F492736

General Info

Members Datasets Scaffolds Average Seq Length
1300 848 830 153

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100260722|Ga0070669_1002607223
Length 176
Sequence MSLSAIDFASDCNEAATALISHMTKTDVSNLTQLGHATALPANPDEAVLERVPNSQGKTIYLVRFVAPEFTSLCPMTGQPDFAHLVIDYVPGRWLVESKSLKLYLGSFRNHGSFHEDCTVGIGKRLVKELKPVWLRIGGYWYPRGGIPIDVFWQTAAPPKGLWLPDQGVPPYRGRG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
19 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
20 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
21 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
22 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
23 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
24 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
25 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
26 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
27 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
28 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
29 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
30 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
31 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
32 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
33 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
34 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
35 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
36 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
37 2516143018 Ensifer sp. BR816 Isolate Nodule
38 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
39 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
40 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
41 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
42 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
43 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
44 2519899620 Rhizobium sp. Pop5 Isolate Nodule
45 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
46 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
47 2534681786 Brucella suis 92/29 Isolate Unclassified
48 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
49 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
50 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
51 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
52 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
53 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
54 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
55 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
56 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
57 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
58 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
59 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
60 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
61 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
62 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
63 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
64 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
65 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
66 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
67 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
68 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
69 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
70 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
71 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
72 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
73 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
74 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
75 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
76 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
77 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
78 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
79 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
80 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
81 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
82 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
83 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
84 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
85 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
86 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
87 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
88 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
89 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
90 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
91 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
92 2643221557 Ensifer sp. Root558 Isolate Unclassified
93 2643221558 Rhizobium sp. Root149 Isolate Unclassified
94 2643221568 Rhizobium sp. Root564 Isolate Unclassified
95 2643221582 Rhizobium sp. Root651 Isolate Unclassified
96 2643221591 Devosia sp. Root685 Isolate Unclassified
97 2643221599 Rhizobium sp. Root708 Isolate Unclassified
98 2643221607 Rhizobium sp. Root73 Isolate Unclassified
99 2643221610 Ensifer sp. Root74 Isolate Unclassified
100 2643221618 Ensifer sp. Root231 Isolate Unclassified
101 2643221626 Ensifer sp. Root31 Isolate Unclassified
102 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
103 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
104 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
105 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
106 2643221651 Afipia sp. Root123D2 Isolate Unclassified
107 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
108 2643221655 Ensifer sp. Root1252 Isolate Unclassified
109 2643221659 Ensifer sp. Root127 Isolate Unclassified
110 2643221668 Ensifer sp. Root423 Isolate Unclassified
111 2643221675 Ensifer sp. Root1298 Isolate Unclassified
112 2643221680 Ensifer sp. Root1312 Isolate Unclassified
113 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
114 2643221688 Rhizobium sp. Root482 Isolate Unclassified
115 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
116 2643221693 Rhizobium sp. Root491 Isolate Unclassified
117 2643221698 Ensifer sp. Root142 Isolate Unclassified
118 2643221712 Ensifer sp. Root258 Isolate Unclassified
119 2643221718 Rhizobium sp. Root268 Isolate Unclassified
120 2643221719 Rhizobium sp. Root274 Isolate Unclassified
121 2643221723 Ensifer sp. Root278 Isolate Unclassified
122 2643221726 Ensifer sp. Root954 Isolate Unclassified
123 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
124 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
125 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
126 2718217882 Rhizobium sp. N741 Isolate Nodule
127 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
128 2718218009 Rhizobium sp. N561 Isolate Nodule
129 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
130 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
131 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
132 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
133 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
134 2718218363 Rhizobium sp. N113 Isolate Nodule
135 2718218365 Rhizobium sp. N731 Isolate Nodule
136 2718218366 Rhizobium sp. N621 Isolate Nodule
137 2721755514 Rhizobium sp. N6212 Isolate Nodule
138 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
139 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
140 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
141 2721755810 Rhizobium sp. N871 Isolate Nodule
142 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
143 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
144 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
145 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
146 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
147 2728369365 Rhizobium sp. N1341 Isolate Nodule
148 2728369397 Rhizobium sp. N1314 Isolate Nodule
149 2738541293 Rhizobium sp. GV031 Isolate Unclassified
150 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
151 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
152 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
153 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
154 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
155 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
156 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
157 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
158 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
159 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
160 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
161 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
162 2791355256 Rhizobium sp. M10 Isolate Nodule
163 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
164 2791355260 Rhizobium sp. L9 Isolate Nodule
165 2791355261 Rhizobium sp. J15 Isolate Nodule
166 2791355262 Rhizobium sp. M1 Isolate Nodule
167 2791355263 Rhizobium chutanense C5 Isolate Nodule
168 2791355264 Rhizobium sp. S9 Isolate Nodule
169 2791355265 Rhizobium sp. H4 Isolate Nodule
170 2791355266 Rhizobium sp. L43 Isolate Nodule
171 2791355267 Rhizobium sp. L18 Isolate Nodule
172 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
173 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
174 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
175 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
176 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
177 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
178 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
179 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
180 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
181 2802429633 Rhizobium anhuiense J3 Isolate Nodule
182 2802429634 Rhizobium anhuiense S10 Isolate Nodule
183 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
184 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
185 2802429637 Rhizobium anhuiense C15 Isolate Nodule
186 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
187 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
188 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
189 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
190 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
191 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
192 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
193 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
194 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
195 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
196 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
197 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
198 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
199 2838048938 Rhizobium pisi 27/80 Isolate Nodule
200 2838061910 Rhizobium phaseoli L15 Isolate Nodule
201 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
202 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
203 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
204 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
205 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
206 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
207 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
208 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
209 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
210 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
211 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
212 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
213 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
214 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
215 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
216 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
217 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
218 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
219 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
220 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
221 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
222 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
223 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
224 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
225 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
226 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
227 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
228 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
229 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
230 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
231 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
232 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
233 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
234 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
235 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
236 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
237 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
238 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
239 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
240 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
241 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
242 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
243 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
244 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
245 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
246 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
247 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
248 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
249 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
250 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
251 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
252 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
253 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
254 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
255 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
256 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
257 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
258 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
259 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
260 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
261 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
262 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
263 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
264 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
265 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
266 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
267 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
268 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
269 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
270 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
271 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
272 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
273 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
274 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
275 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
276 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
277 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
278 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
279 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
280 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
281 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
282 2844163670 Ensifer sp. 1H6 Isolate Unclassified
283 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
284 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
285 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
286 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
287 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
288 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
289 2854911287 Brucella lupini LUP21 Isolate Unclassified
290 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
291 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
292 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
293 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
294 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
295 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
296 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
297 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
298 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
299 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
300 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
301 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
302 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
303 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
304 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
305 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
306 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
307 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
308 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
309 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
310 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
311 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
312 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
313 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
314 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
315 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
316 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
317 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
318 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
319 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
320 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
321 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
322 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
323 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
324 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
325 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
326 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
327 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
328 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
329 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
330 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
331 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
332 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
333 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
334 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
335 2933599457 Rhizobium phaseoli M3 Isolate Nodule
336 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
337 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
338 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
339 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
340 2936381700 Rhizobium chutanense C16 Isolate Unclassified
341 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
342 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
343 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
344 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
345 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
346 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
347 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
348 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
349 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
350 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
351 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
352 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
353 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
354 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
355 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
356 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
357 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
358 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
359 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
360 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
361 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
362 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
363 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
364 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
365 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
366 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
367 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
