100910 3300035725 Bacteria 1814
859 Ga0373947_0497116 3300035725 Bacteria 829
860 Ga0373937_0128231 3300036401 Bacteria 2368
861 Ga0373937_0179397 3300036401 Bacteria 1988
862 Ga0373937_0666150 3300036401 Bacteria 986
863 Ga0373937_0729851 3300036401 Bacteria 938
864 Ga0373925_0001894 3300037068 Bacteria 17368
865 Ga0373925_0132498 3300037068 Bacteria 1945
866 Ga0373925_0187138 3300037068 Bacteria 1642
867 Ga0373925_0553075 3300037068 Bacteria 946
868 Ga0395905_0725402 3300037471 Bacteria 896
869 Ga0436365_1665382 3300039437 Bacteria 10677
870 Ga0439436_0104755 3300041404 Bacteria 789
871 Ga0439453_0034893 3300041408 Bacteria 967
872 Ga0439453_0071816 3300041408 Bacteria 733
873 Ga0451807_1120969 3300041486 Bacteria 870
874 Ga0451849_0842788 3300041505 Unclassified 692
875 Ga0439431_0050198 3300041997 Bacteria 1080
876 Ga0439433_0013092 3300041999 Bacteria 1821
877 Ga0439441_056010 3300042001 Bacteria 821
878 Ga0439445_0122217 3300042004 Bacteria 748
879 Ga0439449_0099049 3300042007 Bacteria 1077
880 Ga0439450_007214 3300042008 Bacteria 2030
881 Ga0439455_0063841 3300042012 Bacteria 980
882 Ga0439457_087211 3300042014 Archaea 720
883 Ga0439462_0039905 3300042015 Bacteria 1252
884 Ga0439462_0061977 3300042015 Bacteria 1012
885 Ga0450920_076029 3300042122 Bacteria 685
886 Ga0450923_029177 3300042125 Bacteria 1117
887 Ga0450910_062204 3300042147 Bacteria 631
888 Ga0439446_0086724 3300042156 Bacteria 975
889 Ga0439446_0121497 3300042156 Bacteria 841
890 Ga0439444_0023278 3300042437 Bacteria 1111
891 Ga0439444_0097221 3300042437 Bacteria 663
892 Ga0439464_0030177 3300042439 Bacteria 1517
893 Ga0439464_0039826 3300042439 Bacteria 1337
894 Ga0439460_0053808 3300042461 Bacteria 1213
895 Ga0451577_0048768 3300042876 Bacteria 3782
896 Ga0451577_0067951 3300042876 Bacteria 3179
897 Ga0451577_0584181 3300042876 Unclassified 1014
898 Ga0451577_0639062 3300042876 Bacteria 965
899 Ga0439440_0045026 3300042993 Bacteria 1087
900 Ga0453684_0001378 3300044712 Bacteria 70372
901 Ga0453684_0285704 3300044712 Bacteria 1880
902 Ga0453684_0908046 3300044712 Bacteria 943
903 Ga0451576_0006781 3300045051 Bacteria 13934
904 Ga0451576_0016168 3300045051 Bacteria 8243
905 Ga0451576_0137896 3300045051 Bacteria 2544
906 Ga0466967_0246017 3300045976 Bacteria 1707
907 Ga0495592_0049786 3300046454 Bacteria 3114
908 Ga0495603_0368579 3300046455 Unclassified 824
909 Ga0495629_0010962 3300046459 Bacteria 6587
910 Ga0495629_0136569 3300046459 Bacteria 1707
911 Ga0495629_0714461 3300046459 Bacteria 665
912 Ga0495641_0148096 3300046461 Bacteria 1049
913 Ga0495651_0097822 3300046462 Bacteria 2191
914 Ga0495653_0157086 3300046463 Unclassified 1583
915 Ga0495582_0173798 3300046473 Bacteria 1227
916 Ga0495639_0017554 3300046475 Bacteria 3110
917 Ga0495639_0083651 3300046475 Bacteria 1489
918 Ga0495639_0153942 3300046475 Bacteria 1110
919 Ga0495664_0282923 3300046477 Unclassified 1002
920 Ga0495584_0030843 3300046491 Bacteria 2715
921 Ga0495594_0020448 3300046499 Bacteria 3526
922 Ga0495594_0267997 3300046499 Unclassified 973
923 Ga0495594_0269610 3300046499 Bacteria 970
924 Ga0495594_0405167 3300046499 Bacteria 776
925 Ga0495608_0002435 3300046511 Bacteria 13383
926 Ga0495628_0053805 3300046516 Bacteria 3175
927 Ga0495630_0086168 3300046517 Bacteria 2372
928 Ga0495643_0318422 3300046522 Bacteria 704
929 Ga0495644_0028928 3300046523 Bacteria 2096
930 Ga0495642_0015666 3300046528 Bacteria 2950
931 Ga0495642_0297578 3300046528 Bacteria 707
932 Ga0495640_0148409 3300046533 Bacteria 1508
933 Ga0495586_0172864 3300046535 Bacteria 1221
934 Ga0495621_0089677 3300046539 Bacteria 1158
935 Ga0495645_0010954 3300046543 Bacteria 6367
936 Ga0495633_0190554 3300046558 Bacteria 943
937 Ga0495656_0432054 3300046615 Bacteria 692
938 Ga0495634_0056724 3300046642 Bacteria 2616
939 Ga0495634_0109003 3300046642 Bacteria 1782
940 Ga0495635_0106129 3300046663 Bacteria 1919
941 Ga0495635_0124975 3300046663 Bacteria 1754
942 Ga0495659_0007644 3300046664 Bacteria 3425
943 Ga0495659_0037184 3300046664 Bacteria 1723
944 Ga0495659_0211397 3300046664 Bacteria 798
945 Ga0495588_0167603 3300046674 Bacteria 1161
946 Ga0495657_0184155 3300046675 Bacteria 1280
947 Ga0495599_0046584 3300046678 Bacteria 2719
948 Ga0495599_0450643 3300046678 Bacteria 762
949 Ga0495623_0033066 3300046679 Bacteria 3320
950 Ga0495647_0016657 3300046681 Bacteria 2591
951 Ga0495647_0017992 3300046681 Bacteria 2509
952 Ga0495647_0114991 3300046681 Bacteria 1126
953 Ga0495658_0025361 3300046683 Bacteria 3168
954 Ga0495658_0088934 3300046683 Bacteria 1826
955 Ga0495658_0141952 3300046683 Bacteria 1469
956 Ga0495669_0000921 3300046684 Bacteria 12299
957 Ga0495669_0026638 3300046684 Bacteria 2527
958 Ga0495669_0152781 3300046684 Bacteria 1093
959 Ga0495613_0009742 3300046689 Bacteria 7140
960 Ga0495613_0162948 3300046689 Bacteria 1585
961 Ga0495613_0184006 3300046689 Bacteria 1479
962 Ga0495613_0245560 3300046689 Bacteria 1251
963 Ga0495613_0280486 3300046689 Bacteria 1157
964 Ga0495624_0379110 3300046690 Bacteria 850
965 Ga0495600_0155315 3300046809 Bacteria 1480
966 Ga0495600_0161460 3300046809 Bacteria 1448
967 Ga0495581_0269124 3300047315 Unclassified 996
968 Ga0495604_0009018 3300047317 Bacteria 7891
969 Ga0495604_0201850 3300047317 Bacteria 1379
970 Ga0495604_0235011 3300047317 Bacteria 1256
971 Ga0495636_0043154 3300047318 Bacteria 1875
972 Ga0495674_0032216 3300047319 Bacteria 4757
973 Ga0495674_0054713 3300047319 Bacteria 3503
974 Ga0495672_0078283 3300047320 Bacteria 1850
975 Ga0495676_0100823 3300047321 Bacteria 2137
976 Ga0495685_008330 3300047447 Bacteria 3441
977 Ga0495684_0000430 3300047471 Bacteria 34261
978 Ga0495684_0100867 3300047471 Bacteria 2183
979 Ga0495684_0391624 3300047471 Bacteria 978
980 Ga0495593_0187302 3300047673 Bacteria 1042
981 Ga0495602_0240875 3300048088 Bacteria 1353
982 Ga0495602_0457953 3300048088 Bacteria 899
983 Ga0495614_0280914 3300048089 Bacteria 766
984 Ga0495614_0297893 3300048089 Bacteria 745
985 Ga0496101_0239790 3300048904 Bacteria 1411
986 Ga0496101_0379865 3300048904 Bacteria 1111
987 Ga0496102_0104961 3300048905 Bacteria 2629
988 Ga0496103_0526175 3300048906 Bacteria 756
989 Ga0496104_0003309 3300048907 Bacteria 13912
990 Ga0496104_0012689 3300048907 Bacteria 7587
991 Ga0496104_0037014 3300048907 Bacteria 4563
992 Ga0496104_0039902 3300048907 Bacteria 4398
993 Ga0496104_0256620 3300048907 Bacteria 1661
994 Ga0496104_0357194 3300048907 Bacteria 1374
995 Ga0496104_0524245 3300048907 Bacteria 1096
996 Ga0496105_0031465 3300048908 Bacteria 4350
997 Ga0496105_0049881 3300048908 Bacteria 3457
998 Ga0496105_0204841 3300048908 Bacteria 1609
999 Ga0496106_0095497 3300048909 Bacteria 2300
1000 Ga0496106_0188178 3300048909 Bacteria 1640
1001 Ga0496107_0395242 3300048910 Bacteria 1028
1002 Ga0496108_0000873 3300048911 Bacteria 23508
1003 Ga0496108_0004636 3300048911 Bacteria 11082
1004 Ga0496108_0190794 3300048911 Bacteria 1776
