F492734

General Info

Members Datasets Scaffolds Average Seq Length
1299 322 1296 111

Family's Representative Sequence

Representative Sequence 3300049664|Ga0501224_000129|Ga0501224_000129_6051_6380
Length 109
Sequence MPKIQAETASGLVETEPPAGKKLVLAIEDAGVDILHRCGGNARCTTCRVEVLEPGEMGELERNRLAMESELAPNVRLSCQIRVNSDLKVRVINQASVRGMDAGPRPLDE

Samples

Sample ID Description Type Environment
1 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
4 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
5 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
6 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
130 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
131 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
132 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
209 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
220 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
228 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
229 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
230 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
231 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
232 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
233 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
234 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
235 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
254 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
255 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
256 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
257 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
258 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
259 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
260 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
261 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
262 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
263 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
269 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
270 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
271 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
272 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
273 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
274 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
275 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
276 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
277 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
278 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
279 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
280 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
281 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
282 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
283 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
284 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
285 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
286 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
287 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
288 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
289 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
290 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
291 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
292 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
293 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
294 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
295 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
296 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
297 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
298 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
299 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
300 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
301 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
302 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
303 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
304 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
305 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
306 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
307 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
308 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
309 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
310 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
311 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
312 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
313 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
314 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
315 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
316 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
317 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.54
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNA_F6ESG4R02GEH5A 2088090002 Unclassified 500
2 SwRhRL2b_contig_36198 2162886007 Bacteria 2309
3 CNAas_1000886 3300000532 Unclassified 2808
4 JGI24737J22298_10073203 3300001990 Bacteria 1022
5 JGI24751J29686_10000009 3300002459 Bacteria 125815
6 JGI25406J46586_10004348 3300003203 Bacteria 6610
7 JGI25406J46586_10019122 3300003203 Bacteria 2799
8 rootL2_10187274 3300003322 Bacteria 1404
9 Ga0065714_10064433 3300005288 Bacteria 133062
10 Ga0065704_10007866 3300005289 Unclassified 3774
11 Ga0065704_10032831 3300005289 Bacteria 1082
12 Ga0065704_10071538 3300005289 Bacteria 10765
13 Ga0065704_10541735 3300005289 Unclassified 640
14 Ga0065712_10009957 3300005290 Bacteria 2148
15 Ga0065712_10027774 3300005290 Unclassified 941
16 Ga0065712_10067731 3300005290 Bacteria 133054
17 Ga0065712_10073465 3300005290 Unclassified 4383
18 Ga0065712_10155211 3300005290 Bacteria 1340
19 Ga0065712_10231027 3300005290 Unclassified 1011
20 Ga0065712_10285635 3300005290 Unclassified 887
21 Ga0065712_10327933 3300005290 Bacteria 818
22 Ga0065715_10018282 3300005293 Bacteria 2250
23 Ga0065715_10088984 3300005293 Bacteria 18335
24 Ga0065715_10091196 3300005293 Bacteria 6008
25 Ga0065715_10125119 3300005293 Bacteria 2138
26 Ga0065715_10143210 3300005293 Unclassified 1823
27 Ga0065715_10207992 3300005293 Bacteria 1315
28 Ga0065715_10221797 3300005293 Bacteria 1269
29 Ga0065715_10273611 3300005293 Bacteria 1104
30 Ga0065715_10289947 3300005293 Bacteria 1053
31 Ga0065715_10384937 3300005293 Bacteria 902
32 Ga0065715_10474231 3300005293 Unclassified 803
33 Ga0065715_10505085 3300005293 Bacteria 768
34 Ga0065715_10624198 3300005293 Bacteria 689
35 Ga0065715_10641742 3300005293 Bacteria 683
36 Ga0065715_10697873 3300005293 Unclassified 654
37 Ga0065715_10867509 3300005293 Unclassified 586
38 Ga0065715_10883610 3300005293 Bacteria 580
39 Ga0065707_10001225 3300005295 Bacteria 9555
40 Ga0065707_10005905 3300005295 Bacteria 3068
41 Ga0065707_10013054 3300005295 Bacteria 2523
42 Ga0065707_10051064 3300005295 Bacteria 684
43 Ga0065707_10136610 3300005295 Bacteria 1832
44 Ga0065707_10149427 3300005295 Bacteria 1662
45 Ga0065707_10359985 3300005295 Unclassified 905
46 Ga0070676_10061800 3300005328 Bacteria 2227
47 Ga0070676_10080976 3300005328 Bacteria 1970
48 Ga0070676_10370433 3300005328 Bacteria 989
49 Ga0070690_100001514 3300005330 Bacteria 12179
50 Ga0070690_100001806 3300005330 Bacteria 11325
51 Ga0070690_100005902 3300005330 Bacteria 6908
52 Ga0070690_100079209 3300005330 Bacteria 2148
53 Ga0070670_100000088 3300005331 Bacteria 87898
54 Ga0070670_100153806 3300005331 Unclassified 1991
55 Ga0070670_100308249 3300005331 Bacteria 1385
56 Ga0070670_100379324 3300005331 Bacteria 1245
57 Ga0070670_100625843 3300005331 Bacteria 964
58 Ga0070670_100702955 3300005331 Unclassified 909
59 Ga0070670_100710091 3300005331 Unclassified 904
60 Ga0070670_101068261 3300005331 Bacteria 735
61 Ga0070670_101185976 3300005331 Unclassified 698
62 Ga0070670_101393369 3300005331 Bacteria 643
63 Ga0070670_101641100 3300005331 Bacteria 591
64 Ga0070677_10058682 3300005333 Bacteria 1581
65 Ga0070677_10325884 3300005333 Unclassified 788
66 Ga0070677_10744176 3300005333 Unclassified 555
67 Ga0068869_100048762 3300005334 Bacteria 3064
68 Ga0068869_100077696 3300005334 Unclassified 2470
69 Ga0068869_100081484 3300005334 Bacteria 2417
70 Ga0068869_100107136 3300005334 Bacteria 2122
71 Ga0068869_100183011 3300005334 Bacteria 1643
72 Ga0068869_100199500 3300005334 Bacteria 1577
73 Ga0068869_100275367 3300005334 Bacteria 1352
74 Ga0068869_100294542 3300005334 Bacteria 1308
75 Ga0068869_100328054 3300005334 Bacteria 1243
76 Ga0068869_100365907 3300005334 Bacteria 1179
77 Ga0068869_100496927 3300005334 Bacteria 1018
78 Ga0068869_100720690 3300005334 Bacteria 852
79 Ga0068869_101048249 3300005334 Bacteria 712
80 Ga0070666_10009988 3300005335 Bacteria 5923
81 Ga0070666_10151870 3300005335 Unclassified 1616
82 Ga0070666_10538277 3300005335 Unclassified 849
83 Ga0070666_10643633 3300005335 Unclassified 775
84 Ga0070680_100029340 3300005336 Bacteria 4418
85 Ga0070680_100083439 3300005336 Unclassified 2639
86 Ga0070680_100449429 3300005336 Bacteria 1101
87 Ga0070682_100053546 3300005337 Bacteria 2529
88 Ga0070682_100295286 3300005337 Bacteria 1187
89 Ga0070682_100971860 3300005337 Bacteria 703
90 Ga0068868_100035494 3300005338 Bacteria 3854
91 Ga0068868_100068046 3300005338 Unclassified 2835
92 Ga0068868_100300844 3300005338 Unclassified 1362
93 Ga0068868_100315339 3300005338 Bacteria 1331
94 Ga0068868_101171148 3300005338 Unclassified 710
95 Ga0068868_101728351 3300005338 Unclassified 590
96 Ga0070660_100079661 3300005339 Bacteria 2570
97 Ga0070689_100017912 3300005340 Bacteria 5207
98 Ga0070689_100035344 3300005340 Bacteria 3818
99 Ga0070689_100058371 3300005340 Bacteria 2997
100 Ga0070689_100334897 3300005340 Bacteria 1267
101 Ga0070689_100574527 3300005340 Unclassified 974
102 Ga0070689_100682541 3300005340 Bacteria 896
103 Ga0070689_100934543 3300005340 Unclassified 769
104 Ga0070689_101361047 3300005340 Bacteria 640
105 Ga0070689_101401675 3300005340 Unclassified 631
106 Ga0070689_101904127 3300005340 Unclassified 543
107 Ga0070689_102136429 3300005340 Unclassified 513
108 Ga0070691_10227041 3300005341 Unclassified 992
109 Ga0070687_100043878 3300005343 Bacteria 2275
110 Ga0070687_100106748 3300005343 Unclassified 1578
111 Ga0070687_100121283 3300005343 Bacteria 1496
112 Ga0070687_100469532 3300005343 Bacteria 841
113 Ga0070687_100574786 3300005343 Bacteria 770
114 Ga0070661_100331197 3300005344 Bacteria 1191
115 Ga0070661_101343904 3300005344 Unclassified 600
116 Ga0070692_10033025 3300005345 Unclassified 2607
117 Ga0070692_10042222 3300005345 Bacteria 2341
118 Ga0070692_10213690 3300005345 Unclassified 1136
119 Ga0070692_10241586 3300005345 Unclassified 1077
120 Ga0070692_10332116 3300005345 Bacteria 939
121 Ga0070692_10348187 3300005345 Unclassified 920
122 Ga0070692_11280678 3300005345 Unclassified 525
123 Ga0070692_11340428 3300005345 Unclassified 515
124 Ga0070668_100008267 3300005347 Bacteria 7724
125 Ga0070668_100854722 3300005347 Unclassified 811
126 Ga0070669_100030178 3300005353 Bacteria 3910
127 Ga0070669_100031507 3300005353 Bacteria 3830
128 Ga0070669_100037585 3300005353 Bacteria 3512
129 Ga0070669_100061319 3300005353 Bacteria 2763
130 Ga0070669_100284422 3300005353 Bacteria 1326
131 Ga0070669_101209082 3300005353 Unclassified 653
132 Ga0070675_100077534 3300005354 Bacteria 2766
133 Ga0070675_100274943 3300005354 Bacteria 1479
134 Ga0070675_100287698 3300005354 Bacteria 1446
135 Ga0070675_100553681 3300005354 Bacteria 1040
136 Ga0070675_100695120 3300005354 Bacteria 926
137 Ga0070675_101406488 3300005354 Unclassified 643
138 Ga0070671_100024875 3300005355 Bacteria 4907
139 Ga0070671_100111481 3300005355 Bacteria 2298
140 Ga0070671_100170372 3300005355 Unclassified 1841
141 Ga0070671_100897050 3300005355 Unclassified 774
142 Ga0070671_100913979 3300005355 Unclassified 767
143 Ga0070674_100190414 3300005356 Unclassified 1578
144 Ga0070674_100470811 3300005356 Unclassified 1041
145 Ga0070673_100077183 3300005364 Unclassified 2692
146 Ga0070673_100081737 3300005364 Bacteria 2620
147 Ga0070673_100084407 3300005364 Bacteria 2583
148 Ga0070673_100246507 3300005364 Bacteria 1555
149 Ga0070673_100331264 3300005364 Bacteria 1347
150 Ga0070673_100413168 3300005364 Bacteria 1208
151 Ga0070673_101789055 3300005364 Unclassified 582
152 Ga0070673_101967611 3300005364 Unclassified 555
153 Ga0070688_100044481 3300005365 Bacteria 2740
154 Ga0070688_100607186 3300005365 Unclassified 838
155 Ga0070688_101002027 3300005365 Bacteria 664
156 Ga0070688_101146645 3300005365 Unclassified 623
157 Ga0070659_100008321 3300005366 Bacteria 7573
158 Ga0070659_100495631 3300005366 Bacteria 1041
159 Ga0070659_101122126 3300005366 Unclassified 694
160 Ga0070667_100018205 3300005367 Bacteria 5825
161 Ga0070667_100889890 3300005367 Bacteria 828
162 Ga0070667_101554848 3300005367 Bacteria 622
163 Ga0070701_10045910 3300005438 Bacteria 2244
164 Ga0070701_10062048 3300005438 Bacteria 1973
165 Ga0070701_10153880 3300005438 Bacteria 1326
166 Ga0070701_10177803 3300005438 Unclassified 1243
167 Ga0070701_10669991 3300005438 Bacteria 695
168 Ga0070705_100013030 3300005440 Bacteria 4243
169 Ga0070705_100014024 3300005440 Bacteria 4113
170 Ga0070705_100063379 3300005440 Bacteria 2205
171 Ga0070705_100210162 3300005440 Bacteria 1341
172 Ga0070705_100325751 3300005440 Bacteria 1111
173 Ga0070705_100512693 3300005440 Unclassified 913
174 Ga0070705_100606653 3300005440 Unclassified 847
175 Ga0070705_100827386 3300005440 Unclassified 739
176 Ga0070700_100000120 3300005441 Bacteria 48358
177 Ga0070700_100010579 3300005441 Bacteria 5097
178 Ga0070700_100060229 3300005441 Bacteria 2392
179 Ga0070700_100100878 3300005441 Bacteria 1901
180 Ga0070700_100120895 3300005441 Unclassified 1755
181 Ga0070700_100144818 3300005441 Bacteria 1618
182 Ga0070700_100177323 3300005441 Bacteria 1480
183 Ga0070700_100327275 3300005441 Bacteria 1128
184 Ga0070700_101154526 3300005441 Bacteria 645
185 Ga0070694_100017204 3300005444 Bacteria 4565