368 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
369 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
370 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
371 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
372 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
373 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
374 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
375 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
376 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
377 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
378 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
379 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
380 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
381 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
382 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
383 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
384 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
385 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
386 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
387 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
388 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
389 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
390 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
391 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
392 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
393 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
394 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
395 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
396 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
397 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
398 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
399 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
400 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
401 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
402 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
403 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
404 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
405 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
406 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
407 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
408 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
409 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
410 2996887358 Rhizobium sp. R711 Isolate Nodule
411 2996893221 Rhizobium sp. R635 Isolate Nodule
412 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
413 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
414 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
415 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
416 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
417 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
418 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
419 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
420 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
421 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
422 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
423 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
424 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
425 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
426 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
427 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
428 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
429 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
430 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
431 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
432 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
433 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
434 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
435 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
436 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
437 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
438 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
439 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
440 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
441 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
442 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
443 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
444 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
445 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
446 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
447 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
448 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
449 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
450 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
451 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
452 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
453 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
454 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
455 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
456 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
457 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
458 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
459 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
460 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
461 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
462 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
463 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
464 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
465 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
466 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
467 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
468 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
469 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
470 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
471 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
472 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
473 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
474 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
475 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
476 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
477 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
478 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
479 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
480 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
481 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
482 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
483 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
484 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
485 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
486 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
487 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
488 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
489 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
490 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
491 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
492 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
493 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
494 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
495 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
496 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
497 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
498 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
499 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
500 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
501 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
502 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
503 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
504 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
505 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
506 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
507 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
508 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
509 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
510 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
511 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
512 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
513 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
514 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
515 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
516 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
517 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
518 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
519 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
520 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
521 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
522 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
523 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
524 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
525 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
526 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
527 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
528 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
529 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
530 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
531 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
532 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
533 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
534 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
535 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
536 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
537 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
538 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
539 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
540 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
541 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
542 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
543 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
544 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
545 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
546 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
547 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
548 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
549 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
550 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
551 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
552 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
553 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
554 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
555 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
558 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
559 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
560 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
563 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
564 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
568 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
569 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
570 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
571 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
572 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
573 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
574 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
576 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
578 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
579 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
580 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
581 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
582 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
583 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
584 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
586 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
587 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
588 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
589 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
590 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
591 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
592 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
593 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
594 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
595 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
596 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
597 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
598 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
599 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
600 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
601 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
602 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
603 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
604 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
605 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
606 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
607 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
608 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
609 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
610 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
611 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
612 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
613 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
614 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
615 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
616 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
617 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
618 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
619 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
620 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
621 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
622 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
623 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
624 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
625 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
626 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
627 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
628 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
629 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
630 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
631 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
632 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
633 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
634 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
635 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
636 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
637 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
638 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
639 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
640 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
641 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
642 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
643 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
644 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
645 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
646 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
647 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
648 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
649 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
650 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
651 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
652 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
653 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
654 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
655 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
656 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
657 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
658 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
659 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
660 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
661 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
662 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
663 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
664 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
665 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
666 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
667 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
668 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
669 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
670 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
671 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
672 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
673 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
674 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
675 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
676 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
677 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
678 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
679 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
680 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
681 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
682 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
683 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
684 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
685 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
686 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
687 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
688 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
689 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
690 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
691 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
692 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
693 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
694 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
695 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
696 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
697 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
698 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
699 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
700 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
701 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
702 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
703 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
704 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
705 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
706 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
707 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
708 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
709 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
710 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
711 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
712 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
713 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
714 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
715 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
716 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
717 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
718 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
719 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
720 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
721 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
722 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
723 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
724 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
725 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
726 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
727 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
