F492734
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1299 | 322 | 1296 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300049664|Ga0501224_000129|Ga0501224_000129_6051_6380 |
| Length | 109 |
| Sequence | MPKIQAETASGLVETEPPAGKKLVLAIEDAGVDILHRCGGNARCTTCRVEVLEPGEMGELERNRLAMESELAPNVRLSCQIRVNSDLKVRVINQASVRGMDAGPRPLDE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2088090002 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 4 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 5 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 6 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 92 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 93 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 94 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 130 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 131 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 132 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 133 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 219 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 220 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 223 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 228 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 229 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 230 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 231 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 232 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 233 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 234 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 235 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 254 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 255 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 256 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 257 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 258 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 259 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 260 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 261 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 262 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 263 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 269 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 270 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 271 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 272 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 273 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 274 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 275 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 276 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 277 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 278 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 281 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 284 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 285 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 286 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 287 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 288 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 289 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 290 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 291 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 292 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 293 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 294 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 295 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 296 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 298 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 299 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 300 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 302 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 303 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 304 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 305 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 306 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 307 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 308 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 309 | 3300049774 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought | Metagenome | Rhizosphere |
| 310 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 311 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 312 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 313 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 314 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0.23 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.54 |
| Rhizosphere | 96.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNA_F6ESG4R02GEH5A | 2088090002 | Unclassified | 500 |
| 2 | SwRhRL2b_contig_36198 | 2162886007 | Bacteria | 2309 |
| 3 | CNAas_1000886 | 3300000532 | Unclassified | 2808 |
| 4 | JGI24737J22298_10073203 | 3300001990 | Bacteria | 1022 |
| 5 | JGI24751J29686_10000009 | 3300002459 | Bacteria | 125815 |
| 6 | JGI25406J46586_10004348 | 3300003203 | Bacteria | 6610 |
| 7 | JGI25406J46586_10019122 | 3300003203 | Bacteria | 2799 |
| 8 | rootL2_10187274 | 3300003322 | Bacteria | 1404 |
| 9 | Ga0065714_10064433 | 3300005288 | Bacteria | 133062 |
| 10 | Ga0065704_10007866 | 3300005289 | Unclassified | 3774 |
| 11 | Ga0065704_10032831 | 3300005289 | Bacteria | 1082 |
| 12 | Ga0065704_10071538 | 3300005289 | Bacteria | 10765 |
| 13 | Ga0065704_10541735 | 3300005289 | Unclassified | 640 |
| 14 | Ga0065712_10009957 | 3300005290 | Bacteria | 2148 |
| 15 | Ga0065712_10027774 | 3300005290 | Unclassified | 941 |
| 16 | Ga0065712_10067731 | 3300005290 | Bacteria | 133054 |
| 17 | Ga0065712_10073465 | 3300005290 | Unclassified | 4383 |
| 18 | Ga0065712_10155211 | 3300005290 | Bacteria | 1340 |
| 19 | Ga0065712_10231027 | 3300005290 | Unclassified | 1011 |
| 20 | Ga0065712_10285635 | 3300005290 | Unclassified | 887 |
| 21 | Ga0065712_10327933 | 3300005290 | Bacteria | 818 |
| 22 | Ga0065715_10018282 | 3300005293 | Bacteria | 2250 |
| 23 | Ga0065715_10088984 | 3300005293 | Bacteria | 18335 |
| 24 | Ga0065715_10091196 | 3300005293 | Bacteria | 6008 |
| 25 | Ga0065715_10125119 | 3300005293 | Bacteria | 2138 |
| 26 | Ga0065715_10143210 | 3300005293 | Unclassified | 1823 |
| 27 | Ga0065715_10207992 | 3300005293 | Bacteria | 1315 |
| 28 | Ga0065715_10221797 | 3300005293 | Bacteria | 1269 |
| 29 | Ga0065715_10273611 | 3300005293 | Bacteria | 1104 |
| 30 | Ga0065715_10289947 | 3300005293 | Bacteria | 1053 |
| 31 | Ga0065715_10384937 | 3300005293 | Bacteria | 902 |
| 32 | Ga0065715_10474231 | 3300005293 | Unclassified | 803 |
| 33 | Ga0065715_10505085 | 3300005293 | Bacteria | 768 |
| 34 | Ga0065715_10624198 | 3300005293 | Bacteria | 689 |
| 35 | Ga0065715_10641742 | 3300005293 | Bacteria | 683 |
| 36 | Ga0065715_10697873 | 3300005293 | Unclassified | 654 |
| 37 | Ga0065715_10867509 | 3300005293 | Unclassified | 586 |
| 38 | Ga0065715_10883610 | 3300005293 | Bacteria | 580 |
| 39 | Ga0065707_10001225 | 3300005295 | Bacteria | 9555 |
| 40 | Ga0065707_10005905 | 3300005295 | Bacteria | 3068 |
| 41 | Ga0065707_10013054 | 3300005295 | Bacteria | 2523 |
| 42 | Ga0065707_10051064 | 3300005295 | Bacteria | 684 |
| 43 | Ga0065707_10136610 | 3300005295 | Bacteria | 1832 |
| 44 | Ga0065707_10149427 | 3300005295 | Bacteria | 1662 |
| 45 | Ga0065707_10359985 | 3300005295 | Unclassified | 905 |
| 46 | Ga0070676_10061800 | 3300005328 | Bacteria | 2227 |
| 47 | Ga0070676_10080976 | 3300005328 | Bacteria | 1970 |
| 48 | Ga0070676_10370433 | 3300005328 | Bacteria | 989 |
| 49 | Ga0070690_100001514 | 3300005330 | Bacteria | 12179 |
| 50 | Ga0070690_100001806 | 3300005330 | Bacteria | 11325 |
| 51 | Ga0070690_100005902 | 3300005330 | Bacteria | 6908 |
| 52 | Ga0070690_100079209 | 3300005330 | Bacteria | 2148 |
| 53 | Ga0070670_100000088 | 3300005331 | Bacteria | 87898 |
| 54 | Ga0070670_100153806 | 3300005331 | Unclassified | 1991 |
| 55 | Ga0070670_100308249 | 3300005331 | Bacteria | 1385 |
| 56 | Ga0070670_100379324 | 3300005331 | Bacteria | 1245 |
| 57 | Ga0070670_100625843 | 3300005331 | Bacteria | 964 |
| 58 | Ga0070670_100702955 | 3300005331 | Unclassified | 909 |
| 59 | Ga0070670_100710091 | 3300005331 | Unclassified | 904 |
| 60 | Ga0070670_101068261 | 3300005331 | Bacteria | 735 |
| 61 | Ga0070670_101185976 | 3300005331 | Unclassified | 698 |
| 62 | Ga0070670_101393369 | 3300005331 | Bacteria | 643 |
| 63 | Ga0070670_101641100 | 3300005331 | Bacteria | 591 |
| 64 | Ga0070677_10058682 | 3300005333 | Bacteria | 1581 |
| 65 | Ga0070677_10325884 | 3300005333 | Unclassified | 788 |
| 66 | Ga0070677_10744176 | 3300005333 | Unclassified | 555 |
| 67 | Ga0068869_100048762 | 3300005334 | Bacteria | 3064 |
| 68 | Ga0068869_100077696 | 3300005334 | Unclassified | 2470 |
| 69 | Ga0068869_100081484 | 3300005334 | Bacteria | 2417 |
| 70 | Ga0068869_100107136 | 3300005334 | Bacteria | 2122 |
| 71 | Ga0068869_100183011 | 3300005334 | Bacteria | 1643 |
| 72 | Ga0068869_100199500 | 3300005334 | Bacteria | 1577 |
| 73 | Ga0068869_100275367 | 3300005334 | Bacteria | 1352 |
| 74 | Ga0068869_100294542 | 3300005334 | Bacteria | 1308 |
| 75 | Ga0068869_100328054 | 3300005334 | Bacteria | 1243 |
| 76 | Ga0068869_100365907 | 3300005334 | Bacteria | 1179 |
| 77 | Ga0068869_100496927 | 3300005334 | Bacteria | 1018 |
| 78 | Ga0068869_100720690 | 3300005334 | Bacteria | 852 |
| 79 | Ga0068869_101048249 | 3300005334 | Bacteria | 712 |
| 80 | Ga0070666_10009988 | 3300005335 | Bacteria | 5923 |
| 81 | Ga0070666_10151870 | 3300005335 | Unclassified | 1616 |
| 82 | Ga0070666_10538277 | 3300005335 | Unclassified | 849 |
| 83 | Ga0070666_10643633 | 3300005335 | Unclassified | 775 |
| 84 | Ga0070680_100029340 | 3300005336 | Bacteria | 4418 |
| 85 | Ga0070680_100083439 | 3300005336 | Unclassified | 2639 |
| 86 | Ga0070680_100449429 | 3300005336 | Bacteria | 1101 |
| 87 | Ga0070682_100053546 | 3300005337 | Bacteria | 2529 |
| 88 | Ga0070682_100295286 | 3300005337 | Bacteria | 1187 |
| 89 | Ga0070682_100971860 | 3300005337 | Bacteria | 703 |
| 90 | Ga0068868_100035494 | 3300005338 | Bacteria | 3854 |
| 91 | Ga0068868_100068046 | 3300005338 | Unclassified | 2835 |
| 92 | Ga0068868_100300844 | 3300005338 | Unclassified | 1362 |
| 93 | Ga0068868_100315339 | 3300005338 | Bacteria | 1331 |
| 94 | Ga0068868_101171148 | 3300005338 | Unclassified | 710 |
| 95 | Ga0068868_101728351 | 3300005338 | Unclassified | 590 |
| 96 | Ga0070660_100079661 | 3300005339 | Bacteria | 2570 |
| 97 | Ga0070689_100017912 | 3300005340 | Bacteria | 5207 |
| 98 | Ga0070689_100035344 | 3300005340 | Bacteria | 3818 |
| 99 | Ga0070689_100058371 | 3300005340 | Bacteria | 2997 |
| 100 | Ga0070689_100334897 | 3300005340 | Bacteria | 1267 |
| 101 | Ga0070689_100574527 | 3300005340 | Unclassified | 974 |
| 102 | Ga0070689_100682541 | 3300005340 | Bacteria | 896 |
| 103 | Ga0070689_100934543 | 3300005340 | Unclassified | 769 |
| 104 | Ga0070689_101361047 | 3300005340 | Bacteria | 640 |
| 105 | Ga0070689_101401675 | 3300005340 | Unclassified | 631 |
| 106 | Ga0070689_101904127 | 3300005340 | Unclassified | 543 |
| 107 | Ga0070689_102136429 | 3300005340 | Unclassified | 513 |
| 108 | Ga0070691_10227041 | 3300005341 | Unclassified | 992 |
| 109 | Ga0070687_100043878 | 3300005343 | Bacteria | 2275 |
| 110 | Ga0070687_100106748 | 3300005343 | Unclassified | 1578 |
| 111 | Ga0070687_100121283 | 3300005343 | Bacteria | 1496 |
| 112 | Ga0070687_100469532 | 3300005343 | Bacteria | 841 |
| 113 | Ga0070687_100574786 | 3300005343 | Bacteria | 770 |
| 114 | Ga0070661_100331197 | 3300005344 | Bacteria | 1191 |
| 115 | Ga0070661_101343904 | 3300005344 | Unclassified | 600 |
| 116 | Ga0070692_10033025 | 3300005345 | Unclassified | 2607 |
| 117 | Ga0070692_10042222 | 3300005345 | Bacteria | 2341 |
| 118 | Ga0070692_10213690 | 3300005345 | Unclassified | 1136 |
| 119 | Ga0070692_10241586 | 3300005345 | Unclassified | 1077 |
| 120 | Ga0070692_10332116 | 3300005345 | Bacteria | 939 |
| 121 | Ga0070692_10348187 | 3300005345 | Unclassified | 920 |
| 122 | Ga0070692_11280678 | 3300005345 | Unclassified | 525 |
| 123 | Ga0070692_11340428 | 3300005345 | Unclassified | 515 |
| 124 | Ga0070668_100008267 | 3300005347 | Bacteria | 7724 |
| 125 | Ga0070668_100854722 | 3300005347 | Unclassified | 811 |
| 126 | Ga0070669_100030178 | 3300005353 | Bacteria | 3910 |
| 127 | Ga0070669_100031507 | 3300005353 | Bacteria | 3830 |
| 128 | Ga0070669_100037585 | 3300005353 | Bacteria | 3512 |
| 129 | Ga0070669_100061319 | 3300005353 | Bacteria | 2763 |
| 130 | Ga0070669_100284422 | 3300005353 | Bacteria | 1326 |
| 131 | Ga0070669_101209082 | 3300005353 | Unclassified | 653 |
| 132 | Ga0070675_100077534 | 3300005354 | Bacteria | 2766 |
| 133 | Ga0070675_100274943 | 3300005354 | Bacteria | 1479 |
| 134 | Ga0070675_100287698 | 3300005354 | Bacteria | 1446 |
| 135 | Ga0070675_100553681 | 3300005354 | Bacteria | 1040 |
| 136 | Ga0070675_100695120 | 3300005354 | Bacteria | 926 |
| 137 | Ga0070675_101406488 | 3300005354 | Unclassified | 643 |
| 138 | Ga0070671_100024875 | 3300005355 | Bacteria | 4907 |
| 139 | Ga0070671_100111481 | 3300005355 | Bacteria | 2298 |
| 140 | Ga0070671_100170372 | 3300005355 | Unclassified | 1841 |
| 141 | Ga0070671_100897050 | 3300005355 | Unclassified | 774 |
| 142 | Ga0070671_100913979 | 3300005355 | Unclassified | 767 |
| 143 | Ga0070674_100190414 | 3300005356 | Unclassified | 1578 |
| 144 | Ga0070674_100470811 | 3300005356 | Unclassified | 1041 |
| 145 | Ga0070673_100077183 | 3300005364 | Unclassified | 2692 |
| 146 | Ga0070673_100081737 | 3300005364 | Bacteria | 2620 |
| 147 | Ga0070673_100084407 | 3300005364 | Bacteria | 2583 |
| 148 | Ga0070673_100246507 | 3300005364 | Bacteria | 1555 |
| 149 | Ga0070673_100331264 | 3300005364 | Bacteria | 1347 |
| 150 | Ga0070673_100413168 | 3300005364 | Bacteria | 1208 |
| 151 | Ga0070673_101789055 | 3300005364 | Unclassified | 582 |
| 152 | Ga0070673_101967611 | 3300005364 | Unclassified | 555 |
| 153 | Ga0070688_100044481 | 3300005365 | Bacteria | 2740 |
| 154 | Ga0070688_100607186 | 3300005365 | Unclassified | 838 |
| 155 | Ga0070688_101002027 | 3300005365 | Bacteria | 664 |
| 156 | Ga0070688_101146645 | 3300005365 | Unclassified | 623 |
| 157 | Ga0070659_100008321 | 3300005366 | Bacteria | 7573 |
| 158 | Ga0070659_100495631 | 3300005366 | Bacteria | 1041 |
| 159 | Ga0070659_101122126 | 3300005366 | Unclassified | 694 |
| 160 | Ga0070667_100018205 | 3300005367 | Bacteria | 5825 |
| 161 | Ga0070667_100889890 | 3300005367 | Bacteria | 828 |
| 162 | Ga0070667_101554848 | 3300005367 | Bacteria | 622 |
| 163 | Ga0070701_10045910 | 3300005438 | Bacteria | 2244 |
| 164 | Ga0070701_10062048 | 3300005438 | Bacteria | 1973 |
| 165 | Ga0070701_10153880 | 3300005438 | Bacteria | 1326 |
| 166 | Ga0070701_10177803 | 3300005438 | Unclassified | 1243 |
| 167 | Ga0070701_10669991 | 3300005438 | Bacteria | 695 |
| 168 | Ga0070705_100013030 | 3300005440 | Bacteria | 4243 |
| 169 | Ga0070705_100014024 | 3300005440 | Bacteria | 4113 |
| 170 | Ga0070705_100063379 | 3300005440 | Bacteria | 2205 |
| 171 | Ga0070705_100210162 | 3300005440 | Bacteria | 1341 |
| 172 | Ga0070705_100325751 | 3300005440 | Bacteria | 1111 |
| 173 | Ga0070705_100512693 | 3300005440 | Unclassified | 913 |
| 174 | Ga0070705_100606653 | 3300005440 | Unclassified | 847 |
| 175 | Ga0070705_100827386 | 3300005440 | Unclassified | 739 |
| 176 | Ga0070700_100000120 | 3300005441 | Bacteria | 48358 |
| 177 | Ga0070700_100010579 | 3300005441 | Bacteria | 5097 |
| 178 | Ga0070700_100060229 | 3300005441 | Bacteria | 2392 |
| 179 | Ga0070700_100100878 | 3300005441 | Bacteria | 1901 |
| 180 | Ga0070700_100120895 | 3300005441 | Unclassified | 1755 |
| 181 | Ga0070700_100144818 | 3300005441 | Bacteria | 1618 |
| 182 | Ga0070700_100177323 | 3300005441 | Bacteria | 1480 |
| 183 | Ga0070700_100327275 | 3300005441 | Bacteria | 1128 |
| 184 | Ga0070700_101154526 | 3300005441 | Bacteria | 645 |
| 185 | Ga0070694_100017204 | 3300005444 | Bacteria | 4565 |
| 186 | Ga0070694_100092269 | 3300005444 | Bacteria | 2127 |
| 187 | Ga0070694_100110404 | 3300005444 | Bacteria | 1958 |
| 188 | Ga0070694_100211119 | 3300005444 | Unclassified | 1452 |
| 189 | Ga0070694_100254010 | 3300005444 | Unclassified | 1331 |
| 190 | Ga0070694_100326153 | 3300005444 | Bacteria | 1183 |
| 191 | Ga0070694_100389803 | 3300005444 | Unclassified | 1088 |
| 192 | Ga0070694_100484635 | 3300005444 | Bacteria | 982 |
| 193 | Ga0070694_100744778 | 3300005444 | Bacteria | 800 |
| 194 | Ga0070694_100954767 | 3300005444 | Unclassified | 710 |
| 195 | Ga0070694_101200209 | 3300005444 | Bacteria | 636 |
| 196 | Ga0070708_100000337 | 3300005445 | Bacteria | 35479 |
| 197 | Ga0070708_100148145 | 3300005445 | Bacteria | 2181 |
| 198 | Ga0070708_100255666 | 3300005445 | Bacteria | 1646 |
| 199 | Ga0070708_100950572 | 3300005445 | Bacteria | 806 |
| 200 | Ga0070663_100643440 | 3300005455 | Bacteria | 896 |
| 201 | Ga0070678_100047848 | 3300005456 | Bacteria | 3076 |
| 202 | Ga0070678_100474634 | 3300005456 | Unclassified | 1100 |
| 203 | Ga0070678_100651468 | 3300005456 | Bacteria | 945 |
| 204 | Ga0070662_100618082 | 3300005457 | Unclassified | 912 |
| 205 | Ga0070662_101016072 | 3300005457 | Unclassified | 710 |
| 206 | Ga0070662_101298029 | 3300005457 | Unclassified | 626 |
| 207 | Ga0070662_101707623 | 3300005457 | Unclassified | 544 |
| 208 | Ga0070681_10001081 | 3300005458 | Bacteria | 23250 |
| 209 | Ga0070681_10006294 | 3300005458 | Bacteria | 11540 |
| 210 | Ga0070681_10054385 | 3300005458 | Bacteria | 3988 |
| 211 | Ga0070681_10201233 | 3300005458 | Bacteria | 1910 |
| 212 | Ga0068867_100034591 | 3300005459 | Bacteria | 3662 |
| 213 | Ga0068867_100042795 | 3300005459 | Unclassified | 3315 |
| 214 | Ga0068867_100054294 | 3300005459 | Bacteria | 2960 |
| 215 | Ga0068867_100059623 | 3300005459 | Bacteria | 2829 |
| 216 | Ga0068867_100101133 | 3300005459 | Bacteria | 2202 |
| 217 | Ga0068867_100236278 | 3300005459 | Bacteria | 1480 |
| 218 | Ga0068867_100439081 | 3300005459 | Bacteria | 1109 |
| 219 | Ga0068867_100588500 | 3300005459 | Bacteria | 969 |
| 220 | Ga0068867_101553076 | 3300005459 | Bacteria | 617 |
| 221 | Ga0068867_101602249 | 3300005459 | Unclassified | 608 |
| 222 | Ga0068867_101604872 | 3300005459 | Unclassified | 608 |
| 223 | Ga0070685_10088908 | 3300005466 | Bacteria | 1867 |
| 224 | Ga0070685_10299235 | 3300005466 | Bacteria | 1084 |
| 225 | Ga0070685_10466184 | 3300005466 | Bacteria | 888 |
| 226 | Ga0070685_10562270 | 3300005466 | Bacteria | 816 |
| 227 | Ga0070706_100012259 | 3300005467 | Bacteria | 7944 |
| 228 | Ga0070706_100035284 | 3300005467 | Bacteria | 4619 |
| 229 | Ga0070706_100277890 | 3300005467 | Bacteria | 1563 |
| 230 | Ga0070706_100913626 | 3300005467 | Unclassified | 811 |
| 231 | Ga0070707_100040959 | 3300005468 | Unclassified | 4432 |
| 232 | Ga0070707_100081032 | 3300005468 | Unclassified | 3133 |
| 233 | Ga0070707_100286500 | 3300005468 | Bacteria | 1601 |
| 234 | Ga0070707_101471620 | 3300005468 | Unclassified | 648 |
| 235 | Ga0070698_100004605 | 3300005471 | Bacteria | 15147 |
| 236 | Ga0070698_100012974 | 3300005471 | Bacteria | 8821 |
| 237 | Ga0070698_100013753 | 3300005471 | Bacteria | 8567 |
| 238 | Ga0070698_100018834 | 3300005471 | Bacteria | 7263 |
| 239 | Ga0070698_100636820 | 3300005471 | Bacteria | 1007 |
| 240 | Ga0070698_101167788 | 3300005471 | Bacteria | 719 |
| 241 | Ga0070698_102242075 | 3300005471 | Unclassified | 500 |
| 242 | Ga0070699_100006275 | 3300005518 | Bacteria | 10374 |
| 243 | Ga0070699_100007202 | 3300005518 | Bacteria | 9674 |
| 244 | Ga0070699_100030729 | 3300005518 | Bacteria | 4637 |
| 245 | Ga0070699_100049948 | 3300005518 | Bacteria | 3620 |
| 246 | Ga0070699_100427062 | 3300005518 | Bacteria | 1200 |
| 247 | Ga0070679_100008421 | 3300005530 | Bacteria | 9706 |
| 248 | Ga0070679_100056125 | 3300005530 | Bacteria | 3924 |
| 249 | Ga0070684_101368972 | 3300005535 | Unclassified | 666 |
| 250 | Ga0070697_100000062 | 3300005536 | Bacteria | 84791 |
| 251 | Ga0070697_100038063 | 3300005536 | Bacteria | 3886 |
| 252 | Ga0070697_101351849 | 3300005536 | Unclassified | 636 |
| 253 | Ga0070697_101469068 | 3300005536 | Bacteria | 609 |
| 254 | Ga0068853_100071741 | 3300005539 | Bacteria | 3016 |
| 255 | Ga0068853_100180300 | 3300005539 | Bacteria | 1915 |
| 256 | Ga0068853_100257079 | 3300005539 | Bacteria | 1604 |
| 257 | Ga0068853_100395567 | 3300005539 | Bacteria | 1293 |
| 258 | Ga0068853_100590121 | 3300005539 | Bacteria | 1055 |
| 259 | Ga0068853_100619133 | 3300005539 | Bacteria | 1029 |
| 260 | Ga0068853_101290359 | 3300005539 | Unclassified | 706 |
| 261 | Ga0068853_102015651 | 3300005539 | Bacteria | 560 |
| 262 | Ga0068853_102184292 | 3300005539 | Unclassified | 537 |
| 263 | Ga0070672_100003235 | 3300005543 | Bacteria | 10544 |
| 264 | Ga0070672_100940672 | 3300005543 | Bacteria | 764 |
| 265 | Ga0070672_100940773 | 3300005543 | Bacteria | 764 |
| 266 | Ga0070672_101238899 | 3300005543 | Bacteria | 665 |
| 267 | Ga0070686_100002174 | 3300005544 | Bacteria | 10821 |
| 268 | Ga0070686_100215400 | 3300005544 | Bacteria | 1385 |
| 269 | Ga0070686_100566541 | 3300005544 | Unclassified | 891 |
| 270 | Ga0070686_100991500 | 3300005544 | Unclassified | 688 |
| 271 | Ga0070686_101710802 | 3300005544 | Unclassified | 534 |
| 272 | Ga0070695_100013916 | 3300005545 | Bacteria | 4842 |
| 273 | Ga0070695_100026460 | 3300005545 | Bacteria | 3589 |
| 274 | Ga0070695_100110005 | 3300005545 | Bacteria | 1868 |
| 275 | Ga0070695_100119248 | 3300005545 | Bacteria | 1802 |
| 276 | Ga0070695_100120848 | 3300005545 | Bacteria | 1792 |
| 277 | Ga0070695_100134121 | 3300005545 | Unclassified | 1709 |
| 278 | Ga0070695_100141653 | 3300005545 | Bacteria | 1668 |
| 279 | Ga0070695_100143482 | 3300005545 | Bacteria | 1658 |
| 280 | Ga0070695_100158535 | 3300005545 | Unclassified | 1586 |
| 281 | Ga0070695_100391206 | 3300005545 | Unclassified | 1052 |
| 282 | Ga0070695_100391276 | 3300005545 | Unclassified | 1051 |
| 283 | Ga0070695_100706216 | 3300005545 | Bacteria | 801 |
| 284 | Ga0070695_101877076 | 3300005545 | Unclassified | 503 |
| 285 | Ga0070696_100000807 | 3300005546 | Bacteria | 20137 |
| 286 | Ga0070696_100010581 | 3300005546 | Bacteria | 6182 |
| 287 | Ga0070696_100095169 | 3300005546 | Unclassified | 2126 |
| 288 | Ga0070696_100098487 | 3300005546 | Bacteria | 2092 |