1005 Ga0496108_0507617 3300048911 Bacteria 1053
1006 Ga0496109_0000242 3300048912 Bacteria 52965
1007 Ga0496109_0097296 3300048912 Bacteria 2728
1008 Ga0496109_0710356 3300048912 Bacteria 943
1009 Ga0496110_0033130 3300048913 Bacteria 4467
1010 Ga0496110_0042510 3300048913 Bacteria 3967
1011 Ga0496110_0461037 3300048913 Bacteria 1158
1012 Ga0496111_0020346 3300048914 Bacteria 4620
1013 Ga0496112_0001215 3300048915 Bacteria 19359
1014 Ga0496112_0011182 3300048915 Bacteria 8184
1015 Ga0496112_0789643 3300048915 Bacteria 875
1016 Ga0496112_0845616 3300048915 Bacteria 839
1017 Ga0496113_0016935 3300048916 Bacteria 5046
1018 Ga0496113_0379902 3300048916 Bacteria 1134
1019 Ga0496114_0002932 3300048917 Bacteria 13084
1020 Ga0496114_0089386 3300048917 Bacteria 2614
1021 Ga0496114_0137215 3300048917 Bacteria 2115
1022 Ga0496114_0266205 3300048917 Bacteria 1510
1023 Ga0496114_0318869 3300048917 Bacteria 1373
1024 Ga0496114_0807218 3300048917 Bacteria 817
1025 Ga0496115_0020602 3300048918 Bacteria 5087
1026 Ga0496115_0060412 3300048918 Bacteria 3054
1027 Ga0496115_0322505 3300048918 Bacteria 1263
1028 Ga0501296_006211 3300049519 Bacteria 1350
1029 Ga0501031_0122025 3300049568 Bacteria 1702
1030 Ga0501033_0106379 3300049570 Unclassified 2044
1031 Ga0501034_0036123 3300049571 Bacteria 5008
1032 Ga0501034_0243086 3300049571 Bacteria 1746
1033 Ga0501034_0772362 3300049571 Bacteria 855
1034 Ga0501036_0097936 3300049572 Bacteria 2479
1035 Ga0501036_0172327 3300049572 Bacteria 1823
1036 Ga0501036_0198223 3300049572 Bacteria 1689
1037 Ga0501036_0400935 3300049572 Bacteria 1144
1038 Ga0501038_0079552 3300049574 Bacteria 2764
1039 Ga0501038_0486575 3300049574 Unclassified 945
1040 Ga0501039_0061360 3300049575 Bacteria 2912
1041 Ga0501039_0343774 3300049575 Bacteria 1172
1042 Ga0501039_0358919 3300049575 Bacteria 1145
1043 Ga0501039_0361400 3300049575 Bacteria 1140
1044 Ga0501040_0033198 3300049576 Bacteria 3495
1045 Ga0501040_0077082 3300049576 Bacteria 2306
1046 Ga0501040_0157515 3300049576 Bacteria 1604
1047 Ga0501040_0477933 3300049576 Bacteria 898
1048 Ga0501041_0010809 3300049577 Bacteria 5385
1049 Ga0501041_0014742 3300049577 Bacteria 4642
1050 Ga0501041_0271819 3300049577 Bacteria 1066
1051 Ga0501041_0429277 3300049577 Bacteria 838
1052 Ga0501042_0006649 3300049578 Bacteria 7532
1053 Ga0501042_0014046 3300049578 Bacteria 5460
1054 Ga0501042_0064420 3300049578 Bacteria 2619
1055 Ga0501042_0160145 3300049578 Bacteria 1624
1056 Ga0501042_0303731 3300049578 Bacteria 1153
1057 Ga0501042_0395259 3300049578 Bacteria 1001
1058 Ga0501042_0639397 3300049578 Archaea 773
1059 Ga0501043_0098189 3300049579 Bacteria 2302
1060 Ga0501043_0552052 3300049579 Bacteria 856
1061 Ga0501043_0722105 3300049579 Bacteria 726
1062 Ga0501046_0027433 3300049580 Bacteria 4645
1063 Ga0501046_0079789 3300049580 Bacteria 2530
1064 Ga0501046_0490289 3300049580 Bacteria 881
1065 Ga0501047_0062761 3300049581 Bacteria 3584
1066 Ga0501047_0259946 3300049581 Bacteria 1584
1067 Ga0501048_0057255 3300049582 Bacteria 2764
1068 Ga0501048_0174387 3300049582 Bacteria 1524
1069 Ga0501048_0180113 3300049582 Bacteria 1498
1070 Ga0501048_0504464 3300049582 Bacteria 867
1071 Ga0501067_0262076 3300049583 Bacteria 962
1072 Ga0501067_0274980 3300049583 Bacteria 938
1073 Ga0501068_0268586 3300049584 Bacteria 1089
1074 Ga0501068_0724580 3300049584 Bacteria 651
1075 Ga0501070_0330100 3300049586 Bacteria 1240
1076 Ga0501070_0419517 3300049586 Bacteria 1081
1077 Ga0501071_0007928 3300049587 Bacteria 7005
1078 Ga0501071_0013636 3300049587 Bacteria 5542
1079 Ga0501071_0017357 3300049587 Bacteria 4962
1080 Ga0501071_0180994 3300049587 Bacteria 1579
1081 Ga0501071_0573393 3300049587 Bacteria 867
1082 Ga0501072_0008843 3300049588 Bacteria 7653
1083 Ga0501072_0035279 3300049588 Bacteria 3920
1084 Ga0501072_0103719 3300049588 Bacteria 2260
1085 Ga0501072_0299403 3300049588 Bacteria 1278
1086 Ga0501072_0354803 3300049588 Bacteria 1164
1087 Ga0501073_0001379 3300049589 Bacteria 17938
1088 Ga0501073_0269925 3300049589 Bacteria 1174
1089 Ga0501073_0305948 3300049589 Bacteria 1097
1090 Ga0501073_0309445 3300049589 Bacteria 1090
1091 Ga0501074_0067557 3300049590 Bacteria 2571
1092 Ga0501074_0144216 3300049590 Bacteria 1703
1093 Ga0501074_0399439 3300049590 Bacteria 975
1094 Ga0501075_0015890 3300049591 Bacteria 5413
1095 Ga0501075_0044114 3300049591 Bacteria 3345
1096 Ga0501075_0057511 3300049591 Bacteria 2928
1097 Ga0501075_0061903 3300049591 Bacteria 2821
1098 Ga0501075_0071698 3300049591 Bacteria 2618
1099 Ga0501075_0107920 3300049591 Bacteria 2116
1100 Ga0501075_0109468 3300049591 Bacteria 2100
1101 Ga0501075_0134001 3300049591 Bacteria 1887
1102 Ga0501075_0350278 3300049591 Bacteria 1125
1103 Ga0501075_0369951 3300049591 Bacteria 1092
1104 Ga0501075_0621693 3300049591 Bacteria 824
1105 Ga0501076_0025970 3300049592 Bacteria 4533
1106 Ga0501076_0028662 3300049592 Bacteria 4325
1107 Ga0501076_0036548 3300049592 Bacteria 3849
1108 Ga0501076_0072209 3300049592 Bacteria 2762
1109 Ga0501076_0089605 3300049592 Bacteria 2473
1110 Ga0501076_0108788 3300049592 Bacteria 2239
1111 Ga0501076_0122748 3300049592 Bacteria 2104
1112 Ga0501077_0053835 3300049593 Bacteria 2555
1113 Ga0501077_0295511 3300049593 Bacteria 1032
1114 Ga0501077_0296915 3300049593 Bacteria 1029
1115 Ga0501207_010382 3300049654 Bacteria 1373
1116 Ga0501217_018099 3300049661 Bacteria 1632
1117 Ga0501235_122669 3300049669 Bacteria 651
1118 Ga0501079_0014531 3300049741 Bacteria 6004
1119 Ga0501079_0017267 3300049741 Bacteria 5509
1120 Ga0501079_0026197 3300049741 Bacteria 4470
1121 Ga0501079_0033403 3300049741 Bacteria 3958
1122 Ga0501079_0056354 3300049741 Bacteria 3033
1123 Ga0501079_0068329 3300049741 Bacteria 2743
1124 Ga0501079_0097212 3300049741 Bacteria 2283
1125 Ga0501079_0164614 3300049741 Bacteria 1729
1126 Ga0501079_0333296 3300049741 Bacteria 1188
1127 Ga0501080_0049040 3300049742 Bacteria 3930
1128 Ga0501080_0243746 3300049742 Bacteria 1640
1129 Ga0501080_0319075 3300049742 Bacteria 1407
1130 Ga0501080_0338495 3300049742 Bacteria 1360
1131 Ga0501080_1323097 3300049742 Unclassified 616
1132 Ga0501081_0029465 3300049743 Bacteria 3709
1133 Ga0501081_0047394 3300049743 Bacteria 2957
1134 Ga0501081_0098296 3300049743 Bacteria 2067
1135 Ga0501081_0161482 3300049743 Bacteria 1615
1136 Ga0501081_0163296 3300049743 Bacteria 1606
1137 Ga0501081_0220944 3300049743 Bacteria 1378
1138 Ga0501081_0292324 3300049743 Bacteria 1194
1139 Ga0501083_0126282 3300049744 Bacteria 1677
1140 Ga0501083_0365560 3300049744 Bacteria 938
1141 Ga0501083_0536529 3300049744 Bacteria 761
1142 Ga0501035_0747448 3300049822 Bacteria 785
1143 Ga0501044_0002963 3300049823 Bacteria 19306
1144 Ga0501044_0813227 3300049823 Bacteria 813
1145 Ga0501044_1018841 3300049823 Bacteria 699
1146 Ga0501045_0004516 3300049824 Bacteria 9615
1147 Ga0501045_0023675 3300049824 Bacteria 4405
1148 Ga0501045_0042885 3300049824 Bacteria 3293