728 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
729 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
730 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
731 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
732 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
733 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
734 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
735 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
736 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
737 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
738 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
739 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
740 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
741 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
742 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
743 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
744 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
745 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
746 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
747 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
748 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
749 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
750 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
751 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
752 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
753 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
754 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
755 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
756 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
757 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
758 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
759 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
760 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
761 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
762 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
763 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
764 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
765 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
766 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
767 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
768 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
769 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
770 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
771 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
772 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
773 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
774 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
775 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
776 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
777 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
778 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
779 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
780 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
781 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
782 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
783 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
784 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
785 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
786 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
787 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
788 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
789 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
790 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
791 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
792 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
793 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
794 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
795 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
796 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
797 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
798 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
799 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
800 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
801 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
802 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
803 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
804 8005258706 Rhizobium sp. R693 Isolate Nodule
805 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
806 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
807 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
808 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
809 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
810 8005321885 Rhizobium sp. R72 Isolate Nodule
811 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
812 8005382845 Rhizobium sp. R634 Isolate Nodule
813 8005395548 Rhizobium sp. R339 Isolate Nodule
814 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
815 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
816 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
817 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
818 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
819 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
820 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
821 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
822 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
823 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
824 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
825 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
826 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
827 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
828 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
829 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
830 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
831 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
832 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
833 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
834 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
835 8024501048 Rhizobium sp. H4 Isolate Nodule
836 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
837 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
838 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
839 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
840 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
841 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
842 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
843 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
844 8056382006 Rhizobium croatiense 13T Isolate Nodule
845 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
846 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
847 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
848 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.08
Metatranscriptomes 0.77
Isolates 36.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.38
Bulb 0
Endosphere 22.54
Nodule 24.54
Rhizoplane 2
Rhizosphere 32.15
Stem 0
Stem Tuber 0
Unclassified 18.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003638 3300001979 Bacteria 6721
2 JGI24739J22299_10033117 3300001989 Bacteria 1771
3 JGI25155J39150_1000014 3300002704 Bacteria 196159
4 JGI25156J39149_1000037 3300002705 Bacteria 109690
5 JGI25156J39149_1000079 3300002705 Bacteria 73408
6 JGI25162J39368_1000497 3300002737 Bacteria 29860
7 JGI25162J39368_1000992 3300002737 Bacteria 17927
8 JGI25154J39366_1000052 3300002738 Bacteria 120209
9 JGI25158J39367_1000499 3300002739 Bacteria 7922
10 JGI25157J39369_1000040 3300002741 Bacteria 126165
11 JGI25152J39213_1001025 3300002773 Bacteria 13379
12 JGI25152J39213_1002772 3300002773 Bacteria 6349
13 JGI25152J39213_1004429 3300002773 Bacteria 4424
14 JGI25152J39213_1020840 3300002773 Bacteria 1163
15 JGI25152J39213_1029794 3300002773 Bacteria 854
16 JGI25150J39212_1000088 3300002774 Bacteria 53538
17 JGI25150J39212_1015270 3300002774 Bacteria 1285
18 JGI25150J39212_1027871 3300002774 Bacteria 805
19 JGI25159J45721_1000004 3300002987 Bacteria 215789
20 JGI25159J45721_1001399 3300002987 Bacteria 10011
21 JGI25159J45721_1006965 3300002987 Bacteria 3304
22 JGI25151J46595_10000215 3300003187 Bacteria 69771
23 JGI25151J46595_10000280 3300003187 Bacteria 58125
24 JGI25151J46595_10005849 3300003187 Bacteria 6291
25 JGI25151J46595_10006069 3300003187 Bacteria 6142
26 JGI25151J46595_10024325 3300003187 Bacteria 2480
27 JGI25151J46595_10024843 3300003187 Bacteria 2445
28 JGI25151J46595_10038793 3300003187 Bacteria 1767
29 JGI25151J46595_10052475 3300003187 Bacteria 1371
30 JGI25151J46595_10065287 3300003187 Bacteria 1134
31 JGI25151J46595_10129791 3300003187 Bacteria 629
32 JGI25406J46586_10003554 3300003203 Bacteria 7306
33 JGI25165J46597_1000371 3300003214 Bacteria 50062
34 JGI25165J46597_1000462 3300003214 Bacteria 40205
35 JGI25165J46597_1005670 3300003214 Bacteria 2358
36 JGI25153J46596_10001244 3300003215 Bacteria 15371
37 JGI25153J46596_10007382 3300003215 Bacteria 5419
38 JGI25153J46596_10017172 3300003215 Bacteria 2862
39 JGI25153J46596_10032466 3300003215 Bacteria 1741
40 rootH1_10177570 3300003323 Bacteria 1729
41 JGI25160J50197_1000001 3300003354 Bacteria 782301
42 JGI25160J50197_1000021 3300003354 Bacteria 215789
43 JGI25160J50197_1001207 3300003354 Bacteria 13131
44 JGI25160J50197_1011565 3300003354 Bacteria 3120
45 JGI25160J50197_1022474 3300003354 Bacteria 1848
46 JGI25161J50226_1000001 3300003374 Bacteria 655036
47 JGI25161J50226_1000283 3300003374 Bacteria 28981
48 JGI25161J50226_1000307 3300003374 Bacteria 27289
49 JGI25161J50226_1016692 3300003374 Bacteria 782
50 Ga0006562J51391_1004630 3300003578 Bacteria 2770
51 Ga0006562J51391_1004633 3300003578 Bacteria 940
52 Ga0055525_1019223 3300003759 Bacteria 580
53 Ga0055529_1005549 3300003763 Bacteria 1815
54 Ga0055526_1001084 3300003771 Bacteria 19838
55 Ga0055526_1002599 3300003771 Bacteria 12069
56 Ga0055526_1004226 3300003771 Bacteria 8720
57 Ga0055526_1013834 3300003771 Bacteria 3374
58 Ga0055526_1042781 3300003771 Bacteria 1111
59 Ga0055524_1002465 3300003775 Bacteria 9507
60 Ga0055524_1004489 3300003775 Bacteria 6431
61 Ga0055524_1004911 3300003775 Bacteria 6069
62 Ga0055524_1009251 3300003775 Bacteria 4029
63 Ga0055524_1011052 3300003775 Bacteria 3553
64 Ga0055524_1021006 3300003775 Bacteria 2179
65 Ga0055524_1025442 3300003775 Bacteria 1853
66 Ga0055524_1074924 3300003775 Bacteria 637
67 Ga0055536_1003481 3300003781 Bacteria 8439
68 Ga0055536_1009272 3300003781 Bacteria 4098
69 Ga0055528_1000549 3300003790 Bacteria 28640
70 Ga0055528_1001077 3300003790 Bacteria 17996
71 Ga0055528_1009596 3300003790 Bacteria 4028
72 Ga0055528_1025209 3300003790 Bacteria 1755
73 Ga0055528_1036530 3300003790 Bacteria 1172
74 Ga0055530_10007952 3300003791 Bacteria 4340
75 Ga0055540_1000766 3300003792 Bacteria 21853
76 Ga0055540_1005952 3300003792 Bacteria 4961
77 Ga0055540_1011443 3300003792 Bacteria 2859
78 Ga0055540_1033758 3300003792 Bacteria 1157
79 Ga0055540_1046310 3300003792 Bacteria 915
80 Ga0055531_10002883 3300003794 Bacteria 11200
81 Ga0055531_10028376 3300003794 Bacteria 1932
82 Ga0058692_1010152 3300003856 Bacteria 2339
83 Ga0058692_1010285 3300003856 Bacteria 2317
84 Ga0055543_1000003 3300004625 Bacteria 358656
85 Ga0055543_1000060 3300004625 Bacteria 98330
86 Ga0055543_1000311 3300004625 Bacteria 33798
87 Ga0055543_1000705 3300004625 Bacteria 17007
88 Ga0065165_1000008 3300005262 Bacteria 334429
89 Ga0065165_1000033 3300005262 Bacteria 215827
90 Ga0065165_1007477 3300005262 Bacteria 5355
91 Ga0065165_1012806 3300005262 Bacteria 3389
92 Ga0065165_1033757 3300005262 Bacteria 1589
93 Ga0065165_1081691 3300005262 Bacteria 838
94 Ga0070682_100162700 3300005337 Bacteria 1543
95 Ga0070689_101665527 3300005340 Bacteria 580
96 Ga0070668_100310520 3300005347 Bacteria 1325
97 Ga0070668_100394043 3300005347 Bacteria 1181
98 Ga0070668_101312432 3300005347 Bacteria 658
99 Ga0070669_100105433 3300005353 Bacteria 2132
100 Ga0070669_100260722 3300005353 Bacteria 1383
101 Ga0070669_100329913 3300005353 Bacteria 1234
102 Ga0070671_100455684 3300005355 Bacteria 1097
103 Ga0070674_100695063 3300005356 Bacteria 869
104 Ga0070667_100031464 3300005367 Bacteria 4425
105 Ga0070667_100781626 3300005367 Bacteria 886
106 Ga0070708_100296775 3300005445 Bacteria 1522
107 Ga0070663_100067010 3300005455 Bacteria 2603
108 Ga0070706_100046586 3300005467 Bacteria 4002
109 Ga0070698_100036273 3300005471 Bacteria 5095
110 Ga0070699_100110489 3300005518 Bacteria 2413
111 Ga0068853_100035919 3300005539 Bacteria 4212
112 Ga0070672_101009375 3300005543 Bacteria 737
113 Ga0070686_100138518 3300005544 Bacteria 1691
114 Ga0070665_100002486 3300005548 Bacteria 20302
115 Ga0070665_100070536 3300005548 Bacteria 3501
116 Ga0070665_100172205 3300005548 Bacteria 2166
117 Ga0070665_100582613 3300005548 Bacteria 1132
118 Ga0070665_100693459 3300005548 Bacteria 1031
119 Ga0070665_100800135 3300005548 Bacteria 956
120 Ga0068855_100727602 3300005563 Bacteria 1060
121 Ga0068854_100069462 3300005578 Bacteria 2572
122 Ga0068856_100224261 3300005614 Bacteria 1895
123 Ga0068856_100251105 3300005614 Bacteria 1784
124 Ga0068851_10068800 3300005834 Bacteria 1828
125 Ga0081455_10000538 3300005937 Bacteria 49235
126 Ga0081455_10019611 3300005937 Bacteria 6389
127 Ga0081539_10000572 3300005985 Bacteria 76133
128 Ga0075365_10002452 3300006038 Bacteria 9106
129 Ga0075365_10017736 3300006038 Bacteria 4364
130 Ga0075365_10068903 3300006038 Bacteria 2377
131 Ga0075365_10356132 3300006038 Bacteria 1032
132 Ga0075368_10041228 3300006042 Bacteria 1813
133 Ga0075363_100123831 3300006048 Bacteria 1446
134 Ga0075363_100185340 3300006048 Bacteria 1185
135 Ga0075363_100483201 3300006048 Bacteria 734
136 Ga0075364_10002108 3300006051 Bacteria 11108
137 Ga0075364_10024817 3300006051 Bacteria 3810
138 Ga0075364_10030331 3300006051 Bacteria 3470
139 Ga0075364_10099563 3300006051 Bacteria 1935
140 Ga0075364_10466317 3300006051 Bacteria 863
141 Ga0075364_10585114 3300006051 Bacteria 763
142 Ga0075362_10000446 3300006177 Bacteria 11962
143 Ga0075362_10050960 3300006177 Bacteria 1852
144 Ga0075362_10383312 3300006177 Bacteria 707
145 Ga0075367_10005571 3300006178 Bacteria 6272
146 Ga0075367_10047982 3300006178 Bacteria 2514
147 Ga0075367_10199637 3300006178 Bacteria 1250
148 Ga0075367_10312320 3300006178 Bacteria 990
149 Ga0075367_10334879 3300006178 Bacteria 954
150 Ga0075367_10371372 3300006178 Bacteria 903
151 Ga0075369_10010204 3300006186 Bacteria 3670
152 Ga0075369_10021611 3300006186 Bacteria 2646
153 Ga0075369_10035009 3300006186 Bacteria 2133
154 Ga0075369_10060746 3300006186 Bacteria 1649
155 Ga0075369_10061641 3300006186 Bacteria 1638
156 Ga0075366_10003015 3300006195 Bacteria 8787
157 Ga0075366_10122371 3300006195 Bacteria 1568
158 Ga0075370_10045499 3300006353 Bacteria 2482
159 Ga0075370_10243232 3300006353 Bacteria 1066
160 Ga0075370_10272640 3300006353 Bacteria 1004
161 Ga0075430_100226040 3300006846 Bacteria 1552
162 Ga0075431_100006441 3300006847 Bacteria 11655
163 Ga0075429_100055477 3300006880 Bacteria 3447
164 Ga0068865_100639961 3300006881 Bacteria 903
165 Ga0068865_100989888 3300006881 Bacteria 736
166 Ga0075436_100176072 3300006914 Bacteria 1511
167 Ga0079104_1000884 3300006946 Bacteria 24591
168 Ga0079104_1002263 3300006946 Bacteria 10711
169 Ga0099826_10010998 3300006948 Bacteria 6799
170 Ga0099795_10351282 3300007788 Bacteria 660
171 Ga0105251_10006266 3300009011 Bacteria 7622
172 Ga0105244_10117156 3300009036 Bacteria 1292
173 Ga0105244_10134460 3300009036 Bacteria 1192
174 Ga0105250_10044154 3300009092 Bacteria 1787
175 Ga0105240_10000014 3300009093 Bacteria 482033
176 Ga0105240_10607559 3300009093 Bacteria 1203
177 Ga0105240_10819328 3300009093 Bacteria 1007
178 Ga0111539_10260506 3300009094 Bacteria 2019
179 Ga0105247_10202228 3300009101 Bacteria 1335
180 Ga0114129_10003089 3300009147 Bacteria 23361
181 Ga0105243_10012270 3300009148 Bacteria 6481
182 Ga0105243_11125546 3300009148 Bacteria 795
183 Ga0105241_10668404 3300009174 Bacteria 945
184 Ga0105248_10001790 3300009177 Bacteria 23884
185 Ga0105248_10019194 3300009177 Bacteria 7563
186 Ga0105237_10003542 3300009545 Bacteria 18502
187 Ga0105237_10268463 3300009545 Bacteria 1709
188 Ga0105238_10089717 3300009551 Bacteria 3061
189 Ga0105238_10470719 3300009551 Bacteria 1255
190 Ga0105238_10596547 3300009551 Bacteria 1112
191 Ga0105238_12071368 3300009551 Bacteria 603
192 Ga0105249_11610098 3300009553 Bacteria 722
193 Ga0123341_1000112 3300009765 Bacteria 36073
194 Ga0123341_1065565 3300009765 Bacteria 1684
195 Ga0123342_1010951 3300009766 Bacteria 10166
196 Ga0123342_1016639 3300009766 Bacteria 6342
197 Ga0099796_10100096 3300010159 Bacteria 1089
198 Ga0105239_10000973 3300010375 Bacteria 40196
199 Ga0105239_11650850 3300010375 Bacteria 741
200 Ga0157322_1002866 3300012490 Bacteria 1011
201 Ga0157314_1015773 3300012500 Bacteria 718
202 Ga0157373_10013476 3300013100 Bacteria 5998
203 Ga0157373_10018335 3300013100 Bacteria 5098
204 Ga0157373_10062061 3300013100 Bacteria 2647
205 Ga0157371_10000017 3300013102 Bacteria 320830
206 Ga0157371_10029204 3300013102 Bacteria 3991
207 Ga0157370_10000327 3300013104 Bacteria 59705
208 Ga0157370_10000616 3300013104 Bacteria 44220
209 Ga0157370_10767920 3300013104 Bacteria 878
210 Ga0157369_10221130 3300013105 Bacteria 1982
211 Ga0157369_10223647 3300013105 Bacteria 1969
212 Ga0157369_10432196 3300013105 Bacteria 1364
213 Ga0157369_10661356 3300013105 Bacteria 1077
214 Ga0157369_10718552 3300013105 Bacteria 1028
215 Ga0171463_1007 3300013249 Bacteria 301198
216 Ga0163162_10328425 3300013306 Bacteria 1662
217 Ga0182008_10017060 3300014497 Bacteria 3768
218 Ga0182007_10002083 3300015262 Bacteria 10267
219 Ga0182005_1001327 3300015265 Bacteria 10109
220 Ga0183363_1049 3300015690 Bacteria 38978
221 Ga0163161_10941000 3300017792 Bacteria 734
222 Ga0214544_1000110 3300021320 Bacteria 113143
223 Ga0214542_1000268 3300021321 Bacteria 87082
224 Ga0214542_1013594 3300021321 Bacteria 9673
225 Ga0214543_1000022 3300021327 Bacteria 241930
226 Ga0214543_1000219 3300021327 Bacteria 87102
227 Ga0213872_10033273 3300021361 Bacteria 2362
228 Ga0213876_10003111 3300021384 Bacteria 9596
229 Ga0213876_10199775 3300021384 Bacteria 1063
230 Ga0213875_10002041 3300021388 Bacteria 12410
231 Ga0213871_10060080 3300021441 Bacteria 1057
232 Ga0228711_1000026 3300022739 Bacteria 101497
233 Ga0228710_1000005 3300022740 Bacteria 233531
234 Ga0209435_100027 3300025206 Bacteria 196217
235 Ga0209760_105271 3300025207 Bacteria 1072
236 Ga0209436_100061 3300025208 Bacteria 58629
237 Ga0209436_100422 3300025208 Bacteria 18988
238 Ga0209436_109886 3300025208 Bacteria 1781
239 Ga0209672_115973 3300025228 Bacteria 827
240 Ga0209563_104435 3300025230 Bacteria 2684
241 Ga0209437_100051 3300025233 Bacteria 392523
242 Ga0209437_100060 3300025233 Bacteria 355034
243 Ga0207425_1000432 3300025245 Bacteria 27708
244 Ga0207425_1004652 3300025245 Bacteria 4060
245 Ga0207425_1004982 3300025245 Bacteria 3866
246 Ga0207425_1017504 3300025245 Bacteria 1572
247 Ga0209646_1000086 3300025246 Bacteria 196217
248 Ga0209026_1000082 3300025250 Bacteria 196315
249 Ga0209677_100273 3300025253 Bacteria 34599
250 Ga0209148_1000588 3300025254 Bacteria 33100
251 Ga0209148_1009991 3300025254 Bacteria 1820
252 Ga0209759_1000063 3300025256 Bacteria 196315
253 Ga0209129_1000029 3300025258 Bacteria 401149
254 Ga0209129_1000307 3300025258 Bacteria 44447
255 Ga0209129_1000433 3300025258 Bacteria 31302
256 Ga0209129_1001238 3300025258 Bacteria 14649
257 Ga0209129_1003217 3300025258 Bacteria 7286
258 Ga0209129_1006305 3300025258 Bacteria 3884
259 Ga0209129_1006840 3300025258 Bacteria 3560
260 Ga0209129_1028875 3300025258 Bacteria 939
261 Ga0209233_1000095 3300025261 Bacteria 303783
262 Ga0209233_1000190 3300025261 Bacteria 130713
263 Ga0209233_1000228 3300025261 Bacteria 100100
264 Ga0209565_1023059 3300025263 Bacteria 1282
265 Ga0209565_1024878 3300025263 Bacteria 1214
266 Ga0209455_1000334 3300025272 Bacteria 45267
267 Ga0209673_1000010 3300025273 Bacteria 596656
268 Ga0209673_1000025 3300025273 Bacteria 404572
269 Ga0209673_1000112 3300025273 Bacteria 179676
270 Ga0209673_1000858 3300025273 Bacteria 39511