| 289 | Ga0070696_100119931 | 3300005546 | Bacteria | 1903 |
| 290 | Ga0070696_100440145 | 3300005546 | Bacteria | 1027 |
| 291 | Ga0070696_100635662 | 3300005546 | Unclassified | 864 |
| 292 | Ga0070696_101129638 | 3300005546 | Unclassified | 660 |
| 293 | Ga0070696_101796155 | 3300005546 | Bacteria | 530 |
| 294 | Ga0070693_100022522 | 3300005547 | Unclassified | 3352 |
| 295 | Ga0070693_100040645 | 3300005547 | Bacteria | 2612 |
| 296 | Ga0070693_100094216 | 3300005547 | Bacteria | 1811 |
| 297 | Ga0070693_100242564 | 3300005547 | Bacteria | 1191 |
| 298 | Ga0070693_100339487 | 3300005547 | Unclassified | 1025 |
| 299 | Ga0070693_100401051 | 3300005547 | Unclassified | 951 |
| 300 | Ga0070693_101656889 | 3300005547 | Unclassified | 504 |
| 301 | Ga0070665_100267008 | 3300005548 | Unclassified | 1713 |
| 302 | Ga0070704_100041854 | 3300005549 | Bacteria | 3165 |
| 303 | Ga0070704_100088858 | 3300005549 | Bacteria | 2297 |
| 304 | Ga0070704_100177140 | 3300005549 | Bacteria | 1702 |
| 305 | Ga0070704_100272872 | 3300005549 | Bacteria | 1398 |
| 306 | Ga0070704_100280836 | 3300005549 | Bacteria | 1379 |
| 307 | Ga0070704_100443264 | 3300005549 | Unclassified | 1116 |
| 308 | Ga0070704_100450887 | 3300005549 | Unclassified | 1108 |
| 309 | Ga0070704_100463381 | 3300005549 | Bacteria | 1094 |
| 310 | Ga0070704_100936529 | 3300005549 | Bacteria | 781 |
| 311 | Ga0068855_100455794 | 3300005563 | Bacteria | 1395 |
| 312 | Ga0068855_101239572 | 3300005563 | Unclassified | 774 |
| 313 | Ga0068855_101426436 | 3300005563 | Bacteria | 713 |
| 314 | Ga0068855_102350087 | 3300005563 | Unclassified | 533 |
| 315 | Ga0070664_100005757 | 3300005564 | Bacteria | 9992 |
| 316 | Ga0070664_100073910 | 3300005564 | Bacteria | 2925 |
| 317 | Ga0070664_100089390 | 3300005564 | Bacteria | 2665 |
| 318 | Ga0070664_100252396 | 3300005564 | Unclassified | 1586 |
| 319 | Ga0070664_100299036 | 3300005564 | Bacteria | 1454 |
| 320 | Ga0070664_100390994 | 3300005564 | Bacteria | 1271 |
| 321 | Ga0070664_100428813 | 3300005564 | Unclassified | 1212 |
| 322 | Ga0070664_100478689 | 3300005564 | Bacteria | 1145 |
| 323 | Ga0070664_101013882 | 3300005564 | Unclassified | 780 |
| 324 | Ga0070664_102288880 | 3300005564 | Unclassified | 513 |
| 325 | Ga0070664_102339284 | 3300005564 | Unclassified | 507 |
| 326 | Ga0068857_100011647 | 3300005577 | Bacteria | 7650 |
| 327 | Ga0068857_100098402 | 3300005577 | Unclassified | 2624 |
| 328 | Ga0068857_100250199 | 3300005577 | Bacteria | 1624 |
| 329 | Ga0068857_100259806 | 3300005577 | Bacteria | 1593 |
| 330 | Ga0068857_100474762 | 3300005577 | Bacteria | 1171 |
| 331 | Ga0068857_100474810 | 3300005577 | Unclassified | 1171 |
| 332 | Ga0068857_100553609 | 3300005577 | Bacteria | 1084 |
| 333 | Ga0068857_100665285 | 3300005577 | Unclassified | 988 |
| 334 | Ga0068857_100866822 | 3300005577 | Bacteria | 865 |
| 335 | Ga0068854_100039135 | 3300005578 | Bacteria | 3338 |
| 336 | Ga0068854_100198348 | 3300005578 | Unclassified | 1576 |
| 337 | Ga0068854_100319982 | 3300005578 | Unclassified | 1260 |
| 338 | Ga0068854_100491532 | 3300005578 | Bacteria | 1032 |
| 339 | Ga0068854_100595031 | 3300005578 | Unclassified | 943 |
| 340 | Ga0068854_100643546 | 3300005578 | Unclassified | 909 |
| 341 | Ga0068854_100660586 | 3300005578 | Bacteria | 898 |
| 342 | Ga0068854_101314622 | 3300005578 | Unclassified | 651 |
| 343 | Ga0068854_101980158 | 3300005578 | Unclassified | 536 |
| 344 | Ga0068854_102125540 | 3300005578 | Unclassified | 519 |
| 345 | Ga0068856_100021795 | 3300005614 | Bacteria | 6227 |
| 346 | Ga0068856_100925077 | 3300005614 | Unclassified | 891 |
| 347 | Ga0070702_100020950 | 3300005615 | Bacteria | 3432 |
| 348 | Ga0070702_100037702 | 3300005615 | Bacteria | 2685 |
| 349 | Ga0070702_100063007 | 3300005615 | Unclassified | 2163 |
| 350 | Ga0070702_100212460 | 3300005615 | Bacteria | 1288 |
| 351 | Ga0070702_100396737 | 3300005615 | Unclassified | 986 |
| 352 | Ga0070702_101325575 | 3300005615 | Unclassified | 585 |
| 353 | Ga0068852_100129712 | 3300005616 | Unclassified | 2320 |
| 354 | Ga0068852_100318997 | 3300005616 | Unclassified | 1509 |
| 355 | Ga0068852_100425615 | 3300005616 | Unclassified | 1310 |
| 356 | Ga0068852_101212324 | 3300005616 | Bacteria | 776 |
| 357 | Ga0068852_101632978 | 3300005616 | Bacteria | 667 |
| 358 | Ga0068852_101659408 | 3300005616 | Unclassified | 662 |
| 359 | Ga0068852_102602473 | 3300005616 | Unclassified | 526 |
| 360 | Ga0068859_100006661 | 3300005617 | Bacteria | 11729 |
| 361 | Ga0068859_100009613 | 3300005617 | Bacteria | 9764 |
| 362 | Ga0068859_100027113 | 3300005617 | Bacteria | 5747 |
| 363 | Ga0068859_100056402 | 3300005617 | Bacteria | 3954 |
| 364 | Ga0068859_100063364 | 3300005617 | Bacteria | 3728 |
| 365 | Ga0068859_100184573 | 3300005617 | Bacteria | 2169 |
| 366 | Ga0068859_100223045 | 3300005617 | Bacteria | 1973 |
| 367 | Ga0068859_100232478 | 3300005617 | Bacteria | 1932 |
| 368 | Ga0068859_100235025 | 3300005617 | Bacteria | 1921 |
| 369 | Ga0068859_100329511 | 3300005617 | Bacteria | 1621 |
| 370 | Ga0068859_100463722 | 3300005617 | Unclassified | 1363 |
| 371 | Ga0068859_100490815 | 3300005617 | Bacteria | 1323 |
| 372 | Ga0068859_100602699 | 3300005617 | Bacteria | 1191 |
| 373 | Ga0068859_100636851 | 3300005617 | Unclassified | 1158 |
| 374 | Ga0068859_100794078 | 3300005617 | Unclassified | 1034 |
| 375 | Ga0068859_100816629 | 3300005617 | Bacteria | 1019 |
| 376 | Ga0068859_100991361 | 3300005617 | Unclassified | 923 |
| 377 | Ga0068859_101063755 | 3300005617 | Bacteria | 889 |
| 378 | Ga0068859_102186136 | 3300005617 | Bacteria | 611 |
| 379 | Ga0068859_102420368 | 3300005617 | Unclassified | 578 |
| 380 | Ga0068859_102835964 | 3300005617 | Unclassified | 532 |
| 381 | Ga0068859_103094459 | 3300005617 | Bacteria | 507 |
| 382 | Ga0068864_100008711 | 3300005618 | Bacteria | 8367 |
| 383 | Ga0068864_100021333 | 3300005618 | Bacteria | 5427 |
| 384 | Ga0068864_100054098 | 3300005618 | Bacteria | 3464 |
| 385 | Ga0068864_100212659 | 3300005618 | Bacteria | 1781 |
| 386 | Ga0068864_100214585 | 3300005618 | Unclassified | 1773 |
| 387 | Ga0068864_100323995 | 3300005618 | Bacteria | 1448 |
| 388 | Ga0068864_100387108 | 3300005618 | Unclassified | 1326 |
| 389 | Ga0068864_100415507 | 3300005618 | Bacteria | 1281 |
| 390 | Ga0068864_100526012 | 3300005618 | Bacteria | 1141 |
| 391 | Ga0068864_100794165 | 3300005618 | Bacteria | 930 |
| 392 | Ga0068864_101367078 | 3300005618 | Unclassified | 709 |
| 393 | Ga0068864_101523147 | 3300005618 | Unclassified | 672 |
| 394 | Ga0068864_101834311 | 3300005618 | Unclassified | 612 |
| 395 | Ga0068864_102357615 | 3300005618 | Unclassified | 539 |
| 396 | Ga0068866_10071694 | 3300005718 | Unclassified | 1833 |
| 397 | Ga0068866_10301056 | 3300005718 | Bacteria | 1001 |
| 398 | Ga0068861_100002983 | 3300005719 | Bacteria | 11168 |
| 399 | Ga0068861_100004194 | 3300005719 | Bacteria | 9666 |
| 400 | Ga0068861_100026590 | 3300005719 | Bacteria | 4208 |
| 401 | Ga0068861_100151057 | 3300005719 | Bacteria | 1906 |
| 402 | Ga0068861_100218202 | 3300005719 | Bacteria | 1610 |
| 403 | Ga0068861_100537665 | 3300005719 | Unclassified | 1063 |
| 404 | Ga0068861_100773458 | 3300005719 | Bacteria | 899 |
| 405 | Ga0068861_101696318 | 3300005719 | Unclassified | 625 |
| 406 | Ga0068861_101809589 | 3300005719 | Bacteria | 606 |
| 407 | Ga0068861_101811476 | 3300005719 | Bacteria | 606 |
| 408 | Ga0068861_102311319 | 3300005719 | Unclassified | 540 |
| 409 | Ga0068851_10063826 | 3300005834 | Bacteria | 1892 |
| 410 | Ga0068851_10402445 | 3300005834 | Unclassified | 806 |
| 411 | Ga0068851_10568427 | 3300005834 | Unclassified | 687 |
| 412 | Ga0068851_10741795 | 3300005834 | Bacteria | 607 |
| 413 | Ga0068870_10107101 | 3300005840 | Unclassified | 1590 |
| 414 | Ga0068870_10150762 | 3300005840 | Bacteria | 1369 |
| 415 | Ga0068870_10232065 | 3300005840 | Bacteria | 1135 |
| 416 | Ga0068870_10414291 | 3300005840 | Unclassified | 880 |
| 417 | Ga0068863_100075227 | 3300005841 | Bacteria | 3195 |
| 418 | Ga0068863_100112035 | 3300005841 | Bacteria | 2599 |
| 419 | Ga0068863_100167444 | 3300005841 | Bacteria | 2107 |
| 420 | Ga0068863_100213033 | 3300005841 | Bacteria | 1860 |
| 421 | Ga0068863_100223750 | 3300005841 | Bacteria | 1813 |
| 422 | Ga0068863_100270853 | 3300005841 | Bacteria | 1643 |
| 423 | Ga0068863_100274814 | 3300005841 | Bacteria | 1631 |
| 424 | Ga0068863_100329269 | 3300005841 | Bacteria | 1485 |
| 425 | Ga0068863_101077930 | 3300005841 | Bacteria | 808 |
| 426 | Ga0068858_100020307 | 3300005842 | Bacteria | 6212 |
| 427 | Ga0068858_100062270 | 3300005842 | Bacteria | 3450 |
| 428 | Ga0068858_100070049 | 3300005842 | Bacteria | 3251 |
| 429 | Ga0068858_100248180 | 3300005842 | Bacteria | 1690 |
| 430 | Ga0068858_100278823 | 3300005842 | Bacteria | 1592 |
| 431 | Ga0068858_100719923 | 3300005842 | Bacteria | 971 |
| 432 | Ga0068858_100915307 | 3300005842 | Bacteria | 858 |
| 433 | Ga0068858_100955120 | 3300005842 | Unclassified | 839 |
| 434 | Ga0068858_101099103 | 3300005842 | Unclassified | 781 |
| 435 | Ga0068858_102430760 | 3300005842 | Unclassified | 518 |
| 436 | Ga0068858_102465385 | 3300005842 | Unclassified | 514 |
| 437 | Ga0068860_100067260 | 3300005843 | Bacteria | 3405 |
| 438 | Ga0068860_100095228 | 3300005843 | Bacteria | 2838 |
| 439 | Ga0068860_100100146 | 3300005843 | Bacteria | 2764 |
| 440 | Ga0068860_100124757 | 3300005843 | Bacteria | 2468 |
| 441 | Ga0068860_100134784 | 3300005843 | Bacteria | 2371 |
| 442 | Ga0068860_100150589 | 3300005843 | Bacteria | 2240 |
| 443 | Ga0068860_100323632 | 3300005843 | Bacteria | 1513 |
| 444 | Ga0068860_100326954 | 3300005843 | Bacteria | 1505 |
| 445 | Ga0068860_100404102 | 3300005843 | Bacteria | 1351 |
| 446 | Ga0068860_100665872 | 3300005843 | Unclassified | 1049 |
| 447 | Ga0068860_102176404 | 3300005843 | Unclassified | 576 |
| 448 | Ga0068862_100010358 | 3300005844 | Bacteria | 7693 |
| 449 | Ga0068862_100036312 | 3300005844 | Bacteria | 4177 |
| 450 | Ga0068862_100073581 | 3300005844 | Bacteria | 2953 |
| 451 | Ga0068862_100150979 | 3300005844 | Bacteria | 2068 |
| 452 | Ga0068862_100211958 | 3300005844 | Unclassified | 1750 |
| 453 | Ga0068862_100672179 | 3300005844 | Bacteria | 1001 |
| 454 | Ga0068862_100778572 | 3300005844 | Unclassified | 933 |
| 455 | Ga0068862_100961321 | 3300005844 | Bacteria | 843 |
| 456 | Ga0068862_101076594 | 3300005844 | Bacteria | 798 |
| 457 | Ga0068862_102301013 | 3300005844 | Bacteria | 550 |
| 458 | Ga0081540_1046504 | 3300005983 | Bacteria | 2190 |
| 459 | Ga0081539_10000408 | 3300005985 | Bacteria | 91634 |
| 460 | Ga0081539_10002782 | 3300005985 | Bacteria | 23520 |
| 461 | Ga0081539_10260842 | 3300005985 | Unclassified | 764 |
| 462 | Ga0070716_100039779 | 3300006173 | Bacteria | 2612 |
| 463 | Ga0097621_100008542 | 3300006237 | Bacteria | 7378 |
| 464 | Ga0097621_100013219 | 3300006237 | Bacteria | 6144 |
| 465 | Ga0097621_100036362 | 3300006237 | Bacteria | 3940 |
| 466 | Ga0097621_100167622 | 3300006237 | Bacteria | 1891 |
| 467 | Ga0097621_100381058 | 3300006237 | Bacteria | 1260 |
| 468 | Ga0097621_101550547 | 3300006237 | Unclassified | 629 |
| 469 | Ga0068871_100019524 | 3300006358 | Bacteria | 5176 |
| 470 | Ga0068871_100031414 | 3300006358 | Bacteria | 4188 |
| 471 | Ga0068871_100185048 | 3300006358 | Unclassified | 1791 |
| 472 | Ga0068871_100428232 | 3300006358 | Unclassified | 1183 |
| 473 | Ga0068871_101554072 | 3300006358 | Unclassified | 626 |
| 474 | Ga0075428_101057264 | 3300006844 | Bacteria | 858 |
| 475 | Ga0075430_100066558 | 3300006846 | Bacteria | 3025 |
| 476 | Ga0075430_100082659 | 3300006846 | Unclassified | 2691 |
| 477 | Ga0075431_100094063 | 3300006847 | Bacteria | 3093 |
| 478 | Ga0075431_100164221 | 3300006847 | Bacteria | 2283 |
| 479 | Ga0075431_100255488 | 3300006847 | Bacteria | 1779 |
| 480 | Ga0075431_100265972 | 3300006847 | Viruses | 1739 |
| 481 | Ga0075431_101432383 | 3300006847 | Unclassified | 650 |
| 482 | Ga0075433_10037055 | 3300006852 | Bacteria | 4204 |
| 483 | Ga0075433_10243454 | 3300006852 | Bacteria | 1596 |
| 484 | Ga0075433_10453845 | 3300006852 | Bacteria | 1130 |
| 485 | Ga0075433_10517438 | 3300006852 | Unclassified | 1050 |
| 486 | Ga0075433_10680206 | 3300006852 | Unclassified | 902 |
| 487 | Ga0075434_100289565 | 3300006871 | Bacteria | 1658 |
| 488 | Ga0075434_100363644 | 3300006871 | Bacteria | 1468 |
| 489 | Ga0075434_100797367 | 3300006871 | Bacteria | 961 |
| 490 | Ga0075429_100100562 | 3300006880 | Unclassified | 2524 |
| 491 | Ga0075429_101684029 | 3300006880 | Unclassified | 551 |
| 492 | Ga0068865_100048889 | 3300006881 | Bacteria | 2913 |
| 493 | Ga0068865_100117481 | 3300006881 | Bacteria | 1972 |
| 494 | Ga0068865_100279919 | 3300006881 | Unclassified | 1327 |
| 495 | Ga0068865_100540999 | 3300006881 | Unclassified | 977 |
| 496 | Ga0097620_100006661 | 3300006931 | Bacteria | 11729 |
| 497 | Ga0097620_100009613 | 3300006931 | Bacteria | 9764 |
| 498 | Ga0097620_100027113 | 3300006931 | Bacteria | 5747 |
| 499 | Ga0097620_100056402 | 3300006931 | Bacteria | 3954 |
| 500 | Ga0097620_100063365 | 3300006931 | Bacteria | 3728 |
| 501 | Ga0097620_100184577 | 3300006931 | Bacteria | 2169 |
| 502 | Ga0097620_100223050 | 3300006931 | Bacteria | 1973 |
| 503 | Ga0097620_100232474 | 3300006931 | Bacteria | 1932 |
| 504 | Ga0097620_100235042 | 3300006931 | Bacteria | 1921 |
| 505 | Ga0097620_100329512 | 3300006931 | Bacteria | 1621 |
| 506 | Ga0097620_100463757 | 3300006931 | Unclassified | 1363 |
| 507 | Ga0097620_100490790 | 3300006931 | Bacteria | 1323 |
| 508 | Ga0097620_100602653 | 3300006931 | Bacteria | 1191 |
| 509 | Ga0097620_100636851 | 3300006931 | Unclassified | 1158 |
| 510 | Ga0097620_100794087 | 3300006931 | Unclassified | 1034 |
| 511 | Ga0097620_100816652 | 3300006931 | Bacteria | 1019 |
| 512 | Ga0097620_100991368 | 3300006931 | Unclassified | 923 |
| 513 | Ga0097620_101063782 | 3300006931 | Bacteria | 889 |
| 514 | Ga0097620_102186338 | 3300006931 | Bacteria | 611 |
| 515 | Ga0097620_102420377 | 3300006931 | Unclassified | 578 |
| 516 | Ga0097620_102836133 | 3300006931 | Unclassified | 532 |
| 517 | Ga0097620_103093790 | 3300006931 | Bacteria | 507 |
| 518 | Ga0075435_100021117 | 3300007076 | Bacteria | 5002 |
| 519 | Ga0105251_10385115 | 3300009011 | Unclassified | 643 |
| 520 | Ga0105244_10522940 | 3300009036 | Unclassified | 546 |
| 521 | Ga0105250_10031522 | 3300009092 | Bacteria | 2128 |
| 522 | Ga0105250_10063537 | 3300009092 | Bacteria | 1486 |
| 523 | Ga0105250_10408584 | 3300009092 | Unclassified | 603 |
| 524 | Ga0105240_10191814 | 3300009093 | Bacteria | 2402 |
| 525 | Ga0105240_10414692 | 3300009093 | Bacteria | 1514 |
| 526 | Ga0105240_10631291 | 3300009093 | Unclassified | 1176 |
| 527 | Ga0105240_10788834 | 3300009093 | Bacteria | 1030 |
| 528 | Ga0105240_11085907 | 3300009093 | Bacteria | 852 |
| 529 | Ga0105240_11793581 | 3300009093 | Unclassified | 639 |
| 530 | Ga0111539_10005075 | 3300009094 | Bacteria | 17101 |
| 531 | Ga0111539_10183930 | 3300009094 | Bacteria | 2440 |
| 532 | Ga0111539_10202263 | 3300009094 | Bacteria | 2316 |
| 533 | Ga0111539_10330094 | 3300009094 | Bacteria | 1775 |
| 534 | Ga0111539_12748337 | 3300009094 | Unclassified | 570 |
| 535 | Ga0105245_10141499 | 3300009098 | Bacteria | 2266 |
| 536 | Ga0105245_10632875 | 3300009098 | Bacteria | 1099 |
| 537 | Ga0105245_10794307 | 3300009098 | Bacteria | 984 |
| 538 | Ga0105245_11623836 | 3300009098 | Unclassified | 698 |
| 539 | Ga0105245_11756378 | 3300009098 | Bacteria | 673 |
| 540 | Ga0105245_12317311 | 3300009098 | Bacteria | 591 |
| 541 | Ga0105247_10007521 | 3300009101 | Bacteria | 6677 |
| 542 | Ga0105247_10164911 | 3300009101 | Bacteria | 1469 |
| 543 | Ga0105247_10320588 | 3300009101 | Bacteria | 1081 |
| 544 | Ga0105247_10459888 | 3300009101 | Unclassified | 919 |
| 545 | Ga0105247_11150293 | 3300009101 | Unclassified | 615 |
| 546 | Ga0114129_10042525 | 3300009147 | Bacteria | 6398 |
| 547 | Ga0114129_10114657 | 3300009147 | Unclassified | 3715 |
| 548 | Ga0114129_10254718 | 3300009147 | Bacteria | 2355 |
| 549 | Ga0114129_10369332 | 3300009147 | Bacteria | 1897 |
| 550 | Ga0114129_10670883 | 3300009147 | Unclassified | 1336 |
| 551 | Ga0114129_11304227 | 3300009147 | Unclassified | 900 |
| 552 | Ga0114129_11420163 | 3300009147 | Unclassified | 856 |
| 553 | Ga0114129_11578951 | 3300009147 | Unclassified | 804 |
| 554 | Ga0105243_10077421 | 3300009148 | Bacteria | 2705 |
| 555 | Ga0105243_10145993 | 3300009148 | Bacteria | 2024 |
| 556 | Ga0105243_10155782 | 3300009148 | Bacteria | 1964 |
| 557 | Ga0105243_10229866 | 3300009148 | Bacteria | 1645 |
| 558 | Ga0105243_10256448 | 3300009148 | Unclassified | 1564 |
| 559 | Ga0105243_10582045 | 3300009148 | Bacteria | 1075 |
| 560 | Ga0105243_10860073 | 3300009148 | Unclassified | 899 |
| 561 | Ga0105241_10019245 | 3300009174 | Bacteria | 5034 |
| 562 | Ga0105241_10021776 | 3300009174 | Bacteria | 4742 |
| 563 | Ga0105241_10046782 | 3300009174 | Bacteria | 3287 |
| 564 | Ga0105241_10064366 | 3300009174 | Bacteria | 2831 |
| 565 | Ga0105241_10109925 | 3300009174 | Unclassified | 2205 |
| 566 | Ga0105241_10206882 | 3300009174 | Bacteria | 1642 |
| 567 | Ga0105241_10222574 | 3300009174 | Unclassified | 1587 |
| 568 | Ga0105241_10457453 | 3300009174 | Bacteria | 1130 |
| 569 | Ga0105241_10482575 | 3300009174 | Bacteria | 1102 |
| 570 | Ga0105241_11136046 | 3300009174 | Unclassified | 737 |
| 571 | Ga0105241_11346875 | 3300009174 | Bacteria | 681 |
| 572 | Ga0105241_11497352 | 3300009174 | Unclassified | 649 |
| 573 | Ga0105241_11797002 | 3300009174 | Unclassified | 598 |
| 574 | Ga0105241_11870419 | 3300009174 | Bacteria | 588 |
| 575 | Ga0105242_10002192 | 3300009176 | Bacteria | 15419 |
| 576 | Ga0105242_10062185 | 3300009176 | Bacteria | 3072 |
| 577 | Ga0105242_10207593 | 3300009176 | Bacteria | 1743 |
| 578 | Ga0105242_10358283 | 3300009176 | Bacteria | 1349 |
| 579 | Ga0105242_10486482 | 3300009176 | Bacteria | 1171 |
| 580 | Ga0105242_11017506 | 3300009176 | Bacteria | 837 |
| 581 | Ga0105242_11404069 | 3300009176 | Unclassified | 726 |
| 582 | Ga0105242_13196653 | 3300009176 | Bacteria | 508 |
| 583 | Ga0105248_10007251 | 3300009177 | Bacteria | 12167 |
| 584 | Ga0105248_10016118 | 3300009177 | Bacteria | 8224 |
| 585 | Ga0105248_10033803 | 3300009177 | Bacteria | 5714 |
| 586 | Ga0105248_10033984 | 3300009177 | Bacteria | 5700 |
| 587 | Ga0105248_10088802 | 3300009177 | Bacteria | 3479 |
| 588 | Ga0105248_10480322 | 3300009177 | Bacteria | 1401 |
| 589 | Ga0105248_10725191 | 3300009177 | Bacteria | 1122 |
| 590 | Ga0105248_11331488 | 3300009177 | Unclassified | 812 |
| 591 | Ga0105248_11336314 | 3300009177 | Unclassified | 811 |
| 592 | Ga0105248_11486161 | 3300009177 | Unclassified | 767 |
| 593 | Ga0105248_12531862 | 3300009177 | Unclassified | 585 |
| 594 | Ga0105237_10019745 | 3300009545 | Bacteria | 6957 |
| 595 | Ga0105237_10296177 | 3300009545 | Bacteria | 1621 |
| 596 | Ga0105237_10723382 | 3300009545 | Bacteria | 1002 |
| 597 | Ga0105237_10878241 | 3300009545 | Unclassified | 903 |
| 598 | Ga0105237_11104178 | 3300009545 | Unclassified | 800 |
| 599 | Ga0105238_10008842 | 3300009551 | Bacteria | 10074 |
| 600 | Ga0105238_10104368 | 3300009551 | Bacteria | 2815 |
| 601 | Ga0105238_10635478 | 3300009551 | Bacteria | 1077 |
| 602 | Ga0105238_11234438 | 3300009551 | Unclassified | 772 |
| 603 | Ga0105249_10000052 | 3300009553 | Bacteria | 168047 |
| 604 | Ga0105249_10004897 | 3300009553 | Bacteria | 11556 |
| 605 | Ga0105249_10009805 | 3300009553 | Bacteria | 8393 |
| 606 | Ga0105249_10017459 | 3300009553 | Bacteria | 6371 |
| 607 | Ga0105249_10022390 | 3300009553 | Bacteria | 5659 |
| 608 | Ga0105249_10411487 | 3300009553 | Bacteria | 1384 |
| 609 | Ga0105249_10508093 | 3300009553 | Bacteria | 1251 |
| 610 | Ga0105249_12386081 | 3300009553 | Unclassified | 601 |
| 611 | Ga0105249_12622480 | 3300009553 | Unclassified | 576 |
| 612 | Ga0105239_10116098 | 3300010375 | Bacteria | 2970 |
| 613 | Ga0105239_10303061 | 3300010375 | Bacteria | 1799 |
| 614 | Ga0105239_10908791 | 3300010375 | Bacteria | 1011 |
| 615 | Ga0105239_11743326 | 3300010375 | Bacteria | 721 |
| 616 | Ga0105239_11845581 | 3300010375 | Bacteria | 701 |
| 617 | Ga0105246_10019006 | 3300011119 | Bacteria | 4383 |
| 618 | Ga0105246_10041615 | 3300011119 | Bacteria | 3106 |
| 619 | Ga0105246_10079138 | 3300011119 | Bacteria | 2337 |
| 620 | Ga0105246_10094377 | 3300011119 | Unclassified | 2164 |
| 621 | Ga0105246_10111502 | 3300011119 | Bacteria | 2010 |
| 622 | Ga0105246_10292357 | 3300011119 | Bacteria | 1311 |
| 623 | Ga0105246_10419796 | 3300011119 | Bacteria | 1116 |
| 624 | Ga0105246_10424657 | 3300011119 | Bacteria | 1110 |
| 625 | Ga0105246_10716314 | 3300011119 | Bacteria | 879 |
| 626 | Ga0157326_1086845 | 3300012513 | Unclassified | 520 |
| 627 | Ga0157373_10016111 | 3300013100 | Bacteria | 5456 |
| 628 | Ga0157373_10031501 | 3300013100 | Bacteria | 3817 |
| 629 | Ga0157373_10033790 | 3300013100 | Bacteria | 3676 |
| 630 | Ga0157373_10136178 | 3300013100 | Unclassified | 1727 |
| 631 | Ga0157373_10520132 | 3300013100 | Bacteria | 861 |
| 632 | Ga0157373_11499500 | 3300013100 | Unclassified | 515 |
| 633 | Ga0157371_10450589 | 3300013102 | Bacteria | 946 |
| 634 | Ga0157374_10015970 | 3300013296 | Bacteria | 6594 |
| 635 | Ga0157374_10135043 | 3300013296 | Bacteria | 2391 |
| 636 | Ga0157374_11340551 | 3300013296 | Unclassified | 738 |
| 637 | Ga0157374_11556776 | 3300013296 | Bacteria | 685 |
| 638 | Ga0157378_10001282 | 3300013297 | Bacteria | 22599 |
| 639 | Ga0157378_10003380 | 3300013297 | Bacteria | 14189 |
| 640 | Ga0157378_10086410 | 3300013297 | Unclassified | 2843 |
| 641 | Ga0157378_10307296 | 3300013297 | Bacteria | 1537 |
| 642 | Ga0157378_10408909 | 3300013297 | Bacteria | 1339 |
| 643 | Ga0157378_10535751 | 3300013297 | Unclassified | 1174 |
| 644 | Ga0157378_10821345 | 3300013297 | Unclassified | 956 |
| 645 | Ga0157378_10913835 | 3300013297 | Bacteria | 909 |
| 646 | Ga0157378_10981057 | 3300013297 | Bacteria | 878 |
| 647 | Ga0157378_11284888 | 3300013297 | Unclassified | 773 |
| 648 | Ga0157378_11297086 | 3300013297 | Unclassified | 769 |
| 649 | Ga0157378_11646753 | 3300013297 | Unclassified | 688 |
| 650 | Ga0157378_11876248 | 3300013297 | Bacteria | 648 |
| 651 | Ga0157378_11930256 | 3300013297 | Bacteria | 640 |
| 652 | Ga0157378_12607041 | 3300013297 | Unclassified | 558 |
| 653 | Ga0163162_10000001 | 3300013306 | Bacteria | 751833 |