1149 Ga0501045_0046934 3300049824 Bacteria 3145
1150 Ga0501045_0246726 3300049824 Bacteria 1329
1151 Ga0501045_0291991 3300049824 Bacteria 1213
1152 Ga0501045_0339753 3300049824 Bacteria 1118
1153 Ga0501045_0477562 3300049824 Bacteria 926
1154 Ga0501045_0508651 3300049824 Unclassified 894
1155 Ga0501045_0958675 3300049824 Bacteria 628
1156 nmdc:mga03683_57062_c1 3300050489 Bacteria 1643
1157 nmdc:mga00v17_127323_c1 3300050491 Bacteria 1626
1158 nmdc:mga00v17_25363_c1 3300050491 Bacteria 3446
1159 nmdc:mga0yw44_56872_c1 3300050492 Bacteria 2385
1160 nmdc:mga0yw44_71484_c1 3300050492 Bacteria 2154
1161 nmdc:mga0k408_116303_c1 3300050493 Bacteria 1582
1162 nmdc:mga0k408_24975_c1 3300050493 Bacteria 3381
1163 nmdc:mga0k408_3174_c1 3300050493 Bacteria 8717
1164 nmdc:mga0k408_4650_c1 3300050493 Bacteria 7272
1165 nmdc:mga06z11_11688_c1 3300050494 Bacteria 3793
1166 nmdc:mga06z11_168943_c1 3300050494 Bacteria 1255
1167 nmdc:mga06z11_2119_c1 3300050494 Bacteria 7523
1168 nmdc:mga06z11_264024_c1 3300050494 Bacteria 1016
1169 nmdc:mga06z11_60038_c1 3300050494 Bacteria 1978
1170 nmdc:mga06z11_94178_c1 3300050494 Bacteria 1632
1171 nmdc:mga04h51_7074_c1 3300050495 Bacteria 2943
1172 nmdc:mga07m45_43174_c1 3300050496 Bacteria 2528
1173 nmdc:mga05p37_11444_c1 3300050507 Bacteria 10565
1174 nmdc:mga05p37_12625_c1 3300050507 Bacteria 10088
1175 nmdc:mga05p37_13779_c1 3300050507 Bacteria 8328
1176 nmdc:mga05p37_196723_c1 3300050507 Bacteria 2444
1177 nmdc:mga05p37_24548_c1 3300050507 Bacteria 7327
1178 nmdc:mga05p37_30727_c1 3300050507 Bacteria 6554
1179 nmdc:mga05p37_30801_c1 3300050507 Bacteria 6548
1180 nmdc:mga05p37_33929_c1 3300050507 Bacteria 6252
1181 nmdc:mga05p37_367944_c1 3300050507 Bacteria 1688
1182 nmdc:mga05p37_38359_c1 3300050507 Bacteria 5876
1183 nmdc:mga05p37_4043_c1 3300050507 Bacteria 17141
1184 nmdc:mga05p37_455611_c1 3300050507 Bacteria 1479
1185 nmdc:mga05p37_530041_c1 3300050507 Bacteria 1345
1186 nmdc:mga05p37_546925_c1 3300050507 Bacteria 1319
1187 nmdc:mga05p37_5767_c1 3300050507 Bacteria 14565
1188 nmdc:mga05p37_62607_c1 3300050507 Bacteria 4578
1189 nmdc:mga05p37_631118_c1 3300050507 Bacteria 1204
1190 nmdc:mga05p37_671321_c1 3300050507 Bacteria 1157
1191 nmdc:mga05p37_693257_c1 3300050507 Bacteria 1133
1192 nmdc:mga05p37_7376_c1 3300050507 Bacteria 12971
1193 nmdc:mga05p37_80513_c1 3300050507 Bacteria 4012
1194 nmdc:mga05p37_839_c1 3300050507 Bacteria 34481
1195 nmdc:mga05p37_899015_c1 3300050507 Bacteria 955
1196 nmdc:mga05p37_928385_c1 3300050507 Unclassified 934
1197 nmdc:mga09592_187629_c1 3300050508 Bacteria 1789
1198 nmdc:mga09592_2044_c1 3300050508 Bacteria 16270
1199 nmdc:mga09592_48337_c1 3300050508 Bacteria 3586
1200 nmdc:mga09592_68228_c1 3300050508 Bacteria 3016
1201 nmdc:mga09592_939245_c1 3300050508 Bacteria 725
1202 nmdc:mga0qj67_217255_c1 3300050509 Bacteria 1552
1203 nmdc:mga06r32_14245_c1 3300050510 Bacteria 7211
1204 nmdc:mga06r32_18049_c1 3300050510 Bacteria 6451
1205 nmdc:mga06r32_18958_c1 3300050510 Bacteria 6308
1206 nmdc:mga06r32_208462_c1 3300050510 Bacteria 1942
1207 nmdc:mga06r32_51806_c1 3300050510 Bacteria 3929
1208 nmdc:mga08y16_11226_c1 3300050511 Bacteria 9411
1209 nmdc:mga08y16_1288120_c1 3300050511 Unclassified 698
1210 nmdc:mga08y16_166794_c1 3300050511 Bacteria 2288
1211 nmdc:mga08y16_25834_c1 3300050511 Bacteria 6197
1212 nmdc:mga08y16_2829_c1 3300050511 Bacteria 17834
1213 nmdc:mga08y16_326152_c1 3300050511 Bacteria 1580
1214 nmdc:mga08y16_4725_c1 3300050511 Bacteria 14199
1215 nmdc:mga08y16_47482_c1 3300050511 Bacteria 4494
1216 nmdc:mga08y16_506111_c1 3300050511 Bacteria 1226
1217 nmdc:mga08y16_513825_c1 3300050511 Bacteria 1216
1218 nmdc:mga08y16_5349_c1 3300050511 Bacteria 13429
1219 nmdc:mga08y16_543300_c1 3300050511 Bacteria 1177
1220 nmdc:mga08y16_58722_c1 3300050511 Bacteria 4020
1221 nmdc:mga08y16_6903_c1 3300050511 Bacteria 11902
1222 nmdc:mga08y16_97061_c1 3300050511 Bacteria 3069
1223 nmdc:mga0n895_12571_c1 3300050512 Bacteria 7598
1224 nmdc:mga0n895_184495_c1 3300050512 Bacteria 2118
1225 nmdc:mga0n895_18763_c1 3300050512 Bacteria 6410
1226 nmdc:mga0n895_267590_c1 3300050512 Bacteria 1734
1227 nmdc:mga0n895_30416_c1 3300050512 Bacteria 5160
1228 nmdc:mga0n895_318047_c1 3300050512 Bacteria 1577
1229 nmdc:mga0n895_453011_c1 3300050512 Bacteria 1295
1230 nmdc:mga0n895_46025_c1 3300050512 Bacteria 4261
1231 nmdc:mga0n895_46783_c1 3300050512 Bacteria 4228
1232 nmdc:mga0n895_6739_c1 3300050512 Bacteria 9797
1233 nmdc:mga0n895_774796_c1 3300050512 Bacteria 951
1234 nmdc:mga0rr50_10246_c1 3300050513 Bacteria 5938
1235 nmdc:mga0rr50_32594_c1 3300050513 Bacteria 3714
1236 nmdc:mga0rr50_355074_c1 3300050513 Bacteria 1233
1237 nmdc:mga0rr50_485749_c1 3300050513 Bacteria 1049
1238 nmdc:mga0rr50_552334_c1 3300050513 Bacteria 981
1239 nmdc:mga0rr50_644356_c1 3300050513 Bacteria 904
1240 nmdc:mga0rr50_647_c1 3300050513 Bacteria 18706
1241 nmdc:mga0rr50_720318_c1 3300050513 Bacteria 851
1242 nmdc:mga0rr50_91846_c1 3300050513 Bacteria 2366
1243 nmdc:mga0rr50_92618_c1 3300050513 Bacteria 2357
1244 nmdc:mga08x19_10014_c1 3300050514 Bacteria 5683
1245 nmdc:mga08x19_134531_c1 3300050514 Bacteria 1666
1246 nmdc:mga08x19_155607_c1 3300050514 Bacteria 1550
1247 nmdc:mga08x19_292481_c1 3300050514 Bacteria 1130
1248 nmdc:mga08x19_73680_c1 3300050514 Bacteria 2230
1249 nmdc:mga0a205_110699_c1 3300050515 Bacteria 2645
1250 nmdc:mga0a205_194290_c1 3300050515 Bacteria 1921
1251 nmdc:mga0a205_200302_c1 3300050515 Bacteria 1887
1252 nmdc:mga0a205_221381_c1 3300050515 Bacteria 1778
1253 nmdc:mga0a205_250853_c1 3300050515 Bacteria 1649
1254 nmdc:mga0a205_40892_c1 3300050515 Bacteria 4465
1255 nmdc:mga0a205_466781_c1 3300050515 Bacteria 1121
1256 nmdc:mga0a205_62979_c2 3300050515 Bacteria 2099
1257 nmdc:mga0a205_92715_c1 3300050515 Bacteria 2919
1258 Ga0495601_0021183 3300053077 Bacteria 3980
1259 Ga0495601_0111142 3300053077 Bacteria 1775
1260 Ga0495601_0302654 3300053077 Bacteria 1041
1261 Ga0495655_0000416 3300053083 Bacteria 7234
1262 Ga0495655_0166640 3300053083 Bacteria 703
1263 Ga0495595_0085759 3300053084 Unclassified 1506
1264 Ga0495619_0000665 3300053085 Bacteria 22534
1265 Ga0495619_0005071 3300053085 Bacteria 8364
1266 Ga0495619_0079557 3300053085 Bacteria 2205
1267 Ga0495619_0099881 3300053085 Bacteria 1974
1268 Ga0495619_0167740 3300053085 Bacteria 1518
1269 Ga0495619_0399608 3300053085 Bacteria 949
1270 Ga0500646_0027050 3300053090 Bacteria 1558
1271 Ga0500628_076579 3300053129 Bacteria 848
1272 Ga0500568_0010387 3300053139 Bacteria 4363
1273 Ga0501084_0075043 3300054114 Bacteria 2833
1274 Ga0501084_0089225 3300054114 Bacteria 2588
1275 Ga0501084_0182569 3300054114 Bacteria 1771
1276 Ga0501084_0257881 3300054114 Bacteria 1472
1277 Ga0501084_0275969 3300054114 Bacteria 1419
1278 Ga0501084_0361277 3300054114 Bacteria 1227
1279 Ga0501084_0448468 3300054114 Bacteria 1091
1280 Ga0501084_0518517 3300054114 Bacteria 1008
1281 Ga0501084_0864852 3300054114 Bacteria 761