271 Ga0209673_1003176 3300025273 Bacteria 10010
272 Ga0209673_1003674 3300025273 Bacteria 8848
273 Ga0209673_1006098 3300025273 Bacteria 5910
274 Ga0209673_1013587 3300025273 Bacteria 3203
275 Ga0209673_1030287 3300025273 Bacteria 1707
276 Ga0209130_1000003 3300025284 Bacteria 677988
277 Ga0209130_1000017 3300025284 Bacteria 388431
278 Ga0209130_1000020 3300025284 Bacteria 379297
279 Ga0209130_1042962 3300025284 Bacteria 862
280 Ga0209675_1049955 3300025291 Bacteria 868
281 Ga0209676_1000197 3300025292 Bacteria 135043
282 Ga0209676_1005472 3300025292 Bacteria 6627
283 Ga0209676_1009017 3300025292 Bacteria 4363
284 Ga0209676_1034629 3300025292 Bacteria 1491
285 Ga0209676_1066449 3300025292 Bacteria 874
286 Ga0209025_1000070 3300025294 Bacteria 287776
287 Ga0209025_1000091 3300025294 Bacteria 250401
288 Ga0209025_1000154 3300025294 Bacteria 170288
289 Ga0209025_1000161 3300025294 Bacteria 166506
290 Ga0209025_1000171 3300025294 Bacteria 160478
291 Ga0209025_1000927 3300025294 Bacteria 44856
292 Ga0209025_1002842 3300025294 Bacteria 17370
293 Ga0209025_1007846 3300025294 Bacteria 7836
294 Ga0209025_1011929 3300025294 Bacteria 5650
295 Ga0209025_1014918 3300025294 Bacteria 4733
296 Ga0209025_1028907 3300025294 Bacteria 2699
297 Ga0209025_1035289 3300025294 Bacteria 2263
298 Ga0209564_1000013 3300025295 Bacteria 775755
299 Ga0209564_1000265 3300025295 Bacteria 110606
300 Ga0209564_1000607 3300025295 Bacteria 55712
301 Ga0209564_1001968 3300025295 Bacteria 18089
302 Ga0209564_1008091 3300025295 Bacteria 5262
303 Ga0209564_1012456 3300025295 Bacteria 3708
304 Ga0209564_1025637 3300025295 Bacteria 1975
305 Ga0209758_1000058 3300025297 Bacteria 331603
306 Ga0209758_1000094 3300025297 Bacteria 241068
307 Ga0209758_1000671 3300025297 Bacteria 51169
308 Ga0209758_1005284 3300025297 Bacteria 10089
309 Ga0209758_1012944 3300025297 Bacteria 4607
310 Ga0209758_1013086 3300025297 Bacteria 4562
311 Ga0209758_1019706 3300025297 Bacteria 3237
312 Ga0209758_1020944 3300025297 Bacteria 3068
313 Ga0209758_1036138 3300025297 Bacteria 1934
314 Ga0209758_1043460 3300025297 Bacteria 1655
315 Ga0209050_1002996 3300025298 Bacteria 13124
316 Ga0209050_1005559 3300025298 Bacteria 7851
317 Ga0209050_1005667 3300025298 Bacteria 7728
318 Ga0209256_1000153 3300025299 Bacteria 144736
319 Ga0209256_1000381 3300025299 Bacteria 70973
320 Ga0209256_1000655 3300025299 Bacteria 47114
321 Ga0209256_1001163 3300025299 Bacteria 29718
322 Ga0209256_1002016 3300025299 Bacteria 18118
323 Ga0209256_1004610 3300025299 Bacteria 8514
324 Ga0209256_1019160 3300025299 Bacteria 2191
325 Ga0209256_1031417 3300025299 Bacteria 1452
326 Ga0209256_1033906 3300025299 Bacteria 1366
327 Ga0207426_1000006 3300025302 Bacteria 1025969
328 Ga0207426_1000008 3300025302 Bacteria 848730
329 Ga0207426_1000011 3300025302 Bacteria 791203
330 Ga0207426_1000344 3300025302 Bacteria 85912
331 Ga0207426_1001833 3300025302 Bacteria 15687
332 Ga0209051_1001157 3300025303 Bacteria 23986
333 Ga0209051_1001614 3300025303 Bacteria 18391
334 Ga0209051_1014703 3300025303 Bacteria 3637
335 Ga0209051_1019573 3300025303 Bacteria 2947
336 Ga0209051_1052327 3300025303 Bacteria 1350
337 Ga0209051_1109753 3300025303 Bacteria 722
338 Ga0209257_1002974 3300025304 Bacteria 15474
339 Ga0209257_1008365 3300025304 Bacteria 5906
340 Ga0209257_1013242 3300025304 Bacteria 3696
341 Ga0209257_1015197 3300025304 Bacteria 3228
342 Ga0207696_1096477 3300025711 Bacteria 808
343 Ga0207655_1139394 3300025728 Bacteria 780
344 Ga0207713_1047877 3300025735 Bacteria 1726
345 Ga0207707_10502268 3300025912 Bacteria 1034
346 Ga0207707_11428980 3300025912 Bacteria 551
347 Ga0207695_10000037 3300025913 Bacteria 476303
348 Ga0207695_10117657 3300025913 Bacteria 2630
349 Ga0207695_10211115 3300025913 Bacteria 1852
350 Ga0207695_10631791 3300025913 Bacteria 952
351 Ga0207695_10920776 3300025913 Bacteria 754
352 Ga0207671_10000271 3300025914 Bacteria 77228
353 Ga0207671_10210143 3300025914 Bacteria 1522
354 Ga0207649_11356407 3300025920 Bacteria 563
355 Ga0207652_10291240 3300025921 Bacteria 1473
356 Ga0207681_10683505 3300025923 Bacteria 852
357 Ga0207694_10002909 3300025924 Bacteria 13780
358 Ga0207694_10498678 3300025924 Bacteria 1019
359 Ga0207694_10518221 3300025924 Bacteria 999
360 Ga0207650_10000911 3300025925 Bacteria 22288
361 Ga0207650_10078116 3300025925 Bacteria 2503
362 Ga0207659_10146647 3300025926 Bacteria 1838
363 Ga0207644_10071576 3300025931 Bacteria 2537
364 Ga0207706_10231682 3300025933 Bacteria 1616
365 Ga0207706_10439739 3300025933 Bacteria 1129
366 Ga0207704_10550465 3300025938 Bacteria 937
367 Ga0207691_10279013 3300025940 Bacteria 1438
368 Ga0207711_10009012 3300025941 Bacteria 8340
369 Ga0207711_10231808 3300025941 Bacteria 1691
370 Ga0207668_10068654 3300025972 Bacteria 2521
371 Ga0207668_10498133 3300025972 Bacteria 1047
372 Ga0207668_11110420 3300025972 Bacteria 709
373 Ga0207640_10052246 3300025981 Bacteria 2661
374 Ga0207640_10198771 3300025981 Bacteria 1517
375 Ga0207658_10627719 3300025986 Bacteria 967
376 Ga0207639_10027841 3300026041 Bacteria 4121
377 Ga0207678_10053726 3300026067 Bacteria 3471
378 Ga0207702_10877792 3300026078 Bacteria 888
379 Ga0207702_11820460 3300026078 Bacteria 601
380 Ga0207698_10314980 3300026142 Bacteria 1463
381 Ga0209281_1000034 3300027111 Bacteria 382562
382 Ga0209281_1000082 3300027111 Bacteria 257684
383 Ga0209371_1000022 3300027312 Bacteria 536342
384 Ga0209371_1000892 3300027312 Bacteria 23789
385 Ga0209371_1006087 3300027312 Bacteria 4582
386 Ga0209282_1000006 3300027666 Bacteria 276998
387 Ga0209282_1007756 3300027666 Bacteria 6737
388 Ga0209282_1030375 3300027666 Bacteria 3327
389 Ga0209588_1077228 3300027671 Bacteria 1076
390 Ga0209813_10007851 3300027866 Bacteria 2672
391 Ga0268266_10003490 3300028379 Bacteria 15653
392 Ga0268266_10003866 3300028379 Bacteria 14604
393 Ga0268266_10075098 3300028379 Bacteria 2936
394 Ga0268266_10691014 3300028379 Bacteria 983
395 Ga0268266_11364684 3300028379 Bacteria 684
396 Ga0268266_11814705 3300028379 Bacteria 584
397 Ga0307515_10000017 3300028794 Bacteria 550465
398 Ga0307515_10046209 3300028794 Bacteria 6662
399 Ga0307515_10069935 3300028794 Bacteria 4787
400 Ga0268256_1000019 3300030500 Bacteria 587949
401 Ga0268256_1006062 3300030500 Bacteria 4582
402 Ga0268256_1026482 3300030500 Bacteria 1456
403 Ga0316181_1138338 3300030744 Bacteria 916
404 Ga0265328_10000189 3300031239 Bacteria 28650
405 Ga0265327_10002688 3300031251 Bacteria 18258
406 Ga0265327_10049111 3300031251 Bacteria 2215
407 Ga0307513_10015439 3300031456 Bacteria 9257
408 Ga0307513_10057743 3300031456 Bacteria 4131
409 Ga0307408_100259728 3300031548 Bacteria 1437
410 Ga0307408_100551394 3300031548 Bacteria 1017
411 Ga0265342_10295511 3300031712 Bacteria 854
412 Ga0316576_10760265 3300031727 Bacteria 699
413 Ga0307405_10002746 3300031731 Bacteria 7890
414 Ga0307405_10103915 3300031731 Bacteria 1911
415 Ga0307410_10192518 3300031852 Bacteria 1552
416 Ga0307406_10740705 3300031901 Bacteria 824
417 Ga0307412_10002363 3300031911 Bacteria 10464
418 Ga0307412_10114024 3300031911 Bacteria 1935
419 Ga0307412_10259515 3300031911 Bacteria 1354
420 Ga0307412_10981645 3300031911 Bacteria 745
421 Ga0315914_1000003 3300031967 Bacteria 314370
422 Ga0307409_100821542 3300031995 Bacteria 938
423 Ga0307416_100299293 3300032002 Bacteria 1598
424 Ga0307416_100495718 3300032002 Bacteria 1285
425 Ga0307414_10076304 3300032004 Bacteria 2435
426 Ga0307414_10329742 3300032004 Bacteria 1302
427 Ga0307414_10963431 3300032004 Bacteria 784
428 Ga0307414_11179505 3300032004 Bacteria 709
429 Ga0307411_10905437 3300032005 Bacteria 784
430 Ga0315913_1000001 3300033430 Bacteria 284459
431 Ga0315915_1000008 3300033464 Bacteria 258517
432 Ga0373945_0483619 3300035116 Bacteria 550
433 Ga0373943_0074066 3300035170 Bacteria 1731
434 Ga0373943_0347105 3300035170 Bacteria 850
435 Ga0373935_0010890 3300035692 Bacteria 5461
436 Ga0373927_0000856 3300035695 Bacteria 23214
437 Ga0373927_0849305 3300035695 Bacteria 603
438 Ga0373925_0002516 3300037068 Bacteria 14642
439 Ga0395899_0032746 3300037312 Bacteria 3907
440 Ga0395899_0037181 3300037312 Bacteria 3650
441 Ga0395899_0040984 3300037312 Bacteria 3461
442 Ga0395899_0189558 3300037312 Bacteria 1439
443 Ga0395900_0079907 3300037418 Bacteria 3360
444 Ga0395900_0102233 3300037418 Bacteria 2944
445 Ga0395898_0009045 3300037466 Bacteria 10487
446 Ga0395898_0019247 3300037466 Bacteria 6950
447 Ga0436364_1142809 3300037853 Bacteria 40161
448 Ga0395901_0276823 3300038443 Bacteria 1744
449 Ga0395901_0331860 3300038443 Bacteria 1572
450 Ga0395901_0689569 3300038443 Bacteria 1020
451 Ga0400483_144045 3300039062 Bacteria 3853
452 Ga0400483_213761 3300039062 Bacteria 1346
453 Ga0436365_0243032 3300039437 Bacteria 1622
454 Ga0436365_0990465 3300039437 Bacteria 14414
455 Ga0436360_1052595 3300039438 Bacteria 3124
456 Ga0436361_0187853 3300039447 Bacteria 3059
457 Ga0436361_0507050 3300039447 Bacteria 1270
458 Ga0436361_0972763 3300039447 Bacteria 4532
459 Ga0436361_1031687 3300039447 Bacteria 1418
460 Ga0436363_1027101 3300039450 Bacteria 1261
461 Ga0436363_1351969 3300039450 Bacteria 1170
462 Ga0436362_0783924 3300039453 Bacteria 683
463 Ga0439436_0019882 3300041404 Bacteria 2002
464 Ga0439438_016435 3300041405 Bacteria 2151
465 Ga0439438_017366 3300041405 Bacteria 2073
466 Ga0439466_0070031 3300041411 Bacteria 1118
467 Ga0439465_0008508 3300041413 Bacteria 3238
468 Ga0439465_0165332 3300041413 Bacteria 795
469 Ga0451787_502609 3300041441 Bacteria 1095
470 Ga0451789_1281455 3300041443 Bacteria 897
471 Ga0451795_0335541 3300041456 Bacteria 973
472 Ga0451835_0255768 3300041492 Bacteria 1831
473 Ga0451837_0676541 3300041494 Bacteria 1093
474 Ga0451837_0772324 3300041494 Bacteria 1973
475 Ga0451840_15734 3300041497 Bacteria 645
476 Ga0451846_31201 3300041502 Bacteria 1028
477 Ga0451847_0188909 3300041503 Bacteria 3856
478 Ga0451851_0267608 3300041507 Bacteria 564
479 Ga0451851_0872605 3300041507 Bacteria 1419
480 Ga0451854_30980 3300041510 Bacteria 732
481 Ga0451855_1076083 3300041511 Bacteria 982
482 Ga0439433_0097097 3300041999 Bacteria 729
483 Ga0439449_0004055 3300042007 Bacteria 5671
484 Ga0439449_0017852 3300042007 Bacteria 2663
485 Ga0439451_016516 3300042009 Bacteria 1487
486 Ga0450920_010616 3300042122 Bacteria 1710
487 Ga0450909_003686 3300042185 Bacteria 2175
488 Ga0439434_0047458 3300042435 Bacteria 1327
489 Ga0450918_010663 3300042531 Bacteria 1604
490 Ga0466965_0694794 3300044683 Bacteria 583
491 Ga0466966_0370726 3300044684 Bacteria 860
492 Ga0466968_0015577 3300044735 Bacteria 3015
493 Ga0466970_0218295 3300044765 Bacteria 1064
494 Ga0466957_0017737 3300044842 Bacteria 4175
495 Ga0466960_0232709 3300044901 Bacteria 1017
496 Ga0451576_0002083 3300045051 Bacteria 31271
497 Ga0451576_2052736 3300045051 Bacteria 588
498 Ga0495627_051123 3300046453 Bacteria 1243
499 Ga0495627_093648 3300046453 Bacteria 862
500 Ga0495590_0016051 3300046457 Bacteria 2708
501 Ga0495638_0001134 3300046460 Bacteria 25773
502 Ga0495638_0080821 3300046460 Bacteria 1974
503 Ga0495651_0140785 3300046462 Bacteria 1750
504 Ga0495650_0045284 3300046471 Bacteria 1853
505 Ga0495605_0099468 3300046474 Bacteria 1339
506 Ga0495662_0009811 3300046476 Bacteria 4704
507 Ga0495585_0060355 3300046492 Bacteria 2087
508 Ga0495596_0027893 3300046500 Bacteria 2268
509 Ga0495607_0010334 3300046501 Bacteria 6279
510 Ga0495607_0046074 3300046501 Bacteria 2563
511 Ga0495583_0035078 3300046506 Bacteria 2398
512 Ga0495583_0053761 3300046506 Bacteria 1826
513 Ga0495606_0004697 3300046507 Bacteria 13488
514 Ga0495606_0007767 3300046507 Bacteria 9492
515 Ga0495606_0039286 3300046507 Bacteria 3192
516 Ga0495606_0112977 3300046507 Bacteria 1636
517 Ga0495610_0003664 3300046512 Bacteria 11821
518 Ga0495610_0031382 3300046512 Bacteria 2772
519 Ga0495610_0139763 3300046512 Bacteria 1043
520 Ga0495616_0022251 3300046513 Bacteria 3424
521 Ga0495618_0210505 3300046514 Bacteria 1229
522 Ga0495620_0026792 3300046515 Bacteria 2706
523 Ga0495620_0359990 3300046515 Bacteria 551
524 Ga0495630_0837281 3300046517 Bacteria 702
525 Ga0495631_0001584 3300046518 Bacteria 13671
526 Ga0495632_0003362 3300046519 Bacteria 11400
527 Ga0495632_0009886 3300046519 Bacteria 5703
528 Ga0495632_0041708 3300046519 Bacteria 2304
529 Ga0495632_0081744 3300046519 Bacteria 1540
530 Ga0495632_0108233 3300046519 Bacteria 1306
531 Ga0495643_0031297 3300046522 Bacteria 2962
532 Ga0495643_0066465 3300046522 Bacteria 1902
533 Ga0495648_0029469 3300046524 Bacteria 3643
534 Ga0495648_0161935 3300046524 Bacteria 1155
535 Ga0495663_0018272 3300046525 Bacteria 1996
536 Ga0495642_0201478 3300046528 Bacteria 868
537 Ga0495654_0001572 3300046530 Bacteria 15496
538 Ga0495654_0011933 3300046530 Bacteria 4685
539 Ga0495654_0198712 3300046530 Bacteria 859
540 Ga0495609_0026854 3300046538 Bacteria 2634
541 Ga0495597_0029591 3300046542 Bacteria 2500
542 Ga0495622_0042615 3300046557 Bacteria 2110
543 Ga0495633_0041073 3300046558 Bacteria 2201
544 Ga0495633_0048871 3300046558 Bacteria 1997
545 Ga0495633_0265304 3300046558 Bacteria 782
546 Ga0495656_0014314 3300046615 Bacteria 2972
547 Ga0495668_0009467 3300046616 Bacteria 5984
548 Ga0495668_0012948 3300046616 Bacteria 4937
549 Ga0495668_0101874 3300046616 Bacteria 1571
550 Ga0495611_0013882 3300046648 Bacteria 3436
551 Ga0495611_0020130 3300046648 Bacteria 2870
552 Ga0495625_0002255 3300046660 Bacteria 21195
553 Ga0495625_0049809 3300046660 Bacteria 3009
554 Ga0495625_0068316 3300046660 Bacteria 2498
555 Ga0495625_0100585 3300046660 Bacteria 1987
556 Ga0495625_0126598 3300046660 Bacteria 1734
557 Ga0495588_0001571 3300046674 Bacteria 9773
558 Ga0495588_0067742 3300046674 Bacteria 1853
559 Ga0495670_0012039 3300046691 Bacteria 4258
560 Ga0495671_0065310 3300046692 Bacteria 1791
561 Ga0495600_0026201 3300046809 Bacteria 3761
562 Ga0495660_0004669 3300046810 Bacteria 8269
563 Ga0495604_0097972 3300047317 Bacteria 2161
564 Ga0495636_0047809 3300047318 Bacteria 1787
565 Ga0495672_0005525 3300047320 Bacteria 10005
566 Ga0495683_0049570 3300047323 Bacteria 2103
567 Ga0495681_0013102 3300047470 Bacteria 4834
568 Ga0495681_0049184 3300047470 Bacteria 1994
569 Ga0495681_0278580 3300047470 Bacteria 653
570 Ga0495686_0001486 3300047472 Bacteria 25489
571 Ga0495686_0010881 3300047472 Bacteria 6442
572 Ga0495686_0011361 3300047472 Bacteria 6277
573 Ga0495686_0021709 3300047472 Bacteria 4258
574 Ga0495686_0200319 3300047472 Bacteria 1146
575 Ga0495686_0213564 3300047472 Bacteria 1101
576 Ga0495686_0322597 3300047472 Bacteria 846
577 Ga0495626_0024583 3300048091 Bacteria 2952
578 Ga0496100_1297634 3300048903 Bacteria 574
579 Ga0496102_1292316 3300048905 Bacteria 649
580 Ga0496105_0022766 3300048908 Bacteria 5077
581 Ga0496105_0070505 3300048908 Bacteria 2889
582 Ga0496105_0338339 3300048908 Bacteria 1204
583 Ga0496106_0006078 3300048909 Bacteria 8935
584 Ga0496106_0218120 3300048909 Bacteria 1521
585 Ga0496110_0046395 3300048913 Bacteria 3801
586 Ga0496110_0252786 3300048913 Bacteria 1604
587 Ga0496111_0029761 3300048914 Bacteria 3879
588 Ga0496112_0017743 3300048915 Bacteria 6698
589 Ga0496112_0803831 3300048915 Bacteria 865
590 Ga0496113_0040908 3300048916 Bacteria 3418
591 Ga0496115_0695078 3300048918 Bacteria 800
592 Ga0496116_0000105 3300048919 Bacteria 192704
593 Ga0496116_0007168 3300048919 Bacteria 9963
594 Ga0496116_0008842 3300048919 Bacteria 8671
595 Ga0496116_0023634 3300048919 Bacteria 4572
596 Ga0496116_0031594 3300048919 Bacteria 3787
597 Ga0496116_0031701 3300048919 Bacteria 3778
598 Ga0496116_0047753 3300048919 Bacteria 2879
599 Ga0496116_0052894 3300048919 Bacteria 2686
600 Ga0496116_0083429 3300048919 Bacteria 1973
601 Ga0496117_0000002 3300048920 Bacteria 2483758
602 Ga0496117_0005967 3300048920 Bacteria 12557
603 Ga0496117_0010221 3300048920 Bacteria 8599
604 Ga0496117_0017552 3300048920 Bacteria 5971
605 Ga0496117_0031122 3300048920 Bacteria 4080
606 Ga0496117_0066513 3300048920 Bacteria 2444
607 Ga0496117_0156739 3300048920 Bacteria 1339
608 Ga0496118_0000566 3300048921 Bacteria 61208
609 Ga0496118_0001151 3300048921 Bacteria 40832
610 Ga0496118_0008628 3300048921 Bacteria 10486
611 Ga0496118_0017174 3300048921 Bacteria 6601
612 Ga0496118_0034028 3300048921 Bacteria 4168
613 Ga0496118_0075392 3300048921 Bacteria 2406
614 Ga0496118_0104617 3300048921 Bacteria 1899
615 Ga0496118_0141386 3300048921 Bacteria 1525
616 Ga0496119_0007422 3300048922 Bacteria 9879
617 Ga0496119_0024620 3300048922 Bacteria 4229
618 Ga0496119_0035300 3300048922 Bacteria 3278
619 Ga0496119_0071800 3300048922 Bacteria 2025
620 Ga0496119_0109266 3300048922 Bacteria 1538
621 Ga0496119_0141554 3300048922 Bacteria 1298
622 Ga0496120_0000309 3300048923 Bacteria 81375
623 Ga0496120_0023586 3300048923 Bacteria 3849
624 Ga0496120_0044995 3300048923 Bacteria 2560
625 Ga0496120_0070685 3300048923 Bacteria 1919
626 Ga0496120_0092898 3300048923 Bacteria 1608
627 Ga0496121_0000003 3300048924 Bacteria 1191431
628 Ga0496121_0003780 3300048924 Bacteria 21134
629 Ga0496121_0009804 3300048924 Bacteria 10942
630 Ga0496121_0012638 3300048924 Bacteria 9172
631 Ga0496121_0019047 3300048924 Bacteria 6886
632 Ga0496121_0076734 3300048924 Bacteria 2663
633 Ga0496121_0081685 3300048924 Bacteria 2557
634 Ga0496121_0155671 3300048924 Bacteria 1677
635 Ga0496121_0248290 3300048924 Bacteria 1235
636 Ga0496122_0000004 3300048925 Bacteria 645283
637 Ga0496122_0000157 3300048925 Bacteria 159733
638 Ga0496122_0000464 3300048925 Bacteria 84473
639 Ga0496122_0010069 3300048925 Bacteria 9817
640 Ga0496122_0034634 3300048925 Bacteria 4128
641 Ga0496122_0038124 3300048925 Bacteria 3856
642 Ga0496122_0041265 3300048925 Bacteria 3651
643 Ga0496122_0048776 3300048925 Bacteria 3251
644 Ga0496122_0063672 3300048925 Bacteria 2689
645 Ga0496122_0122766 3300048925 Bacteria 1670
646 Ga0496122_0174327 3300048925 Bacteria 1291
647 Ga0496122_0175306 3300048925 Bacteria 1286
648 Ga0496123_0000007 3300048926 Bacteria 645283
649 Ga0496123_0000048 3300048926 Bacteria 244152
650 Ga0496123_0000147 3300048926 Bacteria 143834
651 Ga0496123_0007075 3300048926 Bacteria 10666
652 Ga0496123_0014048 3300048926 Bacteria 6663
653 Ga0496123_0015923 3300048926 Bacteria 6135
654 Ga0496123_0024343 3300048926 Bacteria 4604
655 Ga0496123_0027255 3300048926 Bacteria 4259
656 Ga0496123_0044556 3300048926 Bacteria 3032
657 Ga0496123_0173840 3300048926 Bacteria 1133
658 Ga0496123_0294082 3300048926 Bacteria 778
659 Ga0496123_0311236 3300048926 Bacteria 747
660 Ga0496124_0000067 3300048927 Bacteria 222576
661 Ga0496124_0002089 3300048927 Bacteria 26962
662 Ga0496124_0008090 3300048927 Bacteria 11052
663 Ga0496124_0009653 3300048927 Bacteria 9884
664 Ga0496124_0029277 3300048927 Bacteria 4910
665 Ga0496124_0060523 3300048927 Bacteria 3176
666 Ga0496124_0130083 3300048927 Bacteria 2001
667 Ga0496124_0132515 3300048927 Bacteria 1978
668 Ga0496124_0169676 3300048927 Bacteria 1692
669 Ga0496124_0196392 3300048927 Bacteria 1539
670 Ga0496124_0211242 3300048927 Bacteria 1468
671 Ga0496124_0230418 3300048927 Bacteria 1385
672 Ga0496124_0238957 3300048927 Bacteria 1352
673 Ga0496124_0273913 3300048927 Bacteria 1234
674 Ga0496124_0305280 3300048927 Bacteria 1147
675 Ga0496125_0000441 3300048928 Bacteria 75923
676 Ga0496125_0000786 3300048928 Bacteria 51737
677 Ga0496125_0000848 3300048928 Bacteria 49020
678 Ga0496125_0009794 3300048928 Bacteria 9769
679 Ga0496125_0014106 3300048928 Bacteria 7803
680 Ga0496125_0014581 3300048928 Bacteria 7646
681 Ga0496125_0050143 3300048928 Bacteria 3459
682 Ga0496125_0135179 3300048928 Bacteria 1726
683 Ga0496125_0255670 3300048928 Bacteria 1102
684 Ga0496125_0356085 3300048928 Bacteria 872
685 Ga0496125_0491740 3300048928 Bacteria 693
686 Ga0496126_0000188 3300048929 Bacteria 139625
687 Ga0496126_0060889 3300048929 Bacteria 3393
688 Ga0496126_0302042 3300048929 Bacteria 1320
689 Ga0496126_0526382 3300048929 Bacteria 941
690 Ga0496126_0531684 3300048929 Bacteria 935
691 Ga0496126_0852853 3300048929 Bacteria 694
692 Ga0495678_066512 3300049459 Bacteria 1334
693 Ga0495682_0011491 3300049460 Bacteria 3407
694 Ga0501031_0099971 3300049568 Bacteria 1893
695 Ga0501032_0187945 3300049569 Bacteria 1351
696 Ga0501033_0000365 3300049570 Bacteria 43281
697 Ga0501033_0150020 3300049570 Bacteria 1682
698 Ga0501033_0183076 3300049570 Bacteria 1501
699 Ga0501034_0001020 3300049571 Bacteria 40131
700 Ga0501034_0191769 3300049571 Bacteria 2005