| 654 | Ga0163162_10009010 | 3300013306 | Bacteria | 9702 |
| 655 | Ga0163162_10012811 | 3300013306 | Bacteria | 8191 |
| 656 | Ga0163162_10044633 | 3300013306 | Bacteria | 4439 |
| 657 | Ga0163162_10149517 | 3300013306 | Bacteria | 2452 |
| 658 | Ga0163162_10618230 | 3300013306 | Bacteria | 1209 |
| 659 | Ga0163162_11200497 | 3300013306 | Bacteria | 861 |
| 660 | Ga0163162_11479821 | 3300013306 | Unclassified | 773 |
| 661 | Ga0163162_11548231 | 3300013306 | Bacteria | 756 |
| 662 | Ga0157372_10031386 | 3300013307 | Bacteria | 5818 |
| 663 | Ga0157372_10971521 | 3300013307 | Unclassified | 984 |
| 664 | Ga0157372_11419886 | 3300013307 | Bacteria | 800 |
| 665 | Ga0157372_11806124 | 3300013307 | Unclassified | 703 |
| 666 | Ga0157372_12637697 | 3300013307 | Bacteria | 577 |
| 667 | Ga0157375_10004418 | 3300013308 | Bacteria | 12206 |
| 668 | Ga0157375_10066922 | 3300013308 | Bacteria | 3588 |
| 669 | Ga0157375_10073908 | 3300013308 | Bacteria | 3429 |
| 670 | Ga0157375_10198777 | 3300013308 | Bacteria | 2160 |
| 671 | Ga0157375_10262499 | 3300013308 | Unclassified | 1889 |
| 672 | Ga0157375_10336605 | 3300013308 | Bacteria | 1674 |
| 673 | Ga0157375_10511728 | 3300013308 | Bacteria | 1364 |
| 674 | Ga0157375_11127453 | 3300013308 | Bacteria | 919 |
| 675 | Ga0157375_11196087 | 3300013308 | Unclassified | 891 |
| 676 | Ga0157375_11350255 | 3300013308 | Bacteria | 839 |
| 677 | Ga0157375_11785373 | 3300013308 | Unclassified | 729 |
| 678 | Ga0157375_12442601 | 3300013308 | Unclassified | 624 |
| 679 | Ga0157375_12647574 | 3300013308 | Unclassified | 599 |
| 680 | Ga0163163_10001533 | 3300014325 | Bacteria | 19476 |
| 681 | Ga0163163_10001831 | 3300014325 | Bacteria | 17942 |
| 682 | Ga0163163_10007435 | 3300014325 | Bacteria | 9669 |
| 683 | Ga0163163_10132213 | 3300014325 | Bacteria | 2536 |
| 684 | Ga0163163_10207137 | 3300014325 | Unclassified | 2010 |
| 685 | Ga0163163_10220860 | 3300014325 | Bacteria | 1943 |
| 686 | Ga0163163_10268419 | 3300014325 | Bacteria | 1757 |
| 687 | Ga0163163_10310393 | 3300014325 | Bacteria | 1630 |
| 688 | Ga0163163_10312194 | 3300014325 | Bacteria | 1625 |
| 689 | Ga0163163_10340679 | 3300014325 | Unclassified | 1554 |
| 690 | Ga0163163_10370662 | 3300014325 | Bacteria | 1489 |
| 691 | Ga0163163_10421034 | 3300014325 | Unclassified | 1394 |
| 692 | Ga0163163_10684469 | 3300014325 | Unclassified | 1089 |
| 693 | Ga0163163_10931140 | 3300014325 | Bacteria | 932 |
| 694 | Ga0163163_11748079 | 3300014325 | Unclassified | 682 |
| 695 | Ga0163163_12017930 | 3300014325 | Unclassified | 637 |
| 696 | Ga0157380_10001205 | 3300014326 | Bacteria | 16752 |
| 697 | Ga0157380_10017030 | 3300014326 | Bacteria | 5370 |
| 698 | Ga0157380_10034148 | 3300014326 | Bacteria | 3922 |
| 699 | Ga0157380_10041006 | 3300014326 | Bacteria | 3610 |
| 700 | Ga0157380_10270971 | 3300014326 | Unclassified | 1548 |
| 701 | Ga0157380_10504538 | 3300014326 | Bacteria | 1176 |
| 702 | Ga0157380_10593595 | 3300014326 | Unclassified | 1094 |
| 703 | Ga0157380_11151082 | 3300014326 | Bacteria | 817 |
| 704 | Ga0157380_11965845 | 3300014326 | Unclassified | 646 |
| 705 | Ga0157380_12322664 | 3300014326 | Unclassified | 601 |
| 706 | Ga0157380_12453947 | 3300014326 | Unclassified | 587 |
| 707 | Ga0157377_10183115 | 3300014745 | Bacteria | 1319 |
| 708 | Ga0157377_10192309 | 3300014745 | Bacteria | 1290 |
| 709 | Ga0157377_10301550 | 3300014745 | Unclassified | 1057 |
| 710 | Ga0157379_10025079 | 3300014968 | Bacteria | 5294 |
| 711 | Ga0157379_10290117 | 3300014968 | Bacteria | 1490 |
| 712 | Ga0157379_10607894 | 3300014968 | Bacteria | 1021 |
| 713 | Ga0157379_11001281 | 3300014968 | Unclassified | 797 |
| 714 | Ga0157379_12451966 | 3300014968 | Unclassified | 521 |
| 715 | Ga0157376_10014842 | 3300014969 | Bacteria | 5863 |
| 716 | Ga0157376_10906771 | 3300014969 | Unclassified | 900 |
| 717 | Ga0157376_12131772 | 3300014969 | Unclassified | 599 |
| 718 | Ga0182005_1188179 | 3300015265 | Unclassified | 616 |
| 719 | Ga0163161_10032403 | 3300017792 | Bacteria | 3731 |
| 720 | Ga0163161_11040389 | 3300017792 | Bacteria | 701 |
| 721 | Ga0213873_10024794 | 3300021358 | Bacteria | 1442 |
| 722 | Ga0213872_10026992 | 3300021361 | Bacteria | 2638 |
| 723 | Ga0213876_10000355 | 3300021384 | Bacteria | 39376 |
| 724 | Ga0213876_10013377 | 3300021384 | Bacteria | 4360 |
| 725 | Ga0213871_10177439 | 3300021441 | Bacteria | 657 |
| 726 | Ga0207697_10013752 | 3300025315 | Bacteria | 3372 |
| 727 | Ga0207697_10453508 | 3300025315 | Unclassified | 568 |
| 728 | Ga0207656_10456840 | 3300025321 | Unclassified | 646 |
| 729 | Ga0207653_10198873 | 3300025885 | Unclassified | 755 |
| 730 | Ga0207653_10394520 | 3300025885 | Unclassified | 542 |
| 731 | Ga0207682_10236035 | 3300025893 | Unclassified | 849 |
| 732 | Ga0207682_10297446 | 3300025893 | Unclassified | 756 |
| 733 | Ga0207642_10288671 | 3300025899 | Bacteria | 946 |
| 734 | Ga0207642_11009843 | 3300025899 | Unclassified | 536 |
| 735 | Ga0207688_10080312 | 3300025901 | Unclassified | 1861 |
| 736 | Ga0207688_10664907 | 3300025901 | Unclassified | 658 |
| 737 | Ga0207688_10712843 | 3300025901 | Unclassified | 635 |
| 738 | Ga0207680_10062476 | 3300025903 | Bacteria | 2276 |
| 739 | Ga0207647_10084981 | 3300025904 | Bacteria | 1893 |
| 740 | Ga0207647_10233759 | 3300025904 | Unclassified | 1057 |
| 741 | Ga0207647_10556535 | 3300025904 | Unclassified | 636 |
| 742 | Ga0207647_10585535 | 3300025904 | Unclassified | 616 |
| 743 | Ga0207645_10034311 | 3300025907 | Bacteria | 3260 |
| 744 | Ga0207645_10348438 | 3300025907 | Bacteria | 991 |
| 745 | Ga0207645_10574935 | 3300025907 | Bacteria | 765 |
| 746 | Ga0207643_10007213 | 3300025908 | Bacteria | 5967 |
| 747 | Ga0207643_10010917 | 3300025908 | Bacteria | 4899 |
| 748 | Ga0207643_10228242 | 3300025908 | Bacteria | 1141 |
| 749 | Ga0207643_10398919 | 3300025908 | Unclassified | 869 |
| 750 | Ga0207643_10838481 | 3300025908 | Unclassified | 596 |
| 751 | Ga0207684_10007353 | 3300025910 | Bacteria | 9935 |
| 752 | Ga0207684_10027931 | 3300025910 | Unclassified | 4806 |
| 753 | Ga0207684_10089034 | 3300025910 | Unclassified | 2630 |
| 754 | Ga0207684_10116395 | 3300025910 | Bacteria | 2290 |
| 755 | Ga0207684_10447954 | 3300025910 | Bacteria | 1108 |
| 756 | Ga0207654_10021305 | 3300025911 | Bacteria | 3445 |
| 757 | Ga0207654_10024471 | 3300025911 | Bacteria | 3247 |
| 758 | Ga0207654_10081241 | 3300025911 | Bacteria | 1951 |
| 759 | Ga0207654_10375203 | 3300025911 | Unclassified | 984 |
| 760 | Ga0207654_10638415 | 3300025911 | Bacteria | 762 |
| 761 | Ga0207654_10751407 | 3300025911 | Bacteria | 703 |
| 762 | Ga0207654_10874236 | 3300025911 | Unclassified | 651 |
| 763 | Ga0207707_10046482 | 3300025912 | Bacteria | 3781 |
| 764 | Ga0207707_10085543 | 3300025912 | Bacteria | 2755 |
| 765 | Ga0207695_10407813 | 3300025913 | Bacteria | 1243 |
| 766 | Ga0207695_10895571 | 3300025913 | Unclassified | 767 |
| 767 | Ga0207695_11705591 | 3300025913 | Unclassified | 511 |
| 768 | Ga0207671_10386649 | 3300025914 | Bacteria | 1112 |
| 769 | Ga0207671_10495067 | 3300025914 | Unclassified | 974 |
| 770 | Ga0207671_10799703 | 3300025914 | Bacteria | 748 |
| 771 | Ga0207671_10817099 | 3300025914 | Bacteria | 739 |
| 772 | Ga0207660_10054047 | 3300025917 | Bacteria | 2865 |
| 773 | Ga0207660_10378477 | 3300025917 | Bacteria | 1138 |
| 774 | Ga0207660_10627322 | 3300025917 | Bacteria | 876 |
| 775 | Ga0207660_10697038 | 3300025917 | Bacteria | 828 |
| 776 | Ga0207662_10003190 | 3300025918 | Bacteria | 8392 |
| 777 | Ga0207662_10017971 | 3300025918 | Bacteria | 4005 |
| 778 | Ga0207662_10021969 | 3300025918 | Bacteria | 3653 |
| 779 | Ga0207662_10112076 | 3300025918 | Bacteria | 1702 |
| 780 | Ga0207662_10113569 | 3300025918 | Unclassified | 1691 |
| 781 | Ga0207662_10272566 | 3300025918 | Bacteria | 1117 |
| 782 | Ga0207662_10311410 | 3300025918 | Bacteria | 1049 |
| 783 | Ga0207657_10133707 | 3300025919 | Bacteria | 2031 |
| 784 | Ga0207652_10038997 | 3300025921 | Bacteria | 4030 |
| 785 | Ga0207652_10126285 | 3300025921 | Bacteria | 2279 |
| 786 | Ga0207652_11560473 | 3300025921 | Unclassified | 564 |
| 787 | Ga0207646_10102864 | 3300025922 | Bacteria | 2561 |
| 788 | Ga0207646_10361169 | 3300025922 | Unclassified | 1312 |
| 789 | Ga0207646_11520278 | 3300025922 | Unclassified | 579 |
| 790 | Ga0207646_11917737 | 3300025922 | Unclassified | 505 |
| 791 | Ga0207681_10001745 | 3300025923 | Bacteria | 13958 |
| 792 | Ga0207681_10005262 | 3300025923 | Bacteria | 7950 |
| 793 | Ga0207681_10011079 | 3300025923 | Bacteria | 5537 |
| 794 | Ga0207681_10173897 | 3300025923 | Unclassified | 1634 |
| 795 | Ga0207681_10690261 | 3300025923 | Bacteria | 848 |
| 796 | Ga0207681_10840511 | 3300025923 | Bacteria | 768 |
| 797 | Ga0207681_11631206 | 3300025923 | Unclassified | 540 |
| 798 | Ga0207694_10020544 | 3300025924 | Bacteria | 4998 |
| 799 | Ga0207694_10087086 | 3300025924 | Bacteria | 2460 |
| 800 | Ga0207694_10592267 | 3300025924 | Bacteria | 932 |
| 801 | Ga0207694_11395115 | 3300025924 | Unclassified | 592 |
| 802 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 803 | Ga0207650_10122387 | 3300025925 | Bacteria | 2027 |
| 804 | Ga0207650_10239752 | 3300025925 | Bacteria | 1465 |
| 805 | Ga0207650_10454063 | 3300025925 | Unclassified | 1067 |
| 806 | Ga0207650_10502487 | 3300025925 | Bacteria | 1013 |
| 807 | Ga0207650_10510627 | 3300025925 | Unclassified | 1005 |
| 808 | Ga0207650_10702916 | 3300025925 | Unclassified | 854 |
| 809 | Ga0207650_10875432 | 3300025925 | Bacteria | 762 |
| 810 | Ga0207659_10059289 | 3300025926 | Bacteria | 2751 |
| 811 | Ga0207659_10298746 | 3300025926 | Bacteria | 1322 |
| 812 | Ga0207659_10485962 | 3300025926 | Bacteria | 1044 |
| 813 | Ga0207659_11041545 | 3300025926 | Bacteria | 704 |
| 814 | Ga0207659_11413124 | 3300025926 | Unclassified | 596 |
| 815 | Ga0207687_10325267 | 3300025927 | Unclassified | 1246 |
| 816 | Ga0207687_10499295 | 3300025927 | Unclassified | 1015 |
| 817 | Ga0207687_11360645 | 3300025927 | Unclassified | 610 |
| 818 | Ga0207644_10024830 | 3300025931 | Bacteria | 4117 |
| 819 | Ga0207644_10115193 | 3300025931 | Bacteria | 2038 |
| 820 | Ga0207690_10214084 | 3300025932 | Bacteria | 1471 |
| 821 | Ga0207690_11012654 | 3300025932 | Unclassified | 691 |
| 822 | Ga0207706_10062945 | 3300025933 | Bacteria | 3267 |
| 823 | Ga0207706_10335404 | 3300025933 | Bacteria | 1315 |
| 824 | Ga0207706_10633594 | 3300025933 | Bacteria | 917 |
| 825 | Ga0207706_11337085 | 3300025933 | Unclassified | 591 |
| 826 | Ga0207686_10033667 | 3300025934 | Unclassified | 3060 |
| 827 | Ga0207686_10072162 | 3300025934 | Bacteria | 2224 |
| 828 | Ga0207686_10074054 | 3300025934 | Bacteria | 2199 |
| 829 | Ga0207686_10546754 | 3300025934 | Bacteria | 905 |
| 830 | Ga0207709_10037714 | 3300025935 | Bacteria | 2873 |
| 831 | Ga0207709_10066783 | 3300025935 | Bacteria | 2267 |
| 832 | Ga0207709_10167894 | 3300025935 | Unclassified | 1537 |
| 833 | Ga0207709_11205968 | 3300025935 | Unclassified | 624 |
| 834 | Ga0207670_10000250 | 3300025936 | Bacteria | 33568 |
| 835 | Ga0207670_10060445 | 3300025936 | Bacteria | 2582 |
| 836 | Ga0207670_10161749 | 3300025936 | Bacteria | 1671 |
| 837 | Ga0207670_10245468 | 3300025936 | Unclassified | 1381 |
| 838 | Ga0207670_10518059 | 3300025936 | Unclassified | 970 |
| 839 | Ga0207670_11267194 | 3300025936 | Unclassified | 625 |
| 840 | Ga0207670_11662353 | 3300025936 | Unclassified | 543 |
| 841 | Ga0207669_10110184 | 3300025937 | Bacteria | 1843 |
| 842 | Ga0207669_11510085 | 3300025937 | Unclassified | 573 |
| 843 | Ga0207704_10109975 | 3300025938 | Bacteria | 1860 |
| 844 | Ga0207704_10294809 | 3300025938 | Bacteria | 1239 |
| 845 | Ga0207704_11134156 | 3300025938 | Unclassified | 665 |
| 846 | Ga0207665_10010591 | 3300025939 | Bacteria | 6057 |
| 847 | Ga0207691_10001421 | 3300025940 | Bacteria | 23877 |
| 848 | Ga0207691_10249155 | 3300025940 | Unclassified | 1534 |
| 849 | Ga0207691_10265369 | 3300025940 | Bacteria | 1479 |
| 850 | Ga0207691_10818876 | 3300025940 | Bacteria | 782 |
| 851 | Ga0207691_11218298 | 3300025940 | Unclassified | 624 |
| 852 | Ga0207711_10019129 | 3300025941 | Bacteria | 5700 |
| 853 | Ga0207711_10028277 | 3300025941 | Bacteria | 4717 |
| 854 | Ga0207711_10132721 | 3300025941 | Bacteria | 2234 |
| 855 | Ga0207711_10159891 | 3300025941 | Bacteria | 2038 |
| 856 | Ga0207711_10367803 | 3300025941 | Bacteria | 1333 |
| 857 | Ga0207711_10586249 | 3300025941 | Unclassified | 1040 |
| 858 | Ga0207711_11700855 | 3300025941 | Unclassified | 574 |
| 859 | Ga0207689_10002102 | 3300025942 | Bacteria | 18756 |
| 860 | Ga0207689_10009874 | 3300025942 | Bacteria | 8227 |
| 861 | Ga0207689_10019251 | 3300025942 | Bacteria | 5755 |
| 862 | Ga0207689_10085862 | 3300025942 | Bacteria | 2587 |
| 863 | Ga0207689_10257770 | 3300025942 | Bacteria | 1443 |
| 864 | Ga0207689_10282044 | 3300025942 | Bacteria | 1376 |
| 865 | Ga0207689_10510964 | 3300025942 | Unclassified | 1007 |
| 866 | Ga0207689_10542066 | 3300025942 | Bacteria | 977 |
| 867 | Ga0207689_10648118 | 3300025942 | Bacteria | 890 |
| 868 | Ga0207689_10707242 | 3300025942 | Bacteria | 850 |
| 869 | Ga0207689_10754913 | 3300025942 | Unclassified | 821 |
| 870 | Ga0207689_10788582 | 3300025942 | Unclassified | 802 |
| 871 | Ga0207689_10926654 | 3300025942 | Unclassified | 735 |
| 872 | Ga0207689_10944754 | 3300025942 | Unclassified | 727 |
| 873 | Ga0207689_11332472 | 3300025942 | Unclassified | 603 |
| 874 | Ga0207679_10106366 | 3300025945 | Bacteria | 2205 |
| 875 | Ga0207679_10166511 | 3300025945 | Bacteria | 1810 |
| 876 | Ga0207679_10170112 | 3300025945 | Bacteria | 1793 |
| 877 | Ga0207679_10229146 | 3300025945 | Unclassified | 1567 |
| 878 | Ga0207679_10277000 | 3300025945 | Unclassified | 1437 |
| 879 | Ga0207667_10847312 | 3300025949 | Bacteria | 908 |
| 880 | Ga0207651_10055671 | 3300025960 | Bacteria | 2718 |
| 881 | Ga0207651_10059925 | 3300025960 | Bacteria | 2639 |
| 882 | Ga0207651_10294305 | 3300025960 | Bacteria | 1347 |
| 883 | Ga0207651_10661637 | 3300025960 | Bacteria | 917 |
| 884 | Ga0207651_10727138 | 3300025960 | Unclassified | 876 |
| 885 | Ga0207651_10970417 | 3300025960 | Unclassified | 759 |
| 886 | Ga0207712_10000925 | 3300025961 | Bacteria | 21172 |
| 887 | Ga0207712_10005189 | 3300025961 | Bacteria | 8239 |
| 888 | Ga0207712_10060667 | 3300025961 | Bacteria | 2682 |
| 889 | Ga0207712_10402521 | 3300025961 | Bacteria | 1151 |
| 890 | Ga0207712_10551239 | 3300025961 | Bacteria | 992 |
| 891 | Ga0207668_10005063 | 3300025972 | Bacteria | 7760 |
| 892 | Ga0207668_10757806 | 3300025972 | Unclassified | 857 |
| 893 | Ga0207668_10776161 | 3300025972 | Unclassified | 847 |
| 894 | Ga0207640_10129325 | 3300025981 | Bacteria | 1823 |
| 895 | Ga0207640_10255625 | 3300025981 | Bacteria | 1362 |
| 896 | Ga0207640_10265896 | 3300025981 | Bacteria | 1339 |
| 897 | Ga0207640_10419195 | 3300025981 | Unclassified | 1095 |
| 898 | Ga0207640_10470027 | 3300025981 | Bacteria | 1041 |
| 899 | Ga0207640_10482314 | 3300025981 | Bacteria | 1029 |
| 900 | Ga0207640_10848135 | 3300025981 | Unclassified | 795 |
| 901 | Ga0207640_11213186 | 3300025981 | Unclassified | 671 |
| 902 | Ga0207658_11556665 | 3300025986 | Unclassified | 604 |
| 903 | Ga0207677_10299601 | 3300026023 | Unclassified | 1327 |
| 904 | Ga0207677_10732929 | 3300026023 | Bacteria | 880 |
| 905 | Ga0207677_11268258 | 3300026023 | Unclassified | 676 |
| 906 | Ga0207677_12002085 | 3300026023 | Unclassified | 538 |
| 907 | Ga0207703_10016211 | 3300026035 | Bacteria | 5808 |
| 908 | Ga0207703_10102323 | 3300026035 | Unclassified | 2430 |
| 909 | Ga0207703_10103548 | 3300026035 | Bacteria | 2416 |
| 910 | Ga0207703_10108277 | 3300026035 | Bacteria | 2367 |
| 911 | Ga0207703_10108349 | 3300026035 | Unclassified | 2366 |
| 912 | Ga0207703_10134608 | 3300026035 | Bacteria | 2138 |
| 913 | Ga0207703_10299400 | 3300026035 | Bacteria | 1466 |
| 914 | Ga0207703_10337432 | 3300026035 | Unclassified | 1384 |
| 915 | Ga0207703_10773934 | 3300026035 | Unclassified | 915 |
| 916 | Ga0207639_10130352 | 3300026041 | Bacteria | 2081 |
| 917 | Ga0207639_10875156 | 3300026041 | Bacteria | 839 |
| 918 | Ga0207639_11616690 | 3300026041 | Unclassified | 608 |
| 919 | Ga0207639_11744465 | 3300026041 | Unclassified | 583 |
| 920 | Ga0207639_12095856 | 3300026041 | Unclassified | 527 |
| 921 | Ga0207678_10618636 | 3300026067 | Bacteria | 950 |
| 922 | Ga0207678_10817605 | 3300026067 | Unclassified | 823 |
| 923 | Ga0207708_10000196 | 3300026075 | Bacteria | 47880 |
| 924 | Ga0207708_10024519 | 3300026075 | Bacteria | 4563 |
| 925 | Ga0207708_10025822 | 3300026075 | Bacteria | 4445 |
| 926 | Ga0207708_10097546 | 3300026075 | Bacteria | 2271 |
| 927 | Ga0207708_10167033 | 3300026075 | Bacteria | 1740 |
| 928 | Ga0207708_10448049 | 3300026075 | Bacteria | 1075 |
| 929 | Ga0207708_10716997 | 3300026075 | Unclassified | 856 |
| 930 | Ga0207702_10023166 | 3300026078 | Bacteria | 5150 |
| 931 | Ga0207702_10865586 | 3300026078 | Bacteria | 895 |
| 932 | Ga0207641_10053400 | 3300026088 | Unclassified | 3425 |
| 933 | Ga0207641_10066364 | 3300026088 | Bacteria | 3088 |
| 934 | Ga0207641_10229101 | 3300026088 | Unclassified | 1726 |
| 935 | Ga0207641_10235805 | 3300026088 | Unclassified | 1702 |
| 936 | Ga0207641_10390624 | 3300026088 | Unclassified | 1334 |
| 937 | Ga0207641_10402557 | 3300026088 | Unclassified | 1314 |
| 938 | Ga0207641_10758443 | 3300026088 | Unclassified | 958 |
| 939 | Ga0207641_10774450 | 3300026088 | Unclassified | 948 |
| 940 | Ga0207641_11474433 | 3300026088 | Bacteria | 682 |
| 941 | Ga0207641_11489598 | 3300026088 | Unclassified | 678 |
| 942 | Ga0207641_12206487 | 3300026088 | Unclassified | 551 |
| 943 | Ga0207648_10025398 | 3300026089 | Bacteria | 5277 |
| 944 | Ga0207648_10041315 | 3300026089 | Bacteria | 4050 |
| 945 | Ga0207648_10052268 | 3300026089 | Bacteria | 3572 |
| 946 | Ga0207648_10052499 | 3300026089 | Unclassified | 3564 |
| 947 | Ga0207648_10085766 | 3300026089 | Bacteria | 2747 |
| 948 | Ga0207648_10209835 | 3300026089 | Unclassified | 1728 |
| 949 | Ga0207648_10323595 | 3300026089 | Unclassified | 1386 |
| 950 | Ga0207648_10889543 | 3300026089 | Unclassified | 831 |
| 951 | Ga0207676_10003808 | 3300026095 | Bacteria | 10661 |
| 952 | Ga0207676_10022718 | 3300026095 | Bacteria | 4616 |
| 953 | Ga0207676_10037473 | 3300026095 | Unclassified | 3695 |
| 954 | Ga0207676_10057488 | 3300026095 | Unclassified | 3063 |
| 955 | Ga0207676_10135355 | 3300026095 | Unclassified | 2101 |
| 956 | Ga0207676_10205522 | 3300026095 | Unclassified | 1743 |
| 957 | Ga0207676_10358770 | 3300026095 | Bacteria | 1350 |
| 958 | Ga0207676_10376937 | 3300026095 | Bacteria | 1319 |
| 959 | Ga0207676_10700037 | 3300026095 | Unclassified | 981 |
| 960 | Ga0207676_10750417 | 3300026095 | Bacteria | 949 |
| 961 | Ga0207676_10767034 | 3300026095 | Unclassified | 939 |
| 962 | Ga0207676_10779227 | 3300026095 | Bacteria | 932 |
| 963 | Ga0207676_10813426 | 3300026095 | Bacteria | 912 |
| 964 | Ga0207676_11488444 | 3300026095 | Bacteria | 674 |
| 965 | Ga0207676_12000387 | 3300026095 | Unclassified | 578 |
| 966 | Ga0207676_12101541 | 3300026095 | Unclassified | 563 |
| 967 | Ga0207674_10001115 | 3300026116 | Bacteria | 34877 |
| 968 | Ga0207674_10033931 | 3300026116 | Bacteria | 5339 |
| 969 | Ga0207674_10141200 | 3300026116 | Bacteria | 2368 |
| 970 | Ga0207674_10303859 | 3300026116 | Bacteria | 1545 |
| 971 | Ga0207674_10308047 | 3300026116 | Bacteria | 1533 |
| 972 | Ga0207674_10453802 | 3300026116 | Bacteria | 1239 |
| 973 | Ga0207674_10564187 | 3300026116 | Bacteria | 1100 |
| 974 | Ga0207674_10575997 | 3300026116 | Bacteria | 1087 |
| 975 | Ga0207674_10697484 | 3300026116 | Bacteria | 980 |
| 976 | Ga0207674_10861047 | 3300026116 | Unclassified | 874 |
| 977 | Ga0207674_11416742 | 3300026116 | Bacteria | 664 |
| 978 | Ga0207674_11433392 | 3300026116 | Bacteria | 660 |
| 979 | Ga0207674_11481291 | 3300026116 | Bacteria | 648 |
| 980 | Ga0207674_11957967 | 3300026116 | Bacteria | 551 |
| 981 | Ga0207675_100008300 | 3300026118 | Bacteria | 9782 |
| 982 | Ga0207675_100010894 | 3300026118 | Bacteria | 8517 |
| 983 | Ga0207675_100017343 | 3300026118 | Bacteria | 6721 |
| 984 | Ga0207675_100027734 | 3300026118 | Bacteria | 5275 |
| 985 | Ga0207675_100037404 | 3300026118 | Bacteria | 4527 |
| 986 | Ga0207675_100188276 | 3300026118 | Bacteria | 1979 |
| 987 | Ga0207675_100233282 | 3300026118 | Bacteria | 1776 |
| 988 | Ga0207675_101488183 | 3300026118 | Bacteria | 698 |
| 989 | Ga0207683_10622903 | 3300026121 | Bacteria | 999 |
| 990 | Ga0207683_10870574 | 3300026121 | Bacteria | 836 |
| 991 | Ga0207698_10201010 | 3300026142 | Bacteria | 1784 |
| 992 | Ga0207698_10420263 | 3300026142 | Unclassified | 1283 |
| 993 | Ga0207698_10490958 | 3300026142 | Bacteria | 1193 |
| 994 | Ga0207698_10636677 | 3300026142 | Unclassified | 1055 |
| 995 | Ga0207698_11330789 | 3300026142 | Unclassified | 733 |
| 996 | Ga0207698_11516620 | 3300026142 | Unclassified | 686 |
| 997 | Ga0207428_10003589 | 3300027907 | Bacteria | 14977 |
| 998 | Ga0207428_10144878 | 3300027907 | Bacteria | 1811 |
| 999 | Ga0268266_11929848 | 3300028379 | Unclassified | 564 |
| 1000 | Ga0268265_10131993 | 3300028380 | Bacteria | 2077 |
| 1001 | Ga0268265_10160070 | 3300028380 | Bacteria | 1911 |
| 1002 | Ga0268265_10223551 | 3300028380 | Unclassified | 1649 |
| 1003 | Ga0268265_10247986 | 3300028380 | Bacteria | 1575 |
| 1004 | Ga0268265_10412166 | 3300028380 | Bacteria | 1252 |
| 1005 | Ga0268265_10685754 | 3300028380 | Bacteria | 988 |
| 1006 | Ga0268265_11058294 | 3300028380 | Bacteria | 804 |
| 1007 | Ga0268265_11116515 | 3300028380 | Bacteria | 783 |
| 1008 | Ga0268265_11299895 | 3300028380 | Bacteria | 727 |
| 1009 | Ga0268265_12635367 | 3300028380 | Unclassified | 508 |
| 1010 | Ga0268264_10027695 | 3300028381 | Bacteria | 4632 |
| 1011 | Ga0268264_10036791 | 3300028381 | Bacteria | 4034 |
| 1012 | Ga0268264_10049768 | 3300028381 | Bacteria | 3488 |
| 1013 | Ga0268264_10055988 | 3300028381 | Bacteria | 3295 |
| 1014 | Ga0268264_10117447 | 3300028381 | Bacteria | 2339 |
| 1015 | Ga0268264_10147987 | 3300028381 | Unclassified | 2102 |
| 1016 | Ga0268264_10149519 | 3300028381 | Bacteria | 2092 |
| 1017 | Ga0268264_11503126 | 3300028381 | Unclassified | 684 |
| 1018 | Ga0314311_1194228 | 3300030733 | Bacteria | 624 |
| 1019 | Ga0307408_100013384 | 3300031548 | Bacteria | 5444 |