1282 Ga0590071_000399 3300059421 Bacteria 12751
1283 Ga0590071_001760 3300059421 Bacteria 5594
1284 Ga0590071_020340 3300059421 Bacteria 1563
1285 Ga0590071_118805 3300059421 Bacteria 674
1286 Ga0590074_000629 3300059423 Bacteria 5314
1287 Ga0590074_004487 3300059423 Bacteria 2309
1288 Ga0590075_000116 3300059424 Bacteria 20677
1289 Ga0590075_009069 3300059424 Bacteria 2381
1290 Ga0590075_009855 3300059424 Bacteria 2294
1291 Ga0590077_000069 3300059426 Bacteria 25800
1292 Ga0590077_018252 3300059426 Bacteria 1480
1293 Ga0590077_034998 3300059426 Bacteria 1105
1294 Ga0501082_0083244 3300060353 Bacteria 2761
1295 Ga0501082_0116575 3300060353 Bacteria 2313
1296 Ga0501082_0126159 3300060353 Bacteria 2220
1297 Ga0501082_0181012 3300060353 Bacteria 1833
1298 Ga0501082_0193466 3300060353 Bacteria 1769
1299 Ga0501082_0620254 3300060353 Bacteria 946
1300 Ga0501082_0962379 3300060353 Bacteria 746
1301 Ga0530510_0007208 3300061734 Bacteria 7737
1302 Ga0530510_0090854 3300061734 Bacteria 2228
1303 Ga0530510_0105557 3300061734 Bacteria 2061
1304 Ga0530510_0688076 3300061734 Bacteria 779
1305 Ga0500641_0012348
1306 LJQas_1016145
1307 JGI24743J22301_10059014
1308 Ga0065712_10093353
1309 Ga0065712_10145869
1310 Ga0065712_10172999
1311 Ga0065712_10207622
1312 Ga0065715_10024404
1313 Ga0065715_10208870
1314 Ga0065715_10277538
1315 Ga0065715_10408964
1316 Ga0065715_10563385
1317 Ga0065707_10102589
1318 Ga0065707_10125759
1319 Ga0065707_10168558
1320 Ga0065707_10310702
1321 Ga0065707_10361758
1322 Ga0070658_10117399
1323 Ga0070658_10287742
1324 Ga0070658_10607495
1325 Ga0070658_10881550
1326 Ga0070676_10011985
1327 Ga0070676_10039428
1328 Ga0070683_100000214
1329 Ga0070683_100066257
1330 Ga0070683_100125452
1331 Ga0070683_100183911
1332 Ga0070683_100210993
1333 Ga0070690_100002920
1334 Ga0070690_100057024
1335 Ga0070690_100282161
1336 Ga0070670_100009351
1337 Ga0070670_100026024
1338 Ga0070670_100058688
1339 Ga0070670_100072819
1340 Ga0070670_101174209
1341 Ga0068869_100034060
1342 Ga0068869_100137796
1343 Ga0068869_100173313
1344 Ga0070666_10132747
1345 Ga0070666_10461034
1346 Ga0070680_100073176
1347 Ga0070680_100167305
1348 Ga0070680_100288976
1349 Ga0070680_100387767
1350 Ga0070682_100181672
1351 Ga0070682_100399624
1352 Ga0068868_100127194
1353 Ga0068868_100333540
1354 Ga0068868_100431499
1355 Ga0068868_100646827
1356 Ga0068868_100713319
1357 Ga0070660_100004679
1358 Ga0070689_100000003
1359 Ga0070689_100108572
1360 Ga0070689_100310569
1361 Ga0070689_100601929
1362 Ga0070689_100924714
1363 Ga0070691_10002242
1364 Ga0070691_10190717
1365 Ga0070691_10281076
1366 Ga0070687_100007355
1367 Ga0070687_100010885
1368 Ga0070687_100067866
1369 Ga0070687_100359653
1370 Ga0070692_10067636
1371 Ga0070692_10178594
1372 Ga0070668_100076502
1373 Ga0070668_100433087
1374 Ga0070668_101106406
1375 Ga0070669_100002325
1376 Ga0070669_100010935
1377 Ga0070669_100137324
1378 Ga0070669_100259171
1379 Ga0070669_100273669
1380 Ga0070669_100315825
1381 Ga0070675_100000496
1382 Ga0070675_100089228
1383 Ga0070675_100101819
1384 Ga0070675_100343233
1385 Ga0070675_100406876
1386 Ga0070675_100430612
1387 Ga0070675_100617562
1388 Ga0070675_100695173
1389 Ga0070671_100007284
1390 Ga0070671_100010668
1391 Ga0070671_100025978
1392 Ga0070671_100329158
1393 Ga0070671_100567717
1394 Ga0070671_100581682
1395 Ga0070674_100002893
1396 Ga0070674_100012993
1397 Ga0070674_100034657
1398 Ga0070674_100041786
1399 Ga0070674_100049355
1400 Ga0070674_100051566
1401 Ga0070674_100178574
1402 Ga0070674_100187635
1403 Ga0070674_100481384
1404 Ga0070673_100000582
1405 Ga0070673_100070690
1406 Ga0070673_100151069
1407 Ga0070673_100314611
1408 Ga0070673_100323243
1409 Ga0070673_100985300
1410 Ga0070688_100074129
1411 Ga0070688_100125023
1412 Ga0070688_100316784
1413 Ga0070688_100478276
1414 Ga0070688_100647672
1415 Ga0070659_100267448
1416 Ga0070667_100074506
1417 Ga0070667_100187983
1418 Ga0070667_100238862
1419 Ga0070703_10203850
1420 Ga0070709_10016794
1421 Ga0070709_10182888
1422 Ga0070714_100828073
1423 Ga0070713_100021116
1424 Ga0070713_100042802
1425 Ga0070713_100050344
1426 Ga0070713_100105264
1427 Ga0070713_100431225
1428 Ga0070701_10029762
1429 Ga0070701_10047647
1430 Ga0070701_10051354
1431 Ga0070701_10066267
1432 Ga0070711_100570014
1433 Ga0070705_100006858
1434 Ga0070705_100009299
1435 Ga0070705_100013151
1436 Ga0070705_100027005
1437 Ga0070705_100173152
1438 Ga0070705_100466025
1439 Ga0070700_100001354
1440 Ga0070700_100040008
1441 Ga0070700_100094589
1442 Ga0070700_100174655
1443 Ga0070700_100285383
1444 Ga0070700_100563292
1445 Ga0070694_100000869
1446 Ga0070694_100004661
1447 Ga0070694_100105377
1448 Ga0070694_100116676
1449 Ga0070694_100828786
1450 Ga0070708_100108394
1451 Ga0070708_100523825
1452 Ga0070708_100572317
1453 Ga0070663_100088822
1454 Ga0070663_100122891
1455 Ga0070678_100113327
1456 Ga0070678_100199596
1457 Ga0070678_100232531
1458 Ga0070678_100564350
1459 Ga0070678_100589574
1460 Ga0070678_101147457
1461 Ga0070662_100097137
1462 Ga0070662_100745748
1463 Ga0070681_10001417
1464 Ga0070681_10051010
1465 Ga0070681_10100981
1466 Ga0070681_10114660
1467 Ga0070681_10327387
1468 Ga0068867_100015602
1469 Ga0068867_100275039
1470 Ga0068867_100279043
1471 Ga0070706_100270403
1472 Ga0070706_100283144
1473 Ga0070706_100286586
1474 Ga0070706_100724667
1475 Ga0070707_100033298
1476 Ga0070707_100068866
1477 Ga0070707_100145707
1478 Ga0070707_100226648
1479 Ga0070707_100491284
1480 Ga0070707_101043674
1481 Ga0070698_100002146
1482 Ga0070698_100018933
1483 Ga0070698_100246824
1484 Ga0070698_100315138
1485 Ga0070698_100415688
1486 Ga0070698_100696405
1487 Ga0070698_100943443
1488 Ga0070699_100002056
1489 Ga0070699_100002059
1490 Ga0070699_100014233
1491 Ga0070699_100024910
1492 Ga0070699_100067180
1493 Ga0070699_100175372
1494 Ga0070699_100424840
1495 Ga0070679_100027590
1496 Ga0070679_100044862
1497 Ga0070679_100046595
1498 Ga0070679_100088544
1499 Ga0070679_100166627
1500 Ga0070679_100202865
1501 Ga0070679_100274651
1502 Ga0070679_100477184
1503 Ga0070684_100000085
1504 Ga0070684_100066615
1505 Ga0070684_100102808
1506 Ga0070684_100149783
1507 Ga0070684_100470012
1508 Ga0070684_100835128
1509 Ga0070697_100105431
1510 Ga0070697_100375276
1511 Ga0070697_100390728
1512 Ga0070697_100616884
1513 Ga0070697_100848555
1514 Ga0070697_101187556
1515 Ga0068853_100341656
1516 Ga0068853_100526767
1517 Ga0070672_100104004
1518 Ga0070672_100160273
1519 Ga0070672_100250025
1520 Ga0070672_100255300
1521 Ga0070672_100272037
1522 Ga0070672_100457976
1523 Ga0070686_100001752
1524 Ga0070686_100107462
1525 Ga0070686_100434140
1526 Ga0070686_100624921
1527 Ga0070695_100000366
1528 Ga0070695_100011373
1529 Ga0070695_100017832
1530 Ga0070695_100032183
1531 Ga0070695_100072734
1532 Ga0070695_100154207
1533 Ga0070695_100357308
1534 Ga0070695_100373435
1535 Ga0070695_100531771
1536 Ga0070696_100012267
1537 Ga0070696_100015130