701 Ga0501034_0327128 3300049571 Bacteria 1465
702 Ga0501034_0648779 3300049571 Bacteria 957
703 Ga0501036_0031089 3300049572 Bacteria 4512
704 Ga0501036_1004531 3300049572 Bacteria 683
705 Ga0501037_0066214 3300049573 Bacteria 2632
706 Ga0501037_0515409 3300049573 Bacteria 810
707 Ga0501038_0020981 3300049574 Bacteria 5869
708 Ga0501040_0034092 3300049576 Bacteria 3449
709 Ga0501041_0162692 3300049577 Bacteria 1395
710 Ga0501042_0162443 3300049578 Bacteria 1611
711 Ga0501043_0216218 3300049579 Bacteria 1484
712 Ga0501043_0419576 3300049579 Bacteria 1009
713 Ga0501046_0028941 3300049580 Bacteria 4508
714 Ga0501047_0221955 3300049581 Bacteria 1746
715 Ga0501047_0255272 3300049581 Bacteria 1602
716 Ga0501048_0025595 3300049582 Bacteria 4301
717 Ga0501067_0065314 3300049583 Bacteria 2014
718 Ga0501068_0288358 3300049584 Bacteria 1050
719 Ga0501068_0309858 3300049584 Bacteria 1011
720 Ga0501070_1196288 3300049586 Bacteria 583
721 Ga0501071_0046594 3300049587 Bacteria 3114
722 Ga0501074_0005267 3300049590 Bacteria 9310
723 Ga0501075_0195777 3300049591 Bacteria 1541
724 Ga0501076_0056877 3300049592 Bacteria 3105
725 Ga0501077_0084373 3300049593 Bacteria 2014
726 Ga0501079_0057880 3300049741 Bacteria 2990
727 Ga0501080_0232366 3300049742 Bacteria 1685
728 Ga0501080_0310242 3300049742 Bacteria 1430
729 Ga0501080_0426430 3300049742 Bacteria 1191
730 Ga0501080_0460058 3300049742 Bacteria 1140
731 Ga0501081_0001100 3300049743 Bacteria 16217
732 Ga0501280_001764 3300049776 Bacteria 3799
733 Ga0501280_052361 3300049776 Bacteria 690
734 Ga0501280_053158 3300049776 Bacteria 686
735 Ga0501035_0001622 3300049822 Bacteria 22762
736 Ga0501044_0109786 3300049823 Bacteria 2767
737 Ga0501044_0590104 3300049823 Bacteria 1005
738 Ga0501044_1392044 3300049823 Bacteria 567
739 Ga0501045_0045776 3300049824 Bacteria 3185
740 nmdc:mga03683_106140_c1 3300050489 Bacteria 1238
741 nmdc:mga03683_240320_c1 3300050489 Bacteria 839
742 nmdc:mga03683_53915_c1 3300050489 Bacteria 1685
743 nmdc:mga03683_858_c1 3300050489 Bacteria 8750
744 nmdc:mga03683_8607_c2 3300050489 Bacteria 3247
745 nmdc:mga03n38_376232_c1 3300050490 Bacteria 777
746 nmdc:mga03n38_48518_c1 3300050490 Bacteria 1884
747 nmdc:mga03n38_582808_c1 3300050490 Bacteria 636
748 nmdc:mga00v17_180_c1 3300050491 Bacteria 37485
749 nmdc:mga00v17_209459_c1 3300050491 Bacteria 1261
750 nmdc:mga00v17_414573_c1 3300050491 Bacteria 875
751 nmdc:mga00v17_443299_c1 3300050491 Bacteria 843
752 nmdc:mga00v17_824_c1 3300050491 Bacteria 16830
753 nmdc:mga00v17_983886_c1 3300050491 Bacteria 531
754 nmdc:mga0yw44_1405_c1 3300050492 Bacteria 9539
755 nmdc:mga0yw44_192004_c1 3300050492 Bacteria 1347
756 nmdc:mga0yw44_31619_c1 3300050492 Bacteria 3079
757 nmdc:mga0yw44_865_c1 3300050492 Bacteria 5959
758 nmdc:mga0k408_21083_c1 3300050493 Bacteria 3657
759 nmdc:mga0k408_63710_c1 3300050493 Bacteria 2145
760 nmdc:mga06z11_196570_c1 3300050494 Bacteria 1169
761 nmdc:mga06z11_285710_c1 3300050494 Bacteria 978
762 nmdc:mga06z11_424021_c1 3300050494 Bacteria 802
763 nmdc:mga07m45_40428_c1 3300050496 Bacteria 2609
764 nmdc:mga05p37_169637_c1 3300050507 Bacteria 2662
765 nmdc:mga05p37_181727_c1 3300050507 Bacteria 2558
766 nmdc:mga0qj67_357762_c1 3300050509 Bacteria 1180
767 nmdc:mga06r32_179582_c1 3300050510 Bacteria 2102
768 nmdc:mga06r32_954463_c1 3300050510 Bacteria 812
769 nmdc:mga08y16_453561_c1 3300050511 Bacteria 1307
770 nmdc:mga08x19_237661_c1 3300050514 Bacteria 1255
771 nmdc:mga0sz30_235323_c1 3300050516 Bacteria 815
772 nmdc:mga0sz30_260587_c1 3300050516 Bacteria 772
773 nmdc:mga0sz30_4354_c1 3300050516 Bacteria 5112
774 nmdc:mga0sz30_7993_c1 3300050516 Bacteria 2987
775 nmdc:mga0sz30_802_c1 3300050516 Bacteria 11359
776 nmdc:mga0sz30_84103_c1 3300050516 Bacteria 1379
777 Ga0500610_0022183 3300053079 Bacteria 3127
778 Ga0495619_0039700 3300053085 Bacteria 3074
779 Ga0500578_0448500 3300053086 Bacteria 735
780 Ga0500578_0459078 3300053086 Bacteria 723
781 Ga0500643_006663 3300053087 Bacteria 4789
782 Ga0500644_0011388 3300053088 Bacteria 2430
783 Ga0500644_0157381 3300053088 Bacteria 916
784 Ga0500646_0268453 3300053090 Bacteria 605
785 Ga0500647_0108906 3300053091 Bacteria 1318
786 Ga0500583_0343685 3300053092 Bacteria 724
787 Ga0500651_0345810 3300053093 Bacteria 845
788 Ga0500557_000501 3300053105 Bacteria 5231
789 Ga0500569_002896 3300053109 Bacteria 3438
790 Ga0500569_008858 3300053109 Bacteria 2316
791 Ga0500569_155755 3300053109 Bacteria 772
792 Ga0500572_003731 3300053111 Bacteria 3457
793 Ga0500594_0003894 3300053118 Bacteria 3288
794 Ga0500607_180670 3300053121 Bacteria 936
795 Ga0500608_052883 3300053122 Bacteria 1950
796 Ga0500618_000849 3300053125 Bacteria 16428
797 Ga0500618_015687 3300053125 Bacteria 1909
798 Ga0500618_041237 3300053125 Bacteria 1059
799 Ga0500642_0256169 3300053130 Bacteria 802
800 Ga0500658_0000206 3300053134 Bacteria 27878
801 Ga0500658_0011557 3300053134 Bacteria 3254
802 Ga0500561_0002494 3300053137 Bacteria 3106
803 Ga0500568_0001714 3300053139 Bacteria 13653
804 Ga0500568_0003195 3300053139 Bacteria 9316
805 Ga0500573_0018797 3300053140 Bacteria 3946
806 Ga0500588_0000807 3300053146 Bacteria 5419
807 Ga0500590_002837 3300053148 Bacteria 7835
808 Ga0500616_0000309 3300053153 Bacteria 70113
809 Ga0500616_0000576 3300053153 Bacteria 44650
810 Ga0500616_0002766 3300053153 Bacteria 14162
811 Ga0500616_0267263 3300053153 Bacteria 723
812 Ga0500616_0294343 3300053153 Bacteria 676
813 Ga0500620_007914 3300053155 Bacteria 2654
814 Ga0500622_0003878 3300053156 Bacteria 9707
815 Ga0500624_000308 3300053157 Bacteria 16712
816 Ga0500624_087080 3300053157 Bacteria 629
817 Ga0500634_0013063 3300053161 Bacteria 4344
818 Ga0500634_0181681 3300053161 Bacteria 946
819 Ga0500636_0000003 3300053177 Bacteria 240189
820 Ga0500636_0000840 3300053177 Bacteria 16525
821 Ga0500637_0093605 3300053178 Bacteria 1741
822 Ga0500609_029468 3300053731 Bacteria 753
823 Ga0501084_0009756 3300054114 Bacteria 7940
824 Ga0587080_061273 3300059503 Bacteria 733
825 Ga0587090_011104 3300059510 Bacteria 1261
826 Ga0587068_011069 3300059641 Bacteria 1355
827 Ga0587069_012415 3300059642 Bacteria 1155
828 Ga0587072_018780 3300059643 Bacteria 1204
829 Ga0501082_0017190 3300060353 Bacteria 6231
830 Ga0530510_0034914 3300061734 Bacteria 3623

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8057101203 8057103362 143
2 3300003775 Ga0055524_1021006 Ga0055524_10210061 144
3 3300003775 Ga0055524_1074924 Ga0055524_10749241 144
4 3300009174 Ga0105241_10668404 Ga0105241_106684041 144
5 3300009551 Ga0105238_12071368 Ga0105238_120713682 144
6 3300009765 Ga0123341_1065565 Ga0123341_10655652 144
7 3300009766 Ga0123342_1010951 Ga0123342_10109514 144
8 3300046457 Ga0495590_0016051 Ga0495590_0016051_756_1190 144
9 3300046615 Ga0495656_0014314 Ga0495656_0014314_2522_2956 144
10 3300047472 Ga0495686_0213564 Ga0495686_0213564_29_463 144
11 3300048922 Ga0496119_0071800 Ga0496119_0071800_16_450 144
12 3300050489 nmdc:mga03683_106140_c1 nmdc:mga03683_106140_c1_20_454 144
13 3300053086 Ga0500578_0448500 Ga0500578_0448500_287_721 144
14 3300053109 Ga0500569_008858 Ga0500569_008858_11_445 144
15 iso_pu_bacteria 2643221591 2643962815 146
16 iso_pu_bacteria 2894817345 2894817751 146
17 iso_pu_bacteria 2582581279 2585147455 147
18 3300009177 Ga0105248_10001790 Ga0105248_100017906 148
19 3300025941 Ga0207711_10009012 Ga0207711_100090127 148
20 iso_pu_bacteria 2899803654 2899806799 148
21 iso_pu_bacteria 2929138655 2929141018 148
22 3300032004 Ga0307414_10963431 Ga0307414_109634312 149
23 iso_pu_bacteria 2891088606 2891089979 149
24 iso_pu_bacteria 2929199973 2929203319 149
25 iso_pu_bacteria 8055909800 8055910564 149
26 3300005367 Ga0070667_100031464 Ga0070667_1000314646 150
27 3300005539 Ga0068853_100035919 Ga0068853_1000359197 150
28 3300025972 Ga0207668_10498133 Ga0207668_104981333 150
29 3300026041 Ga0207639_10027841 Ga0207639_100278416 150
30 3300031901 Ga0307406_10740705 Ga0307406_107407052 150
31 3300032004 Ga0307414_11179505 Ga0307414_111795052 150
32 3300035695 Ga0373927_0849305 Ga0373927_0849305_32_487 150
33 3300045051 Ga0451576_0002083 Ga0451576_0002083_19444_19896 150
34 3300046528 Ga0495642_0201478 Ga0495642_0201478_382_837 150
35 3300046616 Ga0495668_0101874 Ga0495668_0101874_952_1407 150
36 3300046648 Ga0495611_0013882 Ga0495611_0013882_485_940 150
37 3300047470 Ga0495681_0278580 Ga0495681_0278580_104_559 150
38 3300048919 Ga0496116_0047753 Ga0496116_0047753_1607_2059 150
39 3300048927 Ga0496124_0169676 Ga0496124_0169676_368_820 150
40 3300048927 Ga0496124_0196392 Ga0496124_0196392_897_1349 150
41 3300048928 Ga0496125_0000441 Ga0496125_0000441_39525_39977 150
42 3300049568 Ga0501031_0099971 Ga0501031_0099971_789_1241 150
43 3300049571 Ga0501034_0327128 Ga0501034_0327128_209_661 150
44 3300053087 Ga0500643_006663 Ga0500643_006663_2418_2873 150
45 iso_pu_bacteria 2508501122 2509108157 150
46 iso_pu_bacteria 2509276019 2509376667 150
47 iso_pu_bacteria 2509276021 2509391816 150
48 iso_pu_bacteria 2509276033 2509447329 150
49 iso_pu_bacteria 2510065019 2510134167 150
50 iso_pu_bacteria 2510065057 2510305320 150
51 iso_pu_bacteria 2510461069 2510841357 150
52 iso_pu_bacteria 2510461076 2510895604 150
53 iso_pu_bacteria 2510917022 2511133230 150
54 iso_pu_bacteria 2510917026 2511172874 150
55 iso_pu_bacteria 2510917028 2511182484 150
56 iso_pu_bacteria 2510917030 2511199240 150
57 iso_pu_bacteria 2511231052 2511502456 150
58 iso_pu_bacteria 2512047086 2512533834 150
59 iso_pu_bacteria 2512875026 2512970417 150
60 iso_pu_bacteria 2513237084 2513567753 150
61 iso_pu_bacteria 2513237085 2513577164 150
62 iso_pu_bacteria 2513237088 2513597682 150
63 iso_pu_bacteria 2513237089 2513601481 150
64 iso_pu_bacteria 2513237091 2513618150 150
65 iso_pu_bacteria 2513237093 2513633165 150
66 iso_pu_bacteria 2513237103 2513707838 150
67 iso_pu_bacteria 2513237138 2513865913 150
68 iso_pu_bacteria 2513237140 2513884475 150
69 iso_pu_bacteria 2513237143 2513904483 150
70 iso_pu_bacteria 2513237144 2513908555 150
71 iso_pu_bacteria 2513237146 2513925193 150
72 iso_pu_bacteria 2513237156 2513983678 150
73 iso_pu_bacteria 2513237159 2513997692 150
74 iso_pu_bacteria 2513237160 2514003073 150
75 iso_pu_bacteria 2513237162 2514018084 150
76 iso_pu_bacteria 2515154107 2515609251 150
77 iso_pu_bacteria 2515154113 2515636775 150
78 iso_pu_bacteria 2515154114 2515646359 150
79 iso_pu_bacteria 2515154116 2515655125 150
80 iso_pu_bacteria 2515154134 2515739698 150
81 iso_pu_bacteria 2516143018 2516206197 150
82 iso_pu_bacteria 2516653046 2516893832 150
83 iso_pu_bacteria 2516653077 2517036937 150
84 iso_pu_bacteria 2516653085 2517077294 150
85 iso_pu_bacteria 2517093000 2517096052 150
86 iso_pu_bacteria 2517287029 2517407672 150
87 iso_pu_bacteria 2517487022 2517570545 150
88 iso_pu_bacteria 2519899620 2520377042 150
89 iso_pu_bacteria 2524023207 2524448346 150
90 iso_pu_bacteria 2524023209 2524458843 150
91 iso_pu_bacteria 2534681786 2535484901 150
92 iso_pu_bacteria 2534681796 2535517092 150
93 iso_pu_bacteria 2537561587 2537876325 150
94 iso_pu_bacteria 2554235003 2554248393 150
95 iso_pu_bacteria 2558860100 2558863971 150
96 iso_pu_bacteria 2558860242 2559295509 150
97 iso_pu_bacteria 2558860983 2561469275 150
98 iso_pu_bacteria 2582581283 2585167432 150
99 iso_pu_bacteria 2582581294 2585202005 150
100 iso_pu_bacteria 2582581298 2585223070 150
101 iso_pu_bacteria 2582581299 2585228507 150
102 iso_pu_bacteria 2582581304 2585258284 150
103 iso_pu_bacteria 2582581306 2585265657 150
104 iso_pu_bacteria 2582581307 2585271339 150
105 iso_pu_bacteria 2582581308 2585279278 150
106 iso_pu_bacteria 2582581315 2585323117 150
107 iso_pu_bacteria 2582581316 2585331229 150
108 iso_pu_bacteria 2582581865 2585388862 150
109 iso_pu_bacteria 2582581866 2585395439 150
110 iso_pu_bacteria 2582581867 2585400945 150
111 iso_pu_bacteria 2585427526 2585524722 150
112 iso_pu_bacteria 2585427527 2585531237 150
113 iso_pu_bacteria 2585427528 2585538409 150
114 iso_pu_bacteria 2585427529 2585545653 150
115 iso_pu_bacteria 2585427530 2585552840 150
116 iso_pu_bacteria 2585427531 2585559082 150
117 iso_pu_bacteria 2585427590 2585822152 150
118 iso_pu_bacteria 2585427593 2585836362 150
119 iso_pu_bacteria 2585427594 2585843454 150
120 iso_pu_bacteria 2585427608 2585898463 150
121 iso_pu_bacteria 2585427609 2585903972 150
122 iso_pu_bacteria 2585428125 2587980910 150
123 iso_pu_bacteria 2599185156 2599332003 150
124 iso_pu_bacteria 2599185170 2599417100 150
125 iso_pu_bacteria 2599185210 2599601826 150
126 iso_pu_bacteria 2599185236 2599721594 150
127 iso_pu_bacteria 2599185352 2600194838 150
128 iso_pu_bacteria 2600254933 2600374119 150
129 iso_pu_bacteria 2600255279 2601609918 150
130 iso_pu_bacteria 2600255308 2601746693 150
131 iso_pu_bacteria 2615840624 2616293149 150
132 iso_pu_bacteria 2615840626 2616311445 150
133 iso_pu_bacteria 2615840698 2616554456 150
134 iso_pu_bacteria 2617270742 2617384820 150
135 iso_pu_bacteria 2643221557 2643804208 150
136 iso_pu_bacteria 2643221558 2643811320 150
137 iso_pu_bacteria 2643221568 2643856585 150
138 iso_pu_bacteria 2643221582 2643920175 150
139 iso_pu_bacteria 2643221599 2644007051 150
140 iso_pu_bacteria 2643221607 2644050245 150
141 iso_pu_bacteria 2643221610 2644065018 150
142 iso_pu_bacteria 2643221618 2644105271 150
143 iso_pu_bacteria 2643221626 2644145653 150
144 iso_pu_bacteria 2643221634 2644191830 150
145 iso_pu_bacteria 2643221636 2644204693 150
146 iso_pu_bacteria 2643221637 2644208797 150
147 iso_pu_bacteria 2643221643 2644242553 150
148 iso_pu_bacteria 2643221653 2644298895 150
149 iso_pu_bacteria 2643221655 2644309684 150
150 iso_pu_bacteria 2643221659 2644331148 150
151 iso_pu_bacteria 2643221668 2644376573 150
152 iso_pu_bacteria 2643221675 2644416691 150
153 iso_pu_bacteria 2643221680 2644449731 150
154 iso_pu_bacteria 2643221686 2644483165 150
155 iso_pu_bacteria 2643221688 2644494319 150
156 iso_pu_bacteria 2643221689 2644497812 150
157 iso_pu_bacteria 2643221693 2644521796 150
158 iso_pu_bacteria 2643221698 2644543413 150
159 iso_pu_bacteria 2643221712 2644616208 150
160 iso_pu_bacteria 2643221718 2644652327 150
161 iso_pu_bacteria 2643221719 2644657124 150
162 iso_pu_bacteria 2643221723 2644675831 150
163 iso_pu_bacteria 2643221726 2644689863 150
164 iso_pu_bacteria 2657244999 2657681722 150
165 iso_pu_bacteria 2667528174 2671111224 150
166 iso_pu_bacteria 2690316117 2692315293 150
167 iso_pu_bacteria 2718217882 2719182008 150
168 iso_pu_bacteria 2718217997 2719666368 150
169 iso_pu_bacteria 2718218009 2719732725 150
170 iso_pu_bacteria 2718218199 2720492788 150
171 iso_pu_bacteria 2718218232 2720614256 150
172 iso_pu_bacteria 2718218233 2720621024 150
173 iso_pu_bacteria 2718218235 2720632348 150
174 iso_pu_bacteria 2718218269 2720776076 150
175 iso_pu_bacteria 2718218363 2721148099 150
176 iso_pu_bacteria 2718218365 2721159550 150
177 iso_pu_bacteria 2718218366 2721164935 150
178 iso_pu_bacteria 2721755514 2722841105 150
179 iso_pu_bacteria 2721755556 2723027675 150
180 iso_pu_bacteria 2721755684 2723561303 150
181 iso_pu_bacteria 2721755685 2723567926 150
182 iso_pu_bacteria 2721755810 2724045481 150
183 iso_pu_bacteria 2721755819 2724090683 150
184 iso_pu_bacteria 2721755822 2724105191 150
185 iso_pu_bacteria 2721755823 2724111018 150
186 iso_pu_bacteria 2724679232 2725951385 150
187 iso_pu_bacteria 2728369352 2730108611 150
188 iso_pu_bacteria 2728369365 2730165243 150
189 iso_pu_bacteria 2728369397 2730299182 150
190 iso_pu_bacteria 2738541293 2738800309 150
191 iso_pu_bacteria 2738541317 2738944060 150
192 iso_pu_bacteria 2738541333 2739033050 150
193 iso_pu_bacteria 2751185821 2753462350 150
194 iso_pu_bacteria 2758568016 2758641785 150
195 iso_pu_bacteria 2765235942 2766066093 150
196 iso_pu_bacteria 2775507049 2776914177 150
197 iso_pu_bacteria 2775507266 2778175639 150
198 iso_pu_bacteria 2791355082 2792581434 150
199 iso_pu_bacteria 2791355091 2792620588 150
200 iso_pu_bacteria 2791355092 2792625947 150
201 iso_pu_bacteria 2791355094 2792638886 150
202 iso_pu_bacteria 2791355253 2793280117 150
203 iso_pu_bacteria 2791355256 2793294223 150
204 iso_pu_bacteria 2791355259 2793315878 150
205 iso_pu_bacteria 2791355260 2793319389 150
206 iso_pu_bacteria 2791355261 2793328475 150
207 iso_pu_bacteria 2791355262 2793335433 150
208 iso_pu_bacteria 2791355263 2793339485 150
209 iso_pu_bacteria 2791355264 2793347038 150
210 iso_pu_bacteria 2791355265 2793351630 150
211 iso_pu_bacteria 2791355266 2793361926 150
212 iso_pu_bacteria 2791355267 2793367683 150
213 iso_pu_bacteria 2802428858 2802716773 150
214 iso_pu_bacteria 2802428859 2802725585 150
215 iso_pu_bacteria 2802428860 2802730324 150
216 iso_pu_bacteria 2802428861 2802737705 150
217 iso_pu_bacteria 2802428862 2802742906 150
218 iso_pu_bacteria 2802428863 2802750330 150
219 iso_pu_bacteria 2802429268 2804752909 150
220 iso_pu_bacteria 2802429605 2805926861 150
221 iso_pu_bacteria 2802429606 2805932776 150
222 iso_pu_bacteria 2802429633 2806045189 150
223 iso_pu_bacteria 2802429634 2806050016 150
224 iso_pu_bacteria 2802429635 2806056854 150
225 iso_pu_bacteria 2802429636 2806064235 150
226 iso_pu_bacteria 2802429637 2806071503 150
227 iso_pu_bacteria 2808606387 2808987756 150
228 iso_pu_bacteria 2818991272 2819241098 150
229 iso_pu_bacteria 2818991439 2819559224 150
230 iso_pu_bacteria 2818991448 2819609347 150
231 iso_pu_bacteria 2818991453 2819641341 150
232 iso_pu_bacteria 2818991461 2819685145 150
233 iso_pu_bacteria 2821123053 2821125722 150
234 iso_pu_bacteria 2838016132 2838021666 150
235 iso_pu_bacteria 2838022645 2838023641 150
236 iso_pu_bacteria 2838029111 2838033396 150
237 iso_pu_bacteria 2838035591 2838038693 150
238 iso_pu_bacteria 2838048938 2838053340 150
239 iso_pu_bacteria 2838061910 2838065460 150
240 iso_pu_bacteria 2838068647 2838069939 150
241 iso_pu_bacteria 2838074704 2838079797 150
242 iso_pu_bacteria 2838661181 2838661385 150
243 iso_pu_bacteria 2838668709 2838670571 150
244 iso_pu_bacteria 2838675328 2838675605 150
245 iso_pu_bacteria 2838680041 2838683238 150
246 iso_pu_bacteria 2838686498 2838686833 150
247 iso_pu_bacteria 2838694306 2838697818 150
248 iso_pu_bacteria 2838701080 2838702942 150
249 iso_pu_bacteria 2838707686 2838710933 150
250 iso_pu_bacteria 2838714209 2838714487 150
251 iso_pu_bacteria 2838719591 2838721712 150
252 iso_pu_bacteria 2838724970 2838725247 150
253 iso_pu_bacteria 2838729681 2838730209 150
254 iso_pu_bacteria 2838736955 2838737827 150
255 iso_pu_bacteria 2838742623 2838742776 150
256 iso_pu_bacteria 2841840854 2841841804 150
257 iso_pu_bacteria 2841846520 2841848696 150
258 iso_pu_bacteria 2841851746 2841852279 150
259 iso_pu_bacteria 2841859092 2841862294 150
260 iso_pu_bacteria 2842077413 2842079107 150
261 iso_pu_bacteria 2842110456 2842113045 150
262 iso_pu_bacteria 2842118031 2842118383 150
263 iso_pu_bacteria 2842124991 2842125273 150
264 iso_pu_bacteria 2842130223 2842130500 150
265 iso_pu_bacteria 2842140634 2842141582 150
266 iso_pu_bacteria 2842146304 2842147800 150
267 iso_pu_bacteria 2842152218 2842154330 150
268 iso_pu_bacteria 2842156927 2842158319 150
269 iso_pu_bacteria 2842163707 2842168578 150
270 iso_pu_bacteria 2842170452 2842170729 150
271 iso_pu_bacteria 2842175837 2842177950 150
272 iso_pu_bacteria 2842180545 2842181939 150
273 iso_pu_bacteria 2842187318 2842187596 150
274 iso_pu_bacteria 2842192696 2842195848 150
275 iso_pu_bacteria 2842198810 2842199155 150
276 iso_pu_bacteria 2842205361 2842209605 150
277 iso_pu_bacteria 2842211629 2842211907 150
278 iso_pu_bacteria 2842217011 2842218162 150
279 iso_pu_bacteria 2842224351 2842226474 150
280 iso_pu_bacteria 2842229732 2842230066 150
281 iso_pu_bacteria 2842237096 2842240295 150
282 iso_pu_bacteria 2842243621 2842243955 150
283 iso_pu_bacteria 2842250916 2842252866 150
284 iso_pu_bacteria 2842257432 2842257960 150
285 iso_pu_bacteria 2842264693 2842269496 150
286 iso_pu_bacteria 2842271015 2842271629 150
287 iso_pu_bacteria 2842278818 2842283059 150
288 iso_pu_bacteria 2842285085 2842285393 150
289 iso_pu_bacteria 2842291075 2842292769 150
290 iso_pu_bacteria 2842298080 2842298192 150
291 iso_pu_bacteria 2842304105 2842305260 150
292 iso_pu_bacteria 2842311132 2842314010 150
293 iso_pu_bacteria 2842317721 2842319749 150
294 iso_pu_bacteria 2842357229 2842360208 150
295 iso_pu_bacteria 2842363717 2842370250 150