| 1020 | Ga0307408_100042473 | 3300031548 | Bacteria | 3230 |
| 1021 | Ga0307408_100078016 | 3300031548 | Bacteria | 2468 |
| 1022 | Ga0307408_100133239 | 3300031548 | Unclassified | 1941 |
| 1023 | Ga0307408_100312757 | 3300031548 | Unclassified | 1320 |
| 1024 | Ga0307408_100447848 | 3300031548 | Bacteria | 1119 |
| 1025 | Ga0307408_100654400 | 3300031548 | Bacteria | 940 |
| 1026 | Ga0307408_100994338 | 3300031548 | Unclassified | 773 |
| 1027 | Ga0307408_101918147 | 3300031548 | Unclassified | 568 |
| 1028 | Ga0307405_10015061 | 3300031731 | Bacteria | 4176 |
| 1029 | Ga0307405_10018481 | 3300031731 | Bacteria | 3846 |
| 1030 | Ga0307405_10046932 | 3300031731 | Bacteria | 2657 |
| 1031 | Ga0307405_10415295 | 3300031731 | Bacteria | 1057 |
| 1032 | Ga0307405_10706150 | 3300031731 | Bacteria | 836 |
| 1033 | Ga0307413_10036152 | 3300031824 | Bacteria | 2841 |
| 1034 | Ga0307413_10100182 | 3300031824 | Bacteria | 1912 |
| 1035 | Ga0307413_11238427 | 3300031824 | Bacteria | 650 |
| 1036 | Ga0307410_10002023 | 3300031852 | Bacteria | 9564 |
| 1037 | Ga0307410_10061258 | 3300031852 | Bacteria | 2575 |
| 1038 | Ga0307406_10007704 | 3300031901 | Bacteria | 5981 |
| 1039 | Ga0307406_10092030 | 3300031901 | Bacteria | 2044 |
| 1040 | Ga0307407_10009256 | 3300031903 | Bacteria | 4577 |
| 1041 | Ga0307407_10061460 | 3300031903 | Bacteria | 2196 |
| 1042 | Ga0307412_10018014 | 3300031911 | Unclassified | 4239 |
| 1043 | Ga0307412_10215432 | 3300031911 | Bacteria | 1468 |
| 1044 | Ga0307412_10271605 | 3300031911 | Unclassified | 1327 |
| 1045 | Ga0307412_10458779 | 3300031911 | Bacteria | 1052 |
| 1046 | Ga0307412_11048530 | 3300031911 | Unclassified | 723 |
| 1047 | Ga0307412_12140038 | 3300031911 | Unclassified | 520 |
| 1048 | Ga0307409_100075645 | 3300031995 | Bacteria | 2697 |
| 1049 | Ga0307409_100173127 | 3300031995 | Bacteria | 1902 |
| 1050 | Ga0307409_100603566 | 3300031995 | Bacteria | 1085 |
| 1051 | Ga0307409_100684462 | 3300031995 | Bacteria | 1023 |
| 1052 | Ga0307409_101788176 | 3300031995 | Unclassified | 644 |
| 1053 | Ga0307416_100010309 | 3300032002 | Bacteria | 6166 |
| 1054 | Ga0307416_100172642 | 3300032002 | Bacteria | 2015 |
| 1055 | Ga0307416_100224473 | 3300032002 | Unclassified | 1805 |
| 1056 | Ga0307416_100563007 | 3300032002 | Unclassified | 1215 |
| 1057 | Ga0307414_10007653 | 3300032004 | Bacteria | 6081 |
| 1058 | Ga0307414_10512349 | 3300032004 | Bacteria | 1063 |
| 1059 | Ga0307414_10513069 | 3300032004 | Bacteria | 1063 |
| 1060 | Ga0307414_10657281 | 3300032004 | Unclassified | 945 |
| 1061 | Ga0307411_10028911 | 3300032005 | Bacteria | 3377 |
| 1062 | Ga0307411_10056612 | 3300032005 | Bacteria | 2585 |
| 1063 | Ga0307411_10298789 | 3300032005 | Bacteria | 1290 |
| 1064 | Ga0307415_100007828 | 3300032126 | Bacteria | 5873 |
| 1065 | Ga0307415_100009415 | 3300032126 | Bacteria | 5474 |
| 1066 | Ga0307415_100277030 | 3300032126 | Bacteria | 1377 |
| 1067 | Ga0307415_100792534 | 3300032126 | Unclassified | 864 |
| 1068 | Ga0307415_100948819 | 3300032126 | Bacteria | 796 |
| 1069 | Ga0373930_0070262 | 3300034816 | Bacteria | 795 |
| 1070 | Ga0373940_0092151 | 3300035088 | Unclassified | 909 |
| 1071 | Ga0373951_0000266 | 3300035091 | Bacteria | 17178 |
| 1072 | Ga0373951_0043101 | 3300035091 | Unclassified | 1093 |
| 1073 | Ga0373941_0009951 | 3300035115 | Bacteria | 2412 |
| 1074 | Ga0373941_0070196 | 3300035115 | Bacteria | 1161 |
| 1075 | Ga0373941_0101565 | 3300035115 | Unclassified | 1002 |
| 1076 | Ga0373955_0236707 | 3300035172 | Unclassified | 1093 |
| 1077 | Ga0373931_0134736 | 3300035691 | Unclassified | 1425 |
| 1078 | Ga0373937_0026568 | 3300036401 | Bacteria | 5231 |
| 1079 | Ga0395899_0717104 | 3300037312 | Unclassified | 626 |
| 1080 | Ga0395900_0071081 | 3300037418 | Bacteria | 3577 |
| 1081 | Ga0395900_0174348 | 3300037418 | Unclassified | 2188 |
| 1082 | Ga0395900_1741907 | 3300037418 | Unclassified | 534 |
| 1083 | Ga0395898_0042223 | 3300037466 | Bacteria | 4501 |
| 1084 | Ga0395898_0689554 | 3300037466 | Unclassified | 963 |
| 1085 | Ga0395898_0890092 | 3300037466 | Bacteria | 829 |
| 1086 | Ga0395905_0001898 | 3300037471 | Bacteria | 24069 |
| 1087 | Ga0395905_0149690 | 3300037471 | Bacteria | 2196 |
| 1088 | Ga0395901_1863149 | 3300038443 | Unclassified | 550 |
| 1089 | Ga0242422_00216 | 3300038699 | Bacteria | 3315 |
| 1090 | Ga0242420_004095 | 3300038996 | Bacteria | 2187 |
| 1091 | Ga0436365_1124199 | 3300039437 | Bacteria | 4361 |
| 1092 | Ga0436360_1140381 | 3300039438 | Bacteria | 8137 |
| 1093 | Ga0436361_1173708 | 3300039447 | Bacteria | 1638 |
| 1094 | Ga0436362_0522576 | 3300039453 | Bacteria | 1878 |
| 1095 | Ga0439466_0120413 | 3300041411 | Unclassified | 811 |
| 1096 | Ga0439465_0407354 | 3300041413 | Unclassified | 518 |
| 1097 | Ga0451851_0683408 | 3300041507 | Unclassified | 525 |
| 1098 | Ga0439448_0113932 | 3300042005 | Unclassified | 925 |
| 1099 | Ga0439432_041430 | 3300042006 | Unclassified | 1458 |
| 1100 | Ga0439455_0002290 | 3300042012 | Bacteria | 3447 |
| 1101 | Ga0439462_0089555 | 3300042015 | Unclassified | 844 |
| 1102 | Ga0450914_005011 | 3300042118 | Unclassified | 1105 |
| 1103 | Ga0439458_0001735 | 3300042157 | Bacteria | 5441 |
| 1104 | Ga0439434_0077574 | 3300042435 | Bacteria | 1051 |
| 1105 | Ga0451577_1947822 | 3300042876 | Unclassified | 514 |
| 1106 | Ga0451576_0548841 | 3300045051 | Unclassified | 1214 |
| 1107 | Ga0495582_0203607 | 3300046473 | Unclassified | 1130 |
| 1108 | Ga0495613_0236034 | 3300046689 | Unclassified | 1280 |
| 1109 | Ga0496100_0152678 | 3300048903 | Unclassified | 1649 |
| 1110 | Ga0496102_0011427 | 3300048905 | Bacteria | 7655 |
| 1111 | Ga0496102_0116640 | 3300048905 | Bacteria | 2492 |
| 1112 | Ga0496102_0953668 | 3300048905 | Unclassified | 779 |
| 1113 | Ga0496103_0311167 | 3300048906 | Bacteria | 1013 |
| 1114 | Ga0496104_0063329 | 3300048907 | Bacteria | 3507 |
| 1115 | Ga0496104_0349306 | 3300048907 | Bacteria | 1392 |
| 1116 | Ga0496105_0667348 | 3300048908 | Bacteria | 801 |
| 1117 | Ga0496106_0055940 | 3300048909 | Bacteria | 2983 |
| 1118 | Ga0496106_0234795 | 3300048909 | Bacteria | 1465 |
| 1119 | Ga0496106_0476520 | 3300048909 | Bacteria | 1003 |
| 1120 | Ga0496106_0531911 | 3300048909 | Bacteria | 944 |
| 1121 | Ga0496106_1307781 | 3300048909 | Unclassified | 563 |
| 1122 | Ga0496107_0013028 | 3300048910 | Bacteria | 5809 |
| 1123 | Ga0496108_1061094 | 3300048911 | Unclassified | 690 |
| 1124 | Ga0496109_0512991 | 3300048912 | Bacteria | 1132 |
| 1125 | Ga0496109_1193651 | 3300048912 | Unclassified | 698 |
| 1126 | Ga0496110_0499781 | 3300048913 | Unclassified | 1107 |
| 1127 | Ga0496110_1019972 | 3300048913 | Bacteria | 735 |
| 1128 | Ga0496110_1442206 | 3300048913 | Unclassified | 598 |
| 1129 | Ga0496112_0025724 | 3300048915 | Bacteria | 5653 |
| 1130 | Ga0496112_0162595 | 3300048915 | Bacteria | 2199 |
| 1131 | Ga0496112_0174008 | 3300048915 | Bacteria | 2118 |
| 1132 | Ga0496112_0333453 | 3300048915 | Unclassified | 1461 |
| 1133 | Ga0496112_0561570 | 3300048915 | Bacteria | 1075 |
| 1134 | Ga0496112_0776098 | 3300048915 | Bacteria | 884 |
| 1135 | Ga0496112_1227017 | 3300048915 | Bacteria | 666 |
| 1136 | Ga0496112_1243602 | 3300048915 | Unclassified | 661 |
| 1137 | Ga0496112_1340555 | 3300048915 | Unclassified | 631 |
| 1138 | Ga0496112_1674078 | 3300048915 | Unclassified | 549 |
| 1139 | Ga0496113_0232300 | 3300048916 | Bacteria | 1471 |
| 1140 | Ga0496113_0783022 | 3300048916 | Unclassified | 758 |
| 1141 | Ga0496113_1238099 | 3300048916 | Unclassified | 582 |
| 1142 | Ga0501306_025283 | 3300049127 | Unclassified | 854 |
| 1143 | Ga0501307_016163 | 3300049162 | Unclassified | 928 |
| 1144 | Ga0501290_004185 | 3300049513 | Bacteria | 1798 |
| 1145 | Ga0501290_040259 | 3300049513 | Unclassified | 698 |
| 1146 | Ga0501291_009882 | 3300049514 | Bacteria | 1346 |
| 1147 | Ga0501291_010725 | 3300049514 | Bacteria | 1309 |
| 1148 | Ga0501292_003121 | 3300049515 | Bacteria | 2192 |
| 1149 | Ga0501292_003124 | 3300049515 | Bacteria | 2191 |
| 1150 | Ga0501292_015946 | 3300049515 | Unclassified | 1178 |
| 1151 | Ga0501295_054568 | 3300049518 | Unclassified | 863 |
| 1152 | Ga0501295_055089 | 3300049518 | Unclassified | 859 |
| 1153 | Ga0501296_003503 | 3300049519 | Bacteria | 1675 |
| 1154 | Ga0501296_006498 | 3300049519 | Bacteria | 1326 |
| 1155 | Ga0501297_005098 | 3300049520 | Bacteria | 1364 |
| 1156 | Ga0501297_009085 | 3300049520 | Bacteria | 1106 |
| 1157 | Ga0501297_031024 | 3300049520 | Unclassified | 712 |
| 1158 | Ga0501298_002676 | 3300049521 | Bacteria | 2716 |
| 1159 | Ga0501298_041241 | 3300049521 | Unclassified | 936 |
| 1160 | Ga0501298_072257 | 3300049521 | Unclassified | 747 |
| 1161 | Ga0501298_135017 | 3300049521 | Bacteria | 592 |
| 1162 | Ga0501299_000754 | 3300049522 | Bacteria | 3928 |
| 1163 | Ga0501299_007263 | 3300049522 | Bacteria | 1763 |
| 1164 | Ga0501299_009672 | 3300049522 | Unclassified | 1595 |
| 1165 | Ga0501300_004680 | 3300049523 | Unclassified | 2023 |
| 1166 | Ga0501300_019111 | 3300049523 | Bacteria | 1001 |
| 1167 | Ga0501303_005503 | 3300049526 | Bacteria | 1081 |
| 1168 | Ga0501311_025714 | 3300049527 | Unclassified | 826 |
| 1169 | Ga0501038_0032512 | 3300049574 | Bacteria | 4602 |
| 1170 | Ga0501067_0638052 | 3300049583 | Unclassified | 598 |
| 1171 | Ga0501072_0538087 | 3300049588 | Bacteria | 923 |
| 1172 | Ga0501075_1329767 | 3300049591 | Unclassified | 544 |
| 1173 | Ga0501198_001879 | 3300049649 | Bacteria | 2774 |
| 1174 | Ga0501198_002730 | 3300049649 | Unclassified | 2389 |
| 1175 | Ga0501199_010652 | 3300049650 | Bacteria | 986 |
| 1176 | Ga0501202_001705 | 3300049652 | Bacteria | 3563 |
| 1177 | Ga0501202_006175 | 3300049652 | Bacteria | 2137 |
| 1178 | Ga0501202_111111 | 3300049652 | Unclassified | 678 |
| 1179 | Ga0501206_003365 | 3300049653 | Unclassified | 2033 |
| 1180 | Ga0501206_015357 | 3300049653 | Unclassified | 1059 |
| 1181 | Ga0501208_004930 | 3300049655 | Bacteria | 1609 |
| 1182 | Ga0501208_005660 | 3300049655 | Bacteria | 1549 |
| 1183 | Ga0501209_020524 | 3300049656 | Unclassified | 1558 |
| 1184 | Ga0501209_038598 | 3300049656 | Unclassified | 1252 |
| 1185 | Ga0501214_002166 | 3300049659 | Bacteria | 1622 |
| 1186 | Ga0501216_002071 | 3300049660 | Bacteria | 2810 |
| 1187 | Ga0501216_003901 | 3300049660 | Bacteria | 2193 |
| 1188 | Ga0501217_000517 | 3300049661 | Bacteria | 6418 |
| 1189 | Ga0501217_002052 | 3300049661 | Bacteria | 3898 |
| 1190 | Ga0501217_127653 | 3300049661 | Unclassified | 743 |
| 1191 | Ga0501223_000504 | 3300049663 | Bacteria | 9463 |
| 1192 | Ga0501223_006582 | 3300049663 | Unclassified | 2399 |
| 1193 | Ga0501223_033979 | 3300049663 | Bacteria | 991 |
| 1194 | Ga0501223_057581 | 3300049663 | Unclassified | 757 |
| 1195 | Ga0501224_000129 | 3300049664 | Bacteria | 8262 |
| 1196 | Ga0501224_003539 | 3300049664 | Bacteria | 2185 |
| 1197 | Ga0501224_014757 | 3300049664 | Bacteria | 1156 |
| 1198 | Ga0501224_063876 | 3300049664 | Unclassified | 576 |
| 1199 | Ga0501227_000295 | 3300049665 | Bacteria | 10300 |
| 1200 | Ga0501227_084440 | 3300049665 | Unclassified | 834 |
| 1201 | Ga0501230_142613 | 3300049667 | Unclassified | 540 |
| 1202 | Ga0501233_000556 | 3300049668 | Bacteria | 6049 |
| 1203 | Ga0501233_005685 | 3300049668 | Bacteria | 2318 |
| 1204 | Ga0501233_016218 | 3300049668 | Unclassified | 1543 |
| 1205 | Ga0501235_000590 | 3300049669 | Bacteria | 7327 |
| 1206 | Ga0501235_007415 | 3300049669 | Bacteria | 2390 |
| 1207 | Ga0501235_047113 | 3300049669 | Bacteria | 994 |
| 1208 | Ga0501235_121680 | 3300049669 | Unclassified | 653 |
| 1209 | Ga0501235_201190 | 3300049669 | Bacteria | 539 |
| 1210 | Ga0501238_019305 | 3300049671 | Unclassified | 957 |
| 1211 | Ga0501239_001368 | 3300049672 | Bacteria | 2079 |
| 1212 | Ga0501240_000221 | 3300049673 | Bacteria | 4271 |
| 1213 | Ga0501240_037710 | 3300049673 | Unclassified | 794 |
| 1214 | Ga0501242_044378 | 3300049674 | Unclassified | 637 |
| 1215 | Ga0501243_011012 | 3300049675 | Bacteria | 1415 |
| 1216 | Ga0501249_013420 | 3300049679 | Bacteria | 1741 |
| 1217 | Ga0501249_160157 | 3300049679 | Unclassified | 571 |
| 1218 | Ga0501250_001921 | 3300049680 | Unclassified | 1806 |
| 1219 | Ga0501251_002794 | 3300049681 | Unclassified | 1710 |
| 1220 | Ga0501251_008926 | 3300049681 | Unclassified | 1144 |
| 1221 | Ga0501253_001363 | 3300049683 | Bacteria | 2469 |
| 1222 | Ga0501253_017879 | 3300049683 | Unclassified | 1202 |
| 1223 | Ga0501253_070491 | 3300049683 | Unclassified | 771 |
| 1224 | Ga0501257_040736 | 3300049686 | Bacteria | 1140 |
| 1225 | Ga0501257_068297 | 3300049686 | Unclassified | 905 |
| 1226 | Ga0501257_119225 | 3300049686 | Unclassified | 705 |
| 1227 | Ga0501259_001344 | 3300049688 | Unclassified | 4115 |
| 1228 | Ga0501259_018316 | 3300049688 | Bacteria | 1222 |
| 1229 | Ga0501259_050077 | 3300049688 | Unclassified | 845 |
| 1230 | Ga0501260_040147 | 3300049689 | Unclassified | 565 |
| 1231 | Ga0501221_023102 | 3300049704 | Bacteria | 1237 |
| 1232 | Ga0501221_070746 | 3300049704 | Bacteria | 823 |
| 1233 | Ga0501225_0000145 | 3300049705 | Bacteria | 21644 |
| 1234 | Ga0501225_0042408 | 3300049705 | Bacteria | 1256 |
| 1235 | Ga0501229_005664 | 3300049706 | Unclassified | 1536 |
| 1236 | Ga0501234_000075 | 3300049707 | Bacteria | 12283 |
| 1237 | Ga0501234_002153 | 3300049707 | Bacteria | 3113 |
| 1238 | Ga0501234_011417 | 3300049707 | Bacteria | 1389 |
| 1239 | Ga0501245_007712 | 3300049708 | Bacteria | 1524 |
| 1240 | Ga0501245_012891 | 3300049708 | Bacteria | 1231 |
| 1241 | Ga0501245_070538 | 3300049708 | Unclassified | 657 |
| 1242 | Ga0501081_0866181 | 3300049743 | Bacteria | 681 |
| 1243 | Ga0501241_163592 | 3300049758 | Unclassified | 519 |
| 1244 | Ga0501263_009001 | 3300049760 | Unclassified | 1202 |
| 1245 | Ga0501263_044794 | 3300049760 | Bacteria | 659 |
| 1246 | Ga0501265_053833 | 3300049762 | Bacteria | 640 |
| 1247 | Ga0501266_022281 | 3300049763 | Unclassified | 870 |
| 1248 | Ga0501267_053164 | 3300049764 | Unclassified | 532 |
| 1249 | Ga0501270_051266 | 3300049767 | Bacteria | 748 |
| 1250 | Ga0501272_012536 | 3300049769 | Bacteria | 964 |
| 1251 | Ga0501272_023309 | 3300049769 | Unclassified | 754 |
| 1252 | Ga0501273_003589 | 3300049770 | Bacteria | 1657 |
| 1253 | Ga0501273_011933 | 3300049770 | Bacteria | 1088 |
| 1254 | Ga0501278_002788 | 3300049774 | Bacteria | 1223 |
| 1255 | Ga0501278_004265 | 3300049774 | Unclassified | 1028 |
| 1256 | Ga0501279_001580 | 3300049775 | Bacteria | 2997 |
| 1257 | Ga0501279_001951 | 3300049775 | Bacteria | 2720 |
| 1258 | Ga0501283_009914 | 3300049779 | Unclassified | 1396 |
| 1259 | Ga0501283_011895 | 3300049779 | Unclassified | 1301 |
| 1260 | Ga0501283_048461 | 3300049779 | Unclassified | 748 |
| 1261 | Ga0501204_015500 | 3300049850 | Bacteria | 947 |
| 1262 | Ga0501212_001962 | 3300049851 | Bacteria | 2418 |
| 1263 | Ga0501226_002189 | 3300049853 | Bacteria | 2417 |
| 1264 | Ga0501226_005552 | 3300049853 | Bacteria | 1435 |
| 1265 | nmdc:mga05p37_1986380_c1 | 3300050507 | Unclassified | 551 |
| 1266 | nmdc:mga05p37_275177_c1 | 3300050507 | Bacteria | 2010 |
| 1267 | nmdc:mga05p37_301069_c1 | 3300050507 | Bacteria | 1905 |
| 1268 | nmdc:mga05p37_320629_c1 | 3300050507 | Bacteria | 1834 |
| 1269 | nmdc:mga05p37_558118_c1 | 3300050507 | Bacteria | 1302 |
| 1270 | nmdc:mga05p37_860956_c1 | 3300050507 | Unclassified | 983 |
| 1271 | nmdc:mga09592_1449450_c1 | 3300050508 | Unclassified | 560 |
| 1272 | nmdc:mga09592_440863_c1 | 3300050508 | Bacteria | 1124 |
| 1273 | nmdc:mga09592_71662_c1 | 3300050508 | Bacteria | 2941 |
| 1274 | nmdc:mga09592_898796_c1 | 3300050508 | Unclassified | 744 |
| 1275 | nmdc:mga09592_92749_c1 | 3300050508 | Bacteria | 2582 |
| 1276 | nmdc:mga0qj67_16939_c1 | 3300050509 | Bacteria | 5535 |
| 1277 | nmdc:mga0qj67_221311_c1 | 3300050509 | Bacteria | 1537 |
| 1278 | nmdc:mga06r32_136876_c1 | 3300050510 | Bacteria | 2424 |
| 1279 | nmdc:mga06r32_171085_c1 | 3300050510 | Bacteria | 2156 |
| 1280 | nmdc:mga06r32_210654_c1 | 3300050510 | Viruses | 1931 |
| 1281 | nmdc:mga06r32_831562_c1 | 3300050510 | Bacteria | 883 |
| 1282 | nmdc:mga08y16_143327_c1 | 3300050511 | Bacteria | 2484 |
| 1283 | nmdc:mga08y16_325364_c1 | 3300050511 | Bacteria | 1582 |
| 1284 | nmdc:mga08y16_3905_c1 | 3300050511 | Bacteria | 15524 |
| 1285 | nmdc:mga0n895_1528387_c1 | 3300050512 | Unclassified | 633 |
| 1286 | nmdc:mga0n895_163075_c1 | 3300050512 | Bacteria | 2260 |
| 1287 | nmdc:mga0n895_438430_c1 | 3300050512 | Unclassified | 1320 |
| 1288 | nmdc:mga0n895_693258_c1 | 3300050512 | Unclassified | 1015 |
| 1289 | nmdc:mga0a205_312347_c1 | 3300050515 | Unclassified | 1444 |
| 1290 | nmdc:mga0a205_496004_c1 | 3300050515 | Bacteria | 1078 |
| 1291 | nmdc:mga0a205_512442_c1 | 3300050515 | Unclassified | 1056 |
| 1292 | nmdc:mga0a205_535885_c1 | 3300050515 | Bacteria | 1026 |
| 1293 | nmdc:mga0a205_75331_c1 | 3300050515 | Bacteria | 3261 |
| 1294 | nmdc:mga0a205_84544_c1 | 3300050515 | Bacteria | 3065 |
| 1295 | nmdc:mga0a205_878738_c1 | 3300050515 | Unclassified | 743 |
| 1296 | Ga0501084_0801137 | 3300054114 | Bacteria | 793 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049650 | Ga0501199_010652 | Ga0501199_010652_102_437 | 100 |
| 2 | 3300005545 | Ga0070695_100391276 | Ga0070695_1003912761 | 103 |
| 3 | 3300013308 | Ga0157375_10073908 | Ga0157375_100739082 | 103 |
| 4 | iso_pu_bacteria | 2857604169 | 2857607649 | 103 |
| 5 | iso_pu_bacteria | 2857609550 | 2857611071 | 103 |
| 6 | iso_pu_bacteria | 3001892409 | 3001893421 | 103 |
| 7 | 3300005345 | Ga0070692_11280678 | Ga0070692_112806781 | 104 |
| 8 | 3300009177 | Ga0105248_11486161 | Ga0105248_114861612 | 104 |
| 9 | 3300048909 | Ga0496106_0055940 | Ga0496106_0055940_2110_2445 | 104 |
| 10 | 3300048910 | Ga0496107_0013028 | Ga0496107_0013028_3171_3506 | 104 |
| 11 | 3300049688 | Ga0501259_001344 | Ga0501259_001344_3305_3625 | 105 |
| 12 | 3300005459 | Ga0068867_100236278 | Ga0068867_1002362782 | 107 |
| 13 | 3300021358 | Ga0213873_10024794 | Ga0213873_100247942 | 107 |
| 14 | 3300021361 | Ga0213872_10026992 | Ga0213872_100269923 | 107 |
| 15 | 3300021441 | Ga0213871_10177439 | Ga0213871_101774391 | 107 |
| 16 | 3300025918 | Ga0207662_10272566 | Ga0207662_102725662 | 107 |
| 17 | 3300037312 | Ga0395899_0717104 | Ga0395899_0717104_58_387 | 107 |
| 18 | 3300039438 | Ga0436360_1140381 | Ga0436360_1140381_1913_2236 | 107 |
| 19 | 3300039447 | Ga0436361_1173708 | Ga0436361_1173708_898_1221 | 107 |
| 20 | 3300039453 | Ga0436362_0522576 | Ga0436362_0522576_990_1313 | 107 |
| 21 | 3300049664 | Ga0501224_000129 | Ga0501224_000129_6051_6380 | 108 |
| 22 | 2088090002 | CNA_F6ESG4R02GEH5A | CNA_00279590 | 110 |
| 23 | 2162886007 | SwRhRL2b_contig_36198 | SwRhRL2b_0769.00008810 | 110 |
| 24 | 3300000532 | CNAas_1000886 | CNAas_10008863 | 110 |
| 25 | 3300001990 | JGI24737J22298_10073203 | JGI24737J22298_100732032 | 110 |
| 26 | 3300002459 | JGI24751J29686_10000009 | JGI24751J29686_1000000947 | 110 |
| 27 | 3300003203 | JGI25406J46586_10004348 | JGI25406J46586_100043482 | 110 |
| 28 | 3300003203 | JGI25406J46586_10019122 | JGI25406J46586_100191224 | 110 |
| 29 | 3300003322 | rootL2_10187274 | rootL2_101872743 | 110 |
| 30 | 3300005288 | Ga0065714_10064433 | Ga0065714_1006443367 | 110 |
| 31 | 3300005289 | Ga0065704_10007866 | Ga0065704_100078663 | 110 |
| 32 | 3300005289 | Ga0065704_10032831 | Ga0065704_100328311 | 110 |
| 33 | 3300005289 | Ga0065704_10071538 | Ga0065704_1007153810 | 110 |
| 34 | 3300005289 | Ga0065704_10541735 | Ga0065704_105417351 | 110 |
| 35 | 3300005290 | Ga0065712_10009957 | Ga0065712_100099573 | 110 |
| 36 | 3300005290 | Ga0065712_10027774 | Ga0065712_100277742 | 110 |
| 37 | 3300005290 | Ga0065712_10067731 | Ga0065712_1006773167 | 110 |
| 38 | 3300005290 | Ga0065712_10073465 | Ga0065712_100734655 | 110 |
| 39 | 3300005290 | Ga0065712_10155211 | Ga0065712_101552112 | 110 |
| 40 | 3300005290 | Ga0065712_10231027 | Ga0065712_102310271 | 110 |
| 41 | 3300005290 | Ga0065712_10285635 | Ga0065712_102856352 | 110 |
| 42 | 3300005290 | Ga0065712_10327933 | Ga0065712_103279331 | 110 |
| 43 | 3300005293 | Ga0065715_10018282 | Ga0065715_100182822 | 110 |
| 44 | 3300005293 | Ga0065715_10088984 | Ga0065715_1008898411 | 110 |
| 45 | 3300005293 | Ga0065715_10091196 | Ga0065715_100911967 | 110 |
| 46 | 3300005293 | Ga0065715_10125119 | Ga0065715_101251193 | 110 |
| 47 | 3300005293 | Ga0065715_10143210 | Ga0065715_101432102 | 110 |
| 48 | 3300005293 | Ga0065715_10207992 | Ga0065715_102079922 | 110 |
| 49 | 3300005293 | Ga0065715_10221797 | Ga0065715_102217972 | 110 |
| 50 | 3300005293 | Ga0065715_10273611 | Ga0065715_102736111 | 110 |
| 51 | 3300005293 | Ga0065715_10289947 | Ga0065715_102899472 | 110 |
| 52 | 3300005293 | Ga0065715_10384937 | Ga0065715_103849372 | 110 |
| 53 | 3300005293 | Ga0065715_10474231 | Ga0065715_104742312 | 110 |
| 54 | 3300005293 | Ga0065715_10505085 | Ga0065715_105050851 | 110 |
| 55 | 3300005293 | Ga0065715_10624198 | Ga0065715_106241981 | 110 |
| 56 | 3300005293 | Ga0065715_10641742 | Ga0065715_106417421 | 110 |
| 57 | 3300005293 | Ga0065715_10697873 | Ga0065715_106978732 | 110 |
| 58 | 3300005293 | Ga0065715_10867509 | Ga0065715_108675091 | 110 |
| 59 | 3300005293 | Ga0065715_10883610 | Ga0065715_108836102 | 110 |
| 60 | 3300005295 | Ga0065707_10001225 | Ga0065707_100012259 | 110 |
| 61 | 3300005295 | Ga0065707_10005905 | Ga0065707_100059054 | 110 |
| 62 | 3300005295 | Ga0065707_10013054 | Ga0065707_100130541 | 110 |
| 63 | 3300005295 | Ga0065707_10051064 | Ga0065707_100510642 | 110 |
| 64 | 3300005295 | Ga0065707_10136610 | Ga0065707_101366103 | 110 |
| 65 | 3300005295 | Ga0065707_10149427 | Ga0065707_101494273 | 110 |
| 66 | 3300005295 | Ga0065707_10359985 | Ga0065707_103599852 | 110 |
| 67 | 3300005328 | Ga0070676_10061800 | Ga0070676_100618003 | 110 |
| 68 | 3300005328 | Ga0070676_10080976 | Ga0070676_100809763 | 110 |
| 69 | 3300005328 | Ga0070676_10370433 | Ga0070676_103704331 | 110 |
| 70 | 3300005330 | Ga0070690_100001514 | Ga0070690_10000151412 | 110 |
| 71 | 3300005330 | Ga0070690_100001806 | Ga0070690_1000018062 | 110 |
| 72 | 3300005330 | Ga0070690_100005902 | Ga0070690_1000059027 | 110 |
| 73 | 3300005330 | Ga0070690_100079209 | Ga0070690_1000792093 | 110 |
| 74 | 3300005331 | Ga0070670_100000088 | Ga0070670_10000008824 | 110 |
| 75 | 3300005331 | Ga0070670_100153806 | Ga0070670_1001538063 | 110 |
| 76 | 3300005331 | Ga0070670_100308249 | Ga0070670_1003082491 | 110 |