1538 Ga0070696_100042496
1539 Ga0070696_100232395
1540 Ga0070693_100060767
1541 Ga0070665_100053364
1542 Ga0070665_100362806
1543 Ga0070665_100598391
1544 Ga0070665_100664587
1545 Ga0070704_100004578
1546 Ga0070704_100007489
1547 Ga0070704_100016140
1548 Ga0070704_100030468
1549 Ga0070704_100073190
1550 Ga0070704_100080612
1551 Ga0070704_100160301
1552 Ga0070704_100235195
1553 Ga0070704_100405454
1554 Ga0070704_100589007
1555 Ga0070704_100983892
1556 Ga0068855_100006981
1557 Ga0068855_100100317
1558 Ga0068855_100215776
1559 Ga0070664_100001505
1560 Ga0070664_100005787
1561 Ga0070664_100099866
1562 Ga0070664_100623673
1563 Ga0068854_100006488
1564 Ga0068854_100063858
1565 Ga0068854_100077546
1566 Ga0068854_100799729
1567 Ga0068856_100135181
1568 Ga0070702_100001630
1569 Ga0070702_100173818
1570 Ga0070702_100257014
1571 Ga0070702_100345397
1572 Ga0070702_100697068
1573 Ga0068852_100133711
1574 Ga0068852_100872755
1575 Ga0068852_101115197
1576 Ga0068859_100128619
1577 Ga0068859_100302622
1578 Ga0068859_100566660
1579 Ga0068859_100796925
1580 Ga0068859_101207454
1581 Ga0068859_101320285
1582 Ga0068864_100010958
1583 Ga0068864_100156874
1584 Ga0068864_100214886
1585 Ga0068864_100409450
1586 Ga0068864_100452696
1587 Ga0068866_10091092
1588 Ga0068866_10551393
1589 Ga0068861_100021221
1590 Ga0068861_100053380
1591 Ga0068861_100218040
1592 Ga0068861_100420095
1593 Ga0068861_100424394
1594 Ga0068861_100536288
1595 Ga0068870_10180352
1596 Ga0068863_100004361
1597 Ga0068863_100160298
1598 Ga0068863_100247858
1599 Ga0068863_100832986
1600 Ga0068858_100120573
1601 Ga0068858_100134023
1602 Ga0068858_100143056
1603 Ga0068858_100589676
1604 Ga0068860_100258645
1605 Ga0068860_100741025
1606 Ga0068860_101203053
1607 Ga0068862_100011467
1608 Ga0068862_100047767
1609 Ga0068862_100199029
1610 Ga0081539_10105508
1611 Ga0070717_10075101
1612 Ga0075365_10007714
1613 Ga0075368_10070276
1614 Ga0075368_10077322
1615 Ga0075363_100023452
1616 Ga0075364_10005697
1617 Ga0075364_10007143
1618 Ga0075364_10688346
1619 Ga0070715_10046415
1620 Ga0075362_10000285
1621 Ga0075367_10017091
1622 Ga0075367_10146345
1623 Ga0075367_10489200
1624 Ga0075366_10005792
1625 Ga0075366_10044549
1626 Ga0097621_100002994
1627 Ga0097621_100057572
1628 Ga0097621_100091146
1629 Ga0097621_100471158
1630 Ga0097621_100789932
1631 Ga0075370_10014580
1632 Ga0075370_10024065
1633 Ga0068871_100000122
1634 Ga0068871_100015919
1635 Ga0068871_100049413
1636 Ga0068871_100069807
1637 Ga0068871_100162883
1638 Ga0068871_100179529
1639 Ga0068871_100439295
1640 Ga0068871_100606862
1641 Ga0068871_100611278
1642 Ga0068871_100855084
1643 Ga0075428_100044419
1644 Ga0075428_100048821
1645 Ga0075428_100155689
1646 Ga0075428_100284253
1647 Ga0075428_101021790
1648 Ga0075430_100001106
1649 Ga0075430_100005530
1650 Ga0075430_100019001
1651 Ga0075431_100014341
1652 Ga0075431_100057234
1653 Ga0075431_100061713
1654 Ga0075431_100090938
1655 Ga0075431_100091402
1656 Ga0075431_100285386
1657 Ga0075431_100350197
1658 Ga0075431_100970436
1659 Ga0075433_10006695
1660 Ga0075433_10050792
1661 Ga0075433_10051614
1662 Ga0075433_10052079
1663 Ga0075433_10058208
1664 Ga0075433_10090364
1665 Ga0075433_10096326
1666 Ga0075433_10142172
1667 Ga0075433_10146890
1668 Ga0075433_10174726
1669 Ga0075433_10222416
1670 Ga0075433_10233206
1671 Ga0075433_10258847
1672 Ga0075433_10418434
1673 Ga0075434_100006471
1674 Ga0075434_100029146
1675 Ga0075434_100038875
1676 Ga0075434_100158528
1677 Ga0075434_100229907
1678 Ga0075434_100270417
1679 Ga0075434_100270950
1680 Ga0075434_100311982
1681 Ga0075434_100351567
1682 Ga0075434_100359066
1683 Ga0075434_100587963
1684 Ga0075429_100010325
1685 Ga0075429_100022102
1686 Ga0075429_100753629
1687 Ga0075429_100910085
1688 Ga0068865_100002576
1689 Ga0068865_100147360
1690 Ga0068865_100314476
1691 Ga0068865_100453006
1692 Ga0068865_100892032
1693 Ga0075436_100024164
1694 Ga0075436_100056854
1695 Ga0075436_100125851
1696 Ga0075436_100224562
1697 Ga0075436_100266922
1698 Ga0075436_100516584
1699 Ga0097620_100128613
1700 Ga0097620_100302624
1701 Ga0097620_100566663
1702 Ga0097620_100796974
1703 Ga0097620_101207210
1704 Ga0097620_101320424
1705 Ga0075435_100000436
1706 Ga0075435_100003662
1707 Ga0075435_100012910
1708 Ga0075435_100014905
1709 Ga0075435_100016846
1710 Ga0075435_100051069
1711 Ga0075435_100063832
1712 Ga0075435_100083652
1713 Ga0075435_100174867
1714 Ga0075435_100190660
1715 Ga0075435_100245681
1716 Ga0075435_100279632
1717 Ga0075435_100678569
1718 Ga0075435_100753553
1719 Ga0075435_100787380
1720 Ga0075435_101088374
1721 Ga0105250_10089903
1722 Ga0105240_10394810
1723 Ga0105240_10991496
1724 Ga0111539_10001278
1725 Ga0111539_10001538
1726 Ga0111539_10002608
1727 Ga0111539_10003691
1728 Ga0111539_10029839
1729 Ga0111539_10033012
1730 Ga0111539_10089985
1731 Ga0111539_10113521
1732 Ga0111539_10170192
1733 Ga0111539_10228217
1734 Ga0111539_10261477
1735 Ga0111539_10412964
1736 Ga0111539_10554238
1737 Ga0111539_10608913
1738 Ga0111539_10701148
1739 Ga0111539_11033232
1740 Ga0111539_11164274
1741 Ga0111539_11553881
1742 Ga0105245_10000225
1743 Ga0105245_10093750
1744 Ga0105245_10192382
1745 Ga0105245_10663086
1746 Ga0105247_10002063
1747 Ga0105247_10115213
1748 Ga0114129_10000321
1749 Ga0114129_10000632
1750 Ga0114129_10002823
1751 Ga0114129_10004917
1752 Ga0114129_10005465
1753 Ga0114129_10007113
1754 Ga0114129_10007213
1755 Ga0114129_10024433
1756 Ga0114129_10025016
1757 Ga0114129_10027021
1758 Ga0114129_10028163
1759 Ga0114129_10044574
1760 Ga0114129_10073122
1761 Ga0114129_10077771
1762 Ga0114129_10087902
1763 Ga0114129_10152124
1764 Ga0114129_10165269
1765 Ga0114129_10218636
1766 Ga0114129_10267946
1767 Ga0114129_10327740
1768 Ga0114129_10365486
1769 Ga0114129_10413732
1770 Ga0114129_10464944
1771 Ga0114129_10948288
1772 Ga0114129_10974916
1773 Ga0105243_10021824
1774 Ga0105243_10106553
1775 Ga0105243_10297300
1776 Ga0105243_10331955
1777 Ga0105241_10654334
1778 Ga0105242_10064739
1779 Ga0105242_10205167
1780 Ga0105242_10332824
1781 Ga0105242_10430589
1782 Ga0105248_10005909
1783 Ga0105248_10012693
1784 Ga0105248_10082611
1785 Ga0105248_10093851
1786 Ga0105248_10177565
1787 Ga0105248_10416803
1788 Ga0105248_10424537
1789 Ga0105248_10425795
1790 Ga0105248_10483466
1791 Ga0105248_10734843
1792 Ga0105248_10801348
1793 Ga0105248_10898577
1794 Ga0105248_11164630
1795 Ga0105248_11234970
1796 Ga0105249_10113100
1797 Ga0105249_10317853
1798 Ga0105249_10390359
1799 Ga0105249_10940874
1800 Ga0105239_10102380
1801 Ga0105246_10123842
1802 Ga0157374_10065263
1803 Ga0157378_10043866
1804 Ga0157378_10144237
1805 Ga0157378_10580939
1806 Ga0157378_11587245
1807 Ga0163162_10231079
1808 Ga0163162_10294026
1809 Ga0163162_10295368
1810 Ga0157375_10282178
1811 Ga0157375_10373059
1812 Ga0157375_10462509
1813 Ga0157375_10891436
1814 Ga0157375_11055128
1815 Ga0157375_11418533
1816 Ga0163163_10018932
1817 Ga0163163_10019727
1818 Ga0163163_10119322
1819 Ga0163163_10125267