296 iso_pu_bacteria 2842370503 2842373869 150
297 iso_pu_bacteria 2842377471 2842379166 150
298 iso_pu_bacteria 2842384541 2842384893 150
299 iso_pu_bacteria 2842402390 2842402753 150
300 iso_pu_bacteria 2842409023 2842409876 150
301 iso_pu_bacteria 2842415677 2842416524 150
302 iso_pu_bacteria 2842422224 2842423553 150
303 iso_pu_bacteria 2842428310 2842430502 150
304 iso_pu_bacteria 2842434925 2842436686 150
305 iso_pu_bacteria 2842441272 2842443472 150
306 iso_pu_bacteria 2842447887 2842449342 150
307 iso_pu_bacteria 2842462802 2842466756 150
308 iso_pu_bacteria 2842469257 2842471444 150
309 iso_pu_bacteria 2842475841 2842479938 150
310 iso_pu_bacteria 2842482326 2842483860 150
311 iso_pu_bacteria 2842489311 2842492279 150
312 iso_pu_bacteria 2842495871 2842497861 150
313 iso_pu_bacteria 2842502639 2842505277 150
314 iso_pu_bacteria 2842509118 2842514284 150
315 iso_pu_bacteria 2842515876 2842519078 150
316 iso_pu_bacteria 2842521101 2842522062 150
317 iso_pu_bacteria 2842775625 2842777676 150
318 iso_pu_bacteria 2842922631 2842924338 150
319 iso_pu_bacteria 2844163670 2844164033 150
320 iso_pu_bacteria 2844454524 2844458130 150
321 iso_pu_bacteria 2847417321 2847419648 150
322 iso_pu_bacteria 2848992105 2848994650 150
323 iso_pu_bacteria 2850079185 2850081667 150
324 iso_pu_bacteria 2852387548 2852390469 150
325 iso_pu_bacteria 2854896431 2854901335 150
326 iso_pu_bacteria 2854911287 2854912118 150
327 iso_pu_bacteria 2855825444 2855826557 150
328 iso_pu_bacteria 2855872281 2855877165 150
329 iso_pu_bacteria 2857516855 2857517205 150
330 iso_pu_bacteria 2857531043 2857532283 150
331 iso_pu_bacteria 2858800743 2858803750 150
332 iso_pu_bacteria 2891373044 2891373572 150
333 iso_pu_bacteria 2896384573 2896392101 150
334 iso_pu_bacteria 2899792073 2899794101 150
335 iso_pu_bacteria 2899845264 2899847747 150
336 iso_pu_bacteria 2913295892 2913296101 150
337 iso_pu_bacteria 2913308742 2913313570 150
338 iso_pu_bacteria 2915650412 2915654079 150
339 iso_pu_bacteria 2915980308 2915982886 150
340 iso_pu_bacteria 2915986958 2915989485 150
341 iso_pu_bacteria 2916007675 2916009195 150
342 iso_pu_bacteria 2916041962 2916044326 150
343 iso_pu_bacteria 2916048683 2916050375 150
344 iso_pu_bacteria 2916061851 2916065458 150
345 iso_pu_bacteria 2916068649 2916074655 150
346 iso_pu_bacteria 2916076590 2916078318 150
347 iso_pu_bacteria 2919100787 2919106244 150
348 iso_pu_bacteria 2919114240 2919114523 150
349 iso_pu_bacteria 2919166419 2919169492 150
350 iso_pu_bacteria 2919408235 2919410207 150
351 iso_pu_bacteria 2920760137 2920761319 150
352 iso_pu_bacteria 2920760137 2920762659 150
353 iso_pu_bacteria 2920822456 2920825475 150
354 iso_pu_bacteria 2921250672 2921253734 150
355 iso_pu_bacteria 2921257292 2921261941 150
356 iso_pu_bacteria 2923556063 2923561083 150
357 iso_pu_bacteria 2924150972 2924156775 150
358 iso_pu_bacteria 2924193448 2924196976 150
359 iso_pu_bacteria 2926754445 2926755538 150
360 iso_pu_bacteria 2926760298 2926762666 150
361 iso_pu_bacteria 2933006813 2933008975 150
362 iso_pu_bacteria 2933011516 2933014749 150
363 iso_pu_bacteria 2933016740 2933018204 150
364 iso_pu_bacteria 2933570622 2933571067 150
365 iso_pu_bacteria 2933586486 2933588898 150
366 iso_pu_bacteria 2933594066 2933596430 150
367 iso_pu_bacteria 2933599457 2933600745 150
368 iso_pu_bacteria 2935894831 2935896797 150
369 iso_pu_bacteria 2935901341 2935901739 150
370 iso_pu_bacteria 2936367885 2936371825 150
371 iso_pu_bacteria 2936375103 2936379659 150
372 iso_pu_bacteria 2936996657 2937002713 150
373 iso_pu_bacteria 2937023124 2937027285 150
374 iso_pu_bacteria 2937029754 2937033392 150
375 iso_pu_bacteria 2937036028 2937038430 150
376 iso_pu_bacteria 2937056579 2937057920 150
377 iso_pu_bacteria 2937063883 2937065268 150
378 iso_pu_bacteria 2937078374 2937080638 150
379 iso_pu_bacteria 2937084907 2937091302 150
380 iso_pu_bacteria 2937106411 2937107810 150
381 iso_pu_bacteria 2937113482 2937117732 150
382 iso_pu_bacteria 2941499720 2941504743 150
383 iso_pu_bacteria 2957375807 2957380749 150
384 iso_pu_bacteria 2957382221 2957388538 150
385 iso_pu_bacteria 2957388812 2957394719 150
386 iso_pu_bacteria 2957395598 2957397202 150
387 iso_pu_bacteria 2957415311 2957419003 150
388 iso_pu_bacteria 2957437181 2957439498 150
389 iso_pu_bacteria 2957443900 2957445568 150
390 iso_pu_bacteria 2957457609 2957458737 150
391 iso_pu_bacteria 2957491536 2957493014 150
392 iso_pu_bacteria 2960591022 2960594073 150
393 iso_pu_bacteria 2960610863 2960613155 150
394 iso_pu_bacteria 2960617483 2960619824 150
395 iso_pu_bacteria 2960624210 2960625678 150
396 iso_pu_bacteria 2960631154 2960635574 150
397 iso_pu_bacteria 2960652885 2960656473 150
398 iso_pu_bacteria 2960660292 2960663037 150
399 iso_pu_bacteria 2960667422 2960668053 150
400 iso_pu_bacteria 2960680706 2960680865 150
401 iso_pu_bacteria 2960687367 2960688149 150
402 iso_pu_bacteria 2960693952 2960697323 150
403 iso_pu_bacteria 2964607997 2964608786 150
404 iso_pu_bacteria 2964615318 2964618122 150
405 iso_pu_bacteria 2964698721 2964700139 150
406 iso_pu_bacteria 2964712639 2964717665 150
407 iso_pu_bacteria 2967686174 2967689272 150
408 iso_pu_bacteria 2967693043 2967699529 150
409 iso_pu_bacteria 2967728569 2967729439 150
410 iso_pu_bacteria 2967755722 2967759706 150
411 iso_pu_bacteria 2970026789 2970028070 150
412 iso_pu_bacteria 2970033650 2970036924 150
413 iso_pu_bacteria 2970040964 2970042119 150
414 iso_pu_bacteria 2970047711 2970053661 150
415 iso_pu_bacteria 2970068827 2970073586 150
416 iso_pu_bacteria 2970076120 2970078523 150
417 iso_pu_bacteria 2970082768 2970087450 150
418 iso_pu_bacteria 2970102677 2970104023 150
419 iso_pu_bacteria 2970122695 2970126101 150
420 iso_pu_bacteria 2970129317 2970132045 150
421 iso_pu_bacteria 2970143518 2970147266 150
422 iso_pu_bacteria 2970177841 2970181162 150
423 iso_pu_bacteria 2977516862 2977523195 150
424 iso_pu_bacteria 2977523885 2977524746 150
425 iso_pu_bacteria 2977530762 2977536454 150
426 iso_pu_bacteria 2977544691 2977550416 150
427 iso_pu_bacteria 2977565890 2977572717 150
428 iso_pu_bacteria 2978969890 2978971891 150
429 iso_pu_bacteria 2979089926 2979092021 150
430 iso_pu_bacteria 2979095461 2979100590 150
431 iso_pu_bacteria 2979100975 2979104078 150
432 iso_pu_bacteria 2984509177 2984511351 150
433 iso_pu_bacteria 2984518228 2984522288 150
434 iso_pu_bacteria 2984537506 2984541590 150
435 iso_pu_bacteria 2984587000 2984590176 150
436 iso_pu_bacteria 2984601300 2984603863 150
437 iso_pu_bacteria 2989349275 2989350047 150
438 iso_pu_bacteria 2989771324 2989776011 150
439 iso_pu_bacteria 2989776772 2989779454 150
440 iso_pu_bacteria 2995392953 2995396008 150
441 iso_pu_bacteria 2996887358 2996892826 150
442 iso_pu_bacteria 2996893221 2996894929 150
443 iso_pu_bacteria 3000017691 3000018609 150
444 iso_pu_bacteria 3003930520 3003934460 150
445 iso_pu_bacteria 3005409236 3005414349 150
446 iso_pu_bacteria 3005416602 3005418973 150
447 iso_pu_bacteria 3005445848 3005448663 150
448 iso_pu_bacteria 3005452660 3005454901 150
449 iso_pu_bacteria 643692032 643826545 150
450 iso_pu_bacteria 650716007 650740719 150
451 iso_pu_bacteria 8003570095 8003571793 150
452 iso_pu_bacteria 8003992118 8003994383 150
453 iso_pu_bacteria 8003999396 8004002081 150
454 iso_pu_bacteria 8005246636 8005249937 150
455 iso_pu_bacteria 8005258706 8005259407 150
456 iso_pu_bacteria 8005282627 8005284604 150
457 iso_pu_bacteria 8005289223 8005295727 150
458 iso_pu_bacteria 8005307578 8005309608 150
459 iso_pu_bacteria 8005314921 8005318135 150
460 iso_pu_bacteria 8005321885 8005327353 150
461 iso_pu_bacteria 8005376324 8005381143 150
462 iso_pu_bacteria 8005430974 8005437494 150
463 iso_pu_bacteria 8005484373 8005488988 150
464 iso_pu_bacteria 8005497431 8005501108 150
465 iso_pu_bacteria 8005542996 8005545906 150
466 iso_pu_bacteria 8005556819 8005561435 150
467 iso_pu_bacteria 8005563573 8005568213 150
468 iso_pu_bacteria 8005570704 8005573247 150
469 iso_pu_bacteria 8005619151 8005622475 150
470 iso_pu_bacteria 8005626139 8005629977 150
471 iso_pu_bacteria 8005645114 8005646067 150
472 iso_pu_bacteria 8005658619 8005658852 150
473 iso_pu_bacteria 8005668836 8005672526 150
474 iso_pu_bacteria 8005682033 8005682681 150
475 iso_pu_bacteria 8005695170 8005697623 150
476 iso_pu_bacteria 8018127388 8018127990 150
477 iso_pu_bacteria 8018150411 8018151344 150
478 iso_pu_bacteria 8018163183 8018164355 150
479 iso_pu_bacteria 8023680758 8023682952 150
480 iso_pu_bacteria 8024486573 8024488252 150
481 iso_pu_bacteria 8024501048 8024504646 150
482 iso_pu_bacteria 8045864390 8045865571 150
483 iso_pu_bacteria 8046767195 8046771734 150
484 iso_pu_bacteria 8049293176 8049295515 150
485 iso_pu_bacteria 8054460903 8054463141 150
486 iso_pu_bacteria 8054558443 8054562192 150
487 iso_pu_bacteria 8055431914 8055432393 150
488 iso_pu_bacteria 8056382006 8056384206 150
489 iso_pu_bacteria 8056875544 8056875761 150
490 iso_pu_bacteria 8057575449 8057575488 150
491 iso_pu_bacteria 8057874678 8057879873 150
492 3300005937 Ga0081455_10019611 Ga0081455_100196111 151
493 3300006914 Ga0075436_100176072 Ga0075436_1001760722 151
494 3300007788 Ga0099795_10351282 Ga0099795_103512822 151
495 3300013105 Ga0157369_10223647 Ga0157369_102236472 151
496 3300021388 Ga0213875_10002041 Ga0213875_100020417 151
497 3300025912 Ga0207707_11428980 Ga0207707_114289801 151
498 3300032005 Ga0307411_10905437 Ga0307411_109054372 151
499 3300037312 Ga0395899_0037181 Ga0395899_0037181_718_1173 151
500 3300037312 Ga0395899_0040984 Ga0395899_0040984_667_1122 151
501 3300037418 Ga0395900_0079907 Ga0395900_0079907_557_1012 151
502 3300037418 Ga0395900_0102233 Ga0395900_0102233_2034_2489 151
503 3300037466 Ga0395898_0009045 Ga0395898_0009045_5829_6284 151
504 3300037466 Ga0395898_0019247 Ga0395898_0019247_749_1204 151
505 3300037853 Ga0436364_1142809 Ga0436364_1142809_31782_32237 151
506 3300038443 Ga0395901_0276823 Ga0395901_0276823_98_553 151
507 3300038443 Ga0395901_0331860 Ga0395901_0331860_492_947 151
508 3300044842 Ga0466957_0017737 Ga0466957_0017737_3572_4027 151
509 3300047472 Ga0495686_0322597 Ga0495686_0322597_71_544 151
510 3300049586 Ga0501070_1196288 Ga0501070_1196288_85_540 151
511 3300049742 Ga0501080_0310242 Ga0501080_0310242_810_1265 151
512 3300050510 nmdc:mga06r32_954463_c1 nmdc:mga06r32_954463_c1_113_586 151
513 3300050514 nmdc:mga08x19_237661_c1 nmdc:mga08x19_237661_c1_23_478 151
514 iso_pu_bacteria 2838042994 2838045179 151
515 iso_pu_bacteria 2841864319 2841867168 151
516 iso_pu_bacteria 2842341865 2842348473 151
517 iso_pu_bacteria 2936381700 2936387829 151
518 iso_pu_bacteria 639633055 639649392 151
519 iso_pu_bacteria 8005301065 8005303339 151
520 iso_pu_bacteria 8005382845 8005388903 151
521 iso_pu_bacteria 8005395548 8005395887 151
522 iso_pu_bacteria 8005688590 8005691889 151
523 iso_pu_bacteria 8024479707 8024482647 151
524 iso_pu_bacteria 8056375014 8056378352 151
525 3300003203 JGI25406J46586_10003554 JGI25406J46586_100035544 152
526 3300005445 Ga0070708_100296775 Ga0070708_1002967752 152
527 3300005467 Ga0070706_100046586 Ga0070706_1000465863 152
528 3300005471 Ga0070698_100036273 Ga0070698_1000362733 152
529 3300005518 Ga0070699_100110489 Ga0070699_1001104892 152
530 3300005937 Ga0081455_10000538 Ga0081455_100005385 152
531 3300005985 Ga0081539_10000572 Ga0081539_1000057236 152
532 3300006038 Ga0075365_10068903 Ga0075365_100689032 152
533 3300006038 Ga0075365_10356132 Ga0075365_103561322 152
534 3300006051 Ga0075364_10024817 Ga0075364_100248172 152
535 3300006051 Ga0075364_10030331 Ga0075364_100303312 152
536 3300006178 Ga0075367_10371372 Ga0075367_103713722 152
537 3300006186 Ga0075369_10010204 Ga0075369_100102044 152
538 3300006186 Ga0075369_10061641 Ga0075369_100616412 152
539 3300006353 Ga0075370_10243232 Ga0075370_102432322 152
540 3300010159 Ga0099796_10100096 Ga0099796_101000962 152
541 3300027671 Ga0209588_1077228 Ga0209588_10772282 152
542 3300035116 Ga0373945_0483619 Ga0373945_0483619_64_522 152
543 3300035170 Ga0373943_0074066 Ga0373943_0074066_864_1322 152
544 3300035692 Ga0373935_0010890 Ga0373935_0010890_3897_4355 152
545 3300039062 Ga0400483_144045 Ga0400483_144045_1838_2299 152
546 3300039062 Ga0400483_213761 Ga0400483_213761_355_819 152
547 3300039438 Ga0436360_1052595 Ga0436360_1052595_413_871 152
548 3300039447 Ga0436361_0187853 Ga0436361_0187853_1802_2272 152
549 3300039450 Ga0436363_1351969 Ga0436363_1351969_489_947 152
550 3300039453 Ga0436362_0783924 Ga0436362_0783924_61_519 152
551 3300048919 Ga0496116_0031701 Ga0496116_0031701_2782_3240 152
552 3300048920 Ga0496117_0156739 Ga0496117_0156739_611_1069 152
553 3300048921 Ga0496118_0141386 Ga0496118_0141386_656_1114 152
554 3300048922 Ga0496119_0141554 Ga0496119_0141554_404_862 152
555 3300048923 Ga0496120_0023586 Ga0496120_0023586_321_779 152
556 3300048923 Ga0496120_0092898 Ga0496120_0092898_34_492 152
557 3300048924 Ga0496121_0000003 Ga0496121_0000003_553908_554366 152
558 3300048926 Ga0496123_0044556 Ga0496123_0044556_2548_3006 152
559 3300048927 Ga0496124_0000067 Ga0496124_0000067_200391_200849 152
560 3300048928 Ga0496125_0000786 Ga0496125_0000786_37702_38160 152
561 3300048929 Ga0496126_0060889 Ga0496126_0060889_2876_3334 152
562 3300048929 Ga0496126_0531684 Ga0496126_0531684_451_909 152
563 3300048929 Ga0496126_0852853 Ga0496126_0852853_210_668 152
564 3300050489 nmdc:mga03683_240320_c1 nmdc:mga03683_240320_c1_338_799 152
565 3300050489 nmdc:mga03683_858_c1 nmdc:mga03683_858_c1_6995_7486 152
566 3300050491 nmdc:mga00v17_209459_c1 nmdc:mga00v17_209459_c1_30_491 152
567 3300050491 nmdc:mga00v17_414573_c1 nmdc:mga00v17_414573_c1_177_638 152
568 3300050492 nmdc:mga0yw44_31619_c1 nmdc:mga0yw44_31619_c1_327_788 152
569 3300050494 nmdc:mga06z11_196570_c1 nmdc:mga06z11_196570_c1_447_908 152
570 3300050516 nmdc:mga0sz30_7993_c1 nmdc:mga0sz30_7993_c1_1884_2345 152
571 3300050516 nmdc:mga0sz30_84103_c1 nmdc:mga0sz30_84103_c1_552_1013 152
572 3300053088 Ga0500644_0157381 Ga0500644_0157381_72_530 152
573 3300053092 Ga0500583_0343685 Ga0500583_0343685_13_474 152
574 3300053093 Ga0500651_0345810 Ga0500651_0345810_63_524 152
575 3300053121 Ga0500607_180670 Ga0500607_180670_68_526 152
576 3300053130 Ga0500642_0256169 Ga0500642_0256169_307_768 152
577 3300053153 Ga0500616_0002766 Ga0500616_0002766_5529_5990 152
578 3300053155 Ga0500620_007914 Ga0500620_007914_1801_2262 152
579 3300053161 Ga0500634_0013063 Ga0500634_0013063_964_1422 152
580 iso_pu_bacteria 2894772417 2894776970 152
581 3300003781 Ga0055536_1003481 Ga0055536_10034819 153
582 3300021384 Ga0213876_10199775 Ga0213876_101997752 153
583 3300025292 Ga0209676_1000197 Ga0209676_10001973 153
584 3300031239 Ga0265328_10000189 Ga0265328_1000018928 153
585 3300031251 Ga0265327_10002688 Ga0265327_1000268813 153
586 3300031712 Ga0265342_10295511 Ga0265342_102955112 153
587 3300039437 Ga0436365_0243032 Ga0436365_0243032_395_859 153
588 3300039450 Ga0436363_1027101 Ga0436363_1027101_355_819 153
589 3300044683 Ga0466965_0694794 Ga0466965_0694794_24_485 153
590 3300048908 Ga0496105_0022766 Ga0496105_0022766_816_1292 153
591 3300048915 Ga0496112_0017743 Ga0496112_0017743_6063_6539 153
592 3300049581 Ga0501047_0221955 Ga0501047_0221955_1088_1549 153
593 iso_pu_bacteria 2643221651 2644288418 153
594 3300001979 JGI24740J21852_10003638 JGI24740J21852_100036382 154
595 3300001989 JGI24739J22299_10033117 JGI24739J22299_100331171 154
596 3300002704 JGI25155J39150_1000014 JGI25155J39150_100001477 154
597 3300002705 JGI25156J39149_1000037 JGI25156J39149_100003734 154
598 3300002705 JGI25156J39149_1000079 JGI25156J39149_100007953 154
599 3300002737 JGI25162J39368_1000497 JGI25162J39368_10004972 154
600 3300002737 JGI25162J39368_1000992 JGI25162J39368_100099212 154
601 3300002738 JGI25154J39366_1000052 JGI25154J39366_100005287 154
602 3300002739 JGI25158J39367_1000499 JGI25158J39367_10004996 154
603 3300002741 JGI25157J39369_1000040 JGI25157J39369_100004075 154
604 3300002773 JGI25152J39213_1001025 JGI25152J39213_10010253 154
605 3300002773 JGI25152J39213_1002772 JGI25152J39213_10027724 154
606 3300002773 JGI25152J39213_1004429 JGI25152J39213_10044292 154
607 3300002773 JGI25152J39213_1020840 JGI25152J39213_10208402 154
608 3300002773 JGI25152J39213_1029794 JGI25152J39213_10297941 154
609 3300002774 JGI25150J39212_1000088 JGI25150J39212_10000885 154
610 3300002774 JGI25150J39212_1015270 JGI25150J39212_10152702 154
611 3300002774 JGI25150J39212_1027871 JGI25150J39212_10278712 154
612 3300002987 JGI25159J45721_1000004 JGI25159J45721_100000473 154
613 3300002987 JGI25159J45721_1001399 JGI25159J45721_10013992 154
614 3300002987 JGI25159J45721_1006965 JGI25159J45721_10069653 154
615 3300003187 JGI25151J46595_10000215 JGI25151J46595_1000021547 154
616 3300003187 JGI25151J46595_10000280 JGI25151J46595_1000028056 154
617 3300003187 JGI25151J46595_10005849 JGI25151J46595_100058494 154
618 3300003187 JGI25151J46595_10006069 JGI25151J46595_100060693 154
619 3300003187 JGI25151J46595_10024325 JGI25151J46595_100243251 154
620 3300003187 JGI25151J46595_10024843 JGI25151J46595_100248432 154
621 3300003187 JGI25151J46595_10038793 JGI25151J46595_100387933 154
622 3300003187 JGI25151J46595_10052475 JGI25151J46595_100524751 154
623 3300003187 JGI25151J46595_10065287 JGI25151J46595_100652872 154
624 3300003187 JGI25151J46595_10129791 JGI25151J46595_101297911 154
625 3300003214 JGI25165J46597_1000371 JGI25165J46597_10003716 154
626 3300003214 JGI25165J46597_1000462 JGI25165J46597_10004628 154
627 3300003214 JGI25165J46597_1005670 JGI25165J46597_10056701 154
628 3300003215 JGI25153J46596_10001244 JGI25153J46596_1000124415 154
629 3300003215 JGI25153J46596_10007382 JGI25153J46596_100073823 154
630 3300003215 JGI25153J46596_10017172 JGI25153J46596_100171723 154
631 3300003215 JGI25153J46596_10032466 JGI25153J46596_100324662 154
632 3300003323 rootH1_10177570 rootH1_101775701 154
633 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001407 154
634 3300003354 JGI25160J50197_1000021 JGI25160J50197_1000021136 154
635 3300003354 JGI25160J50197_1001207 JGI25160J50197_10012073 154
636 3300003354 JGI25160J50197_1011565 JGI25160J50197_10115652 154
637 3300003354 JGI25160J50197_1022474 JGI25160J50197_10224742 154
638 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001351 154
639 3300003374 JGI25161J50226_1000283 JGI25161J50226_100028323 154
640 3300003374 JGI25161J50226_1000307 JGI25161J50226_100030714 154
641 3300003374 JGI25161J50226_1016692 JGI25161J50226_10166921 154
642 3300003578 Ga0006562J51391_1004630 Ga0006562J51391_10046303 154
643 3300003578 Ga0006562J51391_1004633 Ga0006562J51391_10046332 154
644 3300003759 Ga0055525_1019223 Ga0055525_10192231 154
645 3300003763 Ga0055529_1005549 Ga0055529_10055492 154
646 3300003771 Ga0055526_1001084 Ga0055526_100108414 154
647 3300003771 Ga0055526_1002599 Ga0055526_100259914 154
648 3300003771 Ga0055526_1004226 Ga0055526_10042266 154
649 3300003771 Ga0055526_1013834 Ga0055526_10138342 154
650 3300003771 Ga0055526_1042781 Ga0055526_10427812 154
651 3300003775 Ga0055524_1002465 Ga0055524_10024656 154
652 3300003775 Ga0055524_1004489 Ga0055524_10044895 154
653 3300003775 Ga0055524_1004911 Ga0055524_10049114 154
654 3300003775 Ga0055524_1009251 Ga0055524_10092515 154
655 3300003775 Ga0055524_1011052 Ga0055524_10110525 154
656 3300003775 Ga0055524_1025442 Ga0055524_10254422 154
657 3300003781 Ga0055536_1009272 Ga0055536_10092724 154
658 3300003790 Ga0055528_1000549 Ga0055528_10005495 154
659 3300003790 Ga0055528_1001077 Ga0055528_100107713 154
660 3300003790 Ga0055528_1009596 Ga0055528_10095963 154
661 3300003790 Ga0055528_1025209 Ga0055528_10252092 154
662 3300003790 Ga0055528_1036530 Ga0055528_10365301 154
663 3300003791 Ga0055530_10007952 Ga0055530_100079524 154
664 3300003792 Ga0055540_1000766 Ga0055540_10007662 154
665 3300003792 Ga0055540_1005952 Ga0055540_10059525 154
666 3300003792 Ga0055540_1011443 Ga0055540_10114433 154
667 3300003792 Ga0055540_1033758 Ga0055540_10337582 154
668 3300003792 Ga0055540_1046310 Ga0055540_10463102 154
669 3300003794 Ga0055531_10002883 Ga0055531_100028835 154
670 3300003794 Ga0055531_10028376 Ga0055531_100283761 154
671 3300003856 Ga0058692_1010152 Ga0058692_10101522 154
672 3300003856 Ga0058692_1010285 Ga0058692_10102853 154
673 3300004625 Ga0055543_1000003 Ga0055543_1000003367 154
674 3300004625 Ga0055543_1000060 Ga0055543_100006092 154