| 77 | 3300005331 | Ga0070670_100379324 | Ga0070670_1003793241 | 110 |
| 78 | 3300005331 | Ga0070670_100625843 | Ga0070670_1006258432 | 110 |
| 79 | 3300005331 | Ga0070670_100702955 | Ga0070670_1007029552 | 110 |
| 80 | 3300005331 | Ga0070670_100710091 | Ga0070670_1007100911 | 110 |
| 81 | 3300005331 | Ga0070670_101068261 | Ga0070670_1010682611 | 110 |
| 82 | 3300005331 | Ga0070670_101185976 | Ga0070670_1011859762 | 110 |
| 83 | 3300005331 | Ga0070670_101393369 | Ga0070670_1013933691 | 110 |
| 84 | 3300005331 | Ga0070670_101641100 | Ga0070670_1016411001 | 110 |
| 85 | 3300005333 | Ga0070677_10058682 | Ga0070677_100586822 | 110 |
| 86 | 3300005333 | Ga0070677_10325884 | Ga0070677_103258841 | 110 |
| 87 | 3300005333 | Ga0070677_10744176 | Ga0070677_107441761 | 110 |
| 88 | 3300005334 | Ga0068869_100048762 | Ga0068869_1000487622 | 110 |
| 89 | 3300005334 | Ga0068869_100077696 | Ga0068869_1000776962 | 110 |
| 90 | 3300005334 | Ga0068869_100081484 | Ga0068869_1000814842 | 110 |
| 91 | 3300005334 | Ga0068869_100107136 | Ga0068869_1001071364 | 110 |
| 92 | 3300005334 | Ga0068869_100183011 | Ga0068869_1001830111 | 110 |
| 93 | 3300005334 | Ga0068869_100199500 | Ga0068869_1001995001 | 110 |
| 94 | 3300005334 | Ga0068869_100275367 | Ga0068869_1002753672 | 110 |
| 95 | 3300005334 | Ga0068869_100294542 | Ga0068869_1002945422 | 110 |
| 96 | 3300005334 | Ga0068869_100328054 | Ga0068869_1003280541 | 110 |
| 97 | 3300005334 | Ga0068869_100365907 | Ga0068869_1003659071 | 110 |
| 98 | 3300005334 | Ga0068869_100496927 | Ga0068869_1004969272 | 110 |
| 99 | 3300005334 | Ga0068869_100720690 | Ga0068869_1007206902 | 110 |
| 100 | 3300005334 | Ga0068869_101048249 | Ga0068869_1010482492 | 110 |
| 101 | 3300005335 | Ga0070666_10009988 | Ga0070666_100099887 | 110 |
| 102 | 3300005335 | Ga0070666_10151870 | Ga0070666_101518701 | 110 |
| 103 | 3300005335 | Ga0070666_10538277 | Ga0070666_105382772 | 110 |
| 104 | 3300005335 | Ga0070666_10643633 | Ga0070666_106436331 | 110 |
| 105 | 3300005336 | Ga0070680_100029340 | Ga0070680_1000293404 | 110 |
| 106 | 3300005336 | Ga0070680_100083439 | Ga0070680_1000834392 | 110 |
| 107 | 3300005336 | Ga0070680_100449429 | Ga0070680_1004494292 | 110 |
| 108 | 3300005337 | Ga0070682_100053546 | Ga0070682_1000535462 | 110 |
| 109 | 3300005337 | Ga0070682_100295286 | Ga0070682_1002952863 | 110 |
| 110 | 3300005337 | Ga0070682_100971860 | Ga0070682_1009718601 | 110 |
| 111 | 3300005338 | Ga0068868_100035494 | Ga0068868_1000354942 | 110 |
| 112 | 3300005338 | Ga0068868_100068046 | Ga0068868_1000680463 | 110 |
| 113 | 3300005338 | Ga0068868_100300844 | Ga0068868_1003008442 | 110 |
| 114 | 3300005338 | Ga0068868_100315339 | Ga0068868_1003153391 | 110 |
| 115 | 3300005338 | Ga0068868_101171148 | Ga0068868_1011711481 | 110 |
| 116 | 3300005338 | Ga0068868_101728351 | Ga0068868_1017283511 | 110 |
| 117 | 3300005339 | Ga0070660_100079661 | Ga0070660_1000796614 | 110 |
| 118 | 3300005340 | Ga0070689_100017912 | Ga0070689_1000179122 | 110 |
| 119 | 3300005340 | Ga0070689_100035344 | Ga0070689_1000353443 | 110 |
| 120 | 3300005340 | Ga0070689_100058371 | Ga0070689_1000583714 | 110 |
| 121 | 3300005340 | Ga0070689_100334897 | Ga0070689_1003348971 | 110 |
| 122 | 3300005340 | Ga0070689_100574527 | Ga0070689_1005745272 | 110 |
| 123 | 3300005340 | Ga0070689_100682541 | Ga0070689_1006825412 | 110 |
| 124 | 3300005340 | Ga0070689_100934543 | Ga0070689_1009345431 | 110 |
| 125 | 3300005340 | Ga0070689_101361047 | Ga0070689_1013610471 | 110 |
| 126 | 3300005340 | Ga0070689_101401675 | Ga0070689_1014016752 | 110 |
| 127 | 3300005340 | Ga0070689_101904127 | Ga0070689_1019041271 | 110 |
| 128 | 3300005340 | Ga0070689_102136429 | Ga0070689_1021364291 | 110 |
| 129 | 3300005341 | Ga0070691_10227041 | Ga0070691_102270411 | 110 |
| 130 | 3300005343 | Ga0070687_100043878 | Ga0070687_1000438781 | 110 |
| 131 | 3300005343 | Ga0070687_100106748 | Ga0070687_1001067482 | 110 |
| 132 | 3300005343 | Ga0070687_100121283 | Ga0070687_1001212832 | 110 |
| 133 | 3300005343 | Ga0070687_100469532 | Ga0070687_1004695322 | 110 |
| 134 | 3300005343 | Ga0070687_100574786 | Ga0070687_1005747861 | 110 |
| 135 | 3300005344 | Ga0070661_100331197 | Ga0070661_1003311971 | 110 |
| 136 | 3300005344 | Ga0070661_101343904 | Ga0070661_1013439042 | 110 |
| 137 | 3300005345 | Ga0070692_10033025 | Ga0070692_100330253 | 110 |
| 138 | 3300005345 | Ga0070692_10042222 | Ga0070692_100422222 | 110 |
| 139 | 3300005345 | Ga0070692_10213690 | Ga0070692_102136902 | 110 |
| 140 | 3300005345 | Ga0070692_10241586 | Ga0070692_102415861 | 110 |
| 141 | 3300005345 | Ga0070692_10332116 | Ga0070692_103321162 | 110 |
| 142 | 3300005345 | Ga0070692_10348187 | Ga0070692_103481871 | 110 |
| 143 | 3300005345 | Ga0070692_11340428 | Ga0070692_113404281 | 110 |
| 144 | 3300005347 | Ga0070668_100008267 | Ga0070668_1000082678 | 110 |
| 145 | 3300005347 | Ga0070668_100854722 | Ga0070668_1008547222 | 110 |
| 146 | 3300005353 | Ga0070669_100030178 | Ga0070669_1000301785 | 110 |
| 147 | 3300005353 | Ga0070669_100031507 | Ga0070669_1000315072 | 110 |
| 148 | 3300005353 | Ga0070669_100037585 | Ga0070669_1000375854 | 110 |
| 149 | 3300005353 | Ga0070669_100061319 | Ga0070669_1000613192 | 110 |
| 150 | 3300005353 | Ga0070669_100284422 | Ga0070669_1002844223 | 110 |
| 151 | 3300005353 | Ga0070669_101209082 | Ga0070669_1012090821 | 110 |
| 152 | 3300005354 | Ga0070675_100077534 | Ga0070675_1000775343 | 110 |
| 153 | 3300005354 | Ga0070675_100274943 | Ga0070675_1002749432 | 110 |
| 154 | 3300005354 | Ga0070675_100287698 | Ga0070675_1002876982 | 110 |
| 155 | 3300005354 | Ga0070675_100553681 | Ga0070675_1005536812 | 110 |
| 156 | 3300005354 | Ga0070675_100695120 | Ga0070675_1006951201 | 110 |
| 157 | 3300005354 | Ga0070675_101406488 | Ga0070675_1014064881 | 110 |
| 158 | 3300005355 | Ga0070671_100024875 | Ga0070671_1000248754 | 110 |
| 159 | 3300005355 | Ga0070671_100111481 | Ga0070671_1001114815 | 110 |
| 160 | 3300005355 | Ga0070671_100170372 | Ga0070671_1001703721 | 110 |
| 161 | 3300005355 | Ga0070671_100897050 | Ga0070671_1008970502 | 110 |
| 162 | 3300005355 | Ga0070671_100913979 | Ga0070671_1009139791 | 110 |
| 163 | 3300005356 | Ga0070674_100190414 | Ga0070674_1001904142 | 110 |
| 164 | 3300005356 | Ga0070674_100470811 | Ga0070674_1004708112 | 110 |
| 165 | 3300005364 | Ga0070673_100077183 | Ga0070673_1000771833 | 110 |
| 166 | 3300005364 | Ga0070673_100081737 | Ga0070673_1000817372 | 110 |
| 167 | 3300005364 | Ga0070673_100084407 | Ga0070673_1000844073 | 110 |
| 168 | 3300005364 | Ga0070673_100246507 | Ga0070673_1002465071 | 110 |
| 169 | 3300005364 | Ga0070673_100331264 | Ga0070673_1003312642 | 110 |
| 170 | 3300005364 | Ga0070673_100413168 | Ga0070673_1004131681 | 110 |
| 171 | 3300005364 | Ga0070673_101789055 | Ga0070673_1017890551 | 110 |
| 172 | 3300005364 | Ga0070673_101967611 | Ga0070673_1019676111 | 110 |
| 173 | 3300005365 | Ga0070688_100044481 | Ga0070688_1000444811 | 110 |
| 174 | 3300005365 | Ga0070688_100607186 | Ga0070688_1006071862 | 110 |
| 175 | 3300005365 | Ga0070688_101002027 | Ga0070688_1010020272 | 110 |
| 176 | 3300005365 | Ga0070688_101146645 | Ga0070688_1011466451 | 110 |
| 177 | 3300005366 | Ga0070659_100008321 | Ga0070659_1000083215 | 110 |
| 178 | 3300005366 | Ga0070659_100495631 | Ga0070659_1004956311 | 110 |
| 179 | 3300005366 | Ga0070659_101122126 | Ga0070659_1011221262 | 110 |
| 180 | 3300005367 | Ga0070667_100018205 | Ga0070667_1000182052 | 110 |
| 181 | 3300005367 | Ga0070667_100889890 | Ga0070667_1008898901 | 110 |
| 182 | 3300005367 | Ga0070667_101554848 | Ga0070667_1015548482 | 110 |
| 183 | 3300005438 | Ga0070701_10045910 | Ga0070701_100459102 | 110 |
| 184 | 3300005438 | Ga0070701_10062048 | Ga0070701_100620483 | 110 |
| 185 | 3300005438 | Ga0070701_10153880 | Ga0070701_101538802 | 110 |
| 186 | 3300005438 | Ga0070701_10177803 | Ga0070701_101778031 | 110 |
| 187 | 3300005438 | Ga0070701_10669991 | Ga0070701_106699911 | 110 |
| 188 | 3300005440 | Ga0070705_100013030 | Ga0070705_1000130303 | 110 |
| 189 | 3300005440 | Ga0070705_100014024 | Ga0070705_1000140245 | 110 |
| 190 | 3300005440 | Ga0070705_100063379 | Ga0070705_1000633793 | 110 |
| 191 | 3300005440 | Ga0070705_100210162 | Ga0070705_1002101621 | 110 |
| 192 | 3300005440 | Ga0070705_100325751 | Ga0070705_1003257512 | 110 |
| 193 | 3300005440 | Ga0070705_100512693 | Ga0070705_1005126932 | 110 |
| 194 | 3300005440 | Ga0070705_100606653 | Ga0070705_1006066532 | 110 |
| 195 | 3300005440 | Ga0070705_100827386 | Ga0070705_1008273862 | 110 |
| 196 | 3300005441 | Ga0070700_100000120 | Ga0070700_10000012016 | 110 |
| 197 | 3300005441 | Ga0070700_100010579 | Ga0070700_1000105793 | 110 |
| 198 | 3300005441 | Ga0070700_100060229 | Ga0070700_1000602292 | 110 |
| 199 | 3300005441 | Ga0070700_100100878 | Ga0070700_1001008783 | 110 |
| 200 | 3300005441 | Ga0070700_100120895 | Ga0070700_1001208952 | 110 |
| 201 | 3300005441 | Ga0070700_100144818 | Ga0070700_1001448182 | 110 |
| 202 | 3300005441 | Ga0070700_100177323 | Ga0070700_1001773232 | 110 |
| 203 | 3300005441 | Ga0070700_100327275 | Ga0070700_1003272752 | 110 |
| 204 | 3300005441 | Ga0070700_101154526 | Ga0070700_1011545261 | 110 |
| 205 | 3300005444 | Ga0070694_100017204 | Ga0070694_1000172043 | 110 |
| 206 | 3300005444 | Ga0070694_100092269 | Ga0070694_1000922692 | 110 |
| 207 | 3300005444 | Ga0070694_100110404 | Ga0070694_1001104044 | 110 |
| 208 | 3300005444 | Ga0070694_100211119 | Ga0070694_1002111192 | 110 |
| 209 | 3300005444 | Ga0070694_100254010 | Ga0070694_1002540102 | 110 |
| 210 | 3300005444 | Ga0070694_100326153 | Ga0070694_1003261531 | 110 |
| 211 | 3300005444 | Ga0070694_100389803 | Ga0070694_1003898032 | 110 |
| 212 | 3300005444 | Ga0070694_100484635 | Ga0070694_1004846352 | 110 |
| 213 | 3300005444 | Ga0070694_100744778 | Ga0070694_1007447781 | 110 |
| 214 | 3300005444 | Ga0070694_100954767 | Ga0070694_1009547672 | 110 |
| 215 | 3300005444 | Ga0070694_101200209 | Ga0070694_1012002091 | 110 |
| 216 | 3300005445 | Ga0070708_100000337 | Ga0070708_10000033717 | 110 |
| 217 | 3300005445 | Ga0070708_100148145 | Ga0070708_1001481452 | 110 |
| 218 | 3300005445 | Ga0070708_100255666 | Ga0070708_1002556662 | 110 |
| 219 | 3300005445 | Ga0070708_100950572 | Ga0070708_1009505721 | 110 |
| 220 | 3300005455 | Ga0070663_100643440 | Ga0070663_1006434402 | 110 |
| 221 | 3300005456 | Ga0070678_100047848 | Ga0070678_1000478482 | 110 |
| 222 | 3300005456 | Ga0070678_100474634 | Ga0070678_1004746341 | 110 |
| 223 | 3300005456 | Ga0070678_100651468 | Ga0070678_1006514681 | 110 |
| 224 | 3300005457 | Ga0070662_100618082 | Ga0070662_1006180821 | 110 |
| 225 | 3300005457 | Ga0070662_101016072 | Ga0070662_1010160722 | 110 |
| 226 | 3300005457 | Ga0070662_101298029 | Ga0070662_1012980291 | 110 |
| 227 | 3300005457 | Ga0070662_101707623 | Ga0070662_1017076231 | 110 |
| 228 | 3300005458 | Ga0070681_10001081 | Ga0070681_100010817 | 110 |
| 229 | 3300005458 | Ga0070681_10006294 | Ga0070681_100062947 | 110 |
| 230 | 3300005458 | Ga0070681_10054385 | Ga0070681_100543854 | 110 |
| 231 | 3300005458 | Ga0070681_10201233 | Ga0070681_102012331 | 110 |
| 232 | 3300005459 | Ga0068867_100034591 | Ga0068867_1000345911 | 110 |
| 233 | 3300005459 | Ga0068867_100042795 | Ga0068867_1000427952 | 110 |
| 234 | 3300005459 | Ga0068867_100054294 | Ga0068867_1000542945 | 110 |
| 235 | 3300005459 | Ga0068867_100059623 | Ga0068867_1000596234 | 110 |
| 236 | 3300005459 | Ga0068867_100101133 | Ga0068867_1001011333 | 110 |
| 237 | 3300005459 | Ga0068867_100439081 | Ga0068867_1004390811 | 110 |
| 238 | 3300005459 | Ga0068867_100588500 | Ga0068867_1005885001 | 110 |
| 239 | 3300005459 | Ga0068867_101553076 | Ga0068867_1015530761 | 110 |
| 240 | 3300005459 | Ga0068867_101602249 | Ga0068867_1016022492 | 110 |
| 241 | 3300005459 | Ga0068867_101604872 | Ga0068867_1016048721 | 110 |
| 242 | 3300005466 | Ga0070685_10088908 | Ga0070685_100889081 | 110 |
| 243 | 3300005466 | Ga0070685_10299235 | Ga0070685_102992352 | 110 |
| 244 | 3300005466 | Ga0070685_10466184 | Ga0070685_104661841 | 110 |
| 245 | 3300005466 | Ga0070685_10562270 | Ga0070685_105622702 | 110 |
| 246 | 3300005467 | Ga0070706_100012259 | Ga0070706_1000122595 | 110 |
| 247 | 3300005467 | Ga0070706_100035284 | Ga0070706_1000352844 | 110 |
| 248 | 3300005467 | Ga0070706_100277890 | Ga0070706_1002778902 | 110 |
| 249 | 3300005467 | Ga0070706_100913626 | Ga0070706_1009136261 | 110 |
| 250 | 3300005468 | Ga0070707_100040959 | Ga0070707_1000409592 | 110 |
| 251 | 3300005468 | Ga0070707_100081032 | Ga0070707_1000810322 | 110 |
| 252 | 3300005468 | Ga0070707_100286500 | Ga0070707_1002865002 | 110 |
| 253 | 3300005468 | Ga0070707_101471620 | Ga0070707_1014716201 | 110 |
| 254 | 3300005471 | Ga0070698_100004605 | Ga0070698_10000460515 | 110 |
| 255 | 3300005471 | Ga0070698_100012974 | Ga0070698_1000129747 | 110 |
| 256 | 3300005471 | Ga0070698_100013753 | Ga0070698_1000137536 | 110 |
| 257 | 3300005471 | Ga0070698_100018834 | Ga0070698_1000188347 | 110 |
| 258 | 3300005471 | Ga0070698_100636820 | Ga0070698_1006368202 | 110 |
| 259 | 3300005471 | Ga0070698_101167788 | Ga0070698_1011677881 | 110 |
| 260 | 3300005471 | Ga0070698_102242075 | Ga0070698_1022420751 | 110 |
| 261 | 3300005518 | Ga0070699_100006275 | Ga0070699_1000062757 | 110 |
| 262 | 3300005518 | Ga0070699_100007202 | Ga0070699_10000720210 | 110 |
| 263 | 3300005518 | Ga0070699_100030729 | Ga0070699_1000307294 | 110 |
| 264 | 3300005518 | Ga0070699_100049948 | Ga0070699_1000499482 | 110 |
| 265 | 3300005518 | Ga0070699_100427062 | Ga0070699_1004270621 | 110 |
| 266 | 3300005530 | Ga0070679_100008421 | Ga0070679_10000842111 | 110 |
| 267 | 3300005530 | Ga0070679_100056125 | Ga0070679_1000561254 | 110 |
| 268 | 3300005535 | Ga0070684_101368972 | Ga0070684_1013689722 | 110 |
| 269 | 3300005536 | Ga0070697_100000062 | Ga0070697_10000006213 | 110 |
| 270 | 3300005536 | Ga0070697_100038063 | Ga0070697_1000380633 | 110 |
| 271 | 3300005536 | Ga0070697_101351849 | Ga0070697_1013518491 | 110 |
| 272 | 3300005536 | Ga0070697_101469068 | Ga0070697_1014690681 | 110 |
| 273 | 3300005539 | Ga0068853_100071741 | Ga0068853_1000717415 | 110 |
| 274 | 3300005539 | Ga0068853_100180300 | Ga0068853_1001803002 | 110 |
| 275 | 3300005539 | Ga0068853_100257079 | Ga0068853_1002570792 | 110 |
| 276 | 3300005539 | Ga0068853_100395567 | Ga0068853_1003955672 | 110 |
| 277 | 3300005539 | Ga0068853_100590121 | Ga0068853_1005901212 | 110 |
| 278 | 3300005539 | Ga0068853_100619133 | Ga0068853_1006191331 | 110 |
| 279 | 3300005539 | Ga0068853_101290359 | Ga0068853_1012903591 | 110 |
| 280 | 3300005539 | Ga0068853_102015651 | Ga0068853_1020156511 | 110 |
| 281 | 3300005539 | Ga0068853_102184292 | Ga0068853_1021842921 | 110 |
| 282 | 3300005543 | Ga0070672_100003235 | Ga0070672_10000323511 | 110 |
| 283 | 3300005543 | Ga0070672_100940672 | Ga0070672_1009406722 | 110 |
| 284 | 3300005543 | Ga0070672_100940773 | Ga0070672_1009407731 | 110 |
| 285 | 3300005543 | Ga0070672_101238899 | Ga0070672_1012388991 | 110 |
| 286 | 3300005544 | Ga0070686_100002174 | Ga0070686_1000021749 | 110 |
| 287 | 3300005544 | Ga0070686_100215400 | Ga0070686_1002154001 | 110 |
| 288 | 3300005544 | Ga0070686_100566541 | Ga0070686_1005665412 | 110 |
| 289 | 3300005544 | Ga0070686_100991500 | Ga0070686_1009915001 | 110 |
| 290 | 3300005544 | Ga0070686_101710802 | Ga0070686_1017108021 | 110 |
| 291 | 3300005545 | Ga0070695_100013916 | Ga0070695_1000139164 | 110 |
| 292 | 3300005545 | Ga0070695_100026460 | Ga0070695_1000264605 | 110 |
| 293 | 3300005545 | Ga0070695_100110005 | Ga0070695_1001100052 | 110 |
| 294 | 3300005545 | Ga0070695_100119248 | Ga0070695_1001192483 | 110 |
| 295 | 3300005545 | Ga0070695_100120848 | Ga0070695_1001208482 | 110 |
| 296 | 3300005545 | Ga0070695_100134121 | Ga0070695_1001341212 | 110 |
| 297 | 3300005545 | Ga0070695_100141653 | Ga0070695_1001416532 | 110 |
| 298 | 3300005545 | Ga0070695_100143482 | Ga0070695_1001434822 | 110 |
| 299 | 3300005545 | Ga0070695_100158535 | Ga0070695_1001585352 | 110 |
| 300 | 3300005545 | Ga0070695_100391206 | Ga0070695_1003912062 | 110 |
| 301 | 3300005545 | Ga0070695_100706216 | Ga0070695_1007062161 | 110 |
| 302 | 3300005545 | Ga0070695_101877076 | Ga0070695_1018770761 | 110 |
| 303 | 3300005546 | Ga0070696_100000807 | Ga0070696_10000080714 | 110 |
| 304 | 3300005546 | Ga0070696_100010581 | Ga0070696_1000105814 | 110 |
| 305 | 3300005546 | Ga0070696_100095169 | Ga0070696_1000951693 | 110 |
| 306 | 3300005546 | Ga0070696_100098487 | Ga0070696_1000984874 | 110 |
| 307 | 3300005546 | Ga0070696_100119931 | Ga0070696_1001199311 | 110 |
| 308 | 3300005546 | Ga0070696_100440145 | Ga0070696_1004401451 | 110 |
| 309 | 3300005546 | Ga0070696_100635662 | Ga0070696_1006356622 | 110 |
| 310 | 3300005546 | Ga0070696_101129638 | Ga0070696_1011296381 | 110 |
| 311 | 3300005546 | Ga0070696_101796155 | Ga0070696_1017961552 | 110 |
| 312 | 3300005547 | Ga0070693_100022522 | Ga0070693_1000225224 | 110 |
| 313 | 3300005547 | Ga0070693_100040645 | Ga0070693_1000406453 | 110 |
| 314 | 3300005547 | Ga0070693_100094216 | Ga0070693_1000942162 | 110 |
| 315 | 3300005547 | Ga0070693_100242564 | Ga0070693_1002425642 | 110 |
| 316 | 3300005547 | Ga0070693_100339487 | Ga0070693_1003394871 | 110 |
| 317 | 3300005547 | Ga0070693_100401051 | Ga0070693_1004010512 | 110 |
| 318 | 3300005547 | Ga0070693_101656889 | Ga0070693_1016568891 | 110 |
| 319 | 3300005548 | Ga0070665_100267008 | Ga0070665_1002670083 | 110 |
| 320 | 3300005549 | Ga0070704_100041854 | Ga0070704_1000418542 | 110 |
| 321 | 3300005549 | Ga0070704_100088858 | Ga0070704_1000888582 | 110 |
| 322 | 3300005549 | Ga0070704_100177140 | Ga0070704_1001771401 | 110 |
| 323 | 3300005549 | Ga0070704_100272872 | Ga0070704_1002728721 | 110 |
| 324 | 3300005549 | Ga0070704_100280836 | Ga0070704_1002808361 | 110 |
| 325 | 3300005549 | Ga0070704_100443264 | Ga0070704_1004432642 | 110 |
| 326 | 3300005549 | Ga0070704_100450887 | Ga0070704_1004508871 | 110 |
| 327 | 3300005549 | Ga0070704_100463381 | Ga0070704_1004633812 | 110 |
| 328 | 3300005549 | Ga0070704_100936529 | Ga0070704_1009365291 | 110 |
| 329 | 3300005563 | Ga0068855_100455794 | Ga0068855_1004557941 | 110 |
| 330 | 3300005563 | Ga0068855_101239572 | Ga0068855_1012395721 | 110 |
| 331 | 3300005563 | Ga0068855_101426436 | Ga0068855_1014264362 | 110 |
| 332 | 3300005563 | Ga0068855_102350087 | Ga0068855_1023500872 | 110 |
| 333 | 3300005564 | Ga0070664_100005757 | Ga0070664_1000057575 | 110 |
| 334 | 3300005564 | Ga0070664_100073910 | Ga0070664_1000739102 | 110 |
| 335 | 3300005564 | Ga0070664_100089390 | Ga0070664_1000893903 | 110 |
| 336 | 3300005564 | Ga0070664_100252396 | Ga0070664_1002523961 | 110 |
| 337 | 3300005564 | Ga0070664_100299036 | Ga0070664_1002990362 | 110 |
| 338 | 3300005564 | Ga0070664_100390994 | Ga0070664_1003909942 | 110 |
| 339 | 3300005564 | Ga0070664_100428813 | Ga0070664_1004288132 | 110 |
| 340 | 3300005564 | Ga0070664_100478689 | Ga0070664_1004786892 | 110 |
| 341 | 3300005564 | Ga0070664_101013882 | Ga0070664_1010138821 | 110 |
| 342 | 3300005564 | Ga0070664_102288880 | Ga0070664_1022888801 | 110 |
| 343 | 3300005564 | Ga0070664_102339284 | Ga0070664_1023392841 | 110 |
| 344 | 3300005577 | Ga0068857_100011647 | Ga0068857_1000116476 | 110 |
| 345 | 3300005577 | Ga0068857_100098402 | Ga0068857_1000984022 | 110 |
| 346 | 3300005577 | Ga0068857_100250199 | Ga0068857_1002501992 | 110 |
| 347 | 3300005577 | Ga0068857_100259806 | Ga0068857_1002598062 | 110 |
| 348 | 3300005577 | Ga0068857_100474762 | Ga0068857_1004747622 | 110 |
| 349 | 3300005577 | Ga0068857_100474810 | Ga0068857_1004748103 | 110 |
| 350 | 3300005577 | Ga0068857_100553609 | Ga0068857_1005536091 | 110 |
| 351 | 3300005577 | Ga0068857_100665285 | Ga0068857_1006652851 | 110 |
| 352 | 3300005577 | Ga0068857_100866822 | Ga0068857_1008668222 | 110 |
| 353 | 3300005578 | Ga0068854_100039135 | Ga0068854_1000391353 | 110 |
| 354 | 3300005578 | Ga0068854_100198348 | Ga0068854_1001983482 | 110 |
| 355 | 3300005578 | Ga0068854_100319982 | Ga0068854_1003199822 | 110 |
| 356 | 3300005578 | Ga0068854_100491532 | Ga0068854_1004915321 | 110 |
| 357 | 3300005578 | Ga0068854_100595031 | Ga0068854_1005950312 | 110 |
| 358 | 3300005578 | Ga0068854_100643546 | Ga0068854_1006435461 | 110 |
| 359 | 3300005578 | Ga0068854_100660586 | Ga0068854_1006605861 | 110 |
| 360 | 3300005578 | Ga0068854_101314622 | Ga0068854_1013146222 | 110 |
| 361 | 3300005578 | Ga0068854_101980158 | Ga0068854_1019801581 | 110 |
| 362 | 3300005578 | Ga0068854_102125540 | Ga0068854_1021255401 | 110 |
| 363 | 3300005614 | Ga0068856_100021795 | Ga0068856_1000217955 | 110 |
| 364 | 3300005614 | Ga0068856_100925077 | Ga0068856_1009250771 | 110 |
| 365 | 3300005615 | Ga0070702_100020950 | Ga0070702_1000209503 | 110 |
| 366 | 3300005615 | Ga0070702_100037702 | Ga0070702_1000377025 | 110 |
| 367 | 3300005615 | Ga0070702_100063007 | Ga0070702_1000630072 | 110 |
| 368 | 3300005615 | Ga0070702_100212460 | Ga0070702_1002124602 | 110 |
| 369 | 3300005615 | Ga0070702_100396737 | Ga0070702_1003967372 | 110 |
| 370 | 3300005615 | Ga0070702_101325575 | Ga0070702_1013255751 | 110 |
| 371 | 3300005616 | Ga0068852_100129712 | Ga0068852_1001297122 | 110 |
| 372 | 3300005616 | Ga0068852_100318997 | Ga0068852_1003189972 | 110 |
| 373 | 3300005616 | Ga0068852_100425615 | Ga0068852_1004256152 | 110 |
| 374 | 3300005616 | Ga0068852_101212324 | Ga0068852_1012123242 | 110 |
| 375 | 3300005616 | Ga0068852_101632978 | Ga0068852_1016329782 | 110 |
| 376 | 3300005616 | Ga0068852_101659408 | Ga0068852_1016594082 | 110 |
| 377 | 3300005616 | Ga0068852_102602473 | Ga0068852_1026024731 | 110 |
| 378 | 3300005617 | Ga0068859_100006661 | Ga0068859_1000066617 | 110 |
| 379 | 3300005617 | Ga0068859_100009613 | Ga0068859_1000096134 | 110 |
| 380 | 3300005617 | Ga0068859_100027113 | Ga0068859_1000271139 | 110 |
| 381 | 3300005617 | Ga0068859_100056402 | Ga0068859_1000564026 | 110 |
| 382 | 3300005617 | Ga0068859_100063364 | Ga0068859_1000633643 | 110 |
| 383 | 3300005617 | Ga0068859_100184573 | Ga0068859_1001845731 | 110 |
| 384 | 3300005617 | Ga0068859_100223045 | Ga0068859_1002230454 | 110 |
| 385 | 3300005617 | Ga0068859_100232478 | Ga0068859_1002324782 | 110 |
| 386 | 3300005617 | Ga0068859_100235025 | Ga0068859_1002350252 | 110 |
| 387 | 3300005617 | Ga0068859_100329511 | Ga0068859_1003295112 | 110 |
| 388 | 3300005617 | Ga0068859_100463722 | Ga0068859_1004637222 | 110 |
| 389 | 3300005617 | Ga0068859_100490815 | Ga0068859_1004908151 | 110 |