186 Ga0070694_100092269 3300005444 Bacteria 2127
187 Ga0070694_100110404 3300005444 Bacteria 1958
188 Ga0070694_100211119 3300005444 Unclassified 1452
189 Ga0070694_100254010 3300005444 Unclassified 1331
190 Ga0070694_100326153 3300005444 Bacteria 1183
191 Ga0070694_100389803 3300005444 Unclassified 1088
192 Ga0070694_100484635 3300005444 Bacteria 982
193 Ga0070694_100744778 3300005444 Bacteria 800
194 Ga0070694_100954767 3300005444 Unclassified 710
195 Ga0070694_101200209 3300005444 Bacteria 636
196 Ga0070708_100000337 3300005445 Bacteria 35479
197 Ga0070708_100148145 3300005445 Bacteria 2181
198 Ga0070708_100255666 3300005445 Bacteria 1646
199 Ga0070708_100950572 3300005445 Bacteria 806
200 Ga0070663_100643440 3300005455 Bacteria 896
201 Ga0070678_100047848 3300005456 Bacteria 3076
202 Ga0070678_100474634 3300005456 Unclassified 1100
203 Ga0070678_100651468 3300005456 Bacteria 945
204 Ga0070662_100618082 3300005457 Unclassified 912
205 Ga0070662_101016072 3300005457 Unclassified 710
206 Ga0070662_101298029 3300005457 Unclassified 626
207 Ga0070662_101707623 3300005457 Unclassified 544
208 Ga0070681_10001081 3300005458 Bacteria 23250
209 Ga0070681_10006294 3300005458 Bacteria 11540
210 Ga0070681_10054385 3300005458 Bacteria 3988
211 Ga0070681_10201233 3300005458 Bacteria 1910
212 Ga0068867_100034591 3300005459 Bacteria 3662
213 Ga0068867_100042795 3300005459 Unclassified 3315
214 Ga0068867_100054294 3300005459 Bacteria 2960
215 Ga0068867_100059623 3300005459 Bacteria 2829
216 Ga0068867_100101133 3300005459 Bacteria 2202
217 Ga0068867_100236278 3300005459 Bacteria 1480
218 Ga0068867_100439081 3300005459 Bacteria 1109
219 Ga0068867_100588500 3300005459 Bacteria 969
220 Ga0068867_101553076 3300005459 Bacteria 617
221 Ga0068867_101602249 3300005459 Unclassified 608
222 Ga0068867_101604872 3300005459 Unclassified 608
223 Ga0070685_10088908 3300005466 Bacteria 1867
224 Ga0070685_10299235 3300005466 Bacteria 1084
225 Ga0070685_10466184 3300005466 Bacteria 888
226 Ga0070685_10562270 3300005466 Bacteria 816
227 Ga0070706_100012259 3300005467 Bacteria 7944
228 Ga0070706_100035284 3300005467 Bacteria 4619
229 Ga0070706_100277890 3300005467 Bacteria 1563
230 Ga0070706_100913626 3300005467 Unclassified 811
231 Ga0070707_100040959 3300005468 Unclassified 4432
232 Ga0070707_100081032 3300005468 Unclassified 3133
233 Ga0070707_100286500 3300005468 Bacteria 1601
234 Ga0070707_101471620 3300005468 Unclassified 648
235 Ga0070698_100004605 3300005471 Bacteria 15147
236 Ga0070698_100012974 3300005471 Bacteria 8821
237 Ga0070698_100013753 3300005471 Bacteria 8567
238 Ga0070698_100018834 3300005471 Bacteria 7263
239 Ga0070698_100636820 3300005471 Bacteria 1007
240 Ga0070698_101167788 3300005471 Bacteria 719
241 Ga0070698_102242075 3300005471 Unclassified 500
242 Ga0070699_100006275 3300005518 Bacteria 10374
243 Ga0070699_100007202 3300005518 Bacteria 9674
244 Ga0070699_100030729 3300005518 Bacteria 4637
245 Ga0070699_100049948 3300005518 Bacteria 3620
246 Ga0070699_100427062 3300005518 Bacteria 1200
247 Ga0070679_100008421 3300005530 Bacteria 9706
248 Ga0070679_100056125 3300005530 Bacteria 3924
249 Ga0070684_101368972 3300005535 Unclassified 666
250 Ga0070697_100000062 3300005536 Bacteria 84791
251 Ga0070697_100038063 3300005536 Bacteria 3886
252 Ga0070697_101351849 3300005536 Unclassified 636
253 Ga0070697_101469068 3300005536 Bacteria 609
254 Ga0068853_100071741 3300005539 Bacteria 3016
255 Ga0068853_100180300 3300005539 Bacteria 1915
256 Ga0068853_100257079 3300005539 Bacteria 1604
257 Ga0068853_100395567 3300005539 Bacteria 1293
258 Ga0068853_100590121 3300005539 Bacteria 1055
259 Ga0068853_100619133 3300005539 Bacteria 1029
260 Ga0068853_101290359 3300005539 Unclassified 706
261 Ga0068853_102015651 3300005539 Bacteria 560
262 Ga0068853_102184292 3300005539 Unclassified 537
263 Ga0070672_100003235 3300005543 Bacteria 10544
264 Ga0070672_100940672 3300005543 Bacteria 764
265 Ga0070672_100940773 3300005543 Bacteria 764
266 Ga0070672_101238899 3300005543 Bacteria 665
267 Ga0070686_100002174 3300005544 Bacteria 10821
268 Ga0070686_100215400 3300005544 Bacteria 1385
269 Ga0070686_100566541 3300005544 Unclassified 891
270 Ga0070686_100991500 3300005544 Unclassified 688
271 Ga0070686_101710802 3300005544 Unclassified 534
272 Ga0070695_100013916 3300005545 Bacteria 4842
273 Ga0070695_100026460 3300005545 Bacteria 3589
274 Ga0070695_100110005 3300005545 Bacteria 1868
275 Ga0070695_100119248 3300005545 Bacteria 1802
276 Ga0070695_100120848 3300005545 Bacteria 1792
277 Ga0070695_100134121 3300005545 Unclassified 1709
278 Ga0070695_100141653 3300005545 Bacteria 1668
279 Ga0070695_100143482 3300005545 Bacteria 1658
280 Ga0070695_100158535 3300005545 Unclassified 1586
281 Ga0070695_100391206 3300005545 Unclassified 1052
282 Ga0070695_100391276 3300005545 Unclassified 1051
283 Ga0070695_100706216 3300005545 Bacteria 801
284 Ga0070695_101877076 3300005545 Unclassified 503
285 Ga0070696_100000807 3300005546 Bacteria 20137
286 Ga0070696_100010581 3300005546 Bacteria 6182
287 Ga0070696_100095169 3300005546 Unclassified 2126
288 Ga0070696_100098487 3300005546 Bacteria 2092
289 Ga0070696_100119931 3300005546 Bacteria 1903
290 Ga0070696_100440145 3300005546 Bacteria 1027
291 Ga0070696_100635662 3300005546 Unclassified 864
292 Ga0070696_101129638 3300005546 Unclassified 660
293 Ga0070696_101796155 3300005546 Bacteria 530
294 Ga0070693_100022522 3300005547 Unclassified 3352
295 Ga0070693_100040645 3300005547 Bacteria 2612
296 Ga0070693_100094216 3300005547 Bacteria 1811
297 Ga0070693_100242564 3300005547 Bacteria 1191
298 Ga0070693_100339487 3300005547 Unclassified 1025
299 Ga0070693_100401051 3300005547 Unclassified 951
300 Ga0070693_101656889 3300005547 Unclassified 504
301 Ga0070665_100267008 3300005548 Unclassified 1713
302 Ga0070704_100041854 3300005549 Bacteria 3165
303 Ga0070704_100088858 3300005549 Bacteria 2297
304 Ga0070704_100177140 3300005549 Bacteria 1702
305 Ga0070704_100272872 3300005549 Bacteria 1398
306 Ga0070704_100280836 3300005549 Bacteria 1379
307 Ga0070704_100443264 3300005549 Unclassified 1116
308 Ga0070704_100450887 3300005549 Unclassified 1108
309 Ga0070704_100463381 3300005549 Bacteria 1094
310 Ga0070704_100936529 3300005549 Bacteria 781
311 Ga0068855_100455794 3300005563 Bacteria 1395
312 Ga0068855_101239572 3300005563 Unclassified 774
313 Ga0068855_101426436 3300005563 Bacteria 713
314 Ga0068855_102350087 3300005563 Unclassified 533
315 Ga0070664_100005757 3300005564 Bacteria 9992
316 Ga0070664_100073910 3300005564 Bacteria 2925
317 Ga0070664_100089390 3300005564 Bacteria 2665
318 Ga0070664_100252396 3300005564 Unclassified 1586
319 Ga0070664_100299036 3300005564 Bacteria 1454
320 Ga0070664_100390994 3300005564 Bacteria 1271
321 Ga0070664_100428813 3300005564 Unclassified 1212
322 Ga0070664_100478689 3300005564 Bacteria 1145
323 Ga0070664_101013882 3300005564 Unclassified 780
324 Ga0070664_102288880 3300005564 Unclassified 513
325 Ga0070664_102339284 3300005564 Unclassified 507
326 Ga0068857_100011647 3300005577 Bacteria 7650
327 Ga0068857_100098402 3300005577 Unclassified 2624
328 Ga0068857_100250199 3300005577 Bacteria 1624
329 Ga0068857_100259806 3300005577 Bacteria 1593
330 Ga0068857_100474762 3300005577 Bacteria 1171
331 Ga0068857_100474810 3300005577 Unclassified 1171
332 Ga0068857_100553609 3300005577 Bacteria 1084
333 Ga0068857_100665285 3300005577 Unclassified 988
334 Ga0068857_100866822 3300005577 Bacteria 865
335 Ga0068854_100039135 3300005578 Bacteria 3338
336 Ga0068854_100198348 3300005578 Unclassified 1576
337 Ga0068854_100319982 3300005578 Unclassified 1260
338 Ga0068854_100491532 3300005578 Bacteria 1032
339 Ga0068854_100595031 3300005578 Unclassified 943
340 Ga0068854_100643546 3300005578 Unclassified 909
341 Ga0068854_100660586 3300005578 Bacteria 898
342 Ga0068854_101314622 3300005578 Unclassified 651
343 Ga0068854_101980158 3300005578 Unclassified 536
344 Ga0068854_102125540 3300005578 Unclassified 519
345 Ga0068856_100021795 3300005614 Bacteria 6227
346 Ga0068856_100925077 3300005614 Unclassified 891
347 Ga0070702_100020950 3300005615 Bacteria 3432
348 Ga0070702_100037702 3300005615 Bacteria 2685
349 Ga0070702_100063007 3300005615 Unclassified 2163
350 Ga0070702_100212460 3300005615 Bacteria 1288
351 Ga0070702_100396737 3300005615 Unclassified 986
352 Ga0070702_101325575 3300005615 Unclassified 585
353 Ga0068852_100129712 3300005616 Unclassified 2320
354 Ga0068852_100318997 3300005616 Unclassified 1509
355 Ga0068852_100425615 3300005616 Unclassified 1310
356 Ga0068852_101212324 3300005616 Bacteria 776
357 Ga0068852_101632978 3300005616 Bacteria 667
358 Ga0068852_101659408 3300005616 Unclassified 662
359 Ga0068852_102602473 3300005616 Unclassified 526
360 Ga0068859_100006661 3300005617 Bacteria 11729
361 Ga0068859_100009613 3300005617 Bacteria 9764
362 Ga0068859_100027113 3300005617 Bacteria 5747
363 Ga0068859_100056402 3300005617 Bacteria 3954
364 Ga0068859_100063364 3300005617 Bacteria 3728
365 Ga0068859_100184573 3300005617 Bacteria 2169
366 Ga0068859_100223045 3300005617 Bacteria 1973
367 Ga0068859_100232478 3300005617 Bacteria 1932
368 Ga0068859_100235025 3300005617 Bacteria 1921
369 Ga0068859_100329511 3300005617 Bacteria 1621
370 Ga0068859_100463722 3300005617 Unclassified 1363
371 Ga0068859_100490815 3300005617 Bacteria 1323
372 Ga0068859_100602699 3300005617 Bacteria 1191
373 Ga0068859_100636851 3300005617 Unclassified 1158
374 Ga0068859_100794078 3300005617 Unclassified 1034
375 Ga0068859_100816629 3300005617 Bacteria 1019
376 Ga0068859_100991361 3300005617 Unclassified 923
377 Ga0068859_101063755 3300005617 Bacteria 889
378 Ga0068859_102186136 3300005617 Bacteria 611
379 Ga0068859_102420368 3300005617 Unclassified 578
380 Ga0068859_102835964 3300005617 Unclassified 532
381 Ga0068859_103094459 3300005617 Bacteria 507
382 Ga0068864_100008711 3300005618 Bacteria 8367
383 Ga0068864_100021333 3300005618 Bacteria 5427
384 Ga0068864_100054098 3300005618 Bacteria 3464
385 Ga0068864_100212659 3300005618 Bacteria 1781
386 Ga0068864_100214585 3300005618 Unclassified 1773
387 Ga0068864_100323995 3300005618 Bacteria 1448
388 Ga0068864_100387108 3300005618 Unclassified 1326
389 Ga0068864_100415507 3300005618 Bacteria 1281
390 Ga0068864_100526012 3300005618 Bacteria 1141
391 Ga0068864_100794165 3300005618 Bacteria 930
392 Ga0068864_101367078 3300005618 Unclassified 709
393 Ga0068864_101523147 3300005618 Unclassified 672
394 Ga0068864_101834311 3300005618 Unclassified 612
395 Ga0068864_102357615 3300005618 Unclassified 539
396 Ga0068866_10071694 3300005718 Unclassified 1833
397 Ga0068866_10301056 3300005718 Bacteria 1001
398 Ga0068861_100002983 3300005719 Bacteria 11168
399 Ga0068861_100004194 3300005719 Bacteria 9666
400 Ga0068861_100026590 3300005719 Bacteria 4208
401 Ga0068861_100151057 3300005719 Bacteria 1906
402 Ga0068861_100218202 3300005719 Bacteria 1610
403 Ga0068861_100537665 3300005719 Unclassified 1063
404 Ga0068861_100773458 3300005719 Bacteria 899
405 Ga0068861_101696318 3300005719 Unclassified 625
406 Ga0068861_101809589 3300005719 Bacteria 606
407 Ga0068861_101811476 3300005719 Bacteria 606
408 Ga0068861_102311319 3300005719 Unclassified 540
409 Ga0068851_10063826 3300005834 Bacteria 1892
410 Ga0068851_10402445 3300005834 Unclassified 806
411 Ga0068851_10568427 3300005834 Unclassified 687
412 Ga0068851_10741795 3300005834 Bacteria 607
413 Ga0068870_10107101 3300005840 Unclassified 1590
414 Ga0068870_10150762 3300005840 Bacteria 1369
415 Ga0068870_10232065 3300005840 Bacteria 1135
416 Ga0068870_10414291 3300005840 Unclassified 880
417 Ga0068863_100075227 3300005841 Bacteria 3195
418 Ga0068863_100112035 3300005841 Bacteria 2599
419 Ga0068863_100167444 3300005841 Bacteria 2107
420 Ga0068863_100213033 3300005841 Bacteria 1860
421 Ga0068863_100223750 3300005841 Bacteria 1813
422 Ga0068863_100270853 3300005841 Bacteria 1643
423 Ga0068863_100274814 3300005841 Bacteria 1631
424 Ga0068863_100329269 3300005841 Bacteria 1485
425 Ga0068863_101077930 3300005841 Bacteria 808
426 Ga0068858_100020307 3300005842 Bacteria 6212
427 Ga0068858_100062270 3300005842 Bacteria 3450
428 Ga0068858_100070049 3300005842 Bacteria 3251
429 Ga0068858_100248180 3300005842 Bacteria 1690
430 Ga0068858_100278823 3300005842 Bacteria 1592
431 Ga0068858_100719923 3300005842 Bacteria 971
432 Ga0068858_100915307 3300005842 Bacteria 858
433 Ga0068858_100955120 3300005842 Unclassified 839
434 Ga0068858_101099103 3300005842 Unclassified 781
435 Ga0068858_102430760 3300005842 Unclassified 518
436 Ga0068858_102465385 3300005842 Unclassified 514
437 Ga0068860_100067260 3300005843 Bacteria 3405
438 Ga0068860_100095228 3300005843 Bacteria 2838
439 Ga0068860_100100146 3300005843 Bacteria 2764
440 Ga0068860_100124757 3300005843 Bacteria 2468
441 Ga0068860_100134784 3300005843 Bacteria 2371
442 Ga0068860_100150589 3300005843 Bacteria 2240
443 Ga0068860_100323632 3300005843 Bacteria 1513
444 Ga0068860_100326954 3300005843 Bacteria 1505
445 Ga0068860_100404102 3300005843 Bacteria 1351
446 Ga0068860_100665872 3300005843 Unclassified 1049
447 Ga0068860_102176404 3300005843 Unclassified 576
448 Ga0068862_100010358 3300005844 Bacteria 7693
449 Ga0068862_100036312 3300005844 Bacteria 4177
450 Ga0068862_100073581 3300005844 Bacteria 2953
451 Ga0068862_100150979 3300005844 Bacteria 2068
452 Ga0068862_100211958 3300005844 Unclassified 1750
453 Ga0068862_100672179 3300005844 Bacteria 1001
454 Ga0068862_100778572 3300005844 Unclassified 933
455 Ga0068862_100961321 3300005844 Bacteria 843
456 Ga0068862_101076594 3300005844 Bacteria 798
457 Ga0068862_102301013 3300005844 Bacteria 550
458 Ga0081540_1046504 3300005983 Bacteria 2190
459 Ga0081539_10000408 3300005985 Bacteria 91634
460 Ga0081539_10002782 3300005985 Bacteria 23520
461 Ga0081539_10260842 3300005985 Unclassified 764
462 Ga0070716_100039779 3300006173 Bacteria 2612
463 Ga0097621_100008542 3300006237 Bacteria 7378