675 3300004625 Ga0055543_1000311 Ga0055543_10003115 154
676 3300004625 Ga0055543_1000705 Ga0055543_10007055 154
677 3300005262 Ga0065165_1000008 Ga0065165_100000846 154
678 3300005262 Ga0065165_1000033 Ga0065165_1000033136 154
679 3300005262 Ga0065165_1007477 Ga0065165_10074772 154
680 3300005262 Ga0065165_1012806 Ga0065165_10128062 154
681 3300005262 Ga0065165_1033757 Ga0065165_10337572 154
682 3300005262 Ga0065165_1081691 Ga0065165_10816911 154
683 3300005337 Ga0070682_100162700 Ga0070682_1001627002 154
684 3300005340 Ga0070689_101665527 Ga0070689_1016655271 154
685 3300005347 Ga0070668_100310520 Ga0070668_1003105201 154
686 3300005347 Ga0070668_100394043 Ga0070668_1003940432 154
687 3300005347 Ga0070668_101312432 Ga0070668_1013124321 154
688 3300005353 Ga0070669_100105433 Ga0070669_1001054331 154
689 3300005353 Ga0070669_100260722 Ga0070669_1002607223 154
690 3300005353 Ga0070669_100329913 Ga0070669_1003299131 154
691 3300005355 Ga0070671_100455684 Ga0070671_1004556842 154
692 3300005356 Ga0070674_100695063 Ga0070674_1006950632 154
693 3300005367 Ga0070667_100781626 Ga0070667_1007816262 154
694 3300005455 Ga0070663_100067010 Ga0070663_1000670103 154
695 3300005543 Ga0070672_101009375 Ga0070672_1010093752 154
696 3300005544 Ga0070686_100138518 Ga0070686_1001385182 154
697 3300005548 Ga0070665_100002486 Ga0070665_10000248618 154
698 3300005548 Ga0070665_100070536 Ga0070665_1000705361 154
699 3300005548 Ga0070665_100172205 Ga0070665_1001722052 154
700 3300005548 Ga0070665_100582613 Ga0070665_1005826132 154
701 3300005548 Ga0070665_100693459 Ga0070665_1006934591 154
702 3300005548 Ga0070665_100800135 Ga0070665_1008001351 154
703 3300005563 Ga0068855_100727602 Ga0068855_1007276022 154
704 3300005578 Ga0068854_100069462 Ga0068854_1000694622 154
705 3300005614 Ga0068856_100224261 Ga0068856_1002242613 154
706 3300005614 Ga0068856_100251105 Ga0068856_1002511052 154
707 3300005834 Ga0068851_10068800 Ga0068851_100688002 154
708 3300006038 Ga0075365_10002452 Ga0075365_100024524 154
709 3300006038 Ga0075365_10017736 Ga0075365_100177363 154
710 3300006042 Ga0075368_10041228 Ga0075368_100412282 154
711 3300006048 Ga0075363_100123831 Ga0075363_1001238312 154
712 3300006048 Ga0075363_100185340 Ga0075363_1001853402 154
713 3300006048 Ga0075363_100483201 Ga0075363_1004832012 154
714 3300006051 Ga0075364_10002108 Ga0075364_1000210810 154
715 3300006051 Ga0075364_10099563 Ga0075364_100995633 154
716 3300006051 Ga0075364_10466317 Ga0075364_104663172 154
717 3300006051 Ga0075364_10585114 Ga0075364_105851141 154
718 3300006177 Ga0075362_10000446 Ga0075362_1000044610 154
719 3300006177 Ga0075362_10050960 Ga0075362_100509602 154
720 3300006177 Ga0075362_10383312 Ga0075362_103833122 154
721 3300006178 Ga0075367_10005571 Ga0075367_100055715 154
722 3300006178 Ga0075367_10047982 Ga0075367_100479823 154
723 3300006178 Ga0075367_10199637 Ga0075367_101996372 154
724 3300006178 Ga0075367_10312320 Ga0075367_103123202 154
725 3300006178 Ga0075367_10334879 Ga0075367_103348792 154
726 3300006186 Ga0075369_10021611 Ga0075369_100216113 154
727 3300006186 Ga0075369_10035009 Ga0075369_100350092 154
728 3300006186 Ga0075369_10060746 Ga0075369_100607462 154
729 3300006195 Ga0075366_10003015 Ga0075366_100030154 154
730 3300006195 Ga0075366_10122371 Ga0075366_101223712 154
731 3300006353 Ga0075370_10045499 Ga0075370_100454993 154
732 3300006353 Ga0075370_10272640 Ga0075370_102726402 154
733 3300006846 Ga0075430_100226040 Ga0075430_1002260401 154
734 3300006847 Ga0075431_100006441 Ga0075431_1000064415 154
735 3300006880 Ga0075429_100055477 Ga0075429_1000554773 154
736 3300006881 Ga0068865_100639961 Ga0068865_1006399612 154
737 3300006881 Ga0068865_100989888 Ga0068865_1009898882 154
738 3300006946 Ga0079104_1000884 Ga0079104_10008845 154
739 3300006946 Ga0079104_1002263 Ga0079104_10022632 154
740 3300006948 Ga0099826_10010998 Ga0099826_100109984 154
741 3300009011 Ga0105251_10006266 Ga0105251_100062663 154
742 3300009036 Ga0105244_10117156 Ga0105244_101171562 154
743 3300009036 Ga0105244_10134460 Ga0105244_101344602 154
744 3300009092 Ga0105250_10044154 Ga0105250_100441543 154
745 3300009093 Ga0105240_10000014 Ga0105240_10000014306 154
746 3300009093 Ga0105240_10607559 Ga0105240_106075592 154
747 3300009093 Ga0105240_10819328 Ga0105240_108193282 154
748 3300009094 Ga0111539_10260506 Ga0111539_102605061 154
749 3300009101 Ga0105247_10202228 Ga0105247_102022281 154
750 3300009147 Ga0114129_10003089 Ga0114129_100030892 154
751 3300009148 Ga0105243_10012270 Ga0105243_100122705 154
752 3300009148 Ga0105243_11125546 Ga0105243_111255462 154
753 3300009177 Ga0105248_10019194 Ga0105248_100191945 154
754 3300009545 Ga0105237_10003542 Ga0105237_1000354215 154
755 3300009545 Ga0105237_10268463 Ga0105237_102684632 154
756 3300009551 Ga0105238_10089717 Ga0105238_100897175 154
757 3300009551 Ga0105238_10470719 Ga0105238_104707192 154
758 3300009551 Ga0105238_10596547 Ga0105238_105965472 154
759 3300009553 Ga0105249_11610098 Ga0105249_116100982 154
760 3300009765 Ga0123341_1000112 Ga0123341_100011216 154
761 3300009766 Ga0123342_1016639 Ga0123342_10166392 154
762 3300010375 Ga0105239_10000973 Ga0105239_1000097336 154
763 3300010375 Ga0105239_11650850 Ga0105239_116508502 154
764 3300012490 Ga0157322_1002866 Ga0157322_10028662 154
765 3300012500 Ga0157314_1015773 Ga0157314_10157732 154
766 3300013100 Ga0157373_10013476 Ga0157373_100134768 154
767 3300013100 Ga0157373_10018335 Ga0157373_100183352 154
768 3300013100 Ga0157373_10062061 Ga0157373_100620614 154
769 3300013102 Ga0157371_10000017 Ga0157371_10000017225 154
770 3300013102 Ga0157371_10029204 Ga0157371_100292043 154
771 3300013104 Ga0157370_10000327 Ga0157370_1000032716 154
772 3300013104 Ga0157370_10000616 Ga0157370_1000061619 154
773 3300013104 Ga0157370_10767920 Ga0157370_107679201 154
774 3300013105 Ga0157369_10221130 Ga0157369_102211302 154
775 3300013105 Ga0157369_10432196 Ga0157369_104321962 154
776 3300013105 Ga0157369_10661356 Ga0157369_106613562 154
777 3300013105 Ga0157369_10718552 Ga0157369_107185522 154
778 3300013249 Ga0171463_1007 Ga0171463_100734 154
779 3300013306 Ga0163162_10328425 Ga0163162_103284252 154
780 3300014497 Ga0182008_10017060 Ga0182008_100170603 154
781 3300015262 Ga0182007_10002083 Ga0182007_100020834 154
782 3300015265 Ga0182005_1001327 Ga0182005_10013274 154
783 3300015690 Ga0183363_1049 Ga0183363_104912 154
784 3300017792 Ga0163161_10941000 Ga0163161_109410001 154
785 3300021320 Ga0214544_1000110 Ga0214544_100011096 154
786 3300021321 Ga0214542_1000268 Ga0214542_100026870 154
787 3300021321 Ga0214542_1013594 Ga0214542_10135949 154
788 3300021327 Ga0214543_1000022 Ga0214543_100002292 154
789 3300021327 Ga0214543_1000219 Ga0214543_100021971 154
790 3300021361 Ga0213872_10033273 Ga0213872_100332733 154
791 3300021384 Ga0213876_10003111 Ga0213876_100031119 154
792 3300021441 Ga0213871_10060080 Ga0213871_100600802 154
793 3300022739 Ga0228711_1000026 Ga0228711_100002627 154
794 3300022740 Ga0228710_1000005 Ga0228710_1000005101 154
795 3300025206 Ga0209435_100027 Ga0209435_10002775 154
796 3300025207 Ga0209760_105271 Ga0209760_1052712 154
797 3300025208 Ga0209436_100061 Ga0209436_10006131 154
798 3300025208 Ga0209436_100422 Ga0209436_10042213 154
799 3300025208 Ga0209436_109886 Ga0209436_1098862 154
800 3300025228 Ga0209672_115973 Ga0209672_1159732 154
801 3300025230 Ga0209563_104435 Ga0209563_1044354 154
802 3300025233 Ga0209437_100051 Ga0209437_10005185 154
803 3300025233 Ga0209437_100060 Ga0209437_100060307 154
804 3300025245 Ga0207425_1000432 Ga0207425_10004326 154
805 3300025245 Ga0207425_1004652 Ga0207425_10046525 154
806 3300025245 Ga0207425_1004982 Ga0207425_10049825 154
807 3300025245 Ga0207425_1017504 Ga0207425_10175042 154
808 3300025246 Ga0209646_1000086 Ga0209646_100008675 154
809 3300025250 Ga0209026_1000082 Ga0209026_100008275 154
810 3300025253 Ga0209677_100273 Ga0209677_10027326 154
811 3300025254 Ga0209148_1000588 Ga0209148_100058812 154
812 3300025254 Ga0209148_1009991 Ga0209148_10099912 154
813 3300025256 Ga0209759_1000063 Ga0209759_1000063126 154
814 3300025258 Ga0209129_1000029 Ga0209129_1000029375 154
815 3300025258 Ga0209129_1000307 Ga0209129_100030747 154
816 3300025258 Ga0209129_1000433 Ga0209129_100043319 154
817 3300025258 Ga0209129_1001238 Ga0209129_100123815 154
818 3300025258 Ga0209129_1003217 Ga0209129_10032173 154
819 3300025258 Ga0209129_1006305 Ga0209129_10063053 154
820 3300025258 Ga0209129_1006840 Ga0209129_10068404 154
821 3300025258 Ga0209129_1028875 Ga0209129_10288752 154
822 3300025261 Ga0209233_1000095 Ga0209233_100009579 154
823 3300025261 Ga0209233_1000190 Ga0209233_100019054 154
824 3300025261 Ga0209233_1000228 Ga0209233_10002284 154
825 3300025263 Ga0209565_1023059 Ga0209565_10230591 154
826 3300025263 Ga0209565_1024878 Ga0209565_10248782 154
827 3300025272 Ga0209455_1000334 Ga0209455_10003348 154
828 3300025273 Ga0209673_1000010 Ga0209673_1000010471 154
829 3300025273 Ga0209673_1000025 Ga0209673_1000025217 154
830 3300025273 Ga0209673_1000112 Ga0209673_10001122 154
831 3300025273 Ga0209673_1000858 Ga0209673_100085835 154
832 3300025273 Ga0209673_1003176 Ga0209673_10031768 154
833 3300025273 Ga0209673_1003674 Ga0209673_10036742 154
834 3300025273 Ga0209673_1006098 Ga0209673_10060985 154
835 3300025273 Ga0209673_1013587 Ga0209673_10135872 154
836 3300025273 Ga0209673_1030287 Ga0209673_10302873 154
837 3300025284 Ga0209130_1000003 Ga0209130_1000003367 154
838 3300025284 Ga0209130_1000017 Ga0209130_1000017247 154
839 3300025284 Ga0209130_1000020 Ga0209130_100002037 154
840 3300025284 Ga0209130_1042962 Ga0209130_10429622 154
841 3300025291 Ga0209675_1049955 Ga0209675_10499552 154
842 3300025292 Ga0209676_1005472 Ga0209676_10054725 154
843 3300025292 Ga0209676_1009017 Ga0209676_10090174 154
844 3300025292 Ga0209676_1034629 Ga0209676_10346291 154
845 3300025292 Ga0209676_1066449 Ga0209676_10664492 154
846 3300025294 Ga0209025_1000070 Ga0209025_10000706 154
847 3300025294 Ga0209025_1000091 Ga0209025_1000091116 154
848 3300025294 Ga0209025_1000154 Ga0209025_1000154142 154
849 3300025294 Ga0209025_1000161 Ga0209025_100016173 154
850 3300025294 Ga0209025_1000171 Ga0209025_100017152 154
851 3300025294 Ga0209025_1000927 Ga0209025_10009278 154
852 3300025294 Ga0209025_1002842 Ga0209025_100284214 154
853 3300025294 Ga0209025_1007846 Ga0209025_10078464 154
854 3300025294 Ga0209025_1011929 Ga0209025_10119291 154
855 3300025294 Ga0209025_1014918 Ga0209025_10149183 154
856 3300025294 Ga0209025_1028907 Ga0209025_10289072 154
857 3300025294 Ga0209025_1035289 Ga0209025_10352891 154
858 3300025295 Ga0209564_1000013 Ga0209564_1000013694 154
859 3300025295 Ga0209564_1000265 Ga0209564_100026548 154
860 3300025295 Ga0209564_1000607 Ga0209564_100060719 154
861 3300025295 Ga0209564_1001968 Ga0209564_10019685 154
862 3300025295 Ga0209564_1008091 Ga0209564_10080912 154
863 3300025295 Ga0209564_1012456 Ga0209564_10124565 154
864 3300025295 Ga0209564_1025637 Ga0209564_10256372 154
865 3300025297 Ga0209758_1000058 Ga0209758_100005848 154
866 3300025297 Ga0209758_1000094 Ga0209758_1000094228 154
867 3300025297 Ga0209758_1000671 Ga0209758_100067117 154
868 3300025297 Ga0209758_1005284 Ga0209758_10052845 154
869 3300025297 Ga0209758_1012944 Ga0209758_10129443 154
870 3300025297 Ga0209758_1013086 Ga0209758_10130863 154
871 3300025297 Ga0209758_1019706 Ga0209758_10197061 154
872 3300025297 Ga0209758_1020944 Ga0209758_10209444 154
873 3300025297 Ga0209758_1036138 Ga0209758_10361382 154
874 3300025297 Ga0209758_1043460 Ga0209758_10434603 154
875 3300025298 Ga0209050_1002996 Ga0209050_10029968 154
876 3300025298 Ga0209050_1005559 Ga0209050_10055596 154
877 3300025298 Ga0209050_1005667 Ga0209050_10056673 154
878 3300025299 Ga0209256_1000153 Ga0209256_100015368 154
879 3300025299 Ga0209256_1000381 Ga0209256_100038141 154
880 3300025299 Ga0209256_1000655 Ga0209256_100065545 154
881 3300025299 Ga0209256_1001163 Ga0209256_100116321 154
882 3300025299 Ga0209256_1002016 Ga0209256_100201613 154
883 3300025299 Ga0209256_1004610 Ga0209256_10046103 154
884 3300025299 Ga0209256_1019160 Ga0209256_10191601 154
885 3300025299 Ga0209256_1031417 Ga0209256_10314171 154
886 3300025299 Ga0209256_1033906 Ga0209256_10339062 154
887 3300025302 Ga0207426_1000006 Ga0207426_1000006246 154
888 3300025302 Ga0207426_1000008 Ga0207426_1000008106 154
889 3300025302 Ga0207426_1000011 Ga0207426_1000011408 154
890 3300025302 Ga0207426_1000344 Ga0207426_10003445 154
891 3300025302 Ga0207426_1001833 Ga0207426_10018336 154
892 3300025303 Ga0209051_1001157 Ga0209051_10011575 154
893 3300025303 Ga0209051_1001614 Ga0209051_10016142 154
894 3300025303 Ga0209051_1014703 Ga0209051_10147035 154
895 3300025303 Ga0209051_1019573 Ga0209051_10195732 154
896 3300025303 Ga0209051_1052327 Ga0209051_10523272 154
897 3300025303 Ga0209051_1109753 Ga0209051_11097532 154
898 3300025304 Ga0209257_1002974 Ga0209257_100297412 154
899 3300025304 Ga0209257_1008365 Ga0209257_10083655 154
900 3300025304 Ga0209257_1013242 Ga0209257_10132425 154
901 3300025304 Ga0209257_1015197 Ga0209257_10151973 154
902 3300025711 Ga0207696_1096477 Ga0207696_10964772 154
903 3300025728 Ga0207655_1139394 Ga0207655_11393942 154
904 3300025735 Ga0207713_1047877 Ga0207713_10478772 154
905 3300025912 Ga0207707_10502268 Ga0207707_105022682 154
906 3300025913 Ga0207695_10000037 Ga0207695_10000037308 154
907 3300025913 Ga0207695_10117657 Ga0207695_101176572 154
908 3300025913 Ga0207695_10211115 Ga0207695_102111153 154
909 3300025913 Ga0207695_10631791 Ga0207695_106317912 154
910 3300025913 Ga0207695_10920776 Ga0207695_109207762 154
911 3300025914 Ga0207671_10000271 Ga0207671_1000027130 154
912 3300025914 Ga0207671_10210143 Ga0207671_102101432 154
913 3300025920 Ga0207649_11356407 Ga0207649_113564071 154
914 3300025921 Ga0207652_10291240 Ga0207652_102912402 154
915 3300025923 Ga0207681_10683505 Ga0207681_106835051 154
916 3300025924 Ga0207694_10002909 Ga0207694_100029092 154
917 3300025924 Ga0207694_10498678 Ga0207694_104986782 154
918 3300025924 Ga0207694_10518221 Ga0207694_105182212 154
919 3300025925 Ga0207650_10000911 Ga0207650_1000091117 154
920 3300025925 Ga0207650_10078116 Ga0207650_100781164 154
921 3300025926 Ga0207659_10146647 Ga0207659_101466472 154
922 3300025931 Ga0207644_10071576 Ga0207644_100715762 154
923 3300025933 Ga0207706_10231682 Ga0207706_102316822 154
924 3300025933 Ga0207706_10439739 Ga0207706_104397392 154
925 3300025938 Ga0207704_10550465 Ga0207704_105504651 154
926 3300025940 Ga0207691_10279013 Ga0207691_102790131 154
927 3300025941 Ga0207711_10231808 Ga0207711_102318082 154
928 3300025972 Ga0207668_10068654 Ga0207668_100686544 154
929 3300025972 Ga0207668_11110420 Ga0207668_111104201 154
930 3300025981 Ga0207640_10052246 Ga0207640_100522463 154
931 3300025981 Ga0207640_10198771 Ga0207640_101987712 154
932 3300025986 Ga0207658_10627719 Ga0207658_106277192 154
933 3300026067 Ga0207678_10053726 Ga0207678_100537262 154
934 3300026078 Ga0207702_10877792 Ga0207702_108777922 154
935 3300026078 Ga0207702_11820460 Ga0207702_118204601 154
936 3300026142 Ga0207698_10314980 Ga0207698_103149802 154
937 3300027111 Ga0209281_1000034 Ga0209281_1000034257 154
938 3300027111 Ga0209281_1000082 Ga0209281_100008249 154
939 3300027312 Ga0209371_1000022 Ga0209371_1000022251 154
940 3300027312 Ga0209371_1000892 Ga0209371_100089212 154
941 3300027312 Ga0209371_1006087 Ga0209371_10060876 154
942 3300027666 Ga0209282_1000006 Ga0209282_100000671 154
943 3300027666 Ga0209282_1007756 Ga0209282_10077566 154
944 3300027666 Ga0209282_1030375 Ga0209282_10303752 154
945 3300027866 Ga0209813_10007851 Ga0209813_100078512 154
946 3300028379 Ga0268266_10003490 Ga0268266_100034909 154
947 3300028379 Ga0268266_10003866 Ga0268266_100038667 154
948 3300028379 Ga0268266_10075098 Ga0268266_100750982 154
949 3300028379 Ga0268266_10691014 Ga0268266_106910141 154
950 3300028379 Ga0268266_11364684 Ga0268266_113646842 154
951 3300028379 Ga0268266_11814705 Ga0268266_118147051 154
952 3300028794 Ga0307515_10000017 Ga0307515_1000001778 154
953 3300028794 Ga0307515_10046209 Ga0307515_100462095 154
954 3300028794 Ga0307515_10069935 Ga0307515_100699354 154
955 3300030500 Ga0268256_1000019 Ga0268256_1000019269 154
956 3300030500 Ga0268256_1006062 Ga0268256_10060622 154
957 3300030500 Ga0268256_1026482 Ga0268256_10264822 154
958 3300030744 Ga0316181_1138338 Ga0316181_11383382 154
959 3300031251 Ga0265327_10049111 Ga0265327_100491112 154
960 3300031456 Ga0307513_10015439 Ga0307513_100154397 154
961 3300031456 Ga0307513_10057743 Ga0307513_100577433 154
962 3300031548 Ga0307408_100259728 Ga0307408_1002597282 154
963 3300031548 Ga0307408_100551394 Ga0307408_1005513941 154
964 3300031727 Ga0316576_10760265 Ga0316576_107602651 154
965 3300031731 Ga0307405_10002746 Ga0307405_100027467 154
966 3300031731 Ga0307405_10103915 Ga0307405_101039152 154
967 3300031852 Ga0307410_10192518 Ga0307410_101925182 154
968 3300031911 Ga0307412_10002363 Ga0307412_100023634 154
969 3300031911 Ga0307412_10114024 Ga0307412_101140243 154
970 3300031911 Ga0307412_10259515 Ga0307412_102595151 154
971 3300031911 Ga0307412_10981645 Ga0307412_109816452 154
972 3300031967 Ga0315914_1000003 Ga0315914_1000003126 154
973 3300031995 Ga0307409_100821542 Ga0307409_1008215422 154
974 3300032002 Ga0307416_100299293 Ga0307416_1002992931 154
975 3300032002 Ga0307416_100495718 Ga0307416_1004957182 154
976 3300032004 Ga0307414_10076304 Ga0307414_100763043 154
977 3300032004 Ga0307414_10329742 Ga0307414_103297421 154
978 3300033430 Ga0315913_1000001 Ga0315913_100000177 154
979 3300033464 Ga0315915_1000008 Ga0315915_1000008210 154
980 3300035170 Ga0373943_0347105 Ga0373943_0347105_27_491 154
981 3300035695 Ga0373927_0000856 Ga0373927_0000856_20373_20837 154
982 3300037068 Ga0373925_0002516 Ga0373925_0002516_2718_3182 154
983 3300037312 Ga0395899_0032746 Ga0395899_0032746_2779_3255 154
984 3300037312 Ga0395899_0189558 Ga0395899_0189558_620_1084 154
985 3300038443 Ga0395901_0689569 Ga0395901_0689569_525_989 154
986 3300039437 Ga0436365_0990465 Ga0436365_0990465_8616_9080 154
987 3300039447 Ga0436361_0507050 Ga0436361_0507050_496_960 154
988 3300039447 Ga0436361_0972763 Ga0436361_0972763_2857_3321 154
989 3300039447 Ga0436361_1031687 Ga0436361_1031687_244_708 154
990 3300041404 Ga0439436_0019882 Ga0439436_0019882_593_1057 154
991 3300041405 Ga0439438_016435 Ga0439438_016435_237_701 154
992 3300041405 Ga0439438_017366 Ga0439438_017366_1450_1914 154
993 3300041411 Ga0439466_0070031 Ga0439466_0070031_80_544 154
994 3300041413 Ga0439465_0008508 Ga0439465_0008508_1652_2116 154
995 3300041413 Ga0439465_0165332 Ga0439465_0165332_226_690 154
996 3300041441 Ga0451787_502609 Ga0451787_502609_59_523 154
997 3300041443 Ga0451789_1281455 Ga0451789_1281455_221_685 154
998 3300041456 Ga0451795_0335541 Ga0451795_0335541_461_925 154
999 3300041492 Ga0451835_0255768 Ga0451835_0255768_760_1227 154
1000 3300041494 Ga0451837_0676541 Ga0451837_0676541_222_689 154
1001 3300041494 Ga0451837_0772324 Ga0451837_0772324_508_975 154
1002 3300041497 Ga0451840_15734 Ga0451840_15734_99_563 154
1003 3300041502 Ga0451846_31201 Ga0451846_31201_373_837 154
1004 3300041503 Ga0451847_0188909 Ga0451847_0188909_944_1411 154
1005 3300041507 Ga0451851_0267608 Ga0451851_0267608_33_515 154
1006 3300041507 Ga0451851_0872605 Ga0451851_0872605_148_612 154
1007 3300041510 Ga0451854_30980 Ga0451854_30980_156_620 154
1008 3300041511 Ga0451855_1076083 Ga0451855_1076083_371_835 154
1009 3300041999 Ga0439433_0097097 Ga0439433_0097097_191_655 154
1010 3300042007 Ga0439449_0004055 Ga0439449_0004055_4059_4523 154
1011 3300042007 Ga0439449_0017852 Ga0439449_0017852_1072_1536 154
1012 3300042009 Ga0439451_016516 Ga0439451_016516_835_1299 154
1013 3300042122 Ga0450920_010616 Ga0450920_010616_869_1333 154
1014 3300042185 Ga0450909_003686 Ga0450909_003686_1338_1802 154
1015 3300042435 Ga0439434_0047458 Ga0439434_0047458_772_1236 154
1016 3300042531 Ga0450918_010663 Ga0450918_010663_730_1194 154
1017 3300044684 Ga0466966_0370726 Ga0466966_0370726_27_491 154
1018 3300044735 Ga0466968_0015577 Ga0466968_0015577_1950_2414 154
1019 3300044765 Ga0466970_0218295 Ga0466970_0218295_85_549 154
1020 3300044901 Ga0466960_0232709 Ga0466960_0232709_51_518 154
1021 3300045051 Ga0451576_2052736 Ga0451576_2052736_63_530 154
1022 3300046453 Ga0495627_051123 Ga0495627_051123_755_1219 154