| 390 | 3300005617 | Ga0068859_100602699 | Ga0068859_1006026993 | 110 |
| 391 | 3300005617 | Ga0068859_100636851 | Ga0068859_1006368512 | 110 |
| 392 | 3300005617 | Ga0068859_100794078 | Ga0068859_1007940782 | 110 |
| 393 | 3300005617 | Ga0068859_100816629 | Ga0068859_1008166292 | 110 |
| 394 | 3300005617 | Ga0068859_100991361 | Ga0068859_1009913611 | 110 |
| 395 | 3300005617 | Ga0068859_101063755 | Ga0068859_1010637551 | 110 |
| 396 | 3300005617 | Ga0068859_102186136 | Ga0068859_1021861361 | 110 |
| 397 | 3300005617 | Ga0068859_102420368 | Ga0068859_1024203681 | 110 |
| 398 | 3300005617 | Ga0068859_102835964 | Ga0068859_1028359641 | 110 |
| 399 | 3300005617 | Ga0068859_103094459 | Ga0068859_1030944591 | 110 |
| 400 | 3300005618 | Ga0068864_100008711 | Ga0068864_1000087112 | 110 |
| 401 | 3300005618 | Ga0068864_100021333 | Ga0068864_1000213334 | 110 |
| 402 | 3300005618 | Ga0068864_100054098 | Ga0068864_1000540983 | 110 |
| 403 | 3300005618 | Ga0068864_100212659 | Ga0068864_1002126592 | 110 |
| 404 | 3300005618 | Ga0068864_100214585 | Ga0068864_1002145852 | 110 |
| 405 | 3300005618 | Ga0068864_100323995 | Ga0068864_1003239952 | 110 |
| 406 | 3300005618 | Ga0068864_100387108 | Ga0068864_1003871082 | 110 |
| 407 | 3300005618 | Ga0068864_100415507 | Ga0068864_1004155072 | 110 |
| 408 | 3300005618 | Ga0068864_100526012 | Ga0068864_1005260121 | 110 |
| 409 | 3300005618 | Ga0068864_100794165 | Ga0068864_1007941652 | 110 |
| 410 | 3300005618 | Ga0068864_101367078 | Ga0068864_1013670781 | 110 |
| 411 | 3300005618 | Ga0068864_101523147 | Ga0068864_1015231471 | 110 |
| 412 | 3300005618 | Ga0068864_101834311 | Ga0068864_1018343111 | 110 |
| 413 | 3300005618 | Ga0068864_102357615 | Ga0068864_1023576151 | 110 |
| 414 | 3300005718 | Ga0068866_10071694 | Ga0068866_100716941 | 110 |
| 415 | 3300005718 | Ga0068866_10301056 | Ga0068866_103010562 | 110 |
| 416 | 3300005719 | Ga0068861_100002983 | Ga0068861_10000298310 | 110 |
| 417 | 3300005719 | Ga0068861_100004194 | Ga0068861_1000041948 | 110 |
| 418 | 3300005719 | Ga0068861_100026590 | Ga0068861_1000265906 | 110 |
| 419 | 3300005719 | Ga0068861_100151057 | Ga0068861_1001510573 | 110 |
| 420 | 3300005719 | Ga0068861_100218202 | Ga0068861_1002182023 | 110 |
| 421 | 3300005719 | Ga0068861_100537665 | Ga0068861_1005376652 | 110 |
| 422 | 3300005719 | Ga0068861_100773458 | Ga0068861_1007734581 | 110 |
| 423 | 3300005719 | Ga0068861_101696318 | Ga0068861_1016963181 | 110 |
| 424 | 3300005719 | Ga0068861_101809589 | Ga0068861_1018095892 | 110 |
| 425 | 3300005719 | Ga0068861_101811476 | Ga0068861_1018114762 | 110 |
| 426 | 3300005719 | Ga0068861_102311319 | Ga0068861_1023113191 | 110 |
| 427 | 3300005834 | Ga0068851_10063826 | Ga0068851_100638262 | 110 |
| 428 | 3300005834 | Ga0068851_10402445 | Ga0068851_104024452 | 110 |
| 429 | 3300005834 | Ga0068851_10568427 | Ga0068851_105684271 | 110 |
| 430 | 3300005834 | Ga0068851_10741795 | Ga0068851_107417951 | 110 |
| 431 | 3300005840 | Ga0068870_10107101 | Ga0068870_101071011 | 110 |
| 432 | 3300005840 | Ga0068870_10150762 | Ga0068870_101507621 | 110 |
| 433 | 3300005840 | Ga0068870_10232065 | Ga0068870_102320652 | 110 |
| 434 | 3300005840 | Ga0068870_10414291 | Ga0068870_104142912 | 110 |
| 435 | 3300005841 | Ga0068863_100075227 | Ga0068863_1000752273 | 110 |
| 436 | 3300005841 | Ga0068863_100112035 | Ga0068863_1001120352 | 110 |
| 437 | 3300005841 | Ga0068863_100167444 | Ga0068863_1001674442 | 110 |
| 438 | 3300005841 | Ga0068863_100213033 | Ga0068863_1002130333 | 110 |
| 439 | 3300005841 | Ga0068863_100223750 | Ga0068863_1002237503 | 110 |
| 440 | 3300005841 | Ga0068863_100270853 | Ga0068863_1002708534 | 110 |
| 441 | 3300005841 | Ga0068863_100274814 | Ga0068863_1002748142 | 110 |
| 442 | 3300005841 | Ga0068863_100329269 | Ga0068863_1003292691 | 110 |
| 443 | 3300005841 | Ga0068863_101077930 | Ga0068863_1010779302 | 110 |
| 444 | 3300005842 | Ga0068858_100020307 | Ga0068858_1000203077 | 110 |
| 445 | 3300005842 | Ga0068858_100062270 | Ga0068858_1000622703 | 110 |
| 446 | 3300005842 | Ga0068858_100070049 | Ga0068858_1000700494 | 110 |
| 447 | 3300005842 | Ga0068858_100248180 | Ga0068858_1002481802 | 110 |
| 448 | 3300005842 | Ga0068858_100278823 | Ga0068858_1002788232 | 110 |
| 449 | 3300005842 | Ga0068858_100719923 | Ga0068858_1007199232 | 110 |
| 450 | 3300005842 | Ga0068858_100915307 | Ga0068858_1009153072 | 110 |
| 451 | 3300005842 | Ga0068858_100955120 | Ga0068858_1009551202 | 110 |
| 452 | 3300005842 | Ga0068858_101099103 | Ga0068858_1010991032 | 110 |
| 453 | 3300005842 | Ga0068858_102430760 | Ga0068858_1024307601 | 110 |
| 454 | 3300005842 | Ga0068858_102465385 | Ga0068858_1024653852 | 110 |
| 455 | 3300005843 | Ga0068860_100067260 | Ga0068860_1000672603 | 110 |
| 456 | 3300005843 | Ga0068860_100095228 | Ga0068860_1000952284 | 110 |
| 457 | 3300005843 | Ga0068860_100100146 | Ga0068860_1001001463 | 110 |
| 458 | 3300005843 | Ga0068860_100124757 | Ga0068860_1001247574 | 110 |
| 459 | 3300005843 | Ga0068860_100134784 | Ga0068860_1001347843 | 110 |
| 460 | 3300005843 | Ga0068860_100150589 | Ga0068860_1001505894 | 110 |
| 461 | 3300005843 | Ga0068860_100323632 | Ga0068860_1003236321 | 110 |
| 462 | 3300005843 | Ga0068860_100326954 | Ga0068860_1003269542 | 110 |
| 463 | 3300005843 | Ga0068860_100404102 | Ga0068860_1004041022 | 110 |
| 464 | 3300005843 | Ga0068860_100665872 | Ga0068860_1006658722 | 110 |
| 465 | 3300005843 | Ga0068860_102176404 | Ga0068860_1021764041 | 110 |
| 466 | 3300005844 | Ga0068862_100010358 | Ga0068862_1000103582 | 110 |
| 467 | 3300005844 | Ga0068862_100036312 | Ga0068862_1000363125 | 110 |
| 468 | 3300005844 | Ga0068862_100073581 | Ga0068862_1000735814 | 110 |
| 469 | 3300005844 | Ga0068862_100150979 | Ga0068862_1001509792 | 110 |
| 470 | 3300005844 | Ga0068862_100211958 | Ga0068862_1002119583 | 110 |
| 471 | 3300005844 | Ga0068862_100672179 | Ga0068862_1006721792 | 110 |
| 472 | 3300005844 | Ga0068862_100778572 | Ga0068862_1007785722 | 110 |
| 473 | 3300005844 | Ga0068862_100961321 | Ga0068862_1009613211 | 110 |
| 474 | 3300005844 | Ga0068862_101076594 | Ga0068862_1010765942 | 110 |
| 475 | 3300005844 | Ga0068862_102301013 | Ga0068862_1023010132 | 110 |
| 476 | 3300005983 | Ga0081540_1046504 | Ga0081540_10465043 | 110 |
| 477 | 3300005985 | Ga0081539_10000408 | Ga0081539_1000040884 | 110 |
| 478 | 3300005985 | Ga0081539_10002782 | Ga0081539_1000278219 | 110 |
| 479 | 3300005985 | Ga0081539_10260842 | Ga0081539_102608422 | 110 |
| 480 | 3300006173 | Ga0070716_100039779 | Ga0070716_1000397794 | 110 |
| 481 | 3300006237 | Ga0097621_100008542 | Ga0097621_1000085427 | 110 |
| 482 | 3300006237 | Ga0097621_100013219 | Ga0097621_1000132192 | 110 |
| 483 | 3300006237 | Ga0097621_100036362 | Ga0097621_1000363621 | 110 |
| 484 | 3300006237 | Ga0097621_100167622 | Ga0097621_1001676223 | 110 |
| 485 | 3300006237 | Ga0097621_100381058 | Ga0097621_1003810582 | 110 |
| 486 | 3300006237 | Ga0097621_101550547 | Ga0097621_1015505471 | 110 |
| 487 | 3300006358 | Ga0068871_100019524 | Ga0068871_1000195247 | 110 |
| 488 | 3300006358 | Ga0068871_100031414 | Ga0068871_1000314143 | 110 |
| 489 | 3300006358 | Ga0068871_100185048 | Ga0068871_1001850483 | 110 |
| 490 | 3300006358 | Ga0068871_100428232 | Ga0068871_1004282322 | 110 |
| 491 | 3300006358 | Ga0068871_101554072 | Ga0068871_1015540722 | 110 |
| 492 | 3300006844 | Ga0075428_101057264 | Ga0075428_1010572642 | 110 |
| 493 | 3300006846 | Ga0075430_100066558 | Ga0075430_1000665581 | 110 |
| 494 | 3300006846 | Ga0075430_100082659 | Ga0075430_1000826594 | 110 |
| 495 | 3300006847 | Ga0075431_100094063 | Ga0075431_1000940634 | 110 |
| 496 | 3300006847 | Ga0075431_100164221 | Ga0075431_1001642213 | 110 |
| 497 | 3300006847 | Ga0075431_100255488 | Ga0075431_1002554882 | 110 |
| 498 | 3300006847 | Ga0075431_100265972 | Ga0075431_1002659723 | 110 |
| 499 | 3300006847 | Ga0075431_101432383 | Ga0075431_1014323831 | 110 |
| 500 | 3300006852 | Ga0075433_10037055 | Ga0075433_100370552 | 110 |
| 501 | 3300006852 | Ga0075433_10243454 | Ga0075433_102434542 | 110 |
| 502 | 3300006852 | Ga0075433_10453845 | Ga0075433_104538452 | 110 |
| 503 | 3300006852 | Ga0075433_10517438 | Ga0075433_105174382 | 110 |
| 504 | 3300006852 | Ga0075433_10680206 | Ga0075433_106802062 | 110 |
| 505 | 3300006871 | Ga0075434_100289565 | Ga0075434_1002895654 | 110 |
| 506 | 3300006871 | Ga0075434_100363644 | Ga0075434_1003636442 | 110 |
| 507 | 3300006871 | Ga0075434_100797367 | Ga0075434_1007973671 | 110 |
| 508 | 3300006880 | Ga0075429_100100562 | Ga0075429_1001005624 | 110 |
| 509 | 3300006880 | Ga0075429_101684029 | Ga0075429_1016840292 | 110 |
| 510 | 3300006881 | Ga0068865_100048889 | Ga0068865_1000488893 | 110 |
| 511 | 3300006881 | Ga0068865_100117481 | Ga0068865_1001174812 | 110 |
| 512 | 3300006881 | Ga0068865_100279919 | Ga0068865_1002799192 | 110 |
| 513 | 3300006881 | Ga0068865_100540999 | Ga0068865_1005409992 | 110 |
| 514 | 3300006931 | Ga0097620_100006661 | Ga0097620_1000066617 | 110 |
| 515 | 3300006931 | Ga0097620_100009613 | Ga0097620_1000096134 | 110 |
| 516 | 3300006931 | Ga0097620_100027113 | Ga0097620_1000271139 | 110 |
| 517 | 3300006931 | Ga0097620_100056402 | Ga0097620_1000564026 | 110 |
| 518 | 3300006931 | Ga0097620_100063365 | Ga0097620_1000633653 | 110 |
| 519 | 3300006931 | Ga0097620_100184577 | Ga0097620_1001845771 | 110 |
| 520 | 3300006931 | Ga0097620_100223050 | Ga0097620_1002230504 | 110 |
| 521 | 3300006931 | Ga0097620_100232474 | Ga0097620_1002324743 | 110 |
| 522 | 3300006931 | Ga0097620_100235042 | Ga0097620_1002350422 | 110 |
| 523 | 3300006931 | Ga0097620_100329512 | Ga0097620_1003295122 | 110 |
| 524 | 3300006931 | Ga0097620_100463757 | Ga0097620_1004637572 | 110 |
| 525 | 3300006931 | Ga0097620_100490790 | Ga0097620_1004907901 | 110 |
| 526 | 3300006931 | Ga0097620_100602653 | Ga0097620_1006026533 | 110 |
| 527 | 3300006931 | Ga0097620_100636851 | Ga0097620_1006368512 | 110 |
| 528 | 3300006931 | Ga0097620_100794087 | Ga0097620_1007940872 | 110 |
| 529 | 3300006931 | Ga0097620_100816652 | Ga0097620_1008166522 | 110 |
| 530 | 3300006931 | Ga0097620_100991368 | Ga0097620_1009913681 | 110 |
| 531 | 3300006931 | Ga0097620_101063782 | Ga0097620_1010637821 | 110 |
| 532 | 3300006931 | Ga0097620_102186338 | Ga0097620_1021863381 | 110 |
| 533 | 3300006931 | Ga0097620_102420377 | Ga0097620_1024203771 | 110 |
| 534 | 3300006931 | Ga0097620_102836133 | Ga0097620_1028361331 | 110 |
| 535 | 3300006931 | Ga0097620_103093790 | Ga0097620_1030937901 | 110 |
| 536 | 3300007076 | Ga0075435_100021117 | Ga0075435_1000211177 | 110 |
| 537 | 3300009011 | Ga0105251_10385115 | Ga0105251_103851152 | 110 |
| 538 | 3300009036 | Ga0105244_10522940 | Ga0105244_105229401 | 110 |
| 539 | 3300009092 | Ga0105250_10031522 | Ga0105250_100315221 | 110 |
| 540 | 3300009092 | Ga0105250_10063537 | Ga0105250_100635372 | 110 |
| 541 | 3300009092 | Ga0105250_10408584 | Ga0105250_104085841 | 110 |
| 542 | 3300009093 | Ga0105240_10191814 | Ga0105240_101918143 | 110 |
| 543 | 3300009093 | Ga0105240_10414692 | Ga0105240_104146923 | 110 |
| 544 | 3300009093 | Ga0105240_10631291 | Ga0105240_106312912 | 110 |
| 545 | 3300009093 | Ga0105240_10788834 | Ga0105240_107888342 | 110 |
| 546 | 3300009093 | Ga0105240_11085907 | Ga0105240_110859072 | 110 |
| 547 | 3300009093 | Ga0105240_11793581 | Ga0105240_117935811 | 110 |
| 548 | 3300009094 | Ga0111539_10005075 | Ga0111539_1000507511 | 110 |
| 549 | 3300009094 | Ga0111539_10183930 | Ga0111539_101839303 | 110 |
| 550 | 3300009094 | Ga0111539_10202263 | Ga0111539_102022634 | 110 |
| 551 | 3300009094 | Ga0111539_10330094 | Ga0111539_103300941 | 110 |
| 552 | 3300009094 | Ga0111539_12748337 | Ga0111539_127483371 | 110 |
| 553 | 3300009098 | Ga0105245_10141499 | Ga0105245_101414992 | 110 |
| 554 | 3300009098 | Ga0105245_10632875 | Ga0105245_106328752 | 110 |
| 555 | 3300009098 | Ga0105245_10794307 | Ga0105245_107943072 | 110 |
| 556 | 3300009098 | Ga0105245_11623836 | Ga0105245_116238362 | 110 |
| 557 | 3300009098 | Ga0105245_11756378 | Ga0105245_117563782 | 110 |
| 558 | 3300009098 | Ga0105245_12317311 | Ga0105245_123173112 | 110 |
| 559 | 3300009101 | Ga0105247_10007521 | Ga0105247_1000752112 | 110 |
| 560 | 3300009101 | Ga0105247_10164911 | Ga0105247_101649113 | 110 |
| 561 | 3300009101 | Ga0105247_10320588 | Ga0105247_103205881 | 110 |
| 562 | 3300009101 | Ga0105247_10459888 | Ga0105247_104598882 | 110 |
| 563 | 3300009101 | Ga0105247_11150293 | Ga0105247_111502931 | 110 |
| 564 | 3300009147 | Ga0114129_10042525 | Ga0114129_100425259 | 110 |
| 565 | 3300009147 | Ga0114129_10114657 | Ga0114129_101146574 | 110 |
| 566 | 3300009147 | Ga0114129_10254718 | Ga0114129_102547184 | 110 |
| 567 | 3300009147 | Ga0114129_10369332 | Ga0114129_103693321 | 110 |
| 568 | 3300009147 | Ga0114129_10670883 | Ga0114129_106708832 | 110 |
| 569 | 3300009147 | Ga0114129_11304227 | Ga0114129_113042271 | 110 |
| 570 | 3300009147 | Ga0114129_11420163 | Ga0114129_114201632 | 110 |
| 571 | 3300009147 | Ga0114129_11578951 | Ga0114129_115789512 | 110 |
| 572 | 3300009148 | Ga0105243_10077421 | Ga0105243_100774212 | 110 |
| 573 | 3300009148 | Ga0105243_10145993 | Ga0105243_101459932 | 110 |
| 574 | 3300009148 | Ga0105243_10155782 | Ga0105243_101557823 | 110 |
| 575 | 3300009148 | Ga0105243_10229866 | Ga0105243_102298663 | 110 |
| 576 | 3300009148 | Ga0105243_10256448 | Ga0105243_102564481 | 110 |
| 577 | 3300009148 | Ga0105243_10582045 | Ga0105243_105820452 | 110 |
| 578 | 3300009148 | Ga0105243_10860073 | Ga0105243_108600732 | 110 |
| 579 | 3300009174 | Ga0105241_10019245 | Ga0105241_100192457 | 110 |
| 580 | 3300009174 | Ga0105241_10021776 | Ga0105241_100217763 | 110 |
| 581 | 3300009174 | Ga0105241_10046782 | Ga0105241_100467823 | 110 |
| 582 | 3300009174 | Ga0105241_10064366 | Ga0105241_100643663 | 110 |
| 583 | 3300009174 | Ga0105241_10109925 | Ga0105241_101099252 | 110 |
| 584 | 3300009174 | Ga0105241_10206882 | Ga0105241_102068821 | 110 |
| 585 | 3300009174 | Ga0105241_10222574 | Ga0105241_102225743 | 110 |
| 586 | 3300009174 | Ga0105241_10457453 | Ga0105241_104574531 | 110 |
| 587 | 3300009174 | Ga0105241_10482575 | Ga0105241_104825751 | 110 |
| 588 | 3300009174 | Ga0105241_11136046 | Ga0105241_111360463 | 110 |
| 589 | 3300009174 | Ga0105241_11346875 | Ga0105241_113468751 | 110 |
| 590 | 3300009174 | Ga0105241_11497352 | Ga0105241_114973522 | 110 |
| 591 | 3300009174 | Ga0105241_11797002 | Ga0105241_117970021 | 110 |
| 592 | 3300009174 | Ga0105241_11870419 | Ga0105241_118704191 | 110 |
| 593 | 3300009176 | Ga0105242_10002192 | Ga0105242_100021928 | 110 |
| 594 | 3300009176 | Ga0105242_10062185 | Ga0105242_100621854 | 110 |
| 595 | 3300009176 | Ga0105242_10207593 | Ga0105242_102075932 | 110 |
| 596 | 3300009176 | Ga0105242_10358283 | Ga0105242_103582832 | 110 |
| 597 | 3300009176 | Ga0105242_10486482 | Ga0105242_104864821 | 110 |
| 598 | 3300009176 | Ga0105242_11017506 | Ga0105242_110175061 | 110 |
| 599 | 3300009176 | Ga0105242_11404069 | Ga0105242_114040691 | 110 |
| 600 | 3300009176 | Ga0105242_13196653 | Ga0105242_131966532 | 110 |
| 601 | 3300009177 | Ga0105248_10007251 | Ga0105248_1000725110 | 110 |
| 602 | 3300009177 | Ga0105248_10016118 | Ga0105248_100161181 | 110 |
| 603 | 3300009177 | Ga0105248_10033803 | Ga0105248_100338033 | 110 |
| 604 | 3300009177 | Ga0105248_10033984 | Ga0105248_100339842 | 110 |
| 605 | 3300009177 | Ga0105248_10088802 | Ga0105248_100888026 | 110 |
| 606 | 3300009177 | Ga0105248_10480322 | Ga0105248_104803222 | 110 |
| 607 | 3300009177 | Ga0105248_10725191 | Ga0105248_107251912 | 110 |
| 608 | 3300009177 | Ga0105248_11331488 | Ga0105248_113314881 | 110 |
| 609 | 3300009177 | Ga0105248_11336314 | Ga0105248_113363141 | 110 |
| 610 | 3300009177 | Ga0105248_12531862 | Ga0105248_125318621 | 110 |
| 611 | 3300009545 | Ga0105237_10019745 | Ga0105237_100197455 | 110 |
| 612 | 3300009545 | Ga0105237_10296177 | Ga0105237_102961773 | 110 |
| 613 | 3300009545 | Ga0105237_10723382 | Ga0105237_107233821 | 110 |
| 614 | 3300009545 | Ga0105237_10878241 | Ga0105237_108782413 | 110 |
| 615 | 3300009545 | Ga0105237_11104178 | Ga0105237_111041781 | 110 |
| 616 | 3300009551 | Ga0105238_10008842 | Ga0105238_1000884211 | 110 |
| 617 | 3300009551 | Ga0105238_10104368 | Ga0105238_101043683 | 110 |
| 618 | 3300009551 | Ga0105238_10635478 | Ga0105238_106354782 | 110 |
| 619 | 3300009551 | Ga0105238_11234438 | Ga0105238_112344382 | 110 |
| 620 | 3300009553 | Ga0105249_10000052 | Ga0105249_1000005288 | 110 |
| 621 | 3300009553 | Ga0105249_10004897 | Ga0105249_100048976 | 110 |
| 622 | 3300009553 | Ga0105249_10009805 | Ga0105249_100098052 | 110 |
| 623 | 3300009553 | Ga0105249_10017459 | Ga0105249_100174594 | 110 |
| 624 | 3300009553 | Ga0105249_10022390 | Ga0105249_100223902 | 110 |
| 625 | 3300009553 | Ga0105249_10411487 | Ga0105249_104114872 | 110 |
| 626 | 3300009553 | Ga0105249_10508093 | Ga0105249_105080932 | 110 |
| 627 | 3300009553 | Ga0105249_12386081 | Ga0105249_123860811 | 110 |
| 628 | 3300009553 | Ga0105249_12622480 | Ga0105249_126224801 | 110 |
| 629 | 3300010375 | Ga0105239_10116098 | Ga0105239_101160983 | 110 |
| 630 | 3300010375 | Ga0105239_10303061 | Ga0105239_103030611 | 110 |
| 631 | 3300010375 | Ga0105239_10908791 | Ga0105239_109087912 | 110 |
| 632 | 3300010375 | Ga0105239_11743326 | Ga0105239_117433261 | 110 |
| 633 | 3300010375 | Ga0105239_11845581 | Ga0105239_118455812 | 110 |
| 634 | 3300011119 | Ga0105246_10019006 | Ga0105246_100190063 | 110 |
| 635 | 3300011119 | Ga0105246_10041615 | Ga0105246_100416152 | 110 |
| 636 | 3300011119 | Ga0105246_10079138 | Ga0105246_100791383 | 110 |
| 637 | 3300011119 | Ga0105246_10094377 | Ga0105246_100943773 | 110 |
| 638 | 3300011119 | Ga0105246_10111502 | Ga0105246_101115023 | 110 |
| 639 | 3300011119 | Ga0105246_10292357 | Ga0105246_102923571 | 110 |
| 640 | 3300011119 | Ga0105246_10419796 | Ga0105246_104197962 | 110 |
| 641 | 3300011119 | Ga0105246_10424657 | Ga0105246_104246572 | 110 |
| 642 | 3300011119 | Ga0105246_10716314 | Ga0105246_107163142 | 110 |
| 643 | 3300012513 | Ga0157326_1086845 | Ga0157326_10868451 | 110 |
| 644 | 3300013100 | Ga0157373_10016111 | Ga0157373_100161113 | 110 |
| 645 | 3300013100 | Ga0157373_10031501 | Ga0157373_100315015 | 110 |
| 646 | 3300013100 | Ga0157373_10033790 | Ga0157373_100337904 | 110 |
| 647 | 3300013100 | Ga0157373_10136178 | Ga0157373_101361781 | 110 |
| 648 | 3300013100 | Ga0157373_10520132 | Ga0157373_105201321 | 110 |
| 649 | 3300013100 | Ga0157373_11499500 | Ga0157373_114995001 | 110 |
| 650 | 3300013102 | Ga0157371_10450589 | Ga0157371_104505891 | 110 |
| 651 | 3300013296 | Ga0157374_10015970 | Ga0157374_100159706 | 110 |
| 652 | 3300013296 | Ga0157374_10135043 | Ga0157374_101350431 | 110 |
| 653 | 3300013296 | Ga0157374_11340551 | Ga0157374_113405511 | 110 |
| 654 | 3300013296 | Ga0157374_11556776 | Ga0157374_115567762 | 110 |
| 655 | 3300013297 | Ga0157378_10001282 | Ga0157378_1000128211 | 110 |
| 656 | 3300013297 | Ga0157378_10003380 | Ga0157378_100033808 | 110 |
| 657 | 3300013297 | Ga0157378_10086410 | Ga0157378_100864104 | 110 |
| 658 | 3300013297 | Ga0157378_10307296 | Ga0157378_103072961 | 110 |
| 659 | 3300013297 | Ga0157378_10408909 | Ga0157378_104089092 | 110 |
| 660 | 3300013297 | Ga0157378_10535751 | Ga0157378_105357512 | 110 |
| 661 | 3300013297 | Ga0157378_10821345 | Ga0157378_108213452 | 110 |
| 662 | 3300013297 | Ga0157378_10913835 | Ga0157378_109138351 | 110 |
| 663 | 3300013297 | Ga0157378_10981057 | Ga0157378_109810572 | 110 |
| 664 | 3300013297 | Ga0157378_11284888 | Ga0157378_112848881 | 110 |
| 665 | 3300013297 | Ga0157378_11297086 | Ga0157378_112970862 | 110 |
| 666 | 3300013297 | Ga0157378_11646753 | Ga0157378_116467531 | 110 |
| 667 | 3300013297 | Ga0157378_11876248 | Ga0157378_118762481 | 110 |
| 668 | 3300013297 | Ga0157378_11930256 | Ga0157378_119302561 | 110 |
| 669 | 3300013297 | Ga0157378_12607041 | Ga0157378_126070412 | 110 |
| 670 | 3300013306 | Ga0163162_10000001 | Ga0163162_10000001600 | 110 |
| 671 | 3300013306 | Ga0163162_10009010 | Ga0163162_100090102 | 110 |
| 672 | 3300013306 | Ga0163162_10012811 | Ga0163162_100128117 | 110 |
| 673 | 3300013306 | Ga0163162_10044633 | Ga0163162_100446334 | 110 |
| 674 | 3300013306 | Ga0163162_10149517 | Ga0163162_101495173 | 110 |
| 675 | 3300013306 | Ga0163162_10618230 | Ga0163162_106182302 | 110 |
| 676 | 3300013306 | Ga0163162_11200497 | Ga0163162_112004971 | 110 |
| 677 | 3300013306 | Ga0163162_11479821 | Ga0163162_114798212 | 110 |
| 678 | 3300013306 | Ga0163162_11548231 | Ga0163162_115482311 | 110 |
| 679 | 3300013307 | Ga0157372_10031386 | Ga0157372_100313867 | 110 |
| 680 | 3300013307 | Ga0157372_10971521 | Ga0157372_109715212 | 110 |
| 681 | 3300013307 | Ga0157372_11419886 | Ga0157372_114198861 | 110 |
| 682 | 3300013307 | Ga0157372_11806124 | Ga0157372_118061242 | 110 |
| 683 | 3300013307 | Ga0157372_12637697 | Ga0157372_126376971 | 110 |
| 684 | 3300013308 | Ga0157375_10004418 | Ga0157375_1000441811 | 110 |
| 685 | 3300013308 | Ga0157375_10066922 | Ga0157375_100669221 | 110 |
| 686 | 3300013308 | Ga0157375_10198777 | Ga0157375_101987772 | 110 |
| 687 | 3300013308 | Ga0157375_10262499 | Ga0157375_102624991 | 110 |
| 688 | 3300013308 | Ga0157375_10336605 | Ga0157375_103366053 | 110 |
| 689 | 3300013308 | Ga0157375_10511728 | Ga0157375_105117282 | 110 |
| 690 | 3300013308 | Ga0157375_11127453 | Ga0157375_111274531 | 110 |
| 691 | 3300013308 | Ga0157375_11196087 | Ga0157375_111960872 | 110 |
| 692 | 3300013308 | Ga0157375_11350255 | Ga0157375_113502551 | 110 |
| 693 | 3300013308 | Ga0157375_11785373 | Ga0157375_117853731 | 110 |
| 694 | 3300013308 | Ga0157375_12442601 | Ga0157375_124426012 | 110 |
| 695 | 3300013308 | Ga0157375_12647574 | Ga0157375_126475741 | 110 |
| 696 | 3300014325 | Ga0163163_10001533 | Ga0163163_1000153325 | 110 |
| 697 | 3300014325 | Ga0163163_10001831 | Ga0163163_1000183113 | 110 |
| 698 | 3300014325 | Ga0163163_10007435 | Ga0163163_100074357 | 110 |
| 699 | 3300014325 | Ga0163163_10132213 | Ga0163163_101322133 | 110 |
| 700 | 3300014325 | Ga0163163_10207137 | Ga0163163_102071371 | 110 |
| 701 | 3300014325 | Ga0163163_10220860 | Ga0163163_102208602 | 110 |
| 702 | 3300014325 | Ga0163163_10268419 | Ga0163163_102684192 | 110 |
| 703 | 3300014325 | Ga0163163_10310393 | Ga0163163_103103932 | 110 |
| 704 | 3300014325 | Ga0163163_10312194 | Ga0163163_103121941 | 110 |
| 705 | 3300014325 | Ga0163163_10340679 | Ga0163163_103406792 | 110 |
| 706 | 3300014325 | Ga0163163_10370662 | Ga0163163_103706623 | 110 |