464 Ga0097621_100013219 3300006237 Bacteria 6144
465 Ga0097621_100036362 3300006237 Bacteria 3940
466 Ga0097621_100167622 3300006237 Bacteria 1891
467 Ga0097621_100381058 3300006237 Bacteria 1260
468 Ga0097621_101550547 3300006237 Unclassified 629
469 Ga0068871_100019524 3300006358 Bacteria 5176
470 Ga0068871_100031414 3300006358 Bacteria 4188
471 Ga0068871_100185048 3300006358 Unclassified 1791
472 Ga0068871_100428232 3300006358 Unclassified 1183
473 Ga0068871_101554072 3300006358 Unclassified 626
474 Ga0075428_101057264 3300006844 Bacteria 858
475 Ga0075430_100066558 3300006846 Bacteria 3025
476 Ga0075430_100082659 3300006846 Unclassified 2691
477 Ga0075431_100094063 3300006847 Bacteria 3093
478 Ga0075431_100164221 3300006847 Bacteria 2283
479 Ga0075431_100255488 3300006847 Bacteria 1779
480 Ga0075431_100265972 3300006847 Viruses 1739
481 Ga0075431_101432383 3300006847 Unclassified 650
482 Ga0075433_10037055 3300006852 Bacteria 4204
483 Ga0075433_10243454 3300006852 Bacteria 1596
484 Ga0075433_10453845 3300006852 Bacteria 1130
485 Ga0075433_10517438 3300006852 Unclassified 1050
486 Ga0075433_10680206 3300006852 Unclassified 902
487 Ga0075434_100289565 3300006871 Bacteria 1658
488 Ga0075434_100363644 3300006871 Bacteria 1468
489 Ga0075434_100797367 3300006871 Bacteria 961
490 Ga0075429_100100562 3300006880 Unclassified 2524
491 Ga0075429_101684029 3300006880 Unclassified 551
492 Ga0068865_100048889 3300006881 Bacteria 2913
493 Ga0068865_100117481 3300006881 Bacteria 1972
494 Ga0068865_100279919 3300006881 Unclassified 1327
495 Ga0068865_100540999 3300006881 Unclassified 977
496 Ga0097620_100006661 3300006931 Bacteria 11729
497 Ga0097620_100009613 3300006931 Bacteria 9764
498 Ga0097620_100027113 3300006931 Bacteria 5747
499 Ga0097620_100056402 3300006931 Bacteria 3954
500 Ga0097620_100063365 3300006931 Bacteria 3728
501 Ga0097620_100184577 3300006931 Bacteria 2169
502 Ga0097620_100223050 3300006931 Bacteria 1973
503 Ga0097620_100232474 3300006931 Bacteria 1932
504 Ga0097620_100235042 3300006931 Bacteria 1921
505 Ga0097620_100329512 3300006931 Bacteria 1621
506 Ga0097620_100463757 3300006931 Unclassified 1363
507 Ga0097620_100490790 3300006931 Bacteria 1323
508 Ga0097620_100602653 3300006931 Bacteria 1191
509 Ga0097620_100636851 3300006931 Unclassified 1158
510 Ga0097620_100794087 3300006931 Unclassified 1034
511 Ga0097620_100816652 3300006931 Bacteria 1019
512 Ga0097620_100991368 3300006931 Unclassified 923
513 Ga0097620_101063782 3300006931 Bacteria 889
514 Ga0097620_102186338 3300006931 Bacteria 611
515 Ga0097620_102420377 3300006931 Unclassified 578
516 Ga0097620_102836133 3300006931 Unclassified 532
517 Ga0097620_103093790 3300006931 Bacteria 507
518 Ga0075435_100021117 3300007076 Bacteria 5002
519 Ga0105251_10385115 3300009011 Unclassified 643
520 Ga0105244_10522940 3300009036 Unclassified 546
521 Ga0105250_10031522 3300009092 Bacteria 2128
522 Ga0105250_10063537 3300009092 Bacteria 1486
523 Ga0105250_10408584 3300009092 Unclassified 603
524 Ga0105240_10191814 3300009093 Bacteria 2402
525 Ga0105240_10414692 3300009093 Bacteria 1514
526 Ga0105240_10631291 3300009093 Unclassified 1176
527 Ga0105240_10788834 3300009093 Bacteria 1030
528 Ga0105240_11085907 3300009093 Bacteria 852
529 Ga0105240_11793581 3300009093 Unclassified 639
530 Ga0111539_10005075 3300009094 Bacteria 17101
531 Ga0111539_10183930 3300009094 Bacteria 2440
532 Ga0111539_10202263 3300009094 Bacteria 2316
533 Ga0111539_10330094 3300009094 Bacteria 1775
534 Ga0111539_12748337 3300009094 Unclassified 570
535 Ga0105245_10141499 3300009098 Bacteria 2266
536 Ga0105245_10632875 3300009098 Bacteria 1099
537 Ga0105245_10794307 3300009098 Bacteria 984
538 Ga0105245_11623836 3300009098 Unclassified 698
539 Ga0105245_11756378 3300009098 Bacteria 673
540 Ga0105245_12317311 3300009098 Bacteria 591
541 Ga0105247_10007521 3300009101 Bacteria 6677
542 Ga0105247_10164911 3300009101 Bacteria 1469
543 Ga0105247_10320588 3300009101 Bacteria 1081
544 Ga0105247_10459888 3300009101 Unclassified 919
545 Ga0105247_11150293 3300009101 Unclassified 615
546 Ga0114129_10042525 3300009147 Bacteria 6398
547 Ga0114129_10114657 3300009147 Unclassified 3715
548 Ga0114129_10254718 3300009147 Bacteria 2355
549 Ga0114129_10369332 3300009147 Bacteria 1897
550 Ga0114129_10670883 3300009147 Unclassified 1336
551 Ga0114129_11304227 3300009147 Unclassified 900
552 Ga0114129_11420163 3300009147 Unclassified 856
553 Ga0114129_11578951 3300009147 Unclassified 804
554 Ga0105243_10077421 3300009148 Bacteria 2705
555 Ga0105243_10145993 3300009148 Bacteria 2024
556 Ga0105243_10155782 3300009148 Bacteria 1964
557 Ga0105243_10229866 3300009148 Bacteria 1645
558 Ga0105243_10256448 3300009148 Unclassified 1564
559 Ga0105243_10582045 3300009148 Bacteria 1075
560 Ga0105243_10860073 3300009148 Unclassified 899
561 Ga0105241_10019245 3300009174 Bacteria 5034
562 Ga0105241_10021776 3300009174 Bacteria 4742
563 Ga0105241_10046782 3300009174 Bacteria 3287
564 Ga0105241_10064366 3300009174 Bacteria 2831
565 Ga0105241_10109925 3300009174 Unclassified 2205
566 Ga0105241_10206882 3300009174 Bacteria 1642
567 Ga0105241_10222574 3300009174 Unclassified 1587
568 Ga0105241_10457453 3300009174 Bacteria 1130
569 Ga0105241_10482575 3300009174 Bacteria 1102
570 Ga0105241_11136046 3300009174 Unclassified 737
571 Ga0105241_11346875 3300009174 Bacteria 681
572 Ga0105241_11497352 3300009174 Unclassified 649
573 Ga0105241_11797002 3300009174 Unclassified 598
574 Ga0105241_11870419 3300009174 Bacteria 588
575 Ga0105242_10002192 3300009176 Bacteria 15419
576 Ga0105242_10062185 3300009176 Bacteria 3072
577 Ga0105242_10207593 3300009176 Bacteria 1743
578 Ga0105242_10358283 3300009176 Bacteria 1349
579 Ga0105242_10486482 3300009176 Bacteria 1171
580 Ga0105242_11017506 3300009176 Bacteria 837
581 Ga0105242_11404069 3300009176 Unclassified 726
582 Ga0105242_13196653 3300009176 Bacteria 508
583 Ga0105248_10007251 3300009177 Bacteria 12167
584 Ga0105248_10016118 3300009177 Bacteria 8224
585 Ga0105248_10033803 3300009177 Bacteria 5714
586 Ga0105248_10033984 3300009177 Bacteria 5700
587 Ga0105248_10088802 3300009177 Bacteria 3479
588 Ga0105248_10480322 3300009177 Bacteria 1401
589 Ga0105248_10725191 3300009177 Bacteria 1122
590 Ga0105248_11331488 3300009177 Unclassified 812
591 Ga0105248_11336314 3300009177 Unclassified 811
592 Ga0105248_11486161 3300009177 Unclassified 767
593 Ga0105248_12531862 3300009177 Unclassified 585
594 Ga0105237_10019745 3300009545 Bacteria 6957
595 Ga0105237_10296177 3300009545 Bacteria 1621
596 Ga0105237_10723382 3300009545 Bacteria 1002
597 Ga0105237_10878241 3300009545 Unclassified 903
598 Ga0105237_11104178 3300009545 Unclassified 800
599 Ga0105238_10008842 3300009551 Bacteria 10074
600 Ga0105238_10104368 3300009551 Bacteria 2815
601 Ga0105238_10635478 3300009551 Bacteria 1077
602 Ga0105238_11234438 3300009551 Unclassified 772
603 Ga0105249_10000052 3300009553 Bacteria 168047
604 Ga0105249_10004897 3300009553 Bacteria 11556
605 Ga0105249_10009805 3300009553 Bacteria 8393
606 Ga0105249_10017459 3300009553 Bacteria 6371
607 Ga0105249_10022390 3300009553 Bacteria 5659
608 Ga0105249_10411487 3300009553 Bacteria 1384
609 Ga0105249_10508093 3300009553 Bacteria 1251
610 Ga0105249_12386081 3300009553 Unclassified 601
611 Ga0105249_12622480 3300009553 Unclassified 576
612 Ga0105239_10116098 3300010375 Bacteria 2970
613 Ga0105239_10303061 3300010375 Bacteria 1799
614 Ga0105239_10908791 3300010375 Bacteria 1011
615 Ga0105239_11743326 3300010375 Bacteria 721
616 Ga0105239_11845581 3300010375 Bacteria 701
617 Ga0105246_10019006 3300011119 Bacteria 4383
618 Ga0105246_10041615 3300011119 Bacteria 3106
619 Ga0105246_10079138 3300011119 Bacteria 2337
620 Ga0105246_10094377 3300011119 Unclassified 2164
621 Ga0105246_10111502 3300011119 Bacteria 2010
622 Ga0105246_10292357 3300011119 Bacteria 1311
623 Ga0105246_10419796 3300011119 Bacteria 1116
624 Ga0105246_10424657 3300011119 Bacteria 1110
625 Ga0105246_10716314 3300011119 Bacteria 879
626 Ga0157326_1086845 3300012513 Unclassified 520
627 Ga0157373_10016111 3300013100 Bacteria 5456
628 Ga0157373_10031501 3300013100 Bacteria 3817
629 Ga0157373_10033790 3300013100 Bacteria 3676
630 Ga0157373_10136178 3300013100 Unclassified 1727
631 Ga0157373_10520132 3300013100 Bacteria 861
632 Ga0157373_11499500 3300013100 Unclassified 515
633 Ga0157371_10450589 3300013102 Bacteria 946
634 Ga0157374_10015970 3300013296 Bacteria 6594
635 Ga0157374_10135043 3300013296 Bacteria 2391
636 Ga0157374_11340551 3300013296 Unclassified 738
637 Ga0157374_11556776 3300013296 Bacteria 685
638 Ga0157378_10001282 3300013297 Bacteria 22599
639 Ga0157378_10003380 3300013297 Bacteria 14189
640 Ga0157378_10086410 3300013297 Unclassified 2843
641 Ga0157378_10307296 3300013297 Bacteria 1537
642 Ga0157378_10408909 3300013297 Bacteria 1339
643 Ga0157378_10535751 3300013297 Unclassified 1174
644 Ga0157378_10821345 3300013297 Unclassified 956
645 Ga0157378_10913835 3300013297 Bacteria 909
646 Ga0157378_10981057 3300013297 Bacteria 878
647 Ga0157378_11284888 3300013297 Unclassified 773
648 Ga0157378_11297086 3300013297 Unclassified 769
649 Ga0157378_11646753 3300013297 Unclassified 688
650 Ga0157378_11876248 3300013297 Bacteria 648
651 Ga0157378_11930256 3300013297 Bacteria 640
652 Ga0157378_12607041 3300013297 Unclassified 558
653 Ga0163162_10000001 3300013306 Bacteria 751833
654 Ga0163162_10009010 3300013306 Bacteria 9702
655 Ga0163162_10012811 3300013306 Bacteria 8191
656 Ga0163162_10044633 3300013306 Bacteria 4439
657 Ga0163162_10149517 3300013306 Bacteria 2452
658 Ga0163162_10618230 3300013306 Bacteria 1209
659 Ga0163162_11200497 3300013306 Bacteria 861
660 Ga0163162_11479821 3300013306 Unclassified 773
661 Ga0163162_11548231 3300013306 Bacteria 756
662 Ga0157372_10031386 3300013307 Bacteria 5818
663 Ga0157372_10971521 3300013307 Unclassified 984
664 Ga0157372_11419886 3300013307 Bacteria 800
665 Ga0157372_11806124 3300013307 Unclassified 703
666 Ga0157372_12637697 3300013307 Bacteria 577
667 Ga0157375_10004418 3300013308 Bacteria 12206
668 Ga0157375_10066922 3300013308 Bacteria 3588
669 Ga0157375_10073908 3300013308 Bacteria 3429
670 Ga0157375_10198777 3300013308 Bacteria 2160
671 Ga0157375_10262499 3300013308 Unclassified 1889
672 Ga0157375_10336605 3300013308 Bacteria 1674
673 Ga0157375_10511728 3300013308 Bacteria 1364
674 Ga0157375_11127453 3300013308 Bacteria 919
675 Ga0157375_11196087 3300013308 Unclassified 891
676 Ga0157375_11350255 3300013308 Bacteria 839
677 Ga0157375_11785373 3300013308 Unclassified 729
678 Ga0157375_12442601 3300013308 Unclassified 624
679 Ga0157375_12647574 3300013308 Unclassified 599
680 Ga0163163_10001533 3300014325 Bacteria 19476
681 Ga0163163_10001831 3300014325 Bacteria 17942
682 Ga0163163_10007435 3300014325 Bacteria 9669
683 Ga0163163_10132213 3300014325 Bacteria 2536
684 Ga0163163_10207137 3300014325 Unclassified 2010
685 Ga0163163_10220860 3300014325 Bacteria 1943
686 Ga0163163_10268419 3300014325 Bacteria 1757
687 Ga0163163_10310393 3300014325 Bacteria 1630
688 Ga0163163_10312194 3300014325 Bacteria 1625
689 Ga0163163_10340679 3300014325 Unclassified 1554
690 Ga0163163_10370662 3300014325 Bacteria 1489
691 Ga0163163_10421034 3300014325 Unclassified 1394
692 Ga0163163_10684469 3300014325 Unclassified 1089
693 Ga0163163_10931140 3300014325 Bacteria 932
694 Ga0163163_11748079 3300014325 Unclassified 682
695 Ga0163163_12017930 3300014325 Unclassified 637
696 Ga0157380_10001205 3300014326 Bacteria 16752
697 Ga0157380_10017030 3300014326 Bacteria 5370
698 Ga0157380_10034148 3300014326 Bacteria 3922
699 Ga0157380_10041006 3300014326 Bacteria 3610
700 Ga0157380_10270971 3300014326 Unclassified 1548
701 Ga0157380_10504538 3300014326 Bacteria 1176
702 Ga0157380_10593595 3300014326 Unclassified 1094
703 Ga0157380_11151082 3300014326 Bacteria 817
704 Ga0157380_11965845 3300014326 Unclassified 646
705 Ga0157380_12322664 3300014326 Unclassified 601
706 Ga0157380_12453947 3300014326 Unclassified 587
707 Ga0157377_10183115 3300014745 Bacteria 1319
708 Ga0157377_10192309 3300014745 Bacteria 1290
709 Ga0157377_10301550 3300014745 Unclassified 1057
710 Ga0157379_10025079 3300014968 Bacteria 5294
711 Ga0157379_10290117 3300014968 Bacteria 1490
712 Ga0157379_10607894 3300014968 Bacteria 1021
713 Ga0157379_11001281 3300014968 Unclassified 797
714 Ga0157379_12451966 3300014968 Unclassified 521
715 Ga0157376_10014842 3300014969 Bacteria 5863
716 Ga0157376_10906771 3300014969 Unclassified 900
717 Ga0157376_12131772 3300014969 Unclassified 599
718 Ga0182005_1188179 3300015265 Unclassified 616
719 Ga0163161_10032403 3300017792 Bacteria 3731
720 Ga0163161_11040389 3300017792 Bacteria 701
721 Ga0213873_10024794 3300021358 Bacteria 1442
722 Ga0213872_10026992 3300021361 Bacteria 2638
723 Ga0213876_10000355 3300021384 Bacteria 39376
724 Ga0213876_10013377 3300021384 Bacteria 4360
725 Ga0213871_10177439 3300021441 Bacteria 657
726 Ga0207697_10013752 3300025315 Bacteria 3372
727 Ga0207697_10453508 3300025315 Unclassified 568
728 Ga0207656_10456840 3300025321 Unclassified 646
729 Ga0207653_10198873 3300025885 Unclassified 755
730 Ga0207653_10394520 3300025885 Unclassified 542
731 Ga0207682_10236035 3300025893 Unclassified 849
732 Ga0207682_10297446 3300025893 Unclassified 756
733 Ga0207642_10288671 3300025899 Bacteria 946
734 Ga0207642_11009843 3300025899 Unclassified 536
735 Ga0207688_10080312 3300025901 Unclassified 1861
736 Ga0207688_10664907 3300025901 Unclassified 658
737 Ga0207688_10712843 3300025901 Unclassified 635
738 Ga0207680_10062476 3300025903 Bacteria 2276
739 Ga0207647_10084981 3300025904 Bacteria 1893
740 Ga0207647_10233759 3300025904 Unclassified 1057
741 Ga0207647_10556535 3300025904 Unclassified 636
742 Ga0207647_10585535 3300025904 Unclassified 616
743 Ga0207645_10034311 3300025907 Bacteria 3260
744 Ga0207645_10348438 3300025907 Bacteria 991
745 Ga0207645_10574935 3300025907 Bacteria 765
746 Ga0207643_10007213 3300025908 Bacteria 5967
747 Ga0207643_10010917 3300025908 Bacteria 4899
748 Ga0207643_10228242 3300025908 Bacteria 1141
749 Ga0207643_10398919 3300025908 Unclassified 869
750 Ga0207643_10838481 3300025908 Unclassified 596
751 Ga0207684_10007353 3300025910 Bacteria 9935
752 Ga0207684_10027931 3300025910 Unclassified 4806
753 Ga0207684_10089034 3300025910 Unclassified 2630
754 Ga0207684_10116395 3300025910 Bacteria 2290
755 Ga0207684_10447954 3300025910 Bacteria 1108
756 Ga0207654_10021305 3300025911 Bacteria 3445
757 Ga0207654_10024471 3300025911 Bacteria 3247
758 Ga0207654_10081241 3300025911 Bacteria 1951
759 Ga0207654_10375203 3300025911 Unclassified 984
760 Ga0207654_10638415 3300025911 Bacteria 762
761 Ga0207654_10751407 3300025911 Bacteria 703
762 Ga0207654_10874236 3300025911 Unclassified 651
763 Ga0207707_10046482 3300025912 Bacteria 3781
764 Ga0207707_10085543 3300025912 Bacteria 2755
765 Ga0207695_10407813 3300025913 Bacteria 1243
766 Ga0207695_10895571 3300025913 Unclassified 767
767 Ga0207695_11705591 3300025913 Unclassified 511
768 Ga0207671_10386649 3300025914 Bacteria 1112
769 Ga0207671_10495067 3300025914 Unclassified 974
770 Ga0207671_10799703 3300025914 Bacteria 748
771 Ga0207671_10817099 3300025914 Bacteria 739
772 Ga0207660_10054047 3300025917 Bacteria 2865
773 Ga0207660_10378477 3300025917 Bacteria 1138
774 Ga0207660_10627322 3300025917 Bacteria 876
775 Ga0207660_10697038 3300025917 Bacteria 828
776 Ga0207662_10003190 3300025918 Bacteria 8392
777 Ga0207662_10017971 3300025918 Bacteria 4005
778 Ga0207662_10021969 3300025918 Bacteria 3653
779 Ga0207662_10112076 3300025918 Bacteria 1702
780 Ga0207662_10113569 3300025918 Unclassified 1691
781 Ga0207662_10272566 3300025918 Bacteria 1117
782 Ga0207662_10311410 3300025918 Bacteria 1049
783 Ga0207657_10133707 3300025919 Bacteria 2031
784 Ga0207652_10038997 3300025921 Bacteria 4030
785 Ga0207652_10126285 3300025921 Bacteria 2279
786 Ga0207652_11560473 3300025921 Unclassified 564
787 Ga0207646_10102864 3300025922 Bacteria 2561
788 Ga0207646_10361169 3300025922 Unclassified 1312
789 Ga0207646_11520278 3300025922 Unclassified 579
790 Ga0207646_11917737 3300025922 Unclassified 505
791 Ga0207681_10001745 3300025923 Bacteria 13958
792 Ga0207681_10005262 3300025923 Bacteria 7950
793 Ga0207681_10011079 3300025923 Bacteria 5537
794 Ga0207681_10173897 3300025923 Unclassified 1634
795 Ga0207681_10690261 3300025923 Bacteria 848
796 Ga0207681_10840511 3300025923 Bacteria 768
797 Ga0207681_11631206 3300025923 Unclassified 540
798 Ga0207694_10020544 3300025924 Bacteria 4998
799 Ga0207694_10087086 3300025924 Bacteria 2460
800 Ga0207694_10592267 3300025924 Bacteria 932
801 Ga0207694_11395115 3300025924 Unclassified 592
802 Ga0207650_10000001 3300025925 Bacteria 1545726
803 Ga0207650_10122387 3300025925 Bacteria 2027
804 Ga0207650_10239752 3300025925 Bacteria 1465
805 Ga0207650_10454063 3300025925 Unclassified 1067
806 Ga0207650_10502487 3300025925 Bacteria 1013
807 Ga0207650_10510627 3300025925 Unclassified 1005
808 Ga0207650_10702916 3300025925 Unclassified 854
809 Ga0207650_10875432 3300025925 Bacteria 762
810 Ga0207659_10059289 3300025926 Bacteria 2751
811 Ga0207659_10298746 3300025926 Bacteria 1322
812 Ga0207659_10485962 3300025926 Bacteria 1044
813 Ga0207659_11041545 3300025926 Bacteria 704
814 Ga0207659_11413124 3300025926 Unclassified 596
815 Ga0207687_10325267 3300025927 Unclassified 1246
816 Ga0207687_10499295 3300025927 Unclassified 1015
817 Ga0207687_11360645 3300025927 Unclassified 610
818 Ga0207644_10024830 3300025931 Bacteria 4117
819 Ga0207644_10115193 3300025931 Bacteria 2038
820 Ga0207690_10214084 3300025932 Bacteria 1471
821 Ga0207690_11012654 3300025932 Unclassified 691
822 Ga0207706_10062945 3300025933 Bacteria 3267
823 Ga0207706_10335404 3300025933 Bacteria 1315
824 Ga0207706_10633594 3300025933 Bacteria 917
825 Ga0207706_11337085 3300025933 Unclassified 591
826 Ga0207686_10033667 3300025934 Unclassified 3060
827 Ga0207686_10072162 3300025934 Bacteria 2224
828 Ga0207686_10074054 3300025934 Bacteria 2199
829 Ga0207686_10546754 3300025934 Bacteria 905
830 Ga0207709_10037714 3300025935 Bacteria 2873
831 Ga0207709_10066783 3300025935 Bacteria 2267
832 Ga0207709_10167894 3300025935 Unclassified 1537
833 Ga0207709_11205968 3300025935 Unclassified 624
834 Ga0207670_10000250 3300025936 Bacteria 33568
835 Ga0207670_10060445 3300025936 Bacteria 2582
836 Ga0207670_10161749 3300025936 Bacteria 1671
837 Ga0207670_10245468 3300025936 Unclassified 1381
838 Ga0207670_10518059 3300025936 Unclassified 970
839 Ga0207670_11267194 3300025936 Unclassified 625
840 Ga0207670_11662353 3300025936 Unclassified 543
841 Ga0207669_10110184 3300025937 Bacteria 1843
842 Ga0207669_11510085 3300025937 Unclassified 573
843 Ga0207704_10109975 3300025938 Bacteria 1860
844 Ga0207704_10294809 3300025938 Bacteria 1239
845 Ga0207704_11134156 3300025938 Unclassified 665
846 Ga0207665_10010591 3300025939 Bacteria 6057
847 Ga0207691_10001421 3300025940 Bacteria 23877
848 Ga0207691_10249155 3300025940 Unclassified 1534
849 Ga0207691_10265369 3300025940 Bacteria 1479
850 Ga0207691_10818876 3300025940 Bacteria 782
851 Ga0207691_11218298 3300025940 Unclassified 624
852 Ga0207711_10019129 3300025941 Bacteria 5700
853 Ga0207711_10028277 3300025941 Bacteria 4717
854 Ga0207711_10132721 3300025941 Bacteria 2234
855 Ga0207711_10159891 3300025941 Bacteria 2038
856 Ga0207711_10367803 3300025941 Bacteria 1333
857 Ga0207711_10586249 3300025941 Unclassified 1040
858 Ga0207711_11700855 3300025941 Unclassified 574
859 Ga0207689_10002102 3300025942 Bacteria 18756
860 Ga0207689_10009874 3300025942 Bacteria 8227
861 Ga0207689_10019251 3300025942 Bacteria 5755
862 Ga0207689_10085862 3300025942 Bacteria 2587
863 Ga0207689_10257770 3300025942 Bacteria 1443
864 Ga0207689_10282044 3300025942 Bacteria 1376
865 Ga0207689_10510964 3300025942 Unclassified 1007
866 Ga0207689_10542066 3300025942 Bacteria 977
867 Ga0207689_10648118 3300025942 Bacteria 890
868 Ga0207689_10707242 3300025942 Bacteria 850
869 Ga0207689_10754913 3300025942 Unclassified 821
870 Ga0207689_10788582 3300025942 Unclassified 802
871 Ga0207689_10926654 3300025942 Unclassified 735
872 Ga0207689_10944754 3300025942 Unclassified 727
873 Ga0207689_11332472 3300025942 Unclassified 603
874 Ga0207679_10106366 3300025945 Bacteria 2205
875 Ga0207679_10166511 3300025945 Bacteria 1810
876 Ga0207679_10170112 3300025945 Bacteria 1793
877 Ga0207679_10229146 3300025945 Unclassified 1567
878 Ga0207679_10277000 3300025945 Unclassified 1437
879 Ga0207667_10847312 3300025949 Bacteria 908
880 Ga0207651_10055671 3300025960 Bacteria 2718
881 Ga0207651_10059925 3300025960 Bacteria 2639
882 Ga0207651_10294305 3300025960 Bacteria 1347
883 Ga0207651_10661637 3300025960 Bacteria 917
884 Ga0207651_10727138 3300025960 Unclassified 876
885 Ga0207651_10970417 3300025960 Unclassified 759
886 Ga0207712_10000925 3300025961 Bacteria 21172
887 Ga0207712_10005189 3300025961 Bacteria 8239
888 Ga0207712_10060667 3300025961 Bacteria 2682
889 Ga0207712_10402521 3300025961 Bacteria 1151
890 Ga0207712_10551239 3300025961 Bacteria 992
891 Ga0207668_10005063 3300025972 Bacteria 7760
892 Ga0207668_10757806 3300025972 Unclassified 857
893 Ga0207668_10776161 3300025972 Unclassified 847
894 Ga0207640_10129325 3300025981 Bacteria 1823
895 Ga0207640_10255625 3300025981 Bacteria 1362
896 Ga0207640_10265896 3300025981 Bacteria 1339
897 Ga0207640_10419195 3300025981 Unclassified 1095
898 Ga0207640_10470027 3300025981 Bacteria 1041
899 Ga0207640_10482314 3300025981 Bacteria 1029
900 Ga0207640_10848135 3300025981 Unclassified 795
901 Ga0207640_11213186 3300025981 Unclassified 671
902 Ga0207658_11556665 3300025986 Unclassified 604
903 Ga0207677_10299601 3300026023 Unclassified 1327
904 Ga0207677_10732929 3300026023 Bacteria 880
905 Ga0207677_11268258 3300026023 Unclassified 676
906 Ga0207677_12002085 3300026023 Unclassified 538
907 Ga0207703_10016211 3300026035 Bacteria 5808
908 Ga0207703_10102323 3300026035 Unclassified 2430
909 Ga0207703_10103548 3300026035 Bacteria 2416
910 Ga0207703_10108277 3300026035 Bacteria 2367
911 Ga0207703_10108349 3300026035 Unclassified 2366
912 Ga0207703_10134608 3300026035 Bacteria 2138
913 Ga0207703_10299400 3300026035 Bacteria 1466
914 Ga0207703_10337432 3300026035 Unclassified 1384
915 Ga0207703_10773934 3300026035 Unclassified 915
916 Ga0207639_10130352 3300026041 Bacteria 2081
917 Ga0207639_10875156 3300026041 Bacteria 839
918 Ga0207639_11616690 3300026041 Unclassified 608
919 Ga0207639_11744465 3300026041 Unclassified 583
920 Ga0207639_12095856 3300026041 Unclassified 527
921 Ga0207678_10618636 3300026067 Bacteria 950
922 Ga0207678_10817605 3300026067 Unclassified 823
923 Ga0207708_10000196 3300026075 Bacteria 47880
924 Ga0207708_10024519 3300026075 Bacteria 4563
925 Ga0207708_10025822 3300026075 Bacteria 4445
926 Ga0207708_10097546 3300026075 Bacteria 2271
927 Ga0207708_10167033 3300026075 Bacteria 1740
928 Ga0207708_10448049 3300026075 Bacteria 1075
929 Ga0207708_10716997 3300026075 Unclassified 856
930 Ga0207702_10023166 3300026078 Bacteria 5150
931 Ga0207702_10865586 3300026078 Bacteria 895
932 Ga0207641_10053400 3300026088 Unclassified 3425
933 Ga0207641_10066364 3300026088 Bacteria 3088
934 Ga0207641_10229101 3300026088 Unclassified 1726
935 Ga0207641_10235805 3300026088 Unclassified 1702
936 Ga0207641_10390624 3300026088 Unclassified 1334
937 Ga0207641_10402557 3300026088 Unclassified 1314
938 Ga0207641_10758443 3300026088 Unclassified 958
939 Ga0207641_10774450 3300026088 Unclassified 948
940 Ga0207641_11474433 3300026088 Bacteria 682
941 Ga0207641_11489598 3300026088 Unclassified 678
942 Ga0207641_12206487 3300026088 Unclassified 551
943 Ga0207648_10025398 3300026089 Bacteria 5277
944 Ga0207648_10041315 3300026089 Bacteria 4050
945 Ga0207648_10052268 3300026089 Bacteria 3572
946 Ga0207648_10052499 3300026089 Unclassified 3564
947 Ga0207648_10085766 3300026089 Bacteria 2747
948 Ga0207648_10209835 3300026089 Unclassified 1728
949 Ga0207648_10323595 3300026089 Unclassified 1386
950 Ga0207648_10889543 3300026089 Unclassified 831
951 Ga0207676_10003808 3300026095 Bacteria 10661
952 Ga0207676_10022718 3300026095 Bacteria 4616
953 Ga0207676_10037473 3300026095 Unclassified 3695
954 Ga0207676_10057488 3300026095 Unclassified 3063
955 Ga0207676_10135355 3300026095 Unclassified 2101
956 Ga0207676_10205522 3300026095 Unclassified 1743
957 Ga0207676_10358770 3300026095 Bacteria 1350
958 Ga0207676_10376937 3300026095 Bacteria 1319
959 Ga0207676_10700037 3300026095 Unclassified 981
960 Ga0207676_10750417 3300026095 Bacteria 949
961 Ga0207676_10767034 3300026095 Unclassified 939
962 Ga0207676_10779227 3300026095 Bacteria 932
963 Ga0207676_10813426 3300026095 Bacteria 912
964 Ga0207676_11488444 3300026095 Bacteria 674
965 Ga0207676_12000387 3300026095 Unclassified 578
966 Ga0207676_12101541 3300026095 Unclassified 563
967 Ga0207674_10001115 3300026116 Bacteria 34877
968 Ga0207674_10033931 3300026116 Bacteria 5339
969 Ga0207674_10141200 3300026116 Bacteria 2368
970 Ga0207674_10303859 3300026116 Bacteria 1545
971 Ga0207674_10308047 3300026116 Bacteria 1533
972 Ga0207674_10453802 3300026116 Bacteria 1239
973 Ga0207674_10564187 3300026116 Bacteria 1100
974 Ga0207674_10575997 3300026116 Bacteria 1087
975 Ga0207674_10697484 3300026116 Bacteria 980
976 Ga0207674_10861047 3300026116 Unclassified 874
977 Ga0207674_11416742 3300026116 Bacteria 664
978 Ga0207674_11433392 3300026116 Bacteria 660
979 Ga0207674_11481291 3300026116 Bacteria 648
980 Ga0207674_11957967 3300026116 Bacteria 551
981 Ga0207675_100008300 3300026118 Bacteria 9782
982 Ga0207675_100010894 3300026118 Bacteria 8517
983 Ga0207675_100017343 3300026118 Bacteria 6721
984 Ga0207675_100027734 3300026118 Bacteria 5275
985 Ga0207675_100037404 3300026118 Bacteria 4527
986 Ga0207675_100188276 3300026118 Bacteria 1979
987 Ga0207675_100233282 3300026118 Bacteria 1776
988 Ga0207675_101488183 3300026118 Bacteria 698
989 Ga0207683_10622903 3300026121 Bacteria 999
990 Ga0207683_10870574 3300026121 Bacteria 836
991 Ga0207698_10201010 3300026142 Bacteria 1784
992 Ga0207698_10420263 3300026142 Unclassified 1283
993 Ga0207698_10490958 3300026142 Bacteria 1193
994 Ga0207698_10636677 3300026142 Unclassified 1055
995 Ga0207698_11330789 3300026142 Unclassified 733
996 Ga0207698_11516620 3300026142 Unclassified 686
997 Ga0207428_10003589 3300027907 Bacteria 14977
998 Ga0207428_10144878 3300027907 Bacteria 1811
999 Ga0268266_11929848 3300028379 Unclassified 564
1000 Ga0268265_10131993 3300028380 Bacteria 2077
1001 Ga0268265_10160070 3300028380 Bacteria 1911
1002 Ga0268265_10223551 3300028380 Unclassified 1649
1003 Ga0268265_10247986 3300028380 Bacteria 1575
1004 Ga0268265_10412166 3300028380 Bacteria 1252
1005 Ga0268265_10685754 3300028380 Bacteria 988
1006 Ga0268265_11058294 3300028380 Bacteria 804
1007 Ga0268265_11116515 3300028380 Bacteria 783
1008 Ga0268265_11299895 3300028380 Bacteria 727
1009 Ga0268265_12635367 3300028380 Unclassified 508
1010 Ga0268264_10027695 3300028381 Bacteria 4632
1011 Ga0268264_10036791 3300028381 Bacteria 4034
1012 Ga0268264_10049768 3300028381 Bacteria 3488
1013 Ga0268264_10055988 3300028381 Bacteria 3295
1014 Ga0268264_10117447 3300028381 Bacteria 2339
1015 Ga0268264_10147987 3300028381 Unclassified 2102
1016 Ga0268264_10149519 3300028381 Bacteria 2092
1017 Ga0268264_11503126 3300028381 Unclassified 684
1018 Ga0314311_1194228 3300030733 Bacteria 624
1019 Ga0307408_100013384 3300031548 Bacteria 5444
1020 Ga0307408_100042473 3300031548 Bacteria 3230
1021 Ga0307408_100078016 3300031548 Bacteria 2468
1022 Ga0307408_100133239 3300031548 Unclassified 1941
1023 Ga0307408_100312757 3300031548 Unclassified 1320
1024 Ga0307408_100447848 3300031548 Bacteria 1119
1025 Ga0307408_100654400 3300031548 Bacteria 940
1026 Ga0307408_100994338 3300031548 Unclassified 773
1027 Ga0307408_101918147 3300031548 Unclassified 568
1028 Ga0307405_10015061 3300031731 Bacteria 4176
1029 Ga0307405_10018481 3300031731 Bacteria 3846
1030 Ga0307405_10046932 3300031731 Bacteria 2657
1031 Ga0307405_10415295 3300031731 Bacteria 1057
1032 Ga0307405_10706150 3300031731 Bacteria 836
1033 Ga0307413_10036152 3300031824 Bacteria 2841
1034 Ga0307413_10100182 3300031824 Bacteria 1912
1035 Ga0307413_11238427 3300031824 Bacteria 650
1036 Ga0307410_10002023 3300031852 Bacteria 9564
1037 Ga0307410_10061258 3300031852 Bacteria 2575
1038 Ga0307406_10007704 3300031901 Bacteria 5981
1039 Ga0307406_10092030 3300031901 Bacteria 2044
1040 Ga0307407_10009256 3300031903 Bacteria 4577
1041 Ga0307407_10061460 3300031903 Bacteria 2196
1042 Ga0307412_10018014 3300031911 Unclassified 4239
1043 Ga0307412_10215432 3300031911 Bacteria 1468
1044 Ga0307412_10271605 3300031911 Unclassified 1327
1045 Ga0307412_10458779 3300031911 Bacteria 1052
1046 Ga0307412_11048530 3300031911 Unclassified 723
1047 Ga0307412_12140038 3300031911 Unclassified 520
1048 Ga0307409_100075645 3300031995 Bacteria 2697
1049 Ga0307409_100173127 3300031995 Bacteria 1902
1050 Ga0307409_100603566 3300031995 Bacteria 1085
1051 Ga0307409_100684462 3300031995 Bacteria 1023
1052 Ga0307409_101788176 3300031995 Unclassified 644
1053 Ga0307416_100010309 3300032002 Bacteria 6166
1054 Ga0307416_100172642 3300032002 Bacteria 2015
1055 Ga0307416_100224473 3300032002 Unclassified 1805
1056 Ga0307416_100563007 3300032002 Unclassified 1215
1057 Ga0307414_10007653 3300032004 Bacteria 6081
1058 Ga0307414_10512349 3300032004 Bacteria 1063
1059 Ga0307414_10513069 3300032004 Bacteria 1063
1060 Ga0307414_10657281 3300032004 Unclassified 945
1061 Ga0307411_10028911 3300032005 Bacteria 3377
1062 Ga0307411_10056612 3300032005 Bacteria 2585
1063 Ga0307411_10298789 3300032005 Bacteria 1290
1064 Ga0307415_100007828 3300032126 Bacteria 5873
1065 Ga0307415_100009415 3300032126 Bacteria 5474
1066 Ga0307415_100277030 3300032126 Bacteria 1377
1067 Ga0307415_100792534 3300032126 Unclassified 864
1068 Ga0307415_100948819 3300032126 Bacteria 796
1069 Ga0373930_0070262 3300034816 Bacteria 795
1070 Ga0373940_0092151 3300035088 Unclassified 909
1071 Ga0373951_0000266 3300035091 Bacteria 17178
1072 Ga0373951_0043101 3300035091 Unclassified 1093
1073 Ga0373941_0009951 3300035115 Bacteria 2412
1074 Ga0373941_0070196 3300035115 Bacteria 1161
1075 Ga0373941_0101565 3300035115 Unclassified 1002
1076 Ga0373955_0236707 3300035172 Unclassified 1093
1077 Ga0373931_0134736 3300035691 Unclassified 1425
1078 Ga0373937_0026568 3300036401 Bacteria 5231
1079 Ga0395899_0717104 3300037312 Unclassified 626
1080 Ga0395900_0071081 3300037418 Bacteria 3577
1081 Ga0395900_0174348 3300037418 Unclassified 2188
1082 Ga0395900_1741907 3300037418 Unclassified 534
1083 Ga0395898_0042223 3300037466 Bacteria 4501
1084 Ga0395898_0689554 3300037466 Unclassified 963
1085 Ga0395898_0890092 3300037466 Bacteria 829
1086 Ga0395905_0001898 3300037471 Bacteria 24069
1087 Ga0395905_0149690 3300037471 Bacteria 2196
1088 Ga0395901_1863149 3300038443 Unclassified 550
1089 Ga0242422_00216 3300038699 Bacteria 3315
1090 Ga0242420_004095 3300038996 Bacteria 2187
1091 Ga0436365_1124199 3300039437 Bacteria 4361
1092 Ga0436360_1140381 3300039438 Bacteria 8137
1093 Ga0436361_1173708 3300039447 Bacteria 1638
1094 Ga0436362_0522576 3300039453 Bacteria 1878
1095 Ga0439466_0120413 3300041411 Unclassified 811
1096 Ga0439465_0407354 3300041413 Unclassified 518
1097 Ga0451851_0683408 3300041507 Unclassified 525
1098 Ga0439448_0113932 3300042005 Unclassified 925
1099 Ga0439432_041430 3300042006 Unclassified 1458
1100 Ga0439455_0002290 3300042012 Bacteria 3447
1101 Ga0439462_0089555 3300042015 Unclassified 844
1102 Ga0450914_005011 3300042118 Unclassified 1105
1103 Ga0439458_0001735 3300042157 Bacteria 5441
1104 Ga0439434_0077574 3300042435 Bacteria 1051
1105 Ga0451577_1947822 3300042876 Unclassified 514
1106 Ga0451576_0548841 3300045051 Unclassified 1214
1107 Ga0495582_0203607 3300046473 Unclassified 1130
1108 Ga0495613_0236034 3300046689 Unclassified 1280
1109 Ga0496100_0152678 3300048903 Unclassified 1649
1110 Ga0496102_0011427 3300048905 Bacteria 7655
1111 Ga0496102_0116640 3300048905 Bacteria 2492
1112 Ga0496102_0953668 3300048905 Unclassified 779
1113 Ga0496103_0311167 3300048906 Bacteria 1013
1114 Ga0496104_0063329 3300048907 Bacteria 3507
1115 Ga0496104_0349306 3300048907 Bacteria 1392
1116 Ga0496105_0667348 3300048908 Bacteria 801
1117 Ga0496106_0055940 3300048909 Bacteria 2983
1118 Ga0496106_0234795 3300048909 Bacteria 1465
1119 Ga0496106_0476520 3300048909 Bacteria 1003
1120 Ga0496106_0531911 3300048909 Bacteria 944
1121 Ga0496106_1307781 3300048909 Unclassified 563
1122 Ga0496107_0013028 3300048910 Bacteria 5809
1123 Ga0496108_1061094 3300048911 Unclassified 690
1124 Ga0496109_0512991 3300048912 Bacteria 1132
1125 Ga0496109_1193651 3300048912 Unclassified 698
1126 Ga0496110_0499781 3300048913 Unclassified 1107
1127 Ga0496110_1019972 3300048913 Bacteria 735
1128 Ga0496110_1442206 3300048913 Unclassified 598
1129 Ga0496112_0025724 3300048915 Bacteria 5653
1130 Ga0496112_0162595 3300048915 Bacteria 2199
1131 Ga0496112_0174008 3300048915 Bacteria 2118
1132 Ga0496112_0333453 3300048915 Unclassified 1461
1133 Ga0496112_0561570 3300048915 Bacteria 1075
1134 Ga0496112_0776098 3300048915 Bacteria 884
1135 Ga0496112_1227017 3300048915 Bacteria 666
1136 Ga0496112_1243602 3300048915 Unclassified 661
1137 Ga0496112_1340555 3300048915 Unclassified 631
1138 Ga0496112_1674078 3300048915 Unclassified 549
1139 Ga0496113_0232300 3300048916 Bacteria 1471
1140 Ga0496113_0783022 3300048916 Unclassified 758
1141 Ga0496113_1238099 3300048916 Unclassified 582
1142 Ga0501306_025283 3300049127 Unclassified 854
1143 Ga0501307_016163 3300049162 Unclassified 928
1144 Ga0501290_004185 3300049513 Bacteria 1798
1145 Ga0501290_040259 3300049513 Unclassified 698
1146 Ga0501291_009882 3300049514 Bacteria 1346
1147 Ga0501291_010725 3300049514 Bacteria 1309
1148 Ga0501292_003121 3300049515 Bacteria 2192
1149 Ga0501292_003124 3300049515 Bacteria 2191
1150 Ga0501292_015946 3300049515 Unclassified 1178
1151 Ga0501295_054568 3300049518 Unclassified 863
1152 Ga0501295_055089 3300049518 Unclassified 859
1153 Ga0501296_003503 3300049519 Bacteria 1675
1154 Ga0501296_006498 3300049519 Bacteria 1326
1155 Ga0501297_005098 3300049520 Bacteria 1364
1156 Ga0501297_009085 3300049520 Bacteria 1106
1157 Ga0501297_031024 3300049520 Unclassified 712
1158 Ga0501298_002676 3300049521 Bacteria 2716
1159 Ga0501298_041241 3300049521 Unclassified 936
1160 Ga0501298_072257 3300049521 Unclassified 747
1161 Ga0501298_135017 3300049521 Bacteria 592
1162 Ga0501299_000754 3300049522 Bacteria 3928
1163 Ga0501299_007263 3300049522 Bacteria 1763
1164 Ga0501299_009672 3300049522 Unclassified 1595
1165 Ga0501300_004680 3300049523 Unclassified 2023
1166 Ga0501300_019111 3300049523 Bacteria 1001
1167 Ga0501303_005503 3300049526 Bacteria 1081
1168 Ga0501311_025714 3300049527 Unclassified 826
1169 Ga0501038_0032512 3300049574 Bacteria 4602
1170 Ga0501067_0638052 3300049583 Unclassified 598
1171 Ga0501072_0538087 3300049588 Bacteria 923
1172 Ga0501075_1329767 3300049591 Unclassified 544
1173 Ga0501198_001879 3300049649 Bacteria 2774
1174 Ga0501198_002730 3300049649 Unclassified 2389
1175 Ga0501199_010652 3300049650 Bacteria 986
1176 Ga0501202_001705 3300049652 Bacteria 3563
1177 Ga0501202_006175 3300049652 Bacteria 2137
1178 Ga0501202_111111 3300049652 Unclassified 678
1179 Ga0501206_003365 3300049653 Unclassified 2033
1180 Ga0501206_015357 3300049653 Unclassified 1059
1181 Ga0501208_004930 3300049655 Bacteria 1609
1182 Ga0501208_005660 3300049655 Bacteria 1549
1183 Ga0501209_020524 3300049656 Unclassified 1558
1184 Ga0501209_038598 3300049656 Unclassified 1252
1185 Ga0501214_002166 3300049659 Bacteria 1622
1186 Ga0501216_002071 3300049660 Bacteria 2810
1187 Ga0501216_003901 3300049660 Bacteria 2193
1188 Ga0501217_000517 3300049661 Bacteria 6418
1189 Ga0501217_002052 3300049661 Bacteria 3898
1190 Ga0501217_127653 3300049661 Unclassified 743
1191 Ga0501223_000504 3300049663 Bacteria 9463
1192 Ga0501223_006582 3300049663 Unclassified 2399
1193 Ga0501223_033979 3300049663 Bacteria 991
1194 Ga0501223_057581 3300049663 Unclassified 757
1195 Ga0501224_000129 3300049664 Bacteria 8262
1196 Ga0501224_003539 3300049664 Bacteria 2185
1197 Ga0501224_014757 3300049664 Bacteria 1156
1198 Ga0501224_063876 3300049664 Unclassified 576
1199 Ga0501227_000295 3300049665 Bacteria 10300
1200 Ga0501227_084440 3300049665 Unclassified 834
1201 Ga0501230_142613 3300049667 Unclassified 540
1202 Ga0501233_000556 3300049668 Bacteria 6049
1203 Ga0501233_005685 3300049668 Bacteria 2318
1204 Ga0501233_016218 3300049668 Unclassified 1543
1205 Ga0501235_000590 3300049669 Bacteria 7327
1206 Ga0501235_007415 3300049669 Bacteria 2390
1207 Ga0501235_047113 3300049669 Bacteria 994
1208 Ga0501235_121680 3300049669 Unclassified 653
1209 Ga0501235_201190 3300049669 Bacteria 539
1210 Ga0501238_019305 3300049671 Unclassified 957
1211 Ga0501239_001368 3300049672 Bacteria 2079
1212 Ga0501240_000221 3300049673 Bacteria 4271
1213 Ga0501240_037710 3300049673 Unclassified 794
1214 Ga0501242_044378 3300049674 Unclassified 637
1215 Ga0501243_011012 3300049675 Bacteria 1415
1216 Ga0501249_013420 3300049679 Bacteria 1741
1217 Ga0501249_160157 3300049679 Unclassified 571
1218 Ga0501250_001921 3300049680 Unclassified 1806
1219 Ga0501251_002794 3300049681 Unclassified 1710
1220 Ga0501251_008926 3300049681 Unclassified 1144
1221 Ga0501253_001363 3300049683 Bacteria 2469
1222 Ga0501253_017879 3300049683 Unclassified 1202
1223 Ga0501253_070491 3300049683 Unclassified 771
1224 Ga0501257_040736 3300049686 Bacteria 1140
1225 Ga0501257_068297 3300049686 Unclassified 905
1226 Ga0501257_119225 3300049686 Unclassified 705
1227 Ga0501259_001344 3300049688 Unclassified 4115
1228 Ga0501259_018316 3300049688 Bacteria 1222
1229 Ga0501259_050077 3300049688 Unclassified 845
1230 Ga0501260_040147 3300049689 Unclassified 565
1231 Ga0501221_023102 3300049704 Bacteria 1237
1232 Ga0501221_070746 3300049704 Bacteria 823
1233 Ga0501225_0000145 3300049705 Bacteria 21644
1234 Ga0501225_0042408 3300049705 Bacteria 1256
1235 Ga0501229_005664 3300049706 Unclassified 1536
1236 Ga0501234_000075 3300049707 Bacteria 12283
1237 Ga0501234_002153 3300049707 Bacteria 3113
1238 Ga0501234_011417 3300049707 Bacteria 1389
1239 Ga0501245_007712 3300049708 Bacteria 1524
1240 Ga0501245_012891 3300049708 Bacteria 1231
1241 Ga0501245_070538 3300049708 Unclassified 657
1242 Ga0501081_0866181 3300049743 Bacteria 681
1243 Ga0501241_163592 3300049758 Unclassified 519
1244 Ga0501263_009001 3300049760 Unclassified 1202
1245 Ga0501263_044794 3300049760 Bacteria 659
1246 Ga0501265_053833 3300049762 Bacteria 640
1247 Ga0501266_022281 3300049763 Unclassified 870
1248 Ga0501267_053164 3300049764 Unclassified 532
1249 Ga0501270_051266 3300049767 Bacteria 748
1250 Ga0501272_012536 3300049769 Bacteria 964
1251 Ga0501272_023309 3300049769 Unclassified 754
1252 Ga0501273_003589 3300049770 Bacteria 1657
1253 Ga0501273_011933 3300049770 Bacteria 1088
1254 Ga0501278_002788 3300049774 Bacteria 1223
1255 Ga0501278_004265 3300049774 Unclassified 1028
1256 Ga0501279_001580 3300049775 Bacteria 2997
1257 Ga0501279_001951 3300049775 Bacteria 2720
1258 Ga0501283_009914 3300049779 Unclassified 1396
1259 Ga0501283_011895 3300049779 Unclassified 1301
1260 Ga0501283_048461 3300049779 Unclassified 748
1261 Ga0501204_015500 3300049850 Bacteria 947
1262 Ga0501212_001962 3300049851 Bacteria 2418
1263 Ga0501226_002189 3300049853 Bacteria 2417
1264 Ga0501226_005552 3300049853 Bacteria 1435
1265 nmdc:mga05p37_1986380_c1 3300050507 Unclassified 551
1266 nmdc:mga05p37_275177_c1 3300050507 Bacteria 2010
1267 nmdc:mga05p37_301069_c1 3300050507 Bacteria 1905
1268 nmdc:mga05p37_320629_c1 3300050507 Bacteria 1834
1269 nmdc:mga05p37_558118_c1 3300050507 Bacteria 1302
1270 nmdc:mga05p37_860956_c1 3300050507 Unclassified 983
1271 nmdc:mga09592_1449450_c1 3300050508 Unclassified 560
1272 nmdc:mga09592_440863_c1 3300050508 Bacteria 1124
1273 nmdc:mga09592_71662_c1 3300050508 Bacteria 2941
1274 nmdc:mga09592_898796_c1 3300050508 Unclassified 744
1275 nmdc:mga09592_92749_c1 3300050508 Bacteria 2582
1276 nmdc:mga0qj67_16939_c1 3300050509 Bacteria 5535
1277 nmdc:mga0qj67_221311_c1 3300050509 Bacteria 1537
1278 nmdc:mga06r32_136876_c1 3300050510 Bacteria 2424
1279 nmdc:mga06r32_171085_c1 3300050510 Bacteria 2156
1280 nmdc:mga06r32_210654_c1 3300050510 Viruses 1931
1281 nmdc:mga06r32_831562_c1 3300050510 Bacteria 883
1282 nmdc:mga08y16_143327_c1 3300050511 Bacteria 2484
1283 nmdc:mga08y16_325364_c1 3300050511 Bacteria 1582
1284 nmdc:mga08y16_3905_c1 3300050511 Bacteria 15524
1285 nmdc:mga0n895_1528387_c1 3300050512 Unclassified 633
1286 nmdc:mga0n895_163075_c1 3300050512 Bacteria 2260
1287 nmdc:mga0n895_438430_c1 3300050512 Unclassified 1320
1288 nmdc:mga0n895_693258_c1 3300050512 Unclassified 1015
1289 nmdc:mga0a205_312347_c1 3300050515 Unclassified 1444
1290 nmdc:mga0a205_496004_c1 3300050515 Bacteria 1078
1291 nmdc:mga0a205_512442_c1 3300050515 Unclassified 1056
1292 nmdc:mga0a205_535885_c1 3300050515 Bacteria 1026
1293 nmdc:mga0a205_75331_c1 3300050515 Bacteria 3261
1294 nmdc:mga0a205_84544_c1 3300050515 Bacteria 3065
1295 nmdc:mga0a205_878738_c1 3300050515 Unclassified 743
1296 Ga0501084_0801137 3300054114 Bacteria 793

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049650 Ga0501199_010652 Ga0501199_010652_102_437 100
2 3300005545 Ga0070695_100391276 Ga0070695_1003912761 103
3 3300013308 Ga0157375_10073908 Ga0157375_100739082 103
4 iso_pu_bacteria 2857604169 2857607649 103
5 iso_pu_bacteria 2857609550 2857611071 103
6 iso_pu_bacteria 3001892409 3001893421 103
7 3300005345 Ga0070692_11280678 Ga0070692_112806781 104
8 3300009177 Ga0105248_11486161 Ga0105248_114861612 104
9 3300048909 Ga0496106_0055940 Ga0496106_0055940_2110_2445 104
10 3300048910 Ga0496107_0013028 Ga0496107_0013028_3171_3506 104
11 3300049688 Ga0501259_001344 Ga0501259_001344_3305_3625 105
12 3300005459 Ga0068867_100236278 Ga0068867_1002362782 107
13 3300021358 Ga0213873_10024794 Ga0213873_100247942 107
14 3300021361 Ga0213872_10026992 Ga0213872_100269923 107
15 3300021441 Ga0213871_10177439 Ga0213871_101774391 107
16 3300025918 Ga0207662_10272566 Ga0207662_102725662 107
17 3300037312 Ga0395899_0717104 Ga0395899_0717104_58_387 107
18 3300039438 Ga0436360_1140381 Ga0436360_1140381_1913_2236 107
19 3300039447 Ga0436361_1173708 Ga0436361_1173708_898_1221 107
20 3300039453 Ga0436362_0522576 Ga0436362_0522576_990_1313 107
21 3300049664 Ga0501224_000129 Ga0501224_000129_6051_6380 108
22 2088090002 CNA_F6ESG4R02GEH5A CNA_00279590 110
23 2162886007 SwRhRL2b_contig_36198 SwRhRL2b_0769.00008810 110
24 3300000532 CNAas_1000886 CNAas_10008863 110
25 3300001990 JGI24737J22298_10073203 JGI24737J22298_100732032 110
26 3300002459 JGI24751J29686_10000009 JGI24751J29686_1000000947 110
27 3300003203 JGI25406J46586_10004348 JGI25406J46586_100043482 110
28 3300003203 JGI25406J46586_10019122 JGI25406J46586_100191224 110
29 3300003322 rootL2_10187274 rootL2_101872743 110
30 3300005288 Ga0065714_10064433 Ga0065714_1006443367 110
31 3300005289 Ga0065704_10007866 Ga0065704_100078663 110
32 3300005289 Ga0065704_10032831 Ga0065704_100328311 110
33 3300005289 Ga0065704_10071538 Ga0065704_1007153810 110
34 3300005289 Ga0065704_10541735 Ga0065704_105417351 110
35 3300005290 Ga0065712_10009957 Ga0065712_100099573 110
36 3300005290 Ga0065712_10027774 Ga0065712_100277742 110
37 3300005290 Ga0065712_10067731 Ga0065712_1006773167 110
38 3300005290 Ga0065712_10073465 Ga0065712_100734655 110
39 3300005290 Ga0065712_10155211 Ga0065712_101552112 110
40 3300005290 Ga0065712_10231027 Ga0065712_102310271 110
41 3300005290 Ga0065712_10285635 Ga0065712_102856352 110
42 3300005290 Ga0065712_10327933 Ga0065712_103279331 110
43 3300005293 Ga0065715_10018282 Ga0065715_100182822 110
44 3300005293 Ga0065715_10088984 Ga0065715_1008898411 110
45 3300005293 Ga0065715_10091196 Ga0065715_100911967 110
46 3300005293 Ga0065715_10125119 Ga0065715_101251193 110
47 3300005293 Ga0065715_10143210 Ga0065715_101432102 110
48 3300005293 Ga0065715_10207992 Ga0065715_102079922 110
49 3300005293 Ga0065715_10221797 Ga0065715_102217972 110
50 3300005293 Ga0065715_10273611 Ga0065715_102736111 110
51 3300005293 Ga0065715_10289947 Ga0065715_102899472 110
52 3300005293 Ga0065715_10384937 Ga0065715_103849372 110
53 3300005293 Ga0065715_10474231 Ga0065715_104742312 110
54 3300005293 Ga0065715_10505085 Ga0065715_105050851 110
55 3300005293 Ga0065715_10624198 Ga0065715_106241981 110
56 3300005293 Ga0065715_10641742 Ga0065715_106417421 110
57 3300005293 Ga0065715_10697873 Ga0065715_106978732 110
58 3300005293 Ga0065715_10867509 Ga0065715_108675091 110
59 3300005293 Ga0065715_10883610 Ga0065715_108836102 110
60 3300005295 Ga0065707_10001225 Ga0065707_100012259 110
61 3300005295 Ga0065707_10005905 Ga0065707_100059054 110
62 3300005295 Ga0065707_10013054 Ga0065707_100130541 110
63 3300005295 Ga0065707_10051064 Ga0065707_100510642 110
64 3300005295 Ga0065707_10136610 Ga0065707_101366103 110
65 3300005295 Ga0065707_10149427 Ga0065707_101494273 110
66 3300005295 Ga0065707_10359985 Ga0065707_103599852 110
67 3300005328 Ga0070676_10061800 Ga0070676_100618003 110
68 3300005328 Ga0070676_10080976 Ga0070676_100809763 110
69 3300005328 Ga0070676_10370433 Ga0070676_103704331 110
70 3300005330 Ga0070690_100001514 Ga0070690_10000151412 110
71 3300005330 Ga0070690_100001806 Ga0070690_1000018062 110
72 3300005330 Ga0070690_100005902 Ga0070690_1000059027 110
73 3300005330 Ga0070690_100079209 Ga0070690_1000792093 110
74 3300005331 Ga0070670_100000088 Ga0070670_10000008824 110
75 3300005331 Ga0070670_100153806 Ga0070670_1001538063 110
76 3300005331 Ga0070670_100308249 Ga0070670_1003082491 110
77 3300005331 Ga0070670_100379324 Ga0070670_1003793241 110
78 3300005331 Ga0070670_100625843 Ga0070670_1006258432 110
79 3300005331 Ga0070670_100702955 Ga0070670_1007029552 110
80 3300005331 Ga0070670_100710091 Ga0070670_1007100911 110
81 3300005331 Ga0070670_101068261 Ga0070670_1010682611 110
82 3300005331 Ga0070670_101185976 Ga0070670_1011859762 110
83 3300005331 Ga0070670_101393369 Ga0070670_1013933691 110
84 3300005331 Ga0070670_101641100 Ga0070670_1016411001 110
85 3300005333 Ga0070677_10058682 Ga0070677_100586822 110
86 3300005333 Ga0070677_10325884 Ga0070677_103258841 110
87 3300005333 Ga0070677_10744176 Ga0070677_107441761 110
88 3300005334 Ga0068869_100048762 Ga0068869_1000487622 110
89 3300005334 Ga0068869_100077696 Ga0068869_1000776962 110
90 3300005334 Ga0068869_100081484 Ga0068869_1000814842 110
91 3300005334 Ga0068869_100107136 Ga0068869_1001071364 110
92 3300005334 Ga0068869_100183011 Ga0068869_1001830111 110
93 3300005334 Ga0068869_100199500 Ga0068869_1001995001 110
94 3300005334 Ga0068869_100275367 Ga0068869_1002753672 110
95 3300005334 Ga0068869_100294542 Ga0068869_1002945422 110
96 3300005334 Ga0068869_100328054 Ga0068869_1003280541 110
97 3300005334 Ga0068869_100365907 Ga0068869_1003659071 110
98 3300005334 Ga0068869_100496927 Ga0068869_1004969272 110
99 3300005334 Ga0068869_100720690 Ga0068869_1007206902 110
100 3300005334 Ga0068869_101048249 Ga0068869_1010482492 110
101 3300005335 Ga0070666_10009988 Ga0070666_100099887 110
102 3300005335 Ga0070666_10151870 Ga0070666_101518701 110
103 3300005335 Ga0070666_10538277 Ga0070666_105382772 110
104 3300005335 Ga0070666_10643633 Ga0070666_106436331 110
105 3300005336 Ga0070680_100029340 Ga0070680_1000293404 110
106 3300005336 Ga0070680_100083439 Ga0070680_1000834392 110
107 3300005336 Ga0070680_100449429 Ga0070680_1004494292 110
108 3300005337 Ga0070682_100053546 Ga0070682_1000535462 110
109 3300005337 Ga0070682_100295286 Ga0070682_1002952863 110
110 3300005337 Ga0070682_100971860 Ga0070682_1009718601 110
111 3300005338 Ga0068868_100035494 Ga0068868_1000354942 110
112 3300005338 Ga0068868_100068046 Ga0068868_1000680463 110
113 3300005338 Ga0068868_100300844 Ga0068868_1003008442 110
114 3300005338 Ga0068868_100315339 Ga0068868_1003153391 110
115 3300005338 Ga0068868_101171148 Ga0068868_1011711481 110
116 3300005338 Ga0068868_101728351 Ga0068868_1017283511 110
117 3300005339 Ga0070660_100079661 Ga0070660_1000796614 110
118 3300005340 Ga0070689_100017912 Ga0070689_1000179122 110
119 3300005340 Ga0070689_100035344 Ga0070689_1000353443 110
120 3300005340 Ga0070689_100058371 Ga0070689_1000583714 110
121 3300005340 Ga0070689_100334897 Ga0070689_1003348971 110
122 3300005340 Ga0070689_100574527 Ga0070689_1005745272 110
123 3300005340 Ga0070689_100682541 Ga0070689_1006825412 110
124 3300005340 Ga0070689_100934543 Ga0070689_1009345431 110
125 3300005340 Ga0070689_101361047 Ga0070689_1013610471 110
126 3300005340 Ga0070689_101401675 Ga0070689_1014016752 110
127 3300005340 Ga0070689_101904127 Ga0070689_1019041271 110
128 3300005340 Ga0070689_102136429 Ga0070689_1021364291 110
129 3300005341 Ga0070691_10227041 Ga0070691_102270411 110
130 3300005343 Ga0070687_100043878 Ga0070687_1000438781 110
131 3300005343 Ga0070687_100106748 Ga0070687_1001067482 110
132 3300005343 Ga0070687_100121283 Ga0070687_1001212832 110
133 3300005343 Ga0070687_100469532 Ga0070687_1004695322 110
134 3300005343 Ga0070687_100574786 Ga0070687_1005747861 110
135 3300005344 Ga0070661_100331197 Ga0070661_1003311971 110
136 3300005344 Ga0070661_101343904 Ga0070661_1013439042 110
137 3300005345 Ga0070692_10033025 Ga0070692_100330253 110
138 3300005345 Ga0070692_10042222 Ga0070692_100422222 110
139 3300005345 Ga0070692_10213690 Ga0070692_102136902 110
140 3300005345 Ga0070692_10241586 Ga0070692_102415861 110
141 3300005345 Ga0070692_10332116 Ga0070692_103321162 110
142 3300005345 Ga0070692_10348187 Ga0070692_103481871 110
143 3300005345 Ga0070692_11340428 Ga0070692_113404281 110
144 3300005347 Ga0070668_100008267 Ga0070668_1000082678 110
145 3300005347 Ga0070668_100854722 Ga0070668_1008547222 110
146 3300005353 Ga0070669_100030178 Ga0070669_1000301785 110
147 3300005353 Ga0070669_100031507 Ga0070669_1000315072 110
148 3300005353 Ga0070669_100037585 Ga0070669_1000375854 110
149 3300005353 Ga0070669_100061319 Ga0070669_1000613192 110
150 3300005353 Ga0070669_100284422 Ga0070669_1002844223 110
151 3300005353 Ga0070669_101209082 Ga0070669_1012090821 110
152 3300005354 Ga0070675_100077534 Ga0070675_1000775343 110
153 3300005354 Ga0070675_100274943 Ga0070675_1002749432 110
154 3300005354 Ga0070675_100287698 Ga0070675_1002876982 110
155 3300005354 Ga0070675_100553681 Ga0070675_1005536812 110
156 3300005354 Ga0070675_100695120 Ga0070675_1006951201 110
157 3300005354 Ga0070675_101406488 Ga0070675_1014064881 110
158 3300005355 Ga0070671_100024875 Ga0070671_1000248754 110
159 3300005355 Ga0070671_100111481 Ga0070671_1001114815 110
160 3300005355 Ga0070671_100170372 Ga0070671_1001703721 110
161 3300005355 Ga0070671_100897050 Ga0070671_1008970502 110
162 3300005355 Ga0070671_100913979 Ga0070671_1009139791 110
163 3300005356 Ga0070674_100190414 Ga0070674_1001904142 110
164 3300005356 Ga0070674_100470811 Ga0070674_1004708112 110
165 3300005364 Ga0070673_100077183 Ga0070673_1000771833 110
166 3300005364 Ga0070673_100081737 Ga0070673_1000817372 110
167 3300005364 Ga0070673_100084407 Ga0070673_1000844073 110
168 3300005364 Ga0070673_100246507 Ga0070673_1002465071 110
169 3300005364 Ga0070673_100331264 Ga0070673_1003312642 110
170 3300005364 Ga0070673_100413168 Ga0070673_1004131681 110
171 3300005364 Ga0070673_101789055 Ga0070673_1017890551 110
172 3300005364 Ga0070673_101967611 Ga0070673_1019676111 110
173 3300005365 Ga0070688_100044481 Ga0070688_1000444811 110
174 3300005365 Ga0070688_100607186 Ga0070688_1006071862 110
175 3300005365 Ga0070688_101002027 Ga0070688_1010020272 110
176 3300005365 Ga0070688_101146645 Ga0070688_1011466451 110
177 3300005366 Ga0070659_100008321 Ga0070659_1000083215 110
178 3300005366 Ga0070659_100495631 Ga0070659_1004956311 110
179 3300005366 Ga0070659_101122126 Ga0070659_1011221262 110
180 3300005367 Ga0070667_100018205 Ga0070667_1000182052 110
181 3300005367 Ga0070667_100889890 Ga0070667_1008898901 110
182 3300005367 Ga0070667_101554848 Ga0070667_1015548482 110
183 3300005438 Ga0070701_10045910 Ga0070701_100459102 110
184 3300005438 Ga0070701_10062048 Ga0070701_100620483 110
185 3300005438 Ga0070701_10153880 Ga0070701_101538802 110
186 3300005438 Ga0070701_10177803 Ga0070701_101778031 110
187 3300005438 Ga0070701_10669991 Ga0070701_106699911 110
188 3300005440 Ga0070705_100013030 Ga0070705_1000130303 110
189 3300005440 Ga0070705_100014024 Ga0070705_1000140245 110
190 3300005440 Ga0070705_100063379 Ga0070705_1000633793 110
191 3300005440 Ga0070705_100210162 Ga0070705_1002101621 110
192 3300005440 Ga0070705_100325751 Ga0070705_1003257512 110
193 3300005440 Ga0070705_100512693 Ga0070705_1005126932 110
194 3300005440 Ga0070705_100606653 Ga0070705_1006066532 110
195 3300005440 Ga0070705_100827386 Ga0070705_1008273862 110
196 3300005441 Ga0070700_100000120 Ga0070700_10000012016 110
197 3300005441 Ga0070700_100010579 Ga0070700_1000105793 110
198 3300005441 Ga0070700_100060229 Ga0070700_1000602292 110
199 3300005441 Ga0070700_100100878 Ga0070700_1001008783 110
200 3300005441 Ga0070700_100120895 Ga0070700_1001208952 110
201 3300005441 Ga0070700_100144818 Ga0070700_1001448182 110
202 3300005441 Ga0070700_100177323 Ga0070700_1001773232 110
203 3300005441 Ga0070700_100327275 Ga0070700_1003272752 110
204 3300005441 Ga0070700_101154526 Ga0070700_1011545261 110
205 3300005444 Ga0070694_100017204 Ga0070694_1000172043 110
206 3300005444 Ga0070694_100092269 Ga0070694_1000922692 110
207 3300005444 Ga0070694_100110404 Ga0070694_1001104044 110
208 3300005444 Ga0070694_100211119 Ga0070694_1002111192 110
209 3300005444 Ga0070694_100254010 Ga0070694_1002540102 110
210 3300005444 Ga0070694_100326153 Ga0070694_1003261531 110
211 3300005444 Ga0070694_100389803 Ga0070694_1003898032 110
212 3300005444 Ga0070694_100484635 Ga0070694_1004846352 110
213 3300005444 Ga0070694_100744778 Ga0070694_1007447781 110
214 3300005444 Ga0070694_100954767 Ga0070694_1009547672 110
215 3300005444 Ga0070694_101200209 Ga0070694_1012002091 110
216 3300005445 Ga0070708_100000337 Ga0070708_10000033717 110
217 3300005445 Ga0070708_100148145 Ga0070708_1001481452 110
218 3300005445 Ga0070708_100255666 Ga0070708_1002556662 110
219 3300005445 Ga0070708_100950572 Ga0070708_1009505721 110
220 3300005455 Ga0070663_100643440 Ga0070663_1006434402 110
221 3300005456 Ga0070678_100047848 Ga0070678_1000478482 110
222 3300005456 Ga0070678_100474634 Ga0070678_1004746341 110
223 3300005456 Ga0070678_100651468 Ga0070678_1006514681 110
224 3300005457 Ga0070662_100618082 Ga0070662_1006180821 110
225 3300005457 Ga0070662_101016072 Ga0070662_1010160722 110
226 3300005457 Ga0070662_101298029 Ga0070662_1012980291 110
227 3300005457 Ga0070662_101707623 Ga0070662_1017076231 110
228 3300005458 Ga0070681_10001081 Ga0070681_100010817 110
229 3300005458 Ga0070681_10006294 Ga0070681_100062947 110
230 3300005458 Ga0070681_10054385 Ga0070681_100543854 110
231 3300005458 Ga0070681_10201233 Ga0070681_102012331 110
232 3300005459 Ga0068867_100034591 Ga0068867_1000345911 110
233 3300005459 Ga0068867_100042795 Ga0068867_1000427952 110
234 3300005459 Ga0068867_100054294 Ga0068867_1000542945 110
235 3300005459 Ga0068867_100059623 Ga0068867_1000596234 110
236 3300005459 Ga0068867_100101133 Ga0068867_1001011333 110
237 3300005459 Ga0068867_100439081 Ga0068867_1004390811 110
238 3300005459 Ga0068867_100588500 Ga0068867_1005885001 110
239 3300005459 Ga0068867_101553076 Ga0068867_1015530761 110
240 3300005459 Ga0068867_101602249 Ga0068867_1016022492 110
241 3300005459 Ga0068867_101604872 Ga0068867_1016048721 110
242 3300005466 Ga0070685_10088908 Ga0070685_100889081 110
243 3300005466 Ga0070685_10299235 Ga0070685_102992352 110
244 3300005466 Ga0070685_10466184 Ga0070685_104661841 110
245 3300005466 Ga0070685_10562270 Ga0070685_105622702 110