1023 3300046453 Ga0495627_093648 Ga0495627_093648_362_826 154
1024 3300046460 Ga0495638_0001134 Ga0495638_0001134_3653_4117 154
1025 3300046460 Ga0495638_0080821 Ga0495638_0080821_985_1449 154
1026 3300046462 Ga0495651_0140785 Ga0495651_0140785_157_621 154
1027 3300046471 Ga0495650_0045284 Ga0495650_0045284_1225_1689 154
1028 3300046474 Ga0495605_0099468 Ga0495605_0099468_183_647 154
1029 3300046476 Ga0495662_0009811 Ga0495662_0009811_4203_4667 154
1030 3300046492 Ga0495585_0060355 Ga0495585_0060355_1341_1805 154
1031 3300046500 Ga0495596_0027893 Ga0495596_0027893_1683_2147 154
1032 3300046501 Ga0495607_0010334 Ga0495607_0010334_2400_2864 154
1033 3300046501 Ga0495607_0046074 Ga0495607_0046074_1028_1492 154
1034 3300046506 Ga0495583_0035078 Ga0495583_0035078_1356_1820 154
1035 3300046506 Ga0495583_0053761 Ga0495583_0053761_195_659 154
1036 3300046507 Ga0495606_0004697 Ga0495606_0004697_7375_7839 154
1037 3300046507 Ga0495606_0007767 Ga0495606_0007767_717_1181 154
1038 3300046507 Ga0495606_0039286 Ga0495606_0039286_2596_3060 154
1039 3300046507 Ga0495606_0112977 Ga0495606_0112977_738_1202 154
1040 3300046512 Ga0495610_0003664 Ga0495610_0003664_8821_9285 154
1041 3300046512 Ga0495610_0031382 Ga0495610_0031382_2007_2471 154
1042 3300046512 Ga0495610_0139763 Ga0495610_0139763_33_497 154
1043 3300046513 Ga0495616_0022251 Ga0495616_0022251_714_1178 154
1044 3300046514 Ga0495618_0210505 Ga0495618_0210505_353_817 154
1045 3300046515 Ga0495620_0026792 Ga0495620_0026792_2003_2467 154
1046 3300046515 Ga0495620_0359990 Ga0495620_0359990_43_507 154
1047 3300046517 Ga0495630_0837281 Ga0495630_0837281_173_637 154
1048 3300046518 Ga0495631_0001584 Ga0495631_0001584_8827_9291 154
1049 3300046519 Ga0495632_0003362 Ga0495632_0003362_4751_5215 154
1050 3300046519 Ga0495632_0009886 Ga0495632_0009886_1065_1529 154
1051 3300046519 Ga0495632_0041708 Ga0495632_0041708_1455_1919 154
1052 3300046519 Ga0495632_0081744 Ga0495632_0081744_818_1282 154
1053 3300046519 Ga0495632_0108233 Ga0495632_0108233_148_612 154
1054 3300046522 Ga0495643_0031297 Ga0495643_0031297_1153_1617 154
1055 3300046522 Ga0495643_0066465 Ga0495643_0066465_711_1175 154
1056 3300046524 Ga0495648_0029469 Ga0495648_0029469_1055_1519 154
1057 3300046524 Ga0495648_0161935 Ga0495648_0161935_573_1037 154
1058 3300046525 Ga0495663_0018272 Ga0495663_0018272_276_740 154
1059 3300046530 Ga0495654_0001572 Ga0495654_0001572_2227_2691 154
1060 3300046530 Ga0495654_0011933 Ga0495654_0011933_2797_3261 154
1061 3300046530 Ga0495654_0198712 Ga0495654_0198712_240_704 154
1062 3300046538 Ga0495609_0026854 Ga0495609_0026854_204_668 154
1063 3300046542 Ga0495597_0029591 Ga0495597_0029591_1438_1902 154
1064 3300046557 Ga0495622_0042615 Ga0495622_0042615_247_711 154
1065 3300046558 Ga0495633_0041073 Ga0495633_0041073_1139_1603 154
1066 3300046558 Ga0495633_0048871 Ga0495633_0048871_1493_1957 154
1067 3300046558 Ga0495633_0265304 Ga0495633_0265304_199_663 154
1068 3300046616 Ga0495668_0009467 Ga0495668_0009467_3468_3932 154
1069 3300046616 Ga0495668_0012948 Ga0495668_0012948_2219_2683 154
1070 3300046648 Ga0495611_0020130 Ga0495611_0020130_1200_1664 154
1071 3300046660 Ga0495625_0002255 Ga0495625_0002255_3894_4358 154
1072 3300046660 Ga0495625_0049809 Ga0495625_0049809_230_694 154
1073 3300046660 Ga0495625_0068316 Ga0495625_0068316_1171_1635 154
1074 3300046660 Ga0495625_0100585 Ga0495625_0100585_691_1158 154
1075 3300046660 Ga0495625_0126598 Ga0495625_0126598_1203_1667 154
1076 3300046674 Ga0495588_0001571 Ga0495588_0001571_7478_7942 154
1077 3300046674 Ga0495588_0067742 Ga0495588_0067742_584_1048 154
1078 3300046691 Ga0495670_0012039 Ga0495670_0012039_2585_3049 154
1079 3300046692 Ga0495671_0065310 Ga0495671_0065310_207_671 154
1080 3300046809 Ga0495600_0026201 Ga0495600_0026201_2295_2759 154
1081 3300046810 Ga0495660_0004669 Ga0495660_0004669_2135_2599 154
1082 3300047317 Ga0495604_0097972 Ga0495604_0097972_471_935 154
1083 3300047318 Ga0495636_0047809 Ga0495636_0047809_972_1436 154
1084 3300047320 Ga0495672_0005525 Ga0495672_0005525_4495_4959 154
1085 3300047323 Ga0495683_0049570 Ga0495683_0049570_511_975 154
1086 3300047470 Ga0495681_0013102 Ga0495681_0013102_3390_3854 154
1087 3300047470 Ga0495681_0049184 Ga0495681_0049184_1429_1893 154
1088 3300047472 Ga0495686_0001486 Ga0495686_0001486_16790_17254 154
1089 3300047472 Ga0495686_0010881 Ga0495686_0010881_3583_4047 154
1090 3300047472 Ga0495686_0011361 Ga0495686_0011361_460_924 154
1091 3300047472 Ga0495686_0021709 Ga0495686_0021709_460_924 154
1092 3300047472 Ga0495686_0200319 Ga0495686_0200319_570_1034 154
1093 3300048091 Ga0495626_0024583 Ga0495626_0024583_2465_2929 154
1094 3300048903 Ga0496100_1297634 Ga0496100_1297634_88_552 154
1095 3300048905 Ga0496102_1292316 Ga0496102_1292316_97_561 154
1096 3300048908 Ga0496105_0070505 Ga0496105_0070505_22_486 154
1097 3300048908 Ga0496105_0338339 Ga0496105_0338339_81_545 154
1098 3300048909 Ga0496106_0006078 Ga0496106_0006078_2446_2910 154
1099 3300048909 Ga0496106_0218120 Ga0496106_0218120_14_478 154
1100 3300048913 Ga0496110_0046395 Ga0496110_0046395_3206_3670 154
1101 3300048913 Ga0496110_0252786 Ga0496110_0252786_355_819 154
1102 3300048914 Ga0496111_0029761 Ga0496111_0029761_1767_2231 154
1103 3300048915 Ga0496112_0803831 Ga0496112_0803831_245_709 154
1104 3300048916 Ga0496113_0040908 Ga0496113_0040908_565_1029 154
1105 3300048918 Ga0496115_0695078 Ga0496115_0695078_231_695 154
1106 3300048919 Ga0496116_0000105 Ga0496116_0000105_187513_187977 154
1107 3300048919 Ga0496116_0007168 Ga0496116_0007168_7043_7507 154
1108 3300048919 Ga0496116_0008842 Ga0496116_0008842_4927_5391 154
1109 3300048919 Ga0496116_0023634 Ga0496116_0023634_3176_3640 154
1110 3300048919 Ga0496116_0031594 Ga0496116_0031594_150_614 154
1111 3300048919 Ga0496116_0052894 Ga0496116_0052894_1656_2120 154
1112 3300048919 Ga0496116_0083429 Ga0496116_0083429_606_1070 154
1113 3300048920 Ga0496117_0000002 Ga0496117_0000002_297364_297828 154
1114 3300048920 Ga0496117_0005967 Ga0496117_0005967_8480_8944 154
1115 3300048920 Ga0496117_0010221 Ga0496117_0010221_3281_3745 154
1116 3300048920 Ga0496117_0017552 Ga0496117_0017552_3316_3780 154
1117 3300048920 Ga0496117_0031122 Ga0496117_0031122_2698_3162 154
1118 3300048920 Ga0496117_0066513 Ga0496117_0066513_125_640 154
1119 3300048921 Ga0496118_0000566 Ga0496118_0000566_54747_55211 154
1120 3300048921 Ga0496118_0001151 Ga0496118_0001151_8433_8897 154
1121 3300048921 Ga0496118_0008628 Ga0496118_0008628_6708_7172 154
1122 3300048921 Ga0496118_0017174 Ga0496118_0017174_3495_3962 154
1123 3300048921 Ga0496118_0034028 Ga0496118_0034028_1713_2177 154
1124 3300048921 Ga0496118_0075392 Ga0496118_0075392_650_1114 154
1125 3300048921 Ga0496118_0104617 Ga0496118_0104617_987_1502 154
1126 3300048922 Ga0496119_0007422 Ga0496119_0007422_523_987 154
1127 3300048922 Ga0496119_0024620 Ga0496119_0024620_1912_2379 154
1128 3300048922 Ga0496119_0035300 Ga0496119_0035300_953_1468 154
1129 3300048922 Ga0496119_0109266 Ga0496119_0109266_15_479 154
1130 3300048923 Ga0496120_0000309 Ga0496120_0000309_76916_77380 154
1131 3300048923 Ga0496120_0044995 Ga0496120_0044995_757_1221 154
1132 3300048923 Ga0496120_0070685 Ga0496120_0070685_478_993 154
1133 3300048924 Ga0496121_0003780 Ga0496121_0003780_11740_12204 154
1134 3300048924 Ga0496121_0009804 Ga0496121_0009804_2839_3303 154
1135 3300048924 Ga0496121_0012638 Ga0496121_0012638_3323_3787 154
1136 3300048924 Ga0496121_0019047 Ga0496121_0019047_4196_4660 154
1137 3300048924 Ga0496121_0076734 Ga0496121_0076734_150_614 154
1138 3300048924 Ga0496121_0081685 Ga0496121_0081685_1628_2092 154
1139 3300048924 Ga0496121_0155671 Ga0496121_0155671_740_1204 154
1140 3300048924 Ga0496121_0248290 Ga0496121_0248290_144_614 154
1141 3300048925 Ga0496122_0000004 Ga0496122_0000004_347848_348312 154
1142 3300048925 Ga0496122_0000157 Ga0496122_0000157_123325_123789 154
1143 3300048925 Ga0496122_0000464 Ga0496122_0000464_79726_80190 154
1144 3300048925 Ga0496122_0010069 Ga0496122_0010069_5067_5531 154
1145 3300048925 Ga0496122_0034634 Ga0496122_0034634_2850_3314 154
1146 3300048925 Ga0496122_0038124 Ga0496122_0038124_3243_3707 154
1147 3300048925 Ga0496122_0041265 Ga0496122_0041265_10_474 154
1148 3300048925 Ga0496122_0048776 Ga0496122_0048776_1005_1469 154
1149 3300048925 Ga0496122_0063672 Ga0496122_0063672_379_843 154
1150 3300048925 Ga0496122_0122766 Ga0496122_0122766_435_905 154
1151 3300048925 Ga0496122_0174327 Ga0496122_0174327_705_1169 154
1152 3300048925 Ga0496122_0175306 Ga0496122_0175306_682_1149 154
1153 3300048926 Ga0496123_0000007 Ga0496123_0000007_347848_348312 154
1154 3300048926 Ga0496123_0000048 Ga0496123_0000048_120364_120828 154
1155 3300048926 Ga0496123_0000147 Ga0496123_0000147_71650_72114 154
1156 3300048926 Ga0496123_0007075 Ga0496123_0007075_3031_3495 154
1157 3300048926 Ga0496123_0014048 Ga0496123_0014048_4603_5067 154
1158 3300048926 Ga0496123_0015923 Ga0496123_0015923_3108_3572 154
1159 3300048926 Ga0496123_0024343 Ga0496123_0024343_4031_4495 154
1160 3300048926 Ga0496123_0027255 Ga0496123_0027255_3314_3784 154
1161 3300048926 Ga0496123_0173840 Ga0496123_0173840_101_565 154
1162 3300048926 Ga0496123_0294082 Ga0496123_0294082_95_562 154
1163 3300048926 Ga0496123_0311236 Ga0496123_0311236_229_696 154
1164 3300048927 Ga0496124_0002089 Ga0496124_0002089_6905_7369 154
1165 3300048927 Ga0496124_0008090 Ga0496124_0008090_7755_8219 154
1166 3300048927 Ga0496124_0009653 Ga0496124_0009653_3323_3787 154
1167 3300048927 Ga0496124_0029277 Ga0496124_0029277_4364_4828 154
1168 3300048927 Ga0496124_0060523 Ga0496124_0060523_2207_2671 154
1169 3300048927 Ga0496124_0130083 Ga0496124_0130083_429_893 154
1170 3300048927 Ga0496124_0132515 Ga0496124_0132515_753_1217 154
1171 3300048927 Ga0496124_0211242 Ga0496124_0211242_786_1250 154
1172 3300048927 Ga0496124_0230418 Ga0496124_0230418_54_518 154
1173 3300048927 Ga0496124_0238957 Ga0496124_0238957_128_592 154
1174 3300048927 Ga0496124_0273913 Ga0496124_0273913_164_628 154
1175 3300048927 Ga0496124_0305280 Ga0496124_0305280_32_496 154
1176 3300048928 Ga0496125_0000848 Ga0496125_0000848_24257_24721 154
1177 3300048928 Ga0496125_0009794 Ga0496125_0009794_5983_6447 154
1178 3300048928 Ga0496125_0014106 Ga0496125_0014106_3824_4288 154
1179 3300048928 Ga0496125_0014581 Ga0496125_0014581_4017_4484 154
1180 3300048928 Ga0496125_0050143 Ga0496125_0050143_458_922 154
1181 3300048928 Ga0496125_0135179 Ga0496125_0135179_982_1497 154
1182 3300048928 Ga0496125_0255670 Ga0496125_0255670_10_474 154
1183 3300048928 Ga0496125_0356085 Ga0496125_0356085_320_784 154
1184 3300048928 Ga0496125_0491740 Ga0496125_0491740_192_656 154
1185 3300048929 Ga0496126_0000188 Ga0496126_0000188_133986_134450 154
1186 3300048929 Ga0496126_0302042 Ga0496126_0302042_11_481 154
1187 3300048929 Ga0496126_0526382 Ga0496126_0526382_147_617 154
1188 3300049459 Ga0495678_066512 Ga0495678_066512_167_631 154
1189 3300049460 Ga0495682_0011491 Ga0495682_0011491_2556_3020 154
1190 3300049569 Ga0501032_0187945 Ga0501032_0187945_872_1336 154
1191 3300049570 Ga0501033_0000365 Ga0501033_0000365_41056_41523 154
1192 3300049570 Ga0501033_0150020 Ga0501033_0150020_1063_1527 154
1193 3300049570 Ga0501033_0183076 Ga0501033_0183076_510_974 154
1194 3300049571 Ga0501034_0001020 Ga0501034_0001020_19875_20339 154
1195 3300049571 Ga0501034_0191769 Ga0501034_0191769_45_509 154
1196 3300049571 Ga0501034_0648779 Ga0501034_0648779_414_878 154
1197 3300049572 Ga0501036_0031089 Ga0501036_0031089_350_814 154
1198 3300049572 Ga0501036_1004531 Ga0501036_1004531_201_665 154
1199 3300049573 Ga0501037_0066214 Ga0501037_0066214_1908_2372 154
1200 3300049573 Ga0501037_0515409 Ga0501037_0515409_322_786 154
1201 3300049574 Ga0501038_0020981 Ga0501038_0020981_3900_4364 154
1202 3300049576 Ga0501040_0034092 Ga0501040_0034092_2342_2806 154
1203 3300049577 Ga0501041_0162692 Ga0501041_0162692_125_589 154
1204 3300049578 Ga0501042_0162443 Ga0501042_0162443_189_653 154
1205 3300049579 Ga0501043_0216218 Ga0501043_0216218_1000_1464 154
1206 3300049579 Ga0501043_0419576 Ga0501043_0419576_454_921 154
1207 3300049580 Ga0501046_0028941 Ga0501046_0028941_2401_2865 154
1208 3300049581 Ga0501047_0255272 Ga0501047_0255272_987_1451 154
1209 3300049582 Ga0501048_0025595 Ga0501048_0025595_3256_3720 154
1210 3300049583 Ga0501067_0065314 Ga0501067_0065314_455_919 154
1211 3300049584 Ga0501068_0288358 Ga0501068_0288358_31_495 154
1212 3300049584 Ga0501068_0309858 Ga0501068_0309858_236_700 154
1213 3300049587 Ga0501071_0046594 Ga0501071_0046594_2395_2859 154
1214 3300049590 Ga0501074_0005267 Ga0501074_0005267_1097_1561 154
1215 3300049591 Ga0501075_0195777 Ga0501075_0195777_144_608 154
1216 3300049592 Ga0501076_0056877 Ga0501076_0056877_2468_2932 154
1217 3300049593 Ga0501077_0084373 Ga0501077_0084373_235_699 154
1218 3300049741 Ga0501079_0057880 Ga0501079_0057880_395_859 154
1219 3300049742 Ga0501080_0232366 Ga0501080_0232366_839_1303 154
1220 3300049742 Ga0501080_0426430 Ga0501080_0426430_171_635 154
1221 3300049742 Ga0501080_0460058 Ga0501080_0460058_560_1024 154
1222 3300049743 Ga0501081_0001100 Ga0501081_0001100_3298_3762 154
1223 3300049776 Ga0501280_001764 Ga0501280_001764_2589_3053 154
1224 3300049776 Ga0501280_052361 Ga0501280_052361_116_580 154
1225 3300049776 Ga0501280_053158 Ga0501280_053158_165_629 154
1226 3300049822 Ga0501035_0001622 Ga0501035_0001622_15754_16221 154
1227 3300049823 Ga0501044_0109786 Ga0501044_0109786_200_664 154
1228 3300049823 Ga0501044_0590104 Ga0501044_0590104_119_583 154
1229 3300049823 Ga0501044_1392044 Ga0501044_1392044_38_502 154
1230 3300049824 Ga0501045_0045776 Ga0501045_0045776_396_860 154
1231 3300050489 nmdc:mga03683_53915_c1 nmdc:mga03683_53915_c1_589_1053 154
1232 3300050489 nmdc:mga03683_8607_c2 nmdc:mga03683_8607_c2_32_499 154
1233 3300050490 nmdc:mga03n38_376232_c1 nmdc:mga03n38_376232_c1_87_602 154
1234 3300050490 nmdc:mga03n38_48518_c1 nmdc:mga03n38_48518_c1_973_1440 154
1235 3300050490 nmdc:mga03n38_582808_c1 nmdc:mga03n38_582808_c1_72_536 154
1236 3300050491 nmdc:mga00v17_180_c1 nmdc:mga00v17_180_c1_18144_18608 154
1237 3300050491 nmdc:mga00v17_443299_c1 nmdc:mga00v17_443299_c1_95_559 154
1238 3300050491 nmdc:mga00v17_824_c1 nmdc:mga00v17_824_c1_9782_10246 154
1239 3300050491 nmdc:mga00v17_983886_c1 nmdc:mga00v17_983886_c1_30_494 154
1240 3300050492 nmdc:mga0yw44_1405_c1 nmdc:mga0yw44_1405_c1_6727_7191 154
1241 3300050492 nmdc:mga0yw44_192004_c1 nmdc:mga0yw44_192004_c1_577_1041 154
1242 3300050492 nmdc:mga0yw44_865_c1 nmdc:mga0yw44_865_c1_2780_3244 154
1243 3300050493 nmdc:mga0k408_21083_c1 nmdc:mga0k408_21083_c1_2120_2587 154
1244 3300050493 nmdc:mga0k408_63710_c1 nmdc:mga0k408_63710_c1_959_1423 154
1245 3300050494 nmdc:mga06z11_285710_c1 nmdc:mga06z11_285710_c1_301_765 154
1246 3300050494 nmdc:mga06z11_424021_c1 nmdc:mga06z11_424021_c1_167_631 154
1247 3300050496 nmdc:mga07m45_40428_c1 nmdc:mga07m45_40428_c1_266_733 154
1248 3300050507 nmdc:mga05p37_169637_c1 nmdc:mga05p37_169637_c1_976_1443 154
1249 3300050507 nmdc:mga05p37_181727_c1 nmdc:mga05p37_181727_c1_13_477 154
1250 3300050509 nmdc:mga0qj67_357762_c1 nmdc:mga0qj67_357762_c1_377_844 154
1251 3300050510 nmdc:mga06r32_179582_c1 nmdc:mga06r32_179582_c1_129_593 154
1252 3300050511 nmdc:mga08y16_453561_c1 nmdc:mga08y16_453561_c1_774_1253 154
1253 3300050516 nmdc:mga0sz30_235323_c1 nmdc:mga0sz30_235323_c1_45_509 154
1254 3300050516 nmdc:mga0sz30_260587_c1 nmdc:mga0sz30_260587_c1_195_659 154
1255 3300050516 nmdc:mga0sz30_4354_c1 nmdc:mga0sz30_4354_c1_2337_2804 154
1256 3300050516 nmdc:mga0sz30_802_c1 nmdc:mga0sz30_802_c1_5839_6303 154
1257 3300053079 Ga0500610_0022183 Ga0500610_0022183_2042_2506 154
1258 3300053085 Ga0495619_0039700 Ga0495619_0039700_2184_2648 154
1259 3300053086 Ga0500578_0459078 Ga0500578_0459078_104_568 154
1260 3300053088 Ga0500644_0011388 Ga0500644_0011388_775_1239 154
1261 3300053090 Ga0500646_0268453 Ga0500646_0268453_40_504 154
1262 3300053091 Ga0500647_0108906 Ga0500647_0108906_412_876 154
1263 3300053105 Ga0500557_000501 Ga0500557_000501_2837_3301 154
1264 3300053109 Ga0500569_002896 Ga0500569_002896_929_1393 154
1265 3300053109 Ga0500569_155755 Ga0500569_155755_89_553 154
1266 3300053111 Ga0500572_003731 Ga0500572_003731_386_850 154
1267 3300053118 Ga0500594_0003894 Ga0500594_0003894_2603_3067 154
1268 3300053122 Ga0500608_052883 Ga0500608_052883_963_1427 154
1269 3300053125 Ga0500618_000849 Ga0500618_000849_15726_16190 154
1270 3300053125 Ga0500618_015687 Ga0500618_015687_688_1152 154
1271 3300053125 Ga0500618_041237 Ga0500618_041237_37_501 154
1272 3300053134 Ga0500658_0000206 Ga0500658_0000206_1486_1950 154
1273 3300053134 Ga0500658_0011557 Ga0500658_0011557_2026_2490 154
1274 3300053137 Ga0500561_0002494 Ga0500561_0002494_1636_2100 154
1275 3300053139 Ga0500568_0001714 Ga0500568_0001714_4310_4774 154
1276 3300053139 Ga0500568_0003195 Ga0500568_0003195_4538_5002 154
1277 3300053140 Ga0500573_0018797 Ga0500573_0018797_2510_2974 154
1278 3300053146 Ga0500588_0000807 Ga0500588_0000807_4668_5135 154
1279 3300053148 Ga0500590_002837 Ga0500590_002837_4114_4578 154
1280 3300053153 Ga0500616_0000309 Ga0500616_0000309_40942_41406 154
1281 3300053153 Ga0500616_0000576 Ga0500616_0000576_3720_4184 154
1282 3300053153 Ga0500616_0267263 Ga0500616_0267263_156_620 154
1283 3300053153 Ga0500616_0294343 Ga0500616_0294343_156_620 154
1284 3300053156 Ga0500622_0003878 Ga0500622_0003878_4053_4517 154
1285 3300053157 Ga0500624_000308 Ga0500624_000308_7857_8321 154
1286 3300053157 Ga0500624_087080 Ga0500624_087080_139_603 154
1287 3300053161 Ga0500634_0181681 Ga0500634_0181681_394_858 154
1288 3300053177 Ga0500636_0000003 Ga0500636_0000003_74604_75068 154
1289 3300053177 Ga0500636_0000840 Ga0500636_0000840_10129_10593 154
1290 3300053178 Ga0500637_0093605 Ga0500637_0093605_632_1096 154
1291 3300053731 Ga0500609_029468 Ga0500609_029468_252_719 154
1292 3300054114 Ga0501084_0009756 Ga0501084_0009756_351_815 154
1293 3300059503 Ga0587080_061273 Ga0587080_061273_24_488 154
1294 3300059510 Ga0587090_011104 Ga0587090_011104_335_823 154
1295 3300059641 Ga0587068_011069 Ga0587068_011069_343_807 154
1296 3300059642 Ga0587069_012415 Ga0587069_012415_240_707 154
1297 3300059643 Ga0587072_018780 Ga0587072_018780_358_846 154
1298 3300060353 Ga0501082_0017190 Ga0501082_0017190_2126_2590 154
1299 3300061734 Ga0530510_0034914 Ga0530510_0034914_2869_3333 154
1300 iso_pu_bacteria 2821443989 2821447862 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14489

QueF

QueF-like protein

80

160

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7alc-assembly1.cif.gz_E-2 human gch-gfrp stimulatory complex 0.9161 38 134
5k0p-assembly1.cif.gz_B crystal structure of the archaeosine synthase quef-like in the apo form 0.913 37 137
7alc-assembly1.cif.gz_B-2 human gch-gfrp stimulatory complex 0.9123 40 134
6z88-assembly1.cif.gz_H human gtp cyclohydrolase i in complex with allosteric inhibitor 0.911 38 134
7alc-assembly1.cif.gz_C-2 human gch-gfrp stimulatory complex 0.9103 40 134
ID Description Score Start End Superfamily
af_Q2G081_22_166_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.9186 15 136 3.30.1130.10
1a8rA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8747 36 130 3.30.1130.10
4uqfA02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8552 34 134 3.30.1130.10
af_A0A1D6DUT0_342_468_3.30.1130.10 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8391 40 135 3.30.1130.10
3rzpD02 Alpha Beta;2-Layer Sandwich;GTP Cyclohydrolase I, domain 2;GTP cyclohydrolase I, C-terminal domain/NADPH-dependent 7-cyano-7-deazaguanine reductase, N-terminal domain 0.8291 31 139 3.30.1130.10
ID Description Score Start End GO Terms
AF-Q9RNJ7-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9892 10 119 GO:0005737
GO:0006400
GO:0008616
GO:0033739
AF-A0A520IJI0-F1-model_v4 PreQ(1) synthase (EC 1.7.1.13) 0.9872 10 116 GO:0005737
GO:0008616
GO:0033739
AF-A0A7U8JXT8-F1-model_v4 deleted 0.9846 7 137
AF-A0A6L7ZVT3-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase QueF (EC 1.7.1.13) 0.9839 8 129 GO:0005737
GO:0008616
GO:0033739
AF-A0A5B8XE36-F1-model_v4 NADPH-dependent 7-cyano-7-deazaguanine reductase (EC 1.7.1.13) (7-cyano-7-carbaguanine reductase) (NADPH-dependent nitrile oxidoreductase) (PreQ(0) reductase) 0.9837 1 145 GO:0005737
GO:0006400
GO:0008616
GO:0033739

Feature Viewer

pLDDT pTM Quality
91.8 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map