| 707 | 3300014325 | Ga0163163_10421034 | Ga0163163_104210342 | 110 |
| 708 | 3300014325 | Ga0163163_10684469 | Ga0163163_106844692 | 110 |
| 709 | 3300014325 | Ga0163163_10931140 | Ga0163163_109311402 | 110 |
| 710 | 3300014325 | Ga0163163_11748079 | Ga0163163_117480792 | 110 |
| 711 | 3300014325 | Ga0163163_12017930 | Ga0163163_120179301 | 110 |
| 712 | 3300014326 | Ga0157380_10001205 | Ga0157380_100012059 | 110 |
| 713 | 3300014326 | Ga0157380_10017030 | Ga0157380_100170302 | 110 |
| 714 | 3300014326 | Ga0157380_10034148 | Ga0157380_100341485 | 110 |
| 715 | 3300014326 | Ga0157380_10041006 | Ga0157380_100410063 | 110 |
| 716 | 3300014326 | Ga0157380_10270971 | Ga0157380_102709712 | 110 |
| 717 | 3300014326 | Ga0157380_10504538 | Ga0157380_105045382 | 110 |
| 718 | 3300014326 | Ga0157380_10593595 | Ga0157380_105935952 | 110 |
| 719 | 3300014326 | Ga0157380_11151082 | Ga0157380_111510822 | 110 |
| 720 | 3300014326 | Ga0157380_11965845 | Ga0157380_119658451 | 110 |
| 721 | 3300014326 | Ga0157380_12322664 | Ga0157380_123226642 | 110 |
| 722 | 3300014326 | Ga0157380_12453947 | Ga0157380_124539471 | 110 |
| 723 | 3300014745 | Ga0157377_10183115 | Ga0157377_101831152 | 110 |
| 724 | 3300014745 | Ga0157377_10192309 | Ga0157377_101923092 | 110 |
| 725 | 3300014745 | Ga0157377_10301550 | Ga0157377_103015502 | 110 |
| 726 | 3300014968 | Ga0157379_10025079 | Ga0157379_100250795 | 110 |
| 727 | 3300014968 | Ga0157379_10290117 | Ga0157379_102901172 | 110 |
| 728 | 3300014968 | Ga0157379_10607894 | Ga0157379_106078943 | 110 |
| 729 | 3300014968 | Ga0157379_11001281 | Ga0157379_110012812 | 110 |
| 730 | 3300014968 | Ga0157379_12451966 | Ga0157379_124519661 | 110 |
| 731 | 3300014969 | Ga0157376_10014842 | Ga0157376_100148424 | 110 |
| 732 | 3300014969 | Ga0157376_10906771 | Ga0157376_109067711 | 110 |
| 733 | 3300014969 | Ga0157376_12131772 | Ga0157376_121317721 | 110 |
| 734 | 3300015265 | Ga0182005_1188179 | Ga0182005_11881792 | 110 |
| 735 | 3300017792 | Ga0163161_10032403 | Ga0163161_100324033 | 110 |
| 736 | 3300017792 | Ga0163161_11040389 | Ga0163161_110403892 | 110 |
| 737 | 3300021384 | Ga0213876_10000355 | Ga0213876_100003554 | 110 |
| 738 | 3300021384 | Ga0213876_10013377 | Ga0213876_100133772 | 110 |
| 739 | 3300025315 | Ga0207697_10013752 | Ga0207697_100137522 | 110 |
| 740 | 3300025315 | Ga0207697_10453508 | Ga0207697_104535081 | 110 |
| 741 | 3300025321 | Ga0207656_10456840 | Ga0207656_104568402 | 110 |
| 742 | 3300025885 | Ga0207653_10198873 | Ga0207653_101988732 | 110 |
| 743 | 3300025885 | Ga0207653_10394520 | Ga0207653_103945201 | 110 |
| 744 | 3300025893 | Ga0207682_10236035 | Ga0207682_102360351 | 110 |
| 745 | 3300025893 | Ga0207682_10297446 | Ga0207682_102974462 | 110 |
| 746 | 3300025899 | Ga0207642_10288671 | Ga0207642_102886712 | 110 |
| 747 | 3300025899 | Ga0207642_11009843 | Ga0207642_110098431 | 110 |
| 748 | 3300025901 | Ga0207688_10080312 | Ga0207688_100803123 | 110 |
| 749 | 3300025901 | Ga0207688_10664907 | Ga0207688_106649072 | 110 |
| 750 | 3300025901 | Ga0207688_10712843 | Ga0207688_107128432 | 110 |
| 751 | 3300025903 | Ga0207680_10062476 | Ga0207680_100624763 | 110 |
| 752 | 3300025904 | Ga0207647_10084981 | Ga0207647_100849812 | 110 |
| 753 | 3300025904 | Ga0207647_10233759 | Ga0207647_102337592 | 110 |
| 754 | 3300025904 | Ga0207647_10556535 | Ga0207647_105565351 | 110 |
| 755 | 3300025904 | Ga0207647_10585535 | Ga0207647_105855351 | 110 |
| 756 | 3300025907 | Ga0207645_10034311 | Ga0207645_100343111 | 110 |
| 757 | 3300025907 | Ga0207645_10348438 | Ga0207645_103484382 | 110 |
| 758 | 3300025907 | Ga0207645_10574935 | Ga0207645_105749352 | 110 |
| 759 | 3300025908 | Ga0207643_10007213 | Ga0207643_100072138 | 110 |
| 760 | 3300025908 | Ga0207643_10010917 | Ga0207643_100109176 | 110 |
| 761 | 3300025908 | Ga0207643_10228242 | Ga0207643_102282422 | 110 |
| 762 | 3300025908 | Ga0207643_10398919 | Ga0207643_103989192 | 110 |
| 763 | 3300025908 | Ga0207643_10838481 | Ga0207643_108384811 | 110 |
| 764 | 3300025910 | Ga0207684_10007353 | Ga0207684_100073537 | 110 |
| 765 | 3300025910 | Ga0207684_10027931 | Ga0207684_100279312 | 110 |
| 766 | 3300025910 | Ga0207684_10089034 | Ga0207684_100890344 | 110 |
| 767 | 3300025910 | Ga0207684_10116395 | Ga0207684_101163953 | 110 |
| 768 | 3300025910 | Ga0207684_10447954 | Ga0207684_104479542 | 110 |
| 769 | 3300025911 | Ga0207654_10021305 | Ga0207654_100213054 | 110 |
| 770 | 3300025911 | Ga0207654_10024471 | Ga0207654_100244714 | 110 |
| 771 | 3300025911 | Ga0207654_10081241 | Ga0207654_100812414 | 110 |
| 772 | 3300025911 | Ga0207654_10375203 | Ga0207654_103752032 | 110 |
| 773 | 3300025911 | Ga0207654_10638415 | Ga0207654_106384151 | 110 |
| 774 | 3300025911 | Ga0207654_10751407 | Ga0207654_107514071 | 110 |
| 775 | 3300025911 | Ga0207654_10874236 | Ga0207654_108742361 | 110 |
| 776 | 3300025912 | Ga0207707_10046482 | Ga0207707_100464824 | 110 |
| 777 | 3300025912 | Ga0207707_10085543 | Ga0207707_100855434 | 110 |
| 778 | 3300025913 | Ga0207695_10407813 | Ga0207695_104078133 | 110 |
| 779 | 3300025913 | Ga0207695_10895571 | Ga0207695_108955711 | 110 |
| 780 | 3300025913 | Ga0207695_11705591 | Ga0207695_117055912 | 110 |
| 781 | 3300025914 | Ga0207671_10386649 | Ga0207671_103866494 | 110 |
| 782 | 3300025914 | Ga0207671_10495067 | Ga0207671_104950672 | 110 |
| 783 | 3300025914 | Ga0207671_10799703 | Ga0207671_107997031 | 110 |
| 784 | 3300025914 | Ga0207671_10817099 | Ga0207671_108170992 | 110 |
| 785 | 3300025917 | Ga0207660_10054047 | Ga0207660_100540472 | 110 |
| 786 | 3300025917 | Ga0207660_10378477 | Ga0207660_103784771 | 110 |
| 787 | 3300025917 | Ga0207660_10627322 | Ga0207660_106273222 | 110 |
| 788 | 3300025917 | Ga0207660_10697038 | Ga0207660_106970382 | 110 |
| 789 | 3300025918 | Ga0207662_10003190 | Ga0207662_100031903 | 110 |
| 790 | 3300025918 | Ga0207662_10017971 | Ga0207662_100179715 | 110 |
| 791 | 3300025918 | Ga0207662_10021969 | Ga0207662_100219691 | 110 |
| 792 | 3300025918 | Ga0207662_10112076 | Ga0207662_101120762 | 110 |
| 793 | 3300025918 | Ga0207662_10113569 | Ga0207662_101135693 | 110 |
| 794 | 3300025918 | Ga0207662_10311410 | Ga0207662_103114102 | 110 |
| 795 | 3300025919 | Ga0207657_10133707 | Ga0207657_101337071 | 110 |
| 796 | 3300025921 | Ga0207652_10038997 | Ga0207652_100389975 | 110 |
| 797 | 3300025921 | Ga0207652_10126285 | Ga0207652_101262853 | 110 |
| 798 | 3300025921 | Ga0207652_11560473 | Ga0207652_115604732 | 110 |
| 799 | 3300025922 | Ga0207646_10102864 | Ga0207646_101028643 | 110 |
| 800 | 3300025922 | Ga0207646_10361169 | Ga0207646_103611692 | 110 |
| 801 | 3300025922 | Ga0207646_11520278 | Ga0207646_115202781 | 110 |
| 802 | 3300025922 | Ga0207646_11917737 | Ga0207646_119177371 | 110 |
| 803 | 3300025923 | Ga0207681_10001745 | Ga0207681_100017454 | 110 |
| 804 | 3300025923 | Ga0207681_10005262 | Ga0207681_100052627 | 110 |
| 805 | 3300025923 | Ga0207681_10011079 | Ga0207681_100110796 | 110 |
| 806 | 3300025923 | Ga0207681_10173897 | Ga0207681_101738971 | 110 |
| 807 | 3300025923 | Ga0207681_10690261 | Ga0207681_106902612 | 110 |
| 808 | 3300025923 | Ga0207681_10840511 | Ga0207681_108405112 | 110 |
| 809 | 3300025923 | Ga0207681_11631206 | Ga0207681_116312061 | 110 |
| 810 | 3300025924 | Ga0207694_10020544 | Ga0207694_100205444 | 110 |
| 811 | 3300025924 | Ga0207694_10087086 | Ga0207694_100870863 | 110 |
| 812 | 3300025924 | Ga0207694_10592267 | Ga0207694_105922672 | 110 |
| 813 | 3300025924 | Ga0207694_11395115 | Ga0207694_113951152 | 110 |
| 814 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001216 | 110 |
| 815 | 3300025925 | Ga0207650_10122387 | Ga0207650_101223873 | 110 |
| 816 | 3300025925 | Ga0207650_10239752 | Ga0207650_102397521 | 110 |
| 817 | 3300025925 | Ga0207650_10454063 | Ga0207650_104540632 | 110 |
| 818 | 3300025925 | Ga0207650_10502487 | Ga0207650_105024872 | 110 |
| 819 | 3300025925 | Ga0207650_10510627 | Ga0207650_105106272 | 110 |
| 820 | 3300025925 | Ga0207650_10702916 | Ga0207650_107029162 | 110 |
| 821 | 3300025925 | Ga0207650_10875432 | Ga0207650_108754322 | 110 |
| 822 | 3300025926 | Ga0207659_10059289 | Ga0207659_100592893 | 110 |
| 823 | 3300025926 | Ga0207659_10298746 | Ga0207659_102987463 | 110 |
| 824 | 3300025926 | Ga0207659_10485962 | Ga0207659_104859621 | 110 |
| 825 | 3300025926 | Ga0207659_11041545 | Ga0207659_110415452 | 110 |
| 826 | 3300025926 | Ga0207659_11413124 | Ga0207659_114131242 | 110 |
| 827 | 3300025927 | Ga0207687_10325267 | Ga0207687_103252672 | 110 |
| 828 | 3300025927 | Ga0207687_10499295 | Ga0207687_104992952 | 110 |
| 829 | 3300025927 | Ga0207687_11360645 | Ga0207687_113606451 | 110 |
| 830 | 3300025931 | Ga0207644_10024830 | Ga0207644_100248302 | 110 |
| 831 | 3300025931 | Ga0207644_10115193 | Ga0207644_101151933 | 110 |
| 832 | 3300025932 | Ga0207690_10214084 | Ga0207690_102140842 | 110 |
| 833 | 3300025932 | Ga0207690_11012654 | Ga0207690_110126541 | 110 |
| 834 | 3300025933 | Ga0207706_10062945 | Ga0207706_100629454 | 110 |
| 835 | 3300025933 | Ga0207706_10335404 | Ga0207706_103354042 | 110 |
| 836 | 3300025933 | Ga0207706_10633594 | Ga0207706_106335941 | 110 |
| 837 | 3300025933 | Ga0207706_11337085 | Ga0207706_113370852 | 110 |
| 838 | 3300025934 | Ga0207686_10033667 | Ga0207686_100336673 | 110 |
| 839 | 3300025934 | Ga0207686_10072162 | Ga0207686_100721623 | 110 |
| 840 | 3300025934 | Ga0207686_10074054 | Ga0207686_100740542 | 110 |
| 841 | 3300025934 | Ga0207686_10546754 | Ga0207686_105467541 | 110 |
| 842 | 3300025935 | Ga0207709_10037714 | Ga0207709_100377142 | 110 |
| 843 | 3300025935 | Ga0207709_10066783 | Ga0207709_100667833 | 110 |
| 844 | 3300025935 | Ga0207709_10167894 | Ga0207709_101678942 | 110 |
| 845 | 3300025935 | Ga0207709_11205968 | Ga0207709_112059682 | 110 |
| 846 | 3300025936 | Ga0207670_10000250 | Ga0207670_1000025012 | 110 |
| 847 | 3300025936 | Ga0207670_10060445 | Ga0207670_100604454 | 110 |
| 848 | 3300025936 | Ga0207670_10161749 | Ga0207670_101617492 | 110 |
| 849 | 3300025936 | Ga0207670_10245468 | Ga0207670_102454682 | 110 |
| 850 | 3300025936 | Ga0207670_10518059 | Ga0207670_105180592 | 110 |
| 851 | 3300025936 | Ga0207670_11267194 | Ga0207670_112671941 | 110 |
| 852 | 3300025936 | Ga0207670_11662353 | Ga0207670_116623531 | 110 |
| 853 | 3300025937 | Ga0207669_10110184 | Ga0207669_101101842 | 110 |
| 854 | 3300025937 | Ga0207669_11510085 | Ga0207669_115100851 | 110 |
| 855 | 3300025938 | Ga0207704_10109975 | Ga0207704_101099753 | 110 |
| 856 | 3300025938 | Ga0207704_10294809 | Ga0207704_102948092 | 110 |
| 857 | 3300025938 | Ga0207704_11134156 | Ga0207704_111341561 | 110 |
| 858 | 3300025939 | Ga0207665_10010591 | Ga0207665_100105917 | 110 |
| 859 | 3300025940 | Ga0207691_10001421 | Ga0207691_100014216 | 110 |
| 860 | 3300025940 | Ga0207691_10249155 | Ga0207691_102491552 | 110 |
| 861 | 3300025940 | Ga0207691_10265369 | Ga0207691_102653691 | 110 |
| 862 | 3300025940 | Ga0207691_10818876 | Ga0207691_108188761 | 110 |
| 863 | 3300025940 | Ga0207691_11218298 | Ga0207691_112182981 | 110 |
| 864 | 3300025941 | Ga0207711_10019129 | Ga0207711_100191298 | 110 |
| 865 | 3300025941 | Ga0207711_10028277 | Ga0207711_100282776 | 110 |
| 866 | 3300025941 | Ga0207711_10132721 | Ga0207711_101327213 | 110 |
| 867 | 3300025941 | Ga0207711_10159891 | Ga0207711_101598913 | 110 |
| 868 | 3300025941 | Ga0207711_10367803 | Ga0207711_103678033 | 110 |
| 869 | 3300025941 | Ga0207711_10586249 | Ga0207711_105862492 | 110 |
| 870 | 3300025941 | Ga0207711_11700855 | Ga0207711_117008551 | 110 |
| 871 | 3300025942 | Ga0207689_10002102 | Ga0207689_1000210212 | 110 |
| 872 | 3300025942 | Ga0207689_10009874 | Ga0207689_100098746 | 110 |
| 873 | 3300025942 | Ga0207689_10019251 | Ga0207689_100192516 | 110 |
| 874 | 3300025942 | Ga0207689_10085862 | Ga0207689_100858623 | 110 |
| 875 | 3300025942 | Ga0207689_10257770 | Ga0207689_102577702 | 110 |
| 876 | 3300025942 | Ga0207689_10282044 | Ga0207689_102820442 | 110 |
| 877 | 3300025942 | Ga0207689_10510964 | Ga0207689_105109641 | 110 |
| 878 | 3300025942 | Ga0207689_10542066 | Ga0207689_105420662 | 110 |
| 879 | 3300025942 | Ga0207689_10648118 | Ga0207689_106481182 | 110 |
| 880 | 3300025942 | Ga0207689_10707242 | Ga0207689_107072422 | 110 |
| 881 | 3300025942 | Ga0207689_10754913 | Ga0207689_107549132 | 110 |
| 882 | 3300025942 | Ga0207689_10788582 | Ga0207689_107885822 | 110 |
| 883 | 3300025942 | Ga0207689_10926654 | Ga0207689_109266542 | 110 |
| 884 | 3300025942 | Ga0207689_10944754 | Ga0207689_109447542 | 110 |
| 885 | 3300025942 | Ga0207689_11332472 | Ga0207689_113324721 | 110 |
| 886 | 3300025945 | Ga0207679_10106366 | Ga0207679_101063663 | 110 |
| 887 | 3300025945 | Ga0207679_10166511 | Ga0207679_101665112 | 110 |
| 888 | 3300025945 | Ga0207679_10170112 | Ga0207679_101701123 | 110 |
| 889 | 3300025945 | Ga0207679_10229146 | Ga0207679_102291462 | 110 |
| 890 | 3300025945 | Ga0207679_10277000 | Ga0207679_102770001 | 110 |
| 891 | 3300025949 | Ga0207667_10847312 | Ga0207667_108473122 | 110 |
| 892 | 3300025960 | Ga0207651_10055671 | Ga0207651_100556712 | 110 |
| 893 | 3300025960 | Ga0207651_10059925 | Ga0207651_100599253 | 110 |
| 894 | 3300025960 | Ga0207651_10294305 | Ga0207651_102943052 | 110 |
| 895 | 3300025960 | Ga0207651_10661637 | Ga0207651_106616372 | 110 |
| 896 | 3300025960 | Ga0207651_10727138 | Ga0207651_107271382 | 110 |
| 897 | 3300025960 | Ga0207651_10970417 | Ga0207651_109704172 | 110 |
| 898 | 3300025961 | Ga0207712_10000925 | Ga0207712_1000092517 | 110 |
| 899 | 3300025961 | Ga0207712_10005189 | Ga0207712_1000518910 | 110 |
| 900 | 3300025961 | Ga0207712_10060667 | Ga0207712_100606671 | 110 |
| 901 | 3300025961 | Ga0207712_10402521 | Ga0207712_104025212 | 110 |
| 902 | 3300025961 | Ga0207712_10551239 | Ga0207712_105512391 | 110 |
| 903 | 3300025972 | Ga0207668_10005063 | Ga0207668_100050638 | 110 |
| 904 | 3300025972 | Ga0207668_10757806 | Ga0207668_107578062 | 110 |
| 905 | 3300025972 | Ga0207668_10776161 | Ga0207668_107761611 | 110 |
| 906 | 3300025981 | Ga0207640_10129325 | Ga0207640_101293254 | 110 |
| 907 | 3300025981 | Ga0207640_10255625 | Ga0207640_102556253 | 110 |
| 908 | 3300025981 | Ga0207640_10265896 | Ga0207640_102658962 | 110 |
| 909 | 3300025981 | Ga0207640_10419195 | Ga0207640_104191952 | 110 |
| 910 | 3300025981 | Ga0207640_10470027 | Ga0207640_104700272 | 110 |
| 911 | 3300025981 | Ga0207640_10482314 | Ga0207640_104823143 | 110 |
| 912 | 3300025981 | Ga0207640_10848135 | Ga0207640_108481352 | 110 |
| 913 | 3300025981 | Ga0207640_11213186 | Ga0207640_112131862 | 110 |
| 914 | 3300025986 | Ga0207658_11556665 | Ga0207658_115566651 | 110 |
| 915 | 3300026023 | Ga0207677_10299601 | Ga0207677_102996012 | 110 |
| 916 | 3300026023 | Ga0207677_10732929 | Ga0207677_107329291 | 110 |
| 917 | 3300026023 | Ga0207677_11268258 | Ga0207677_112682582 | 110 |
| 918 | 3300026023 | Ga0207677_12002085 | Ga0207677_120020852 | 110 |
| 919 | 3300026035 | Ga0207703_10016211 | Ga0207703_100162115 | 110 |
| 920 | 3300026035 | Ga0207703_10102323 | Ga0207703_101023233 | 110 |
| 921 | 3300026035 | Ga0207703_10103548 | Ga0207703_101035483 | 110 |
| 922 | 3300026035 | Ga0207703_10108277 | Ga0207703_101082774 | 110 |
| 923 | 3300026035 | Ga0207703_10108349 | Ga0207703_101083492 | 110 |
| 924 | 3300026035 | Ga0207703_10134608 | Ga0207703_101346083 | 110 |
| 925 | 3300026035 | Ga0207703_10299400 | Ga0207703_102994001 | 110 |
| 926 | 3300026035 | Ga0207703_10337432 | Ga0207703_103374321 | 110 |
| 927 | 3300026035 | Ga0207703_10773934 | Ga0207703_107739342 | 110 |
| 928 | 3300026041 | Ga0207639_10130352 | Ga0207639_101303521 | 110 |
| 929 | 3300026041 | Ga0207639_10875156 | Ga0207639_108751562 | 110 |
| 930 | 3300026041 | Ga0207639_11616690 | Ga0207639_116166901 | 110 |
| 931 | 3300026041 | Ga0207639_11744465 | Ga0207639_117444652 | 110 |
| 932 | 3300026041 | Ga0207639_12095856 | Ga0207639_120958561 | 110 |
| 933 | 3300026067 | Ga0207678_10618636 | Ga0207678_106186361 | 110 |
| 934 | 3300026067 | Ga0207678_10817605 | Ga0207678_108176051 | 110 |
| 935 | 3300026075 | Ga0207708_10000196 | Ga0207708_1000019633 | 110 |
| 936 | 3300026075 | Ga0207708_10024519 | Ga0207708_100245195 | 110 |
| 937 | 3300026075 | Ga0207708_10025822 | Ga0207708_100258222 | 110 |
| 938 | 3300026075 | Ga0207708_10097546 | Ga0207708_100975461 | 110 |
| 939 | 3300026075 | Ga0207708_10167033 | Ga0207708_101670333 | 110 |
| 940 | 3300026075 | Ga0207708_10448049 | Ga0207708_104480492 | 110 |
| 941 | 3300026075 | Ga0207708_10716997 | Ga0207708_107169972 | 110 |
| 942 | 3300026078 | Ga0207702_10023166 | Ga0207702_100231664 | 110 |
| 943 | 3300026078 | Ga0207702_10865586 | Ga0207702_108655862 | 110 |
| 944 | 3300026088 | Ga0207641_10053400 | Ga0207641_100534003 | 110 |
| 945 | 3300026088 | Ga0207641_10066364 | Ga0207641_100663642 | 110 |
| 946 | 3300026088 | Ga0207641_10229101 | Ga0207641_102291012 | 110 |
| 947 | 3300026088 | Ga0207641_10235805 | Ga0207641_102358051 | 110 |
| 948 | 3300026088 | Ga0207641_10390624 | Ga0207641_103906242 | 110 |
| 949 | 3300026088 | Ga0207641_10402557 | Ga0207641_104025571 | 110 |
| 950 | 3300026088 | Ga0207641_10758443 | Ga0207641_107584432 | 110 |
| 951 | 3300026088 | Ga0207641_10774450 | Ga0207641_107744502 | 110 |
| 952 | 3300026088 | Ga0207641_11474433 | Ga0207641_114744331 | 110 |
| 953 | 3300026088 | Ga0207641_11489598 | Ga0207641_114895981 | 110 |
| 954 | 3300026088 | Ga0207641_12206487 | Ga0207641_122064871 | 110 |
| 955 | 3300026089 | Ga0207648_10025398 | Ga0207648_100253984 | 110 |
| 956 | 3300026089 | Ga0207648_10041315 | Ga0207648_100413152 | 110 |
| 957 | 3300026089 | Ga0207648_10052268 | Ga0207648_100522681 | 110 |
| 958 | 3300026089 | Ga0207648_10052499 | Ga0207648_100524993 | 110 |
| 959 | 3300026089 | Ga0207648_10085766 | Ga0207648_100857664 | 110 |
| 960 | 3300026089 | Ga0207648_10209835 | Ga0207648_102098352 | 110 |
| 961 | 3300026089 | Ga0207648_10323595 | Ga0207648_103235952 | 110 |
| 962 | 3300026089 | Ga0207648_10889543 | Ga0207648_108895432 | 110 |
| 963 | 3300026095 | Ga0207676_10003808 | Ga0207676_1000380812 | 110 |
| 964 | 3300026095 | Ga0207676_10022718 | Ga0207676_100227184 | 110 |
| 965 | 3300026095 | Ga0207676_10037473 | Ga0207676_100374735 | 110 |
| 966 | 3300026095 | Ga0207676_10057488 | Ga0207676_100574884 | 110 |
| 967 | 3300026095 | Ga0207676_10135355 | Ga0207676_101353552 | 110 |
| 968 | 3300026095 | Ga0207676_10205522 | Ga0207676_102055223 | 110 |
| 969 | 3300026095 | Ga0207676_10358770 | Ga0207676_103587701 | 110 |
| 970 | 3300026095 | Ga0207676_10376937 | Ga0207676_103769372 | 110 |
| 971 | 3300026095 | Ga0207676_10700037 | Ga0207676_107000372 | 110 |
| 972 | 3300026095 | Ga0207676_10750417 | Ga0207676_107504172 | 110 |
| 973 | 3300026095 | Ga0207676_10767034 | Ga0207676_107670342 | 110 |
| 974 | 3300026095 | Ga0207676_10779227 | Ga0207676_107792272 | 110 |
| 975 | 3300026095 | Ga0207676_10813426 | Ga0207676_108134261 | 110 |
| 976 | 3300026095 | Ga0207676_11488444 | Ga0207676_114884442 | 110 |
| 977 | 3300026095 | Ga0207676_12000387 | Ga0207676_120003871 | 110 |
| 978 | 3300026095 | Ga0207676_12101541 | Ga0207676_121015411 | 110 |
| 979 | 3300026116 | Ga0207674_10001115 | Ga0207674_1000111523 | 110 |
| 980 | 3300026116 | Ga0207674_10033931 | Ga0207674_100339314 | 110 |
| 981 | 3300026116 | Ga0207674_10141200 | Ga0207674_101412003 | 110 |
| 982 | 3300026116 | Ga0207674_10303859 | Ga0207674_103038592 | 110 |
| 983 | 3300026116 | Ga0207674_10308047 | Ga0207674_103080472 | 110 |
| 984 | 3300026116 | Ga0207674_10453802 | Ga0207674_104538023 | 110 |
| 985 | 3300026116 | Ga0207674_10564187 | Ga0207674_105641872 | 110 |
| 986 | 3300026116 | Ga0207674_10575997 | Ga0207674_105759971 | 110 |
| 987 | 3300026116 | Ga0207674_10697484 | Ga0207674_106974841 | 110 |
| 988 | 3300026116 | Ga0207674_10861047 | Ga0207674_108610472 | 110 |
| 989 | 3300026116 | Ga0207674_11416742 | Ga0207674_114167422 | 110 |
| 990 | 3300026116 | Ga0207674_11433392 | Ga0207674_114333921 | 110 |
| 991 | 3300026116 | Ga0207674_11481291 | Ga0207674_114812911 | 110 |
| 992 | 3300026116 | Ga0207674_11957967 | Ga0207674_119579671 | 110 |
| 993 | 3300026118 | Ga0207675_100008300 | Ga0207675_1000083008 | 110 |
| 994 | 3300026118 | Ga0207675_100010894 | Ga0207675_1000108949 | 110 |
| 995 | 3300026118 | Ga0207675_100017343 | Ga0207675_1000173434 | 110 |
| 996 | 3300026118 | Ga0207675_100027734 | Ga0207675_1000277344 | 110 |
| 997 | 3300026118 | Ga0207675_100037404 | Ga0207675_1000374042 | 110 |
| 998 | 3300026118 | Ga0207675_100188276 | Ga0207675_1001882762 | 110 |
| 999 | 3300026118 | Ga0207675_100233282 | Ga0207675_1002332821 | 110 |
| 1000 | 3300026118 | Ga0207675_101488183 | Ga0207675_1014881831 | 110 |
| 1001 | 3300026121 | Ga0207683_10622903 | Ga0207683_106229032 | 110 |
| 1002 | 3300026121 | Ga0207683_10870574 | Ga0207683_108705742 | 110 |
| 1003 | 3300026142 | Ga0207698_10201010 | Ga0207698_102010102 | 110 |
| 1004 | 3300026142 | Ga0207698_10420263 | Ga0207698_104202632 | 110 |
| 1005 | 3300026142 | Ga0207698_10490958 | Ga0207698_104909582 | 110 |
| 1006 | 3300026142 | Ga0207698_10636677 | Ga0207698_106366772 | 110 |
| 1007 | 3300026142 | Ga0207698_11330789 | Ga0207698_113307891 | 110 |
| 1008 | 3300026142 | Ga0207698_11516620 | Ga0207698_115166201 | 110 |
| 1009 | 3300027907 | Ga0207428_10003589 | Ga0207428_1000358911 | 110 |
| 1010 | 3300027907 | Ga0207428_10144878 | Ga0207428_101448783 | 110 |
| 1011 | 3300028379 | Ga0268266_11929848 | Ga0268266_119298481 | 110 |
| 1012 | 3300028380 | Ga0268265_10131993 | Ga0268265_101319933 | 110 |
| 1013 | 3300028380 | Ga0268265_10160070 | Ga0268265_101600703 | 110 |
| 1014 | 3300028380 | Ga0268265_10223551 | Ga0268265_102235513 | 110 |
| 1015 | 3300028380 | Ga0268265_10247986 | Ga0268265_102479861 | 110 |
| 1016 | 3300028380 | Ga0268265_10412166 | Ga0268265_104121661 | 110 |
| 1017 | 3300028380 | Ga0268265_10685754 | Ga0268265_106857542 | 110 |
| 1018 | 3300028380 | Ga0268265_11058294 | Ga0268265_110582941 | 110 |
| 1019 | 3300028380 | Ga0268265_11116515 | Ga0268265_111165152 | 110 |
| 1020 | 3300028380 | Ga0268265_11299895 | Ga0268265_112998952 | 110 |
| 1021 | 3300028380 | Ga0268265_12635367 | Ga0268265_126353672 | 110 |
| 1022 | 3300028381 | Ga0268264_10027695 | Ga0268264_100276955 | 110 |
| 1023 | 3300028381 | Ga0268264_10036791 | Ga0268264_100367911 | 110 |
| 1024 | 3300028381 | Ga0268264_10049768 | Ga0268264_100497683 | 110 |
| 1025 | 3300028381 | Ga0268264_10055988 | Ga0268264_100559885 | 110 |
| 1026 | 3300028381 | Ga0268264_10117447 | Ga0268264_101174472 | 110 |