246 3300005467 Ga0070706_100012259 Ga0070706_1000122595 110
247 3300005467 Ga0070706_100035284 Ga0070706_1000352844 110
248 3300005467 Ga0070706_100277890 Ga0070706_1002778902 110
249 3300005467 Ga0070706_100913626 Ga0070706_1009136261 110
250 3300005468 Ga0070707_100040959 Ga0070707_1000409592 110
251 3300005468 Ga0070707_100081032 Ga0070707_1000810322 110
252 3300005468 Ga0070707_100286500 Ga0070707_1002865002 110
253 3300005468 Ga0070707_101471620 Ga0070707_1014716201 110
254 3300005471 Ga0070698_100004605 Ga0070698_10000460515 110
255 3300005471 Ga0070698_100012974 Ga0070698_1000129747 110
256 3300005471 Ga0070698_100013753 Ga0070698_1000137536 110
257 3300005471 Ga0070698_100018834 Ga0070698_1000188347 110
258 3300005471 Ga0070698_100636820 Ga0070698_1006368202 110
259 3300005471 Ga0070698_101167788 Ga0070698_1011677881 110
260 3300005471 Ga0070698_102242075 Ga0070698_1022420751 110
261 3300005518 Ga0070699_100006275 Ga0070699_1000062757 110
262 3300005518 Ga0070699_100007202 Ga0070699_10000720210 110
263 3300005518 Ga0070699_100030729 Ga0070699_1000307294 110
264 3300005518 Ga0070699_100049948 Ga0070699_1000499482 110
265 3300005518 Ga0070699_100427062 Ga0070699_1004270621 110
266 3300005530 Ga0070679_100008421 Ga0070679_10000842111 110
267 3300005530 Ga0070679_100056125 Ga0070679_1000561254 110
268 3300005535 Ga0070684_101368972 Ga0070684_1013689722 110
269 3300005536 Ga0070697_100000062 Ga0070697_10000006213 110
270 3300005536 Ga0070697_100038063 Ga0070697_1000380633 110
271 3300005536 Ga0070697_101351849 Ga0070697_1013518491 110
272 3300005536 Ga0070697_101469068 Ga0070697_1014690681 110
273 3300005539 Ga0068853_100071741 Ga0068853_1000717415 110
274 3300005539 Ga0068853_100180300 Ga0068853_1001803002 110
275 3300005539 Ga0068853_100257079 Ga0068853_1002570792 110
276 3300005539 Ga0068853_100395567 Ga0068853_1003955672 110
277 3300005539 Ga0068853_100590121 Ga0068853_1005901212 110
278 3300005539 Ga0068853_100619133 Ga0068853_1006191331 110
279 3300005539 Ga0068853_101290359 Ga0068853_1012903591 110
280 3300005539 Ga0068853_102015651 Ga0068853_1020156511 110
281 3300005539 Ga0068853_102184292 Ga0068853_1021842921 110
282 3300005543 Ga0070672_100003235 Ga0070672_10000323511 110
283 3300005543 Ga0070672_100940672 Ga0070672_1009406722 110
284 3300005543 Ga0070672_100940773 Ga0070672_1009407731 110
285 3300005543 Ga0070672_101238899 Ga0070672_1012388991 110
286 3300005544 Ga0070686_100002174 Ga0070686_1000021749 110
287 3300005544 Ga0070686_100215400 Ga0070686_1002154001 110
288 3300005544 Ga0070686_100566541 Ga0070686_1005665412 110
289 3300005544 Ga0070686_100991500 Ga0070686_1009915001 110
290 3300005544 Ga0070686_101710802 Ga0070686_1017108021 110
291 3300005545 Ga0070695_100013916 Ga0070695_1000139164 110
292 3300005545 Ga0070695_100026460 Ga0070695_1000264605 110
293 3300005545 Ga0070695_100110005 Ga0070695_1001100052 110
294 3300005545 Ga0070695_100119248 Ga0070695_1001192483 110
295 3300005545 Ga0070695_100120848 Ga0070695_1001208482 110
296 3300005545 Ga0070695_100134121 Ga0070695_1001341212 110
297 3300005545 Ga0070695_100141653 Ga0070695_1001416532 110
298 3300005545 Ga0070695_100143482 Ga0070695_1001434822 110
299 3300005545 Ga0070695_100158535 Ga0070695_1001585352 110
300 3300005545 Ga0070695_100391206 Ga0070695_1003912062 110
301 3300005545 Ga0070695_100706216 Ga0070695_1007062161 110
302 3300005545 Ga0070695_101877076 Ga0070695_1018770761 110
303 3300005546 Ga0070696_100000807 Ga0070696_10000080714 110
304 3300005546 Ga0070696_100010581 Ga0070696_1000105814 110
305 3300005546 Ga0070696_100095169 Ga0070696_1000951693 110
306 3300005546 Ga0070696_100098487 Ga0070696_1000984874 110
307 3300005546 Ga0070696_100119931 Ga0070696_1001199311 110
308 3300005546 Ga0070696_100440145 Ga0070696_1004401451 110
309 3300005546 Ga0070696_100635662 Ga0070696_1006356622 110
310 3300005546 Ga0070696_101129638 Ga0070696_1011296381 110
311 3300005546 Ga0070696_101796155 Ga0070696_1017961552 110
312 3300005547 Ga0070693_100022522 Ga0070693_1000225224 110
313 3300005547 Ga0070693_100040645 Ga0070693_1000406453 110
314 3300005547 Ga0070693_100094216 Ga0070693_1000942162 110
315 3300005547 Ga0070693_100242564 Ga0070693_1002425642 110
316 3300005547 Ga0070693_100339487 Ga0070693_1003394871 110
317 3300005547 Ga0070693_100401051 Ga0070693_1004010512 110
318 3300005547 Ga0070693_101656889 Ga0070693_1016568891 110
319 3300005548 Ga0070665_100267008 Ga0070665_1002670083 110
320 3300005549 Ga0070704_100041854 Ga0070704_1000418542 110
321 3300005549 Ga0070704_100088858 Ga0070704_1000888582 110
322 3300005549 Ga0070704_100177140 Ga0070704_1001771401 110
323 3300005549 Ga0070704_100272872 Ga0070704_1002728721 110
324 3300005549 Ga0070704_100280836 Ga0070704_1002808361 110
325 3300005549 Ga0070704_100443264 Ga0070704_1004432642 110
326 3300005549 Ga0070704_100450887 Ga0070704_1004508871 110
327 3300005549 Ga0070704_100463381 Ga0070704_1004633812 110
328 3300005549 Ga0070704_100936529 Ga0070704_1009365291 110
329 3300005563 Ga0068855_100455794 Ga0068855_1004557941 110
330 3300005563 Ga0068855_101239572 Ga0068855_1012395721 110
331 3300005563 Ga0068855_101426436 Ga0068855_1014264362 110
332 3300005563 Ga0068855_102350087 Ga0068855_1023500872 110
333 3300005564 Ga0070664_100005757 Ga0070664_1000057575 110
334 3300005564 Ga0070664_100073910 Ga0070664_1000739102 110
335 3300005564 Ga0070664_100089390 Ga0070664_1000893903 110
336 3300005564 Ga0070664_100252396 Ga0070664_1002523961 110
337 3300005564 Ga0070664_100299036 Ga0070664_1002990362 110
338 3300005564 Ga0070664_100390994 Ga0070664_1003909942 110
339 3300005564 Ga0070664_100428813 Ga0070664_1004288132 110
340 3300005564 Ga0070664_100478689 Ga0070664_1004786892 110
341 3300005564 Ga0070664_101013882 Ga0070664_1010138821 110
342 3300005564 Ga0070664_102288880 Ga0070664_1022888801 110
343 3300005564 Ga0070664_102339284 Ga0070664_1023392841 110
344 3300005577 Ga0068857_100011647 Ga0068857_1000116476 110
345 3300005577 Ga0068857_100098402 Ga0068857_1000984022 110
346 3300005577 Ga0068857_100250199 Ga0068857_1002501992 110
347 3300005577 Ga0068857_100259806 Ga0068857_1002598062 110
348 3300005577 Ga0068857_100474762 Ga0068857_1004747622 110
349 3300005577 Ga0068857_100474810 Ga0068857_1004748103 110
350 3300005577 Ga0068857_100553609 Ga0068857_1005536091 110
351 3300005577 Ga0068857_100665285 Ga0068857_1006652851 110
352 3300005577 Ga0068857_100866822 Ga0068857_1008668222 110
353 3300005578 Ga0068854_100039135 Ga0068854_1000391353 110
354 3300005578 Ga0068854_100198348 Ga0068854_1001983482 110
355 3300005578 Ga0068854_100319982 Ga0068854_1003199822 110
356 3300005578 Ga0068854_100491532 Ga0068854_1004915321 110
357 3300005578 Ga0068854_100595031 Ga0068854_1005950312 110
358 3300005578 Ga0068854_100643546 Ga0068854_1006435461 110
359 3300005578 Ga0068854_100660586 Ga0068854_1006605861 110
360 3300005578 Ga0068854_101314622 Ga0068854_1013146222 110
361 3300005578 Ga0068854_101980158 Ga0068854_1019801581 110
362 3300005578 Ga0068854_102125540 Ga0068854_1021255401 110
363 3300005614 Ga0068856_100021795 Ga0068856_1000217955 110
364 3300005614 Ga0068856_100925077 Ga0068856_1009250771 110
365 3300005615 Ga0070702_100020950 Ga0070702_1000209503 110
366 3300005615 Ga0070702_100037702 Ga0070702_1000377025 110
367 3300005615 Ga0070702_100063007 Ga0070702_1000630072 110
368 3300005615 Ga0070702_100212460 Ga0070702_1002124602 110
369 3300005615 Ga0070702_100396737 Ga0070702_1003967372 110
370 3300005615 Ga0070702_101325575 Ga0070702_1013255751 110
371 3300005616 Ga0068852_100129712 Ga0068852_1001297122 110
372 3300005616 Ga0068852_100318997 Ga0068852_1003189972 110
373 3300005616 Ga0068852_100425615 Ga0068852_1004256152 110
374 3300005616 Ga0068852_101212324 Ga0068852_1012123242 110
375 3300005616 Ga0068852_101632978 Ga0068852_1016329782 110
376 3300005616 Ga0068852_101659408 Ga0068852_1016594082 110
377 3300005616 Ga0068852_102602473 Ga0068852_1026024731 110
378 3300005617 Ga0068859_100006661 Ga0068859_1000066617 110
379 3300005617 Ga0068859_100009613 Ga0068859_1000096134 110
380 3300005617 Ga0068859_100027113 Ga0068859_1000271139 110
381 3300005617 Ga0068859_100056402 Ga0068859_1000564026 110
382 3300005617 Ga0068859_100063364 Ga0068859_1000633643 110
383 3300005617 Ga0068859_100184573 Ga0068859_1001845731 110
384 3300005617 Ga0068859_100223045 Ga0068859_1002230454 110
385 3300005617 Ga0068859_100232478 Ga0068859_1002324782 110
386 3300005617 Ga0068859_100235025 Ga0068859_1002350252 110
387 3300005617 Ga0068859_100329511 Ga0068859_1003295112 110
388 3300005617 Ga0068859_100463722 Ga0068859_1004637222 110
389 3300005617 Ga0068859_100490815 Ga0068859_1004908151 110
390 3300005617 Ga0068859_100602699 Ga0068859_1006026993 110
391 3300005617 Ga0068859_100636851 Ga0068859_1006368512 110
392 3300005617 Ga0068859_100794078 Ga0068859_1007940782 110
393 3300005617 Ga0068859_100816629 Ga0068859_1008166292 110
394 3300005617 Ga0068859_100991361 Ga0068859_1009913611 110
395 3300005617 Ga0068859_101063755 Ga0068859_1010637551 110
396 3300005617 Ga0068859_102186136 Ga0068859_1021861361 110
397 3300005617 Ga0068859_102420368 Ga0068859_1024203681 110
398 3300005617 Ga0068859_102835964 Ga0068859_1028359641 110
399 3300005617 Ga0068859_103094459 Ga0068859_1030944591 110
400 3300005618 Ga0068864_100008711 Ga0068864_1000087112 110
401 3300005618 Ga0068864_100021333 Ga0068864_1000213334 110
402 3300005618 Ga0068864_100054098 Ga0068864_1000540983 110
403 3300005618 Ga0068864_100212659 Ga0068864_1002126592 110
404 3300005618 Ga0068864_100214585 Ga0068864_1002145852 110
405 3300005618 Ga0068864_100323995 Ga0068864_1003239952 110
406 3300005618 Ga0068864_100387108 Ga0068864_1003871082 110
407 3300005618 Ga0068864_100415507 Ga0068864_1004155072 110
408 3300005618 Ga0068864_100526012 Ga0068864_1005260121 110
409 3300005618 Ga0068864_100794165 Ga0068864_1007941652 110
410 3300005618 Ga0068864_101367078 Ga0068864_1013670781 110
411 3300005618 Ga0068864_101523147 Ga0068864_1015231471 110
412 3300005618 Ga0068864_101834311 Ga0068864_1018343111 110
413 3300005618 Ga0068864_102357615 Ga0068864_1023576151 110
414 3300005718 Ga0068866_10071694 Ga0068866_100716941 110
415 3300005718 Ga0068866_10301056 Ga0068866_103010562 110
416 3300005719 Ga0068861_100002983 Ga0068861_10000298310 110
417 3300005719 Ga0068861_100004194 Ga0068861_1000041948 110
418 3300005719 Ga0068861_100026590 Ga0068861_1000265906 110
419 3300005719 Ga0068861_100151057 Ga0068861_1001510573 110
420 3300005719 Ga0068861_100218202 Ga0068861_1002182023 110
421 3300005719 Ga0068861_100537665 Ga0068861_1005376652 110
422 3300005719 Ga0068861_100773458 Ga0068861_1007734581 110
423 3300005719 Ga0068861_101696318 Ga0068861_1016963181 110
424 3300005719 Ga0068861_101809589 Ga0068861_1018095892 110
425 3300005719 Ga0068861_101811476 Ga0068861_1018114762 110
426 3300005719 Ga0068861_102311319 Ga0068861_1023113191 110
427 3300005834 Ga0068851_10063826 Ga0068851_100638262 110
428 3300005834 Ga0068851_10402445 Ga0068851_104024452 110
429 3300005834 Ga0068851_10568427 Ga0068851_105684271 110
430 3300005834 Ga0068851_10741795 Ga0068851_107417951 110
431 3300005840 Ga0068870_10107101 Ga0068870_101071011 110
432 3300005840 Ga0068870_10150762 Ga0068870_101507621 110
433 3300005840 Ga0068870_10232065 Ga0068870_102320652 110
434 3300005840 Ga0068870_10414291 Ga0068870_104142912 110
435 3300005841 Ga0068863_100075227 Ga0068863_1000752273 110
436 3300005841 Ga0068863_100112035 Ga0068863_1001120352 110
437 3300005841 Ga0068863_100167444 Ga0068863_1001674442 110
438 3300005841 Ga0068863_100213033 Ga0068863_1002130333 110
439 3300005841 Ga0068863_100223750 Ga0068863_1002237503 110
440 3300005841 Ga0068863_100270853 Ga0068863_1002708534 110
441 3300005841 Ga0068863_100274814 Ga0068863_1002748142 110
442 3300005841 Ga0068863_100329269 Ga0068863_1003292691 110
443 3300005841 Ga0068863_101077930 Ga0068863_1010779302 110
444 3300005842 Ga0068858_100020307 Ga0068858_1000203077 110
445 3300005842 Ga0068858_100062270 Ga0068858_1000622703 110
446 3300005842 Ga0068858_100070049 Ga0068858_1000700494 110
447 3300005842 Ga0068858_100248180 Ga0068858_1002481802 110
448 3300005842 Ga0068858_100278823 Ga0068858_1002788232 110
449 3300005842 Ga0068858_100719923 Ga0068858_1007199232 110
450 3300005842 Ga0068858_100915307 Ga0068858_1009153072 110
451 3300005842 Ga0068858_100955120 Ga0068858_1009551202 110
452 3300005842 Ga0068858_101099103 Ga0068858_1010991032 110
453 3300005842 Ga0068858_102430760 Ga0068858_1024307601 110
454 3300005842 Ga0068858_102465385 Ga0068858_1024653852 110
455 3300005843 Ga0068860_100067260 Ga0068860_1000672603 110
456 3300005843 Ga0068860_100095228 Ga0068860_1000952284 110
457 3300005843 Ga0068860_100100146 Ga0068860_1001001463 110
458 3300005843 Ga0068860_100124757 Ga0068860_1001247574 110
459 3300005843 Ga0068860_100134784 Ga0068860_1001347843 110
460 3300005843 Ga0068860_100150589 Ga0068860_1001505894 110
461 3300005843 Ga0068860_100323632 Ga0068860_1003236321 110
462 3300005843 Ga0068860_100326954 Ga0068860_1003269542 110
463 3300005843 Ga0068860_100404102 Ga0068860_1004041022 110
464 3300005843 Ga0068860_100665872 Ga0068860_1006658722 110
465 3300005843 Ga0068860_102176404 Ga0068860_1021764041 110
466 3300005844 Ga0068862_100010358 Ga0068862_1000103582 110
467 3300005844 Ga0068862_100036312 Ga0068862_1000363125 110
468 3300005844 Ga0068862_100073581 Ga0068862_1000735814 110
469 3300005844 Ga0068862_100150979 Ga0068862_1001509792 110
470 3300005844 Ga0068862_100211958 Ga0068862_1002119583 110
471 3300005844 Ga0068862_100672179 Ga0068862_1006721792 110
472 3300005844 Ga0068862_100778572 Ga0068862_1007785722 110
473 3300005844 Ga0068862_100961321 Ga0068862_1009613211 110
474 3300005844 Ga0068862_101076594 Ga0068862_1010765942 110
475 3300005844 Ga0068862_102301013 Ga0068862_1023010132 110
476 3300005983 Ga0081540_1046504 Ga0081540_10465043 110
477 3300005985 Ga0081539_10000408 Ga0081539_1000040884 110
478 3300005985 Ga0081539_10002782 Ga0081539_1000278219 110
479 3300005985 Ga0081539_10260842 Ga0081539_102608422 110
480 3300006173 Ga0070716_100039779 Ga0070716_1000397794 110
481 3300006237 Ga0097621_100008542 Ga0097621_1000085427 110
482 3300006237 Ga0097621_100013219 Ga0097621_1000132192 110
483 3300006237 Ga0097621_100036362 Ga0097621_1000363621 110
484 3300006237 Ga0097621_100167622 Ga0097621_1001676223 110
485 3300006237 Ga0097621_100381058 Ga0097621_1003810582 110
486 3300006237 Ga0097621_101550547 Ga0097621_1015505471 110
487 3300006358 Ga0068871_100019524 Ga0068871_1000195247 110
488 3300006358 Ga0068871_100031414 Ga0068871_1000314143 110
489 3300006358 Ga0068871_100185048 Ga0068871_1001850483 110
490 3300006358 Ga0068871_100428232 Ga0068871_1004282322 110
491 3300006358 Ga0068871_101554072 Ga0068871_1015540722 110
492 3300006844 Ga0075428_101057264 Ga0075428_1010572642 110
493 3300006846 Ga0075430_100066558 Ga0075430_1000665581 110
494 3300006846 Ga0075430_100082659 Ga0075430_1000826594 110
495 3300006847 Ga0075431_100094063 Ga0075431_1000940634 110
496 3300006847 Ga0075431_100164221 Ga0075431_1001642213 110
497 3300006847 Ga0075431_100255488 Ga0075431_1002554882 110
498 3300006847 Ga0075431_100265972 Ga0075431_1002659723 110
499 3300006847 Ga0075431_101432383 Ga0075431_1014323831 110
500 3300006852 Ga0075433_10037055 Ga0075433_100370552 110
501 3300006852 Ga0075433_10243454 Ga0075433_102434542 110
502 3300006852 Ga0075433_10453845 Ga0075433_104538452 110
503 3300006852 Ga0075433_10517438 Ga0075433_105174382 110
504 3300006852 Ga0075433_10680206 Ga0075433_106802062 110
505 3300006871 Ga0075434_100289565 Ga0075434_1002895654 110
506 3300006871 Ga0075434_100363644 Ga0075434_1003636442 110
507 3300006871 Ga0075434_100797367 Ga0075434_1007973671 110
508 3300006880 Ga0075429_100100562 Ga0075429_1001005624 110
509 3300006880 Ga0075429_101684029 Ga0075429_1016840292 110
510 3300006881 Ga0068865_100048889 Ga0068865_1000488893 110
511 3300006881 Ga0068865_100117481 Ga0068865_1001174812 110
512 3300006881 Ga0068865_100279919 Ga0068865_1002799192 110
513 3300006881 Ga0068865_100540999 Ga0068865_1005409992 110
514 3300006931 Ga0097620_100006661 Ga0097620_1000066617 110
515 3300006931 Ga0097620_100009613 Ga0097620_1000096134 110
516 3300006931 Ga0097620_100027113 Ga0097620_1000271139 110
517 3300006931 Ga0097620_100056402 Ga0097620_1000564026 110
518 3300006931 Ga0097620_100063365 Ga0097620_1000633653 110
519 3300006931 Ga0097620_100184577 Ga0097620_1001845771 110
520 3300006931 Ga0097620_100223050 Ga0097620_1002230504 110
521 3300006931 Ga0097620_100232474 Ga0097620_1002324743 110
522 3300006931 Ga0097620_100235042 Ga0097620_1002350422 110
523 3300006931 Ga0097620_100329512 Ga0097620_1003295122 110
524 3300006931 Ga0097620_100463757 Ga0097620_1004637572 110
525 3300006931 Ga0097620_100490790 Ga0097620_1004907901 110
526 3300006931 Ga0097620_100602653 Ga0097620_1006026533 110
527 3300006931 Ga0097620_100636851 Ga0097620_1006368512 110
528 3300006931 Ga0097620_100794087 Ga0097620_1007940872 110
529 3300006931 Ga0097620_100816652 Ga0097620_1008166522 110
530 3300006931 Ga0097620_100991368 Ga0097620_1009913681 110
531 3300006931 Ga0097620_101063782 Ga0097620_1010637821 110
532 3300006931 Ga0097620_102186338 Ga0097620_1021863381 110
533 3300006931 Ga0097620_102420377 Ga0097620_1024203771 110
534 3300006931 Ga0097620_102836133 Ga0097620_1028361331 110
535 3300006931 Ga0097620_103093790 Ga0097620_1030937901 110
536 3300007076 Ga0075435_100021117 Ga0075435_1000211177 110
537 3300009011 Ga0105251_10385115 Ga0105251_103851152 110
538 3300009036 Ga0105244_10522940 Ga0105244_105229401 110
539 3300009092 Ga0105250_10031522 Ga0105250_100315221 110
540 3300009092 Ga0105250_10063537 Ga0105250_100635372 110
541 3300009092 Ga0105250_10408584 Ga0105250_104085841 110
542 3300009093 Ga0105240_10191814 Ga0105240_101918143 110
543 3300009093 Ga0105240_10414692 Ga0105240_104146923 110
544 3300009093 Ga0105240_10631291 Ga0105240_106312912 110
545 3300009093 Ga0105240_10788834 Ga0105240_107888342 110
546 3300009093 Ga0105240_11085907 Ga0105240_110859072 110
547 3300009093 Ga0105240_11793581 Ga0105240_117935811 110
548 3300009094 Ga0111539_10005075 Ga0111539_1000507511 110
549 3300009094 Ga0111539_10183930 Ga0111539_101839303 110
550 3300009094 Ga0111539_10202263 Ga0111539_102022634 110
551 3300009094 Ga0111539_10330094 Ga0111539_103300941 110
552 3300009094 Ga0111539_12748337 Ga0111539_127483371 110
553 3300009098 Ga0105245_10141499 Ga0105245_101414992 110
554 3300009098 Ga0105245_10632875 Ga0105245_106328752 110
555 3300009098 Ga0105245_10794307 Ga0105245_107943072 110
556 3300009098 Ga0105245_11623836 Ga0105245_116238362 110
557 3300009098 Ga0105245_11756378 Ga0105245_117563782 110
558 3300009098 Ga0105245_12317311 Ga0105245_123173112 110
559 3300009101 Ga0105247_10007521 Ga0105247_1000752112 110
560 3300009101 Ga0105247_10164911 Ga0105247_101649113 110
561 3300009101 Ga0105247_10320588 Ga0105247_103205881 110
562 3300009101 Ga0105247_10459888 Ga0105247_104598882 110
563 3300009101 Ga0105247_11150293 Ga0105247_111502931 110
564 3300009147 Ga0114129_10042525 Ga0114129_100425259 110
565 3300009147 Ga0114129_10114657 Ga0114129_101146574 110
566 3300009147 Ga0114129_10254718 Ga0114129_102547184 110
567 3300009147 Ga0114129_10369332 Ga0114129_103693321 110
568 3300009147 Ga0114129_10670883 Ga0114129_106708832 110
569 3300009147 Ga0114129_11304227 Ga0114129_113042271 110
570 3300009147 Ga0114129_11420163 Ga0114129_114201632 110
571 3300009147 Ga0114129_11578951 Ga0114129_115789512 110
572 3300009148 Ga0105243_10077421 Ga0105243_100774212 110
573 3300009148 Ga0105243_10145993 Ga0105243_101459932 110
574 3300009148 Ga0105243_10155782 Ga0105243_101557823 110
575 3300009148 Ga0105243_10229866 Ga0105243_102298663 110
576 3300009148 Ga0105243_10256448 Ga0105243_102564481 110
577 3300009148 Ga0105243_10582045 Ga0105243_105820452 110
578 3300009148 Ga0105243_10860073 Ga0105243_108600732 110
579 3300009174 Ga0105241_10019245 Ga0105241_100192457 110
580 3300009174 Ga0105241_10021776 Ga0105241_100217763 110
581 3300009174 Ga0105241_10046782 Ga0105241_100467823 110
582 3300009174 Ga0105241_10064366 Ga0105241_100643663 110
583 3300009174 Ga0105241_10109925 Ga0105241_101099252 110
584 3300009174 Ga0105241_10206882 Ga0105241_102068821 110
585 3300009174 Ga0105241_10222574 Ga0105241_102225743 110
586 3300009174 Ga0105241_10457453 Ga0105241_104574531 110
587 3300009174 Ga0105241_10482575 Ga0105241_104825751 110
588 3300009174 Ga0105241_11136046 Ga0105241_111360463 110
589 3300009174 Ga0105241_11346875 Ga0105241_113468751 110
590 3300009174 Ga0105241_11497352 Ga0105241_114973522 110
591 3300009174 Ga0105241_11797002 Ga0105241_117970021 110
592 3300009174 Ga0105241_11870419 Ga0105241_118704191 110
593 3300009176 Ga0105242_10002192 Ga0105242_100021928 110
594 3300009176 Ga0105242_10062185 Ga0105242_100621854 110
595 3300009176 Ga0105242_10207593 Ga0105242_102075932 110
596 3300009176 Ga0105242_10358283 Ga0105242_103582832 110
597 3300009176 Ga0105242_10486482 Ga0105242_104864821 110
598 3300009176 Ga0105242_11017506 Ga0105242_110175061 110
599 3300009176 Ga0105242_11404069 Ga0105242_114040691 110
600 3300009176 Ga0105242_13196653 Ga0105242_131966532 110
601 3300009177 Ga0105248_10007251 Ga0105248_1000725110 110
602 3300009177 Ga0105248_10016118 Ga0105248_100161181 110
603 3300009177 Ga0105248_10033803 Ga0105248_100338033 110
604 3300009177 Ga0105248_10033984 Ga0105248_100339842 110
605 3300009177 Ga0105248_10088802 Ga0105248_100888026 110
606 3300009177 Ga0105248_10480322 Ga0105248_104803222 110
607 3300009177 Ga0105248_10725191 Ga0105248_107251912 110
608 3300009177 Ga0105248_11331488 Ga0105248_113314881 110
609 3300009177 Ga0105248_11336314 Ga0105248_113363141 110
610 3300009177 Ga0105248_12531862 Ga0105248_125318621 110
611 3300009545 Ga0105237_10019745 Ga0105237_100197455 110
612 3300009545 Ga0105237_10296177 Ga0105237_102961773 110
613 3300009545 Ga0105237_10723382 Ga0105237_107233821 110
614 3300009545 Ga0105237_10878241 Ga0105237_108782413 110
615 3300009545 Ga0105237_11104178 Ga0105237_111041781 110
616 3300009551 Ga0105238_10008842 Ga0105238_1000884211 110
617 3300009551 Ga0105238_10104368 Ga0105238_101043683 110
618 3300009551 Ga0105238_10635478 Ga0105238_106354782 110
619 3300009551 Ga0105238_11234438 Ga0105238_112344382 110
620 3300009553 Ga0105249_10000052 Ga0105249_1000005288 110
621 3300009553 Ga0105249_10004897 Ga0105249_100048976 110
622 3300009553 Ga0105249_10009805 Ga0105249_100098052 110
623 3300009553 Ga0105249_10017459 Ga0105249_100174594 110
624 3300009553 Ga0105249_10022390 Ga0105249_100223902 110
625 3300009553 Ga0105249_10411487 Ga0105249_104114872 110
626 3300009553 Ga0105249_10508093 Ga0105249_105080932 110
627 3300009553 Ga0105249_12386081 Ga0105249_123860811 110
628 3300009553 Ga0105249_12622480 Ga0105249_126224801 110
629 3300010375 Ga0105239_10116098 Ga0105239_101160983 110
630 3300010375 Ga0105239_10303061 Ga0105239_103030611 110
631 3300010375 Ga0105239_10908791 Ga0105239_109087912 110
632 3300010375 Ga0105239_11743326 Ga0105239_117433261 110
633 3300010375 Ga0105239_11845581 Ga0105239_118455812 110
634 3300011119 Ga0105246_10019006 Ga0105246_100190063 110
635 3300011119 Ga0105246_10041615 Ga0105246_100416152 110
636 3300011119 Ga0105246_10079138 Ga0105246_100791383 110
637 3300011119 Ga0105246_10094377 Ga0105246_100943773 110
638 3300011119 Ga0105246_10111502 Ga0105246_101115023 110
639 3300011119 Ga0105246_10292357 Ga0105246_102923571 110
640 3300011119 Ga0105246_10419796 Ga0105246_104197962 110
641 3300011119 Ga0105246_10424657 Ga0105246_104246572 110
642 3300011119 Ga0105246_10716314 Ga0105246_107163142 110
643 3300012513 Ga0157326_1086845 Ga0157326_10868451 110
644 3300013100 Ga0157373_10016111 Ga0157373_100161113 110
645 3300013100 Ga0157373_10031501 Ga0157373_100315015 110
646 3300013100 Ga0157373_10033790 Ga0157373_100337904 110
647 3300013100 Ga0157373_10136178 Ga0157373_101361781 110
648 3300013100 Ga0157373_10520132 Ga0157373_105201321 110
649 3300013100 Ga0157373_11499500 Ga0157373_114995001 110
650 3300013102 Ga0157371_10450589 Ga0157371_104505891 110
651 3300013296 Ga0157374_10015970 Ga0157374_100159706 110
652 3300013296 Ga0157374_10135043 Ga0157374_101350431 110
653 3300013296 Ga0157374_11340551 Ga0157374_113405511 110
654 3300013296 Ga0157374_11556776 Ga0157374_115567762 110
655 3300013297 Ga0157378_10001282 Ga0157378_1000128211 110
656 3300013297 Ga0157378_10003380 Ga0157378_100033808 110
657 3300013297 Ga0157378_10086410 Ga0157378_100864104 110
658 3300013297 Ga0157378_10307296 Ga0157378_103072961 110
659 3300013297 Ga0157378_10408909 Ga0157378_104089092 110
660 3300013297 Ga0157378_10535751 Ga0157378_105357512 110
661 3300013297 Ga0157378_10821345 Ga0157378_108213452 110
662 3300013297 Ga0157378_10913835 Ga0157378_109138351 110
663 3300013297 Ga0157378_10981057 Ga0157378_109810572 110
664 3300013297 Ga0157378_11284888 Ga0157378_112848881 110
665 3300013297 Ga0157378_11297086 Ga0157378_112970862 110
666 3300013297 Ga0157378_11646753 Ga0157378_116467531 110
667 3300013297 Ga0157378_11876248 Ga0157378_118762481 110
668 3300013297 Ga0157378_11930256 Ga0157378_119302561 110
669 3300013297 Ga0157378_12607041 Ga0157378_126070412 110
670 3300013306 Ga0163162_10000001 Ga0163162_10000001600 110
671 3300013306 Ga0163162_10009010 Ga0163162_100090102 110
672 3300013306 Ga0163162_10012811 Ga0163162_100128117 110
673 3300013306 Ga0163162_10044633 Ga0163162_100446334 110
674 3300013306 Ga0163162_10149517 Ga0163162_101495173 110
675 3300013306 Ga0163162_10618230 Ga0163162_106182302 110
676 3300013306 Ga0163162_11200497 Ga0163162_112004971 110
677 3300013306 Ga0163162_11479821 Ga0163162_114798212 110
678 3300013306 Ga0163162_11548231 Ga0163162_115482311 110
679 3300013307 Ga0157372_10031386 Ga0157372_100313867 110
680 3300013307 Ga0157372_10971521 Ga0157372_109715212 110
681 3300013307 Ga0157372_11419886 Ga0157372_114198861 110
682 3300013307 Ga0157372_11806124 Ga0157372_118061242 110
683 3300013307 Ga0157372_12637697 Ga0157372_126376971 110
684 3300013308 Ga0157375_10004418 Ga0157375_1000441811 110
685 3300013308 Ga0157375_10066922 Ga0157375_100669221 110
686 3300013308 Ga0157375_10198777 Ga0157375_101987772 110
687 3300013308 Ga0157375_10262499 Ga0157375_102624991 110
688 3300013308 Ga0157375_10336605 Ga0157375_103366053 110
689 3300013308 Ga0157375_10511728 Ga0157375_105117282 110
690 3300013308 Ga0157375_11127453 Ga0157375_111274531 110
691 3300013308 Ga0157375_11196087 Ga0157375_111960872 110
692 3300013308 Ga0157375_11350255 Ga0157375_113502551 110
693 3300013308 Ga0157375_11785373 Ga0157375_117853731 110
694 3300013308 Ga0157375_12442601 Ga0157375_124426012 110
695 3300013308 Ga0157375_12647574 Ga0157375_126475741 110
696 3300014325 Ga0163163_10001533 Ga0163163_1000153325 110
697 3300014325 Ga0163163_10001831 Ga0163163_1000183113 110
698 3300014325 Ga0163163_10007435 Ga0163163_100074357 110
699 3300014325 Ga0163163_10132213 Ga0163163_101322133 110
700 3300014325 Ga0163163_10207137 Ga0163163_102071371 110
701 3300014325 Ga0163163_10220860 Ga0163163_102208602 110
702 3300014325 Ga0163163_10268419 Ga0163163_102684192 110
703 3300014325 Ga0163163_10310393 Ga0163163_103103932 110
704 3300014325 Ga0163163_10312194 Ga0163163_103121941 110
705 3300014325 Ga0163163_10340679 Ga0163163_103406792 110
706 3300014325 Ga0163163_10370662 Ga0163163_103706623 110
707 3300014325 Ga0163163_10421034 Ga0163163_104210342 110
708 3300014325 Ga0163163_10684469 Ga0163163_106844692 110
709 3300014325 Ga0163163_10931140 Ga0163163_109311402 110
710 3300014325 Ga0163163_11748079 Ga0163163_117480792 110
711 3300014325 Ga0163163_12017930 Ga0163163_120179301 110
712 3300014326 Ga0157380_10001205 Ga0157380_100012059 110
713 3300014326 Ga0157380_10017030 Ga0157380_100170302 110
714 3300014326 Ga0157380_10034148 Ga0157380_100341485 110
715 3300014326 Ga0157380_10041006 Ga