1820 Ga0163163_10128894
1821 Ga0163163_10191702
1822 Ga0163163_10234447
1823 Ga0163163_10665381
1824 Ga0157380_10062317
1825 Ga0157380_10071192
1826 Ga0157380_10081924
1827 Ga0157380_10101066
1828 Ga0157380_10192720
1829 Ga0157380_10279565
1830 Ga0157380_10318681
1831 Ga0157380_10382163
1832 Ga0157380_10430444
1833 Ga0157380_10631328
1834 Ga0157380_10875238
1835 Ga0157380_10953090
1836 Ga0157377_10095126
1837 Ga0157379_10013078
1838 Ga0157379_10051800
1839 Ga0157379_10221754
1840 Ga0157379_10341408
1841 Ga0157379_10349041
1842 Ga0157379_10484172
1843 Ga0157376_10038520
1844 Ga0157376_10092620
1845 Ga0157376_10525698
1846 Ga0157376_10696710
1847 Ga0163161_10200820
1848 Ga0213876_10003164
1849 Ga0207682_10017655
1850 Ga0207642_10081584
1851 Ga0207642_10123412
1852 Ga0207642_10229181
1853 Ga0207710_10009464
1854 Ga0207710_10257521
1855 Ga0207688_10121761
1856 Ga0207688_10348005
1857 Ga0207680_10031786
1858 Ga0207680_10241671
1859 Ga0207680_10602721
1860 Ga0207647_10036643
1861 Ga0207699_10107827
1862 Ga0207699_10198582
1863 Ga0207645_10007009
1864 Ga0207645_10013629
1865 Ga0207645_10033237
1866 Ga0207645_10292096
1867 Ga0207645_10303441
1868 Ga0207684_10097824
1869 Ga0207684_10336569
1870 Ga0207684_10364328
1871 Ga0207654_10426602
1872 Ga0207707_10015384
1873 Ga0207707_10020605
1874 Ga0207707_10122981
1875 Ga0207707_10169789
1876 Ga0207707_10386784
1877 Ga0207707_10666891
1878 Ga0207695_10195243
1879 Ga0207693_10333338
1880 Ga0207693_10389854
1881 Ga0207663_10048204
1882 Ga0207660_10143890
1883 Ga0207660_10211180
1884 Ga0207662_10015205
1885 Ga0207662_10041195
1886 Ga0207662_10129643
1887 Ga0207662_10169520
1888 Ga0207662_10692042
1889 Ga0207657_10011789
1890 Ga0207657_10368169
1891 Ga0207649_10246664
1892 Ga0207652_10006944
1893 Ga0207652_10036961
1894 Ga0207652_10052747
1895 Ga0207652_10146912
1896 Ga0207652_10203250
1897 Ga0207652_10415992
1898 Ga0207652_10484717
1899 Ga0207652_10696896
1900 Ga0207646_10047536
1901 Ga0207646_10614396
1902 Ga0207681_10010366
1903 Ga0207681_10010678
1904 Ga0207681_10038422
1905 Ga0207681_10243719
1906 Ga0207681_10267045
1907 Ga0207681_10655393
1908 Ga0207694_10577865
1909 Ga0207650_10000805
1910 Ga0207650_10023660
1911 Ga0207650_10036209
1912 Ga0207650_10840857
1913 Ga0207659_10000167
1914 Ga0207659_10014392
1915 Ga0207659_10078092
1916 Ga0207659_10108617
1917 Ga0207659_10219821
1918 Ga0207659_10289734
1919 Ga0207659_10556895
1920 Ga0207659_10589562
1921 Ga0207659_10795036
1922 Ga0207687_10001207
1923 Ga0207687_10074289
1924 Ga0207687_10184586
1925 Ga0207687_10337033
1926 Ga0207700_10085289
1927 Ga0207700_10092145
1928 Ga0207700_10187250
1929 Ga0207700_10427135
1930 Ga0207700_10855539
1931 Ga0207644_10005413
1932 Ga0207644_10098397
1933 Ga0207644_10248226
1934 Ga0207644_10457959
1935 Ga0207706_10063762
1936 Ga0207706_10205041
1937 Ga0207706_10447829
1938 Ga0207686_10008198
1939 Ga0207686_10135303
1940 Ga0207686_10338578
1941 Ga0207709_10041464
1942 Ga0207709_10468928
1943 Ga0207670_10000015
1944 Ga0207670_10107695
1945 Ga0207670_10383600
1946 Ga0207670_10841161
1947 Ga0207669_10022496
1948 Ga0207669_10069542
1949 Ga0207669_10188263
1950 Ga0207704_10205913
1951 Ga0207704_10502334
1952 Ga0207691_10013615
1953 Ga0207691_10099285
1954 Ga0207691_10115305
1955 Ga0207691_10160294
1956 Ga0207691_10259341
1957 Ga0207691_10295218
1958 Ga0207691_10316969
1959 Ga0207691_10435930
1960 Ga0207711_10008539
1961 Ga0207711_10014300
1962 Ga0207711_10126003
1963 Ga0207711_10221801
1964 Ga0207711_10289348
1965 Ga0207711_10396661
1966 Ga0207711_10501701
1967 Ga0207711_10880083
1968 Ga0207689_10073965
1969 Ga0207689_10098110
1970 Ga0207689_10200294
1971 Ga0207689_10241283
1972 Ga0207689_10546072
1973 Ga0207661_10000923
1974 Ga0207661_10045146
1975 Ga0207661_10148669
1976 Ga0207679_10001230
1977 Ga0207679_10235769
1978 Ga0207679_10518576
1979 Ga0207679_10539889
1980 Ga0207679_10581964
1981 Ga0207667_10133369
1982 Ga0207651_10022628
1983 Ga0207651_10117209
1984 Ga0207651_10155102
1985 Ga0207651_10216024
1986 Ga0207651_10318185
1987 Ga0207651_10436724
1988 Ga0207651_10467216
1989 Ga0207651_10529010
1990 Ga0207712_10077639
1991 Ga0207712_10113385
1992 Ga0207712_10395353
1993 Ga0207712_11193075
1994 Ga0207668_10035334
1995 Ga0207668_10350734
1996 Ga0207668_10691601
1997 Ga0207640_10029494
1998 Ga0207640_10041720
1999 Ga0207658_10091748
2000 Ga0207658_10179578
2001 Ga0207658_10493495
2002 Ga0207677_10169449
2003 Ga0207703_10023595
2004 Ga0207703_10056737
2005 Ga0207703_10270206
2006 Ga0207703_10549069
2007 Ga0207703_10689315
2008 Ga0207639_10644292
2009 Ga0207639_10790687
2010 Ga0207639_11258050
2011 Ga0207678_10087135
2012 Ga0207678_10114873
2013 Ga0207708_10007428
2014 Ga0207708_10013381
2015 Ga0207708_10018940
2016 Ga0207708_10024327
2017 Ga0207708_10065707
2018 Ga0207708_10112063
2019 Ga0207708_10158927
2020 Ga0207708_10189998
2021 Ga0207708_10208871
2022 Ga0207708_10599781
2023 Ga0207708_10830162
2024 Ga0207702_10085324
2025 Ga0207702_10167508
2026 Ga0207702_10777606
2027 Ga0207641_10003071
2028 Ga0207641_10229120
2029 Ga0207641_10720795
2030 Ga0207648_10018303
2031 Ga0207648_10029472
2032 Ga0207648_10078540
2033 Ga0207648_10099978
2034 Ga0207648_10468939
2035 Ga0207676_10042570
2036 Ga0207676_10206848
2037 Ga0207676_10304757
2038 Ga0207675_100003256
2039 Ga0207675_100064531
2040 Ga0207675_100070261
2041 Ga0207675_100084401
2042 Ga0207675_100084920
2043 Ga0207675_100170182
2044 Ga0207675_100190676
2045 Ga0207675_100441573
2046 Ga0207683_10036957
2047 Ga0207683_10140461
2048 Ga0207683_10548579
2049 Ga0207683_10632521
2050 Ga0207698_10295462
2051 Ga0207698_10495348
2052 Ga0207698_10808889
2053 Ga0207698_11277536
2054 Ga0207428_10001696
2055 Ga0207428_10005045
2056 Ga0207428_10007759
2057 Ga0207428_10008023
2058 Ga0207428_10060333
2059 Ga0207428_10076486
2060 Ga0268266_10272483
2061 Ga0268266_10572410
2062 Ga0268265_10108453
2063 Ga0268265_10203723
2064 Ga0268265_10260762
2065 Ga0268265_10434821
2066 Ga0268264_10038958
2067 Ga0268264_10132157
2068 Ga0268264_10185373
2069 Ga0265318_10022316
2070 Ga0265336_10076994
2071 Ga0265332_10276996
2072 Ga0265316_10467880
2073 Ga0307408_100014846
2074 Ga0307408_100322936
2075 Ga0307408_100607019
2076 Ga0307408_101211812
2077 Ga0265314_10058113
2078 Ga0265314_10291724
2079 Ga0316576_10237184
2080 Ga0307405_10268156
2081 Ga0307405_10380276
2082 Ga0307413_10200052
2083 Ga0307410_10243123
2084 Ga0307406_10118720
2085 Ga0307406_10129400
2086 Ga0307406_10681177
2087 Ga0307407_10528714
2088 Ga0307412_10024228
2089 Ga0307412_10226251
2090 Ga0307412_10438349
2091 Ga0307412_10558324
2092 Ga0307409_100263166
2093 Ga0307409_100417713
2094 Ga0307409_100911771
2095 Ga0307409_101452583
2096 Ga0307416_100016739
2097 Ga0307416_100061958
2098 Ga0307416_100098230
2099 Ga0307416_100111776
2100 Ga0307416_100386393
2101 Ga0307416_100600508
2102 Ga0307416_100654321
2103 Ga0307416_101405133
2104 Ga0307416_101931152
2105 Ga0307414_10201321
2106 Ga0307411_10118055
2107 Ga0307411_10207060
2108 Ga0307411_10966096
2109 Ga0307415_100044964
2110 Ga0307415_100098943
2111 Ga0307415_100424029
2112 Ga0373948_0000627
2113 Ga0373950_0000692
2114 Ga0373959_0000568
2115 Ga0373938_0002621
2116 Ga0373928_0003110
2117 Ga0373928_0122250
2118 Ga0373929_0000691
2119 Ga0373949_0003668
2120 Ga0373951_0001601
2121 Ga0373951_0077508
2122 Ga0373923_0012797
2123 Ga0373932_0000337
2124 Ga0373932_0066230
2125 Ga0373936_0039253
2126 Ga0373936_0061684
2127 Ga0373939_0035652
2128 Ga0373939_0183176
2129 Ga0373941_0003248
2130 Ga0373941_0008215
2131 Ga0373941_0016589
2132 Ga0373941_0075863
2133 Ga0373941_0136807
2134 Ga0373945_0008026
2135 Ga0373954_0183532
2136 Ga0373956_0186997
2137 Ga0373960_0003490
2138 Ga0373943_0053757
2139 Ga0373943_0248122
2140 Ga0373946_0051439
2141 Ga0373946_0062881
2142 Ga0373946_0150092
2143 Ga0373955_0025317
2144 Ga0373955_0093914
2145 Ga0373955_0095465
2146 Ga0373955_0106235
2147 Ga0373955_0475938
2148 Ga0373942_0001277
2149 Ga0373961_0000257
2150 Ga0373962_0001671
2151 Ga0373962_0041882
2152 Ga0373924_0007565
2153 Ga0373924_0108947
2154 Ga0373924_0168333
2155 Ga0373935_0233128
2156 Ga0373935_0239596
2157 Ga0373935_0448182
2158 Ga0373927_0535812
2159 Ga0373933_0002856
2160 Ga0373947_0059290
2161 Ga0373947_0079282
2162 Ga0373947_0100910
2163 Ga0373947_0497116
2164 Ga0373937_0128231
2165 Ga0373937_0179397
2166 Ga0373937_0666150
2167 Ga0373937_0729851
2168 Ga0373925_0001894
2169 Ga0373925_0132498
2170 Ga0373925_0187138
2171 Ga0373925_0553075
2172 Ga0395905_0725402
2173 Ga0436365_1665382
2174 Ga0439436_0104755
2175 Ga0439453_0034893
2176 Ga0439453_0071816
2177 Ga0451807_1120969
2178 Ga0451849_0842788
2179 Ga0439431_0050198
2180 Ga0439433_0013092
2181 Ga0439441_056010
2182 Ga0439445_0122217
2183 Ga0439449_0099049
2184 Ga0439450_007214
2185 Ga0439455_0063841
2186 Ga0439457_087211
2187 Ga0439462_0039905
2188 Ga0439462_0061977
2189 Ga0450920_076029
2190 Ga0450923_029177
2191 Ga0450910_062204
2192 Ga0439446_0086724
2193 Ga0439446_0121497
2194 Ga0439444_0023278
2195 Ga0439444_0097221
2196 Ga0439464_0030177
2197 Ga0439464_0039826
2198 Ga0439460_0053808
2199 Ga0451577_0048768
2200 Ga0451577_0067951
2201 Ga0451577_0584181
2202 Ga0451577_0639062
2203 Ga0439440_0045026
2204 Ga0453684_0001378
2205 Ga0453684_0285704
2206 Ga0453684_0908046
2207 Ga0451576_0006781
2208 Ga0451576_0016168
2209 Ga0451576_0137896
2210 Ga0466967_0246017
2211 Ga0495592_0049786
2212 Ga0495603_0368579
2213 Ga0495629_0010962
2214 Ga0495629_0136569
2215 Ga0495629_0714461
2216 Ga0495641_0148096
2217 Ga0495651_0097822
2218 Ga0495653_0157086
2219 Ga0495582_0173798
2220 Ga0495639_0017554
2221 Ga0495639_0083651
2222 Ga0495639_0153942
2223 Ga0495664_0282923
2224 Ga0495584_0030843
2225 Ga0495594_0020448
2226 Ga0495594_0267997
2227 Ga0495594_0269610
2228 Ga0495594_0405167
2229 Ga0495608_0002435
2230 Ga0495628_0053805
2231 Ga0495630_0086168
2232 Ga0495643_0318422
2233 Ga0495644_0028928
2234 Ga0495642_0015666
2235 Ga0495642_0297578
2236 Ga0495640_0148409
2237 Ga0495586_0172864
2238 Ga0495621_0089677
2239 Ga0495645_0010954
2240 Ga0495633_0190554
2241 Ga0495656_0432054
2242 Ga0495634_0056724
2243 Ga0495634_0109003
2244 Ga0495635_0106129
2245 Ga0495635_0124975
2246 Ga0495659_0007644
2247 Ga0495659_0037184
2248 Ga0495659_0211397
2249 Ga0495588_0167603
2250 Ga0495657_0184155
2251 Ga0495599_0046584
2252 Ga0495599_0450643
2253 Ga0495623_0033066
2254 Ga0495647_0016657
2255 Ga0495647_0017992
2256 Ga0495647_0114991
2257 Ga0495658_0025361
2258 Ga0495658_0088934
2259 Ga0495658_0141952
2260 Ga0495669_0000921
2261 Ga0495669_0026638
2262 Ga0495669_0152781
2263 Ga0495613_0009742
2264 Ga0495613_0162948
2265 Ga0495613_0184006
2266 Ga0495613_0245560
2267 Ga0495613_0280486
2268 Ga0495624_0379110
2269 Ga0495600_0155315
2270 Ga0495600_0161460
2271 Ga0495581_0269124
2272 Ga0495604_0009018
2273 Ga0495604_0201850
2274 Ga0495604_0235011
2275 Ga0495636_0043154
2276 Ga0495674_0032216
2277 Ga0495674_0054713
2278 Ga0495672_0078283
2279 Ga0495676_0100823
2280 Ga0495685_008330
2281 Ga0495684_0000430
2282 Ga0495684_0100867
2283 Ga0495684_0391624
2284 Ga0495593_0187302
2285 Ga0495602_0240875
2286 Ga0495602_0457953
2287 Ga0495614_0280914
2288 Ga0495614_0297893
2289 Ga0496101_0239790
2290 Ga0496101_0379865
2291 Ga0496102_0104961
2292 Ga0496103_0526175
2293 Ga0496104_0003309
2294 Ga0496104_0012689
2295 Ga0496104_0037014
2296 Ga0496104_0039902
2297 Ga0496104_0256620
2298 Ga0496104_0357194
2299 Ga0496104_0524245
2300 Ga0496105_0031465
2301 Ga0496105_0049881
2302 Ga0496105_0204841
2303 Ga0496106_0095497
2304 Ga0496106_0188178
2305 Ga0496107_0395242
2306 Ga0496108_0000873
2307 Ga0496108_0004636
2308 Ga0496108_0190794
2309 Ga0496108_0507617
2310 Ga0496109_0000242
2311 Ga0496109_0097296
2312 Ga0496109_0710356
2313 Ga0496110_0033130
2314 Ga0496110_0042510
2315 Ga0496110_0461037
2316 Ga0496111_0020346
2317 Ga0496112_0001215
2318 Ga0496112_0011182
2319 Ga0496112_0789643
2320 Ga0496112_0845616
2321 Ga0496113_0016935
2322 Ga0496113_0379902
2323 Ga0496114_0002932
2324 Ga0496114_0089386
2325 Ga0496114_0137215
2326 Ga0496114_0266205
2327 Ga0496114_0318869
2328 Ga0496114_0807218
2329 Ga0496115_0020602
2330 Ga0496115_0060412
2331 Ga0496115_0322505
2332 Ga0501296_006211
2333 Ga0501031_0122025
2334 Ga0501033_0106379
2335 Ga0501034_0036123
2336 Ga0501034_0243086
2337 Ga0501034_0772362
2338 Ga0501036_0097936
2339 Ga0501036_0172327
2340 Ga0501036_0198223
2341 Ga0501036_0400935
2342 Ga0501038_0079552
2343 Ga0501038_0486575
2344 Ga0501039_0061360
2345 Ga0501039_0343774
2346 Ga0501039_0358919
2347 Ga0501039_0361400
2348 Ga0501040_0033198
2349 Ga0501040_0077082
2350 Ga0501040_0157515
2351 Ga0501040_0477933
2352 Ga0501041_0010809
2353 Ga0501041_0014742
2354 Ga0501041_0271819
2355 Ga0501041_0429277
2356 Ga0501042_0006649
2357 Ga0501042_0014046
2358 Ga0501042_0064420
2359 Ga0501042_0160145
2360 Ga0501042_0303731
2361 Ga0501042_0395259
2362 Ga0501042_0639397
2363 Ga0501043_0098189
2364 Ga0501043_0552052
2365 Ga0501043_0722105
2366 Ga0501046_0027433
2367 Ga0501046_0079789
2368 Ga0501046_0490289
2369 Ga0501047_0062761
2370 Ga0501047_0259946
2371 Ga0501048_0057255
2372 Ga0501048_0174387
2373 Ga0501048_0180113
2374 Ga0501048_0504464
2375 Ga0501067_0262076
2376 Ga0501067_0274980
2377 Ga0501068_0268586
2378 Ga0501068_0724580
2379 Ga0501070_0330100
2380 Ga0501070_0419517
2381 Ga0501071_0007928
2382 Ga0501071_0013636
2383 Ga0501071_0017357
2384 Ga0501071_0180994
2385 Ga0501071_0573393
2386 Ga0501072_0008843
2387 Ga0501072_0035279
2388 Ga0501072_0103719
2389 Ga0501072_0299403
2390 Ga0501072_0354803
2391 Ga0501073_0001379
2392 Ga0501073_0269925
2393 Ga0501073_0305948
2394 Ga0501073_0309445
2395 Ga0501074_0067557
2396 Ga0501074_0144216
2397 Ga0501074_0399439
2398 Ga0501075_0015890
2399 Ga0501075_0044114
2400 Ga0501075_0057511
2401 Ga0501075_0061903
2402 Ga0501075_0071698
2403 Ga0501075_0107920
2404 Ga0501075_0109468
2405 Ga0501075_0134001
2406 Ga0501075_0350278
2407 Ga0501075_0369951
2408 Ga0501075_0621693
2409 Ga0501076_0025970
2410 Ga0501076_0028662
2411 Ga0501076_0036548
2412 Ga0501076_0072209
2413 Ga0501076_0089605
2414 Ga0501076_0108788
2415 Ga0501076_0122748
2416 Ga0501077_0053835
2417 Ga0501077_0295511
2418 Ga0501077_0296915
2419 Ga0501207_010382
2420 Ga0501217_018099
2421 Ga0501235_122669
2422 Ga0501079_0014531
2423 Ga0501079_0017267
2424 Ga0501079_0026197
2425 Ga0501079_0033403
2426 Ga0501079_0056354
2427 Ga0501079_0068329
2428 Ga0501079_0097212
2429 Ga0501079_0164614
2430 Ga0501079_0333296
2431 Ga0501080_0049040
2432 Ga0501080_0243746
2433 Ga0501080_0319075
2434 Ga0501080_0338495
2435 Ga0501080_1323097
2436 Ga0501081_0029465
2437 Ga0501081_0047394
2438 Ga0501081_0098296
2439 Ga0501081_0161482
2440 Ga0501081_0163296
2441 Ga0501081_0220944
2442 Ga0501081_0292324
2443 Ga0501083_0126282
2444 Ga0501083_0365560
2445 Ga0501083_0536529
2446 Ga0501035_0747448
2447 Ga0501044_0002963
2448 Ga0501044_0813227
2449 Ga0501044_1018841
2450 Ga0501045_0004516
2451 Ga0501045_0023675
2452 Ga0501045_0042885
2453 Ga0501045_0046934
2454 Ga0501045_0246726
2455 Ga0501045_0291991
2456 Ga0501045_0339753
2457 Ga0501045_0477562
2458 Ga0501045_0508651
2459 Ga0501045_0958675
2460 nmdc:mga03683_57062_c1
2461 nmdc:mga00v17_127323_c1
2462 nmdc:mga00v17_25363_c1
2463 nmdc:mga0yw44_56872_c1
2464 nmdc:mga0yw44_71484_c1
2465 nmdc:mga0k408_116303_c1
2466 nmdc:mga0k408_24975_c1
2467 nmdc:mga0k408_3174_c1
2468 nmdc:mga0k408_4650_c1
2469 nmdc:mga06z11_11688_c1
2470 nmdc:mga06z11_168943_c1
2471 nmdc:mga06z11_2119_c1
2472 nmdc:mga06z11_264024_c1
2473 nmdc:mga06z11_60038_c1
2474 nmdc:mga06z11_94178_c1
2475 nmdc:mga04h51_7074_c1
2476 nmdc:mga07m45_43174_c1
2477 nmdc:mga05p37_11444_c1
2478 nmdc:mga05p37_12625_c1
2479 nmdc:mga05p37_13779_c1
2480 nmdc:mga05p37_196723_c1
2481 nmdc:mga05p37_24548_c1
2482 nmdc:mga05p37_30727_c1
2483 nmdc:mga05p37_30801_c1
2484 nmdc:mga05p37_33929_c1
2485 nmdc:mga05p37_367944_c1
2486 nmdc:mga05p37_38359_c1
2487 nmdc:mga05p37_4043_c1
2488 nmdc:mga05p37_455611_c1
2489 nmdc:mga05p37_530041_c1
2490 nmdc:mga05p37_546925_c1
2491 nmdc:mga05p37_5767_c1
2492 nmdc:mga05p37_62607_c1
2493 nmdc:mga05p37_631118_c1
2494 nmdc:mga05p37_671321_c1
2495 nmdc:mga05p37_693257_c1
2496 nmdc:mga05p37_7376_c1
2497 nmdc:mga05p37_80513_c1
2498 nmdc:mga05p37_839_c1
2499 nmdc:mga05p37_899015_c1
2500 nmdc:mga05p37_928385_c1
2501 nmdc:mga09592_187629_c1
2502 nmdc:mga09592_2044_c1
2503 nmdc:mga09592_48337_c1
2504 nmdc:mga09592_68228_c1
2505 nmdc:mga09592_939245_c1
2506 nmdc:mga0qj67_217255_c1
2507 nmdc:mga06r32_14245_c1
2508 nmdc:mga06r32_18049_c1
2509 nmdc:mga06r32_18958_c1
2510 nmdc:mga06r32_208462_c1
2511 nmdc:mga06r32_51806_c1
2512 nmdc:mga08y16_11226_c1
2513 nmdc:mga08y16_1288120_c1
2514 nmdc:mga08y16_166794_c1
2515 nmdc:mga08y16_25834_c1
2516 nmdc:mga08y16_2829_c1
2517 nmdc:mga08y16_326152_c1
2518 nmdc:mga08y16_4725_c1
2519 nmdc:mga08y16_47482_c1
2520 nmdc:mga08y16_506111_c1
2521 nmdc:mga08y16_513825_c1
2522 nmdc:mga08y16_5349_c1
2523 nmdc:mga08y16_543300_c1
2524 nmdc:mga08y16_58722_c1
2525 nmdc:mga08y16_6903_c1
2526 nmdc:mga08y16_97061_c1
2527 nmdc:mga0n895_12571_c1
2528 nmdc:mga0n895_184495_c1
2529 nmdc:mga0n895_18763_c1
2530 nmdc:mga0n895_267590_c1
2531 nmdc:mga0n895_30416_c1
2532 nmdc:mga0n895_318047_c1
2533 nmdc:mga0n895_453011_c1
2534 nmdc:mga0n895_46025_c1
2535 nmdc:mga0n895_46783_c1
2536 nmdc:mga0n895_6739_c1
2537 nmdc:mga0n895_774796_c1
2538 nmdc:mga0rr50_10246_c1
2539 nmdc:mga0rr50_32594_c1
2540 nmdc:mga0rr50_355074_c1
2541 nmdc:mga0rr50_485749_c1
2542 nmdc:mga0rr50_552334_c1
2543 nmdc:mga0rr50_644356_c1
2544 nmdc:mga0rr50_647_c1
2545 nmdc:mga0rr50_720318_c1
2546 nmdc:mga0rr50_91846_c1
2547 nmdc:mga0rr50_92618_c1
2548 nmdc:mga08x19_10014_c1
2549 nmdc:mga08x19_134531_c1
2550 nmdc:mga08x19_155607_c1
2551 nmdc:mga08x19_292481_c1
2552 nmdc:mga08x19_73680_c1
2553 nmdc:mga0a205_110699_c1
2554 nmdc:mga0a205_194290_c1
2555 nmdc:mga0a205_200302_c1
2556 nmdc:mga0a205_221381_c1
2557 nmdc:mga0a205_250853_c1
2558 nmdc:mga0a205_40892_c1
2559 nmdc:mga0a205_466781_c1
2560 nmdc:mga0a205_62979_c2
2561 nmdc:mga0a205_92715_c1
2562 Ga0495601_0021183
2563 Ga0495601_0111142
2564 Ga0495601_0302654
2565 Ga0495655_0000416
2566 Ga0495655_0166640
2567 Ga0495595_0085759
2568 Ga0495619_0000665
2569 Ga0495619_0005071
2570 Ga0495619_0079557
2571 Ga0495619_0099881
2572 Ga0495619_0167740
2573 Ga0495619_0399608
2574 Ga0500646_0027050
2575 Ga0500628_076579
2576 Ga0500568_0010387
2577 Ga0501084_0075043
2578 Ga0501084_0089225
2579 Ga0501084_0182569
2580 Ga0501084_0257881
2581 Ga0501084_0275969
2582 Ga0501084_0361277
2583 Ga0501084_0448468
2584 Ga0501084_0518517
2585 Ga0501084_0864852
2586 Ga0590071_000399
2587 Ga0590071_001760
2588 Ga0590071_020340
2589 Ga0590071_118805
2590 Ga0590074_000629
2591 Ga0590074_004487
2592 Ga0590075_000116
2593 Ga0590075_009069
2594 Ga0590075_009855
2595 Ga0590077_000069
2596 Ga0590077_018252
2597 Ga0590077_034998
2598 Ga0501082_0083244
2599 Ga0501082_0116575
2600 Ga0501082_0126159
2601 Ga0501082_0181012
2602 Ga0501082_0193466
2603 Ga0501082_0620254
2604 Ga0501082_0962379
2605 Ga0530510_0007208
2606 Ga0530510_0090854
2607 Ga0530510_0105557
2608 Ga0530510_0688076

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

120

204

0.99

PF00677

Lum_binding

Lumazine binding domain

3

107

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4g6i-assembly1.cif.gz_B crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with roseoflavin 0.974 1 192
1i8d-assembly1.cif.gz_A crystal structure of riboflavin synthase 0.9731 1 191
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9702 1 85
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.9675 1 191
4gqn-assembly1.cif.gz_C crystallographic structure of trimeric riboflavin synthase from brucella abortus in complex with 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione 0.9595 1 191
ID Description Score Start End Superfamily
af_P9WK35_102_200_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9795 100 191 2.40.30.20
af_B7FAH8_195_301_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9765 100 193 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9755 1 86 2.40.30.20
af_A0A1D8PP67_110_218_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9725 100 193 2.40.30.20
af_Q2FXG0_101_204_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9685 100 195 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A1Q7HAC6-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9934 9 176 GO:0004746
GO:0009231
AF-A0A532U345-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9898 1 194 GO:0004746
GO:0009231
AF-A0A1F3SIY4-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9895 1 190 GO:0004746
GO:0009231
AF-A0A1F2VDV5-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9885 1 195 GO:0004746
GO:0009231
AF-A0A0P1MYS4-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9885 1 191 GO:0004746
GO:0009231

Map