| 1027 | 3300028381 | Ga0268264_10147987 | Ga0268264_101479872 | 110 |
| 1028 | 3300028381 | Ga0268264_10149519 | Ga0268264_101495192 | 110 |
| 1029 | 3300028381 | Ga0268264_11503126 | Ga0268264_115031262 | 110 |
| 1030 | 3300030733 | Ga0314311_1194228 | Ga0314311_11942282 | 110 |
| 1031 | 3300031548 | Ga0307408_100013384 | Ga0307408_1000133847 | 110 |
| 1032 | 3300031548 | Ga0307408_100042473 | Ga0307408_1000424732 | 110 |
| 1033 | 3300031548 | Ga0307408_100078016 | Ga0307408_1000780164 | 110 |
| 1034 | 3300031548 | Ga0307408_100133239 | Ga0307408_1001332393 | 110 |
| 1035 | 3300031548 | Ga0307408_100312757 | Ga0307408_1003127572 | 110 |
| 1036 | 3300031548 | Ga0307408_100447848 | Ga0307408_1004478482 | 110 |
| 1037 | 3300031548 | Ga0307408_100654400 | Ga0307408_1006544002 | 110 |
| 1038 | 3300031548 | Ga0307408_100994338 | Ga0307408_1009943382 | 110 |
| 1039 | 3300031548 | Ga0307408_101918147 | Ga0307408_1019181471 | 110 |
| 1040 | 3300031731 | Ga0307405_10015061 | Ga0307405_100150614 | 110 |
| 1041 | 3300031731 | Ga0307405_10018481 | Ga0307405_100184812 | 110 |
| 1042 | 3300031731 | Ga0307405_10046932 | Ga0307405_100469322 | 110 |
| 1043 | 3300031731 | Ga0307405_10415295 | Ga0307405_104152952 | 110 |
| 1044 | 3300031731 | Ga0307405_10706150 | Ga0307405_107061502 | 110 |
| 1045 | 3300031824 | Ga0307413_10036152 | Ga0307413_100361523 | 110 |
| 1046 | 3300031824 | Ga0307413_10100182 | Ga0307413_101001822 | 110 |
| 1047 | 3300031824 | Ga0307413_11238427 | Ga0307413_112384272 | 110 |
| 1048 | 3300031852 | Ga0307410_10002023 | Ga0307410_100020234 | 110 |
| 1049 | 3300031852 | Ga0307410_10061258 | Ga0307410_100612582 | 110 |
| 1050 | 3300031901 | Ga0307406_10007704 | Ga0307406_100077046 | 110 |
| 1051 | 3300031901 | Ga0307406_10092030 | Ga0307406_100920302 | 110 |
| 1052 | 3300031903 | Ga0307407_10009256 | Ga0307407_100092561 | 110 |
| 1053 | 3300031903 | Ga0307407_10061460 | Ga0307407_100614602 | 110 |
| 1054 | 3300031911 | Ga0307412_10018014 | Ga0307412_100180144 | 110 |
| 1055 | 3300031911 | Ga0307412_10215432 | Ga0307412_102154322 | 110 |
| 1056 | 3300031911 | Ga0307412_10271605 | Ga0307412_102716052 | 110 |
| 1057 | 3300031911 | Ga0307412_10458779 | Ga0307412_104587792 | 110 |
| 1058 | 3300031911 | Ga0307412_11048530 | Ga0307412_110485301 | 110 |
| 1059 | 3300031911 | Ga0307412_12140038 | Ga0307412_121400381 | 110 |
| 1060 | 3300031995 | Ga0307409_100075645 | Ga0307409_1000756453 | 110 |
| 1061 | 3300031995 | Ga0307409_100173127 | Ga0307409_1001731271 | 110 |
| 1062 | 3300031995 | Ga0307409_100603566 | Ga0307409_1006035662 | 110 |
| 1063 | 3300031995 | Ga0307409_100684462 | Ga0307409_1006844622 | 110 |
| 1064 | 3300031995 | Ga0307409_101788176 | Ga0307409_1017881762 | 110 |
| 1065 | 3300032002 | Ga0307416_100010309 | Ga0307416_1000103094 | 110 |
| 1066 | 3300032002 | Ga0307416_100172642 | Ga0307416_1001726422 | 110 |
| 1067 | 3300032002 | Ga0307416_100224473 | Ga0307416_1002244734 | 110 |
| 1068 | 3300032002 | Ga0307416_100563007 | Ga0307416_1005630072 | 110 |
| 1069 | 3300032004 | Ga0307414_10007653 | Ga0307414_100076534 | 110 |
| 1070 | 3300032004 | Ga0307414_10512349 | Ga0307414_105123491 | 110 |
| 1071 | 3300032004 | Ga0307414_10513069 | Ga0307414_105130691 | 110 |
| 1072 | 3300032004 | Ga0307414_10657281 | Ga0307414_106572811 | 110 |
| 1073 | 3300032005 | Ga0307411_10028911 | Ga0307411_100289115 | 110 |
| 1074 | 3300032005 | Ga0307411_10056612 | Ga0307411_100566124 | 110 |
| 1075 | 3300032005 | Ga0307411_10298789 | Ga0307411_102987891 | 110 |
| 1076 | 3300032126 | Ga0307415_100007828 | Ga0307415_1000078287 | 110 |
| 1077 | 3300032126 | Ga0307415_100009415 | Ga0307415_1000094152 | 110 |
| 1078 | 3300032126 | Ga0307415_100277030 | Ga0307415_1002770302 | 110 |
| 1079 | 3300032126 | Ga0307415_100792534 | Ga0307415_1007925342 | 110 |
| 1080 | 3300032126 | Ga0307415_100948819 | Ga0307415_1009488191 | 110 |
| 1081 | 3300034816 | Ga0373930_0070262 | Ga0373930_0070262_189_524 | 110 |
| 1082 | 3300035088 | Ga0373940_0092151 | Ga0373940_0092151_457_792 | 110 |
| 1083 | 3300035091 | Ga0373951_0000266 | Ga0373951_0000266_2425_2760 | 110 |
| 1084 | 3300035091 | Ga0373951_0043101 | Ga0373951_0043101_353_688 | 110 |
| 1085 | 3300035115 | Ga0373941_0009951 | Ga0373941_0009951_270_605 | 110 |
| 1086 | 3300035115 | Ga0373941_0070196 | Ga0373941_0070196_609_944 | 110 |
| 1087 | 3300035115 | Ga0373941_0101565 | Ga0373941_0101565_321_656 | 110 |
| 1088 | 3300035172 | Ga0373955_0236707 | Ga0373955_0236707_600_932 | 110 |
| 1089 | 3300035691 | Ga0373931_0134736 | Ga0373931_0134736_295_630 | 110 |
| 1090 | 3300036401 | Ga0373937_0026568 | Ga0373937_0026568_1892_2224 | 110 |
| 1091 | 3300037418 | Ga0395900_0071081 | Ga0395900_0071081_67_402 | 110 |
| 1092 | 3300037418 | Ga0395900_0174348 | Ga0395900_0174348_267_656 | 110 |
| 1093 | 3300037418 | Ga0395900_1741907 | Ga0395900_1741907_127_462 | 110 |
| 1094 | 3300037466 | Ga0395898_0042223 | Ga0395898_0042223_3457_3792 | 110 |
| 1095 | 3300037466 | Ga0395898_0689554 | Ga0395898_0689554_562_897 | 110 |
| 1096 | 3300037466 | Ga0395898_0890092 | Ga0395898_0890092_224_613 | 110 |
| 1097 | 3300037471 | Ga0395905_0001898 | Ga0395905_0001898_21151_21486 | 110 |
| 1098 | 3300037471 | Ga0395905_0149690 | Ga0395905_0149690_847_1236 | 110 |
| 1099 | 3300038443 | Ga0395901_1863149 | Ga0395901_1863149_180_515 | 110 |
| 1100 | 3300038699 | Ga0242422_00216 | Ga0242422_00216_1298_1633 | 110 |
| 1101 | 3300038996 | Ga0242420_004095 | Ga0242420_004095_92_427 | 110 |
| 1102 | 3300039437 | Ga0436365_1124199 | Ga0436365_1124199_794_1129 | 110 |
| 1103 | 3300041411 | Ga0439466_0120413 | Ga0439466_0120413_127_471 | 110 |
| 1104 | 3300041413 | Ga0439465_0407354 | Ga0439465_0407354_37_369 | 110 |
| 1105 | 3300041507 | Ga0451851_0683408 | Ga0451851_0683408_101_433 | 110 |
| 1106 | 3300042005 | Ga0439448_0113932 | Ga0439448_0113932_255_590 | 110 |
| 1107 | 3300042006 | Ga0439432_041430 | Ga0439432_041430_126_470 | 110 |
| 1108 | 3300042012 | Ga0439455_0002290 | Ga0439455_0002290_1486_1821 | 110 |
| 1109 | 3300042015 | Ga0439462_0089555 | Ga0439462_0089555_395_730 | 110 |
| 1110 | 3300042118 | Ga0450914_005011 | Ga0450914_005011_67_402 | 110 |
| 1111 | 3300042157 | Ga0439458_0001735 | Ga0439458_0001735_3121_3456 | 110 |
| 1112 | 3300042435 | Ga0439434_0077574 | Ga0439434_0077574_651_986 | 110 |
| 1113 | 3300042876 | Ga0451577_1947822 | Ga0451577_1947822_76_408 | 110 |
| 1114 | 3300045051 | Ga0451576_0548841 | Ga0451576_0548841_279_614 | 110 |
| 1115 | 3300046473 | Ga0495582_0203607 | Ga0495582_0203607_572_904 | 110 |
| 1116 | 3300046689 | Ga0495613_0236034 | Ga0495613_0236034_15_347 | 110 |
| 1117 | 3300048903 | Ga0496100_0152678 | Ga0496100_0152678_227_559 | 110 |
| 1118 | 3300048905 | Ga0496102_0011427 | Ga0496102_0011427_3289_3621 | 110 |
| 1119 | 3300048905 | Ga0496102_0116640 | Ga0496102_0116640_804_1139 | 110 |
| 1120 | 3300048905 | Ga0496102_0953668 | Ga0496102_0953668_420_755 | 110 |
| 1121 | 3300048906 | Ga0496103_0311167 | Ga0496103_0311167_317_649 | 110 |
| 1122 | 3300048907 | Ga0496104_0063329 | Ga0496104_0063329_2856_3188 | 110 |
| 1123 | 3300048907 | Ga0496104_0349306 | Ga0496104_0349306_104_439 | 110 |
| 1124 | 3300048908 | Ga0496105_0667348 | Ga0496105_0667348_268_603 | 110 |
| 1125 | 3300048909 | Ga0496106_0234795 | Ga0496106_0234795_186_521 | 110 |
| 1126 | 3300048909 | Ga0496106_0476520 | Ga0496106_0476520_441_776 | 110 |
| 1127 | 3300048909 | Ga0496106_0531911 | Ga0496106_0531911_299_631 | 110 |
| 1128 | 3300048909 | Ga0496106_1307781 | Ga0496106_1307781_107_442 | 110 |
| 1129 | 3300048911 | Ga0496108_1061094 | Ga0496108_1061094_58_393 | 110 |
| 1130 | 3300048912 | Ga0496109_0512991 | Ga0496109_0512991_394_729 | 110 |
| 1131 | 3300048912 | Ga0496109_1193651 | Ga0496109_1193651_44_379 | 110 |
| 1132 | 3300048913 | Ga0496110_0499781 | Ga0496110_0499781_668_1003 | 110 |
| 1133 | 3300048913 | Ga0496110_1019972 | Ga0496110_1019972_56_391 | 110 |
| 1134 | 3300048913 | Ga0496110_1442206 | Ga0496110_1442206_89_424 | 110 |
| 1135 | 3300048915 | Ga0496112_0025724 | Ga0496112_0025724_4093_4428 | 110 |
| 1136 | 3300048915 | Ga0496112_0162595 | Ga0496112_0162595_474_809 | 110 |
| 1137 | 3300048915 | Ga0496112_0174008 | Ga0496112_0174008_1668_2003 | 110 |
| 1138 | 3300048915 | Ga0496112_0333453 | Ga0496112_0333453_407_742 | 110 |
| 1139 | 3300048915 | Ga0496112_0561570 | Ga0496112_0561570_61_396 | 110 |
| 1140 | 3300048915 | Ga0496112_0776098 | Ga0496112_0776098_172_504 | 110 |
| 1141 | 3300048915 | Ga0496112_1227017 | Ga0496112_1227017_306_641 | 110 |
| 1142 | 3300048915 | Ga0496112_1243602 | Ga0496112_1243602_301_636 | 110 |
| 1143 | 3300048915 | Ga0496112_1340555 | Ga0496112_1340555_280_615 | 110 |
| 1144 | 3300048915 | Ga0496112_1674078 | Ga0496112_1674078_93_425 | 110 |
| 1145 | 3300048916 | Ga0496113_0232300 | Ga0496113_0232300_102_434 | 110 |
| 1146 | 3300048916 | Ga0496113_0783022 | Ga0496113_0783022_79_414 | 110 |
| 1147 | 3300048916 | Ga0496113_1238099 | Ga0496113_1238099_135_470 | 110 |
| 1148 | 3300049127 | Ga0501306_025283 | Ga0501306_025283_48_383 | 110 |
| 1149 | 3300049162 | Ga0501307_016163 | Ga0501307_016163_287_622 | 110 |
| 1150 | 3300049513 | Ga0501290_004185 | Ga0501290_004185_438_773 | 110 |
| 1151 | 3300049513 | Ga0501290_040259 | Ga0501290_040259_256_591 | 110 |
| 1152 | 3300049514 | Ga0501291_009882 | Ga0501291_009882_532_867 | 110 |
| 1153 | 3300049514 | Ga0501291_010725 | Ga0501291_010725_60_395 | 110 |
| 1154 | 3300049515 | Ga0501292_003121 | Ga0501292_003121_1568_1903 | 110 |
| 1155 | 3300049515 | Ga0501292_003124 | Ga0501292_003124_1650_1985 | 110 |
| 1156 | 3300049515 | Ga0501292_015946 | Ga0501292_015946_737_1072 | 110 |
| 1157 | 3300049518 | Ga0501295_054568 | Ga0501295_054568_310_645 | 110 |
| 1158 | 3300049518 | Ga0501295_055089 | Ga0501295_055089_108_443 | 110 |
| 1159 | 3300049519 | Ga0501296_003503 | Ga0501296_003503_103_438 | 110 |
| 1160 | 3300049519 | Ga0501296_006498 | Ga0501296_006498_535_870 | 110 |
| 1161 | 3300049520 | Ga0501297_005098 | Ga0501297_005098_506_841 | 110 |
| 1162 | 3300049520 | Ga0501297_009085 | Ga0501297_009085_160_495 | 110 |
| 1163 | 3300049520 | Ga0501297_031024 | Ga0501297_031024_295_630 | 110 |
| 1164 | 3300049521 | Ga0501298_002676 | Ga0501298_002676_1727_2062 | 110 |
| 1165 | 3300049521 | Ga0501298_041241 | Ga0501298_041241_395_730 | 110 |
| 1166 | 3300049521 | Ga0501298_072257 | Ga0501298_072257_174_509 | 110 |
| 1167 | 3300049521 | Ga0501298_135017 | Ga0501298_135017_154_486 | 110 |
| 1168 | 3300049522 | Ga0501299_000754 | Ga0501299_000754_1845_2180 | 110 |
| 1169 | 3300049522 | Ga0501299_007263 | Ga0501299_007263_433_768 | 110 |
| 1170 | 3300049522 | Ga0501299_009672 | Ga0501299_009672_776_1111 | 110 |
| 1171 | 3300049523 | Ga0501300_004680 | Ga0501300_004680_644_979 | 110 |
| 1172 | 3300049523 | Ga0501300_019111 | Ga0501300_019111_253_588 | 110 |
| 1173 | 3300049526 | Ga0501303_005503 | Ga0501303_005503_36_371 | 110 |
| 1174 | 3300049527 | Ga0501311_025714 | Ga0501311_025714_238_573 | 110 |
| 1175 | 3300049574 | Ga0501038_0032512 | Ga0501038_0032512_3673_4008 | 110 |
| 1176 | 3300049583 | Ga0501067_0638052 | Ga0501067_0638052_187_522 | 110 |
| 1177 | 3300049588 | Ga0501072_0538087 | Ga0501072_0538087_108_443 | 110 |
| 1178 | 3300049591 | Ga0501075_1329767 | Ga0501075_1329767_109_444 | 110 |
| 1179 | 3300049649 | Ga0501198_001879 | Ga0501198_001879_1000_1335 | 110 |
| 1180 | 3300049649 | Ga0501198_002730 | Ga0501198_002730_1866_2201 | 110 |
| 1181 | 3300049652 | Ga0501202_001705 | Ga0501202_001705_1850_2185 | 110 |
| 1182 | 3300049652 | Ga0501202_006175 | Ga0501202_006175_67_402 | 110 |
| 1183 | 3300049652 | Ga0501202_111111 | Ga0501202_111111_262_597 | 110 |
| 1184 | 3300049653 | Ga0501206_003365 | Ga0501206_003365_858_1193 | 110 |
| 1185 | 3300049653 | Ga0501206_015357 | Ga0501206_015357_530_865 | 110 |
| 1186 | 3300049655 | Ga0501208_004930 | Ga0501208_004930_211_546 | 110 |
| 1187 | 3300049655 | Ga0501208_005660 | Ga0501208_005660_33_368 | 110 |
| 1188 | 3300049656 | Ga0501209_020524 | Ga0501209_020524_538_873 | 110 |
| 1189 | 3300049656 | Ga0501209_038598 | Ga0501209_038598_874_1209 | 110 |
| 1190 | 3300049659 | Ga0501214_002166 | Ga0501214_002166_1263_1598 | 110 |
| 1191 | 3300049660 | Ga0501216_002071 | Ga0501216_002071_1231_1566 | 110 |
| 1192 | 3300049660 | Ga0501216_003901 | Ga0501216_003901_479_814 | 110 |
| 1193 | 3300049661 | Ga0501217_000517 | Ga0501217_000517_1880_2215 | 110 |
| 1194 | 3300049661 | Ga0501217_002052 | Ga0501217_002052_1817_2152 | 110 |
| 1195 | 3300049661 | Ga0501217_127653 | Ga0501217_127653_369_704 | 110 |
| 1196 | 3300049663 | Ga0501223_000504 | Ga0501223_000504_6648_6983 | 110 |
| 1197 | 3300049663 | Ga0501223_006582 | Ga0501223_006582_913_1248 | 110 |
| 1198 | 3300049663 | Ga0501223_033979 | Ga0501223_033979_595_930 | 110 |
| 1199 | 3300049663 | Ga0501223_057581 | Ga0501223_057581_70_405 | 110 |
| 1200 | 3300049664 | Ga0501224_003539 | Ga0501224_003539_70_405 | 110 |
| 1201 | 3300049664 | Ga0501224_014757 | Ga0501224_014757_270_605 | 110 |
| 1202 | 3300049664 | Ga0501224_063876 | Ga0501224_063876_207_542 | 110 |
| 1203 | 3300049665 | Ga0501227_000295 | Ga0501227_000295_2951_3286 | 110 |
| 1204 | 3300049665 | Ga0501227_084440 | Ga0501227_084440_102_437 | 110 |
| 1205 | 3300049667 | Ga0501230_142613 | Ga0501230_142613_24_359 | 110 |
| 1206 | 3300049668 | Ga0501233_000556 | Ga0501233_000556_3719_4054 | 110 |
| 1207 | 3300049668 | Ga0501233_005685 | Ga0501233_005685_451_786 | 110 |
| 1208 | 3300049668 | Ga0501233_016218 | Ga0501233_016218_80_415 | 110 |
| 1209 | 3300049669 | Ga0501235_000590 | Ga0501235_000590_1683_2018 | 110 |
| 1210 | 3300049669 | Ga0501235_007415 | Ga0501235_007415_1504_1839 | 110 |
| 1211 | 3300049669 | Ga0501235_047113 | Ga0501235_047113_64_399 | 110 |
| 1212 | 3300049669 | Ga0501235_121680 | Ga0501235_121680_147_482 | 110 |
| 1213 | 3300049669 | Ga0501235_201190 | Ga0501235_201190_54_386 | 110 |
| 1214 | 3300049671 | Ga0501238_019305 | Ga0501238_019305_193_528 | 110 |
| 1215 | 3300049672 | Ga0501239_001368 | Ga0501239_001368_686_1021 | 110 |
| 1216 | 3300049673 | Ga0501240_000221 | Ga0501240_000221_1291_1626 | 110 |
| 1217 | 3300049673 | Ga0501240_037710 | Ga0501240_037710_112_447 | 110 |
| 1218 | 3300049674 | Ga0501242_044378 | Ga0501242_044378_207_542 | 110 |
| 1219 | 3300049675 | Ga0501243_011012 | Ga0501243_011012_571_906 | 110 |
| 1220 | 3300049679 | Ga0501249_013420 | Ga0501249_013420_507_842 | 110 |
| 1221 | 3300049679 | Ga0501249_160157 | Ga0501249_160157_50_385 | 110 |
| 1222 | 3300049680 | Ga0501250_001921 | Ga0501250_001921_564_899 | 110 |
| 1223 | 3300049681 | Ga0501251_002794 | Ga0501251_002794_321_656 | 110 |
| 1224 | 3300049681 | Ga0501251_008926 | Ga0501251_008926_725_1060 | 110 |
| 1225 | 3300049683 | Ga0501253_001363 | Ga0501253_001363_1343_1678 | 110 |
| 1226 | 3300049683 | Ga0501253_017879 | Ga0501253_017879_170_505 | 110 |
| 1227 | 3300049683 | Ga0501253_070491 | Ga0501253_070491_84_419 | 110 |
| 1228 | 3300049686 | Ga0501257_040736 | Ga0501257_040736_233_568 | 110 |
| 1229 | 3300049686 | Ga0501257_068297 | Ga0501257_068297_383_718 | 110 |
| 1230 | 3300049686 | Ga0501257_119225 | Ga0501257_119225_188_523 | 110 |
| 1231 | 3300049688 | Ga0501259_018316 | Ga0501259_018316_394_729 | 110 |
| 1232 | 3300049688 | Ga0501259_050077 | Ga0501259_050077_366_701 | 110 |
| 1233 | 3300049689 | Ga0501260_040147 | Ga0501260_040147_189_524 | 110 |
| 1234 | 3300049704 | Ga0501221_023102 | Ga0501221_023102_685_1020 | 110 |
| 1235 | 3300049704 | Ga0501221_070746 | Ga0501221_070746_83_418 | 110 |
| 1236 | 3300049705 | Ga0501225_0000145 | Ga0501225_0000145_16000_16335 | 110 |
| 1237 | 3300049705 | Ga0501225_0042408 | Ga0501225_0042408_529_864 | 110 |
| 1238 | 3300049706 | Ga0501229_005664 | Ga0501229_005664_1043_1378 | 110 |
| 1239 | 3300049707 | Ga0501234_000075 | Ga0501234_000075_1339_1674 | 110 |
| 1240 | 3300049707 | Ga0501234_002153 | Ga0501234_002153_1640_1975 | 110 |
| 1241 | 3300049707 | Ga0501234_011417 | Ga0501234_011417_170_505 | 110 |
| 1242 | 3300049708 | Ga0501245_007712 | Ga0501245_007712_747_1082 | 110 |
| 1243 | 3300049708 | Ga0501245_012891 | Ga0501245_012891_672_1007 | 110 |
| 1244 | 3300049708 | Ga0501245_070538 | Ga0501245_070538_159_494 | 110 |
| 1245 | 3300049743 | Ga0501081_0866181 | Ga0501081_0866181_83_418 | 110 |
| 1246 | 3300049758 | Ga0501241_163592 | Ga0501241_163592_53_388 | 110 |
| 1247 | 3300049760 | Ga0501263_009001 | Ga0501263_009001_28_363 | 110 |
| 1248 | 3300049760 | Ga0501263_044794 | Ga0501263_044794_65_400 | 110 |
| 1249 | 3300049762 | Ga0501265_053833 | Ga0501265_053833_36_371 | 110 |
| 1250 | 3300049763 | Ga0501266_022281 | Ga0501266_022281_354_689 | 110 |
| 1251 | 3300049764 | Ga0501267_053164 | Ga0501267_053164_72_404 | 110 |
| 1252 | 3300049767 | Ga0501270_051266 | Ga0501270_051266_17_352 | 110 |
| 1253 | 3300049769 | Ga0501272_012536 | Ga0501272_012536_573_908 | 110 |
| 1254 | 3300049769 | Ga0501272_023309 | Ga0501272_023309_322_657 | 110 |
| 1255 | 3300049770 | Ga0501273_003589 | Ga0501273_003589_50_385 | 110 |
| 1256 | 3300049770 | Ga0501273_011933 | Ga0501273_011933_80_415 | 110 |
| 1257 | 3300049774 | Ga0501278_002788 | Ga0501278_002788_239_574 | 110 |
| 1258 | 3300049774 | Ga0501278_004265 | Ga0501278_004265_597_932 | 110 |
| 1259 | 3300049775 | Ga0501279_001580 | Ga0501279_001580_1369_1704 | 110 |
| 1260 | 3300049775 | Ga0501279_001951 | Ga0501279_001951_930_1265 | 110 |
| 1261 | 3300049779 | Ga0501283_009914 | Ga0501283_009914_619_954 | 110 |
| 1262 | 3300049779 | Ga0501283_011895 | Ga0501283_011895_793_1128 | 110 |
| 1263 | 3300049779 | Ga0501283_048461 | Ga0501283_048461_294_629 | 110 |
| 1264 | 3300049850 | Ga0501204_015500 | Ga0501204_015500_14_349 | 110 |
| 1265 | 3300049851 | Ga0501212_001962 | Ga0501212_001962_77_412 | 110 |
| 1266 | 3300049853 | Ga0501226_002189 | Ga0501226_002189_1519_1854 | 110 |
| 1267 | 3300049853 | Ga0501226_005552 | Ga0501226_005552_603_938 | 110 |
| 1268 | 3300050507 | nmdc:mga05p37_1986380_c1 | nmdc:mga05p37_1986380_c1_96_431 | 110 |
| 1269 | 3300050507 | nmdc:mga05p37_275177_c1 | nmdc:mga05p37_275177_c1_1105_1437 | 110 |
| 1270 | 3300050507 | nmdc:mga05p37_301069_c1 | nmdc:mga05p37_301069_c1_303_635 | 110 |
| 1271 | 3300050507 | nmdc:mga05p37_320629_c1 | nmdc:mga05p37_320629_c1_1383_1718 | 110 |
| 1272 | 3300050507 | nmdc:mga05p37_558118_c1 | nmdc:mga05p37_558118_c1_170_502 | 110 |
| 1273 | 3300050507 | nmdc:mga05p37_860956_c1 | nmdc:mga05p37_860956_c1_106_441 | 110 |
| 1274 | 3300050508 | nmdc:mga09592_1449450_c1 | nmdc:mga09592_1449450_c1_200_532 | 110 |
| 1275 | 3300050508 | nmdc:mga09592_440863_c1 | nmdc:mga09592_440863_c1_366_701 | 110 |
| 1276 | 3300050508 | nmdc:mga09592_71662_c1 | nmdc:mga09592_71662_c1_1287_1619 | 110 |
| 1277 | 3300050508 | nmdc:mga09592_898796_c1 | nmdc:mga09592_898796_c1_392_724 | 110 |
| 1278 | 3300050508 | nmdc:mga09592_92749_c1 | nmdc:mga09592_92749_c1_1683_2015 | 110 |
| 1279 | 3300050509 | nmdc:mga0qj67_16939_c1 | nmdc:mga0qj67_16939_c1_598_930 | 110 |
| 1280 | 3300050509 | nmdc:mga0qj67_221311_c1 | nmdc:mga0qj67_221311_c1_308_643 | 110 |
| 1281 | 3300050510 | nmdc:mga06r32_136876_c1 | nmdc:mga06r32_136876_c1_610_990 | 110 |
| 1282 | 3300050510 | nmdc:mga06r32_171085_c1 | nmdc:mga06r32_171085_c1_531_866 | 110 |
| 1283 | 3300050510 | nmdc:mga06r32_210654_c1 | nmdc:mga06r32_210654_c1_344_712 | 110 |
| 1284 | 3300050510 | nmdc:mga06r32_831562_c1 | nmdc:mga06r32_831562_c1_248_583 | 110 |
| 1285 | 3300050511 | nmdc:mga08y16_143327_c1 | nmdc:mga08y16_143327_c1_446_778 | 110 |
| 1286 | 3300050511 | nmdc:mga08y16_325364_c1 | nmdc:mga08y16_325364_c1_81_413 | 110 |
| 1287 | 3300050511 | nmdc:mga08y16_3905_c1 | nmdc:mga08y16_3905_c1_7468_7803 | 110 |
| 1288 | 3300050512 | nmdc:mga0n895_1528387_c1 | nmdc:mga0n895_1528387_c1_139_471 | 110 |
| 1289 | 3300050512 | nmdc:mga0n895_163075_c1 | nmdc:mga0n895_163075_c1_1501_1836 | 110 |
| 1290 | 3300050512 | nmdc:mga0n895_438430_c1 | nmdc:mga0n895_438430_c1_26_361 | 110 |
| 1291 | 3300050512 | nmdc:mga0n895_693258_c1 | nmdc:mga0n895_693258_c1_452_787 | 110 |
| 1292 | 3300050515 | nmdc:mga0a205_312347_c1 | nmdc:mga0a205_312347_c1_946_1281 | 110 |
| 1293 | 3300050515 | nmdc:mga0a205_496004_c1 | nmdc:mga0a205_496004_c1_65_400 | 110 |
| 1294 | 3300050515 | nmdc:mga0a205_512442_c1 | nmdc:mga0a205_512442_c1_212_544 | 110 |
| 1295 | 3300050515 | nmdc:mga0a205_535885_c1 | nmdc:mga0a205_535885_c1_590_925 | 110 |
| 1296 | 3300050515 | nmdc:mga0a205_75331_c1 | nmdc:mga0a205_75331_c1_1634_1969 | 110 |
| 1297 | 3300050515 | nmdc:mga0a205_84544_c1 | nmdc:mga0a205_84544_c1_2467_2802 | 110 |
| 1298 | 3300050515 | nmdc:mga0a205_878738_c1 | nmdc:mga0a205_878738_c1_61_393 | 110 |
| 1299 | 3300054114 | Ga0501084_0801137 | Ga0501084_0801137_388_723 | 110 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1i7h-assembly3.cif.gz_C | crystal sturcuture of fdx | 0.928 | 3 | 94 |
| 3ah7-assembly1.cif.gz_A-2 | crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 | 0.899 | 1 | 94 |
| 2y5c-assembly2.cif.gz_B | structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster | 0.8701 | 2 | 93 |
| 1xlq-assembly4.cif.gz_A | crystal structure of reduced c73s putidaredoxin from pseudomonas putida | 0.8632 | 2 | 96 |
| 6nbl-assembly2.cif.gz_D | cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide | 0.8584 | 1 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i7hA00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.9234 | 3 | 94 | 3.10.20.30 |
| af_A4I756_34_144_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8647 | 2 | 93 | 3.10.20.30 |
| 3lxfB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8623 | 2 | 96 | 3.10.20.30 |
| 4ltuB00 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8567 | 3 | 96 | 3.10.20.30 |
| af_Q9CPW2_55_168_3.10.20.30 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain | 0.8557 | 2 | 94 | 3.10.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8NQ13-F1-model_v4 | (2Fe-2S)-binding protein | 0.9985 | 1 | 109 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A7T9J6Y2-F1-model_v4 | deleted | 0.9984 | 1 | 110 |
|
| AF-A0A7V9N2T1-F1-model_v4 | (2Fe-2S)-binding protein | 0.9906 | 15 | 109 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A2V8NQ13-F1-model_v4 | (2Fe-2S)-binding protein | 0.9805 | 1 | 109 |
GO:0009055
GO:0051537 GO:0140647 |
| AF-A0A7W1DXR3-F1-model_v4 | (2Fe-2S)-binding protein | 0.9539 | 1 | 109 |
GO:0051536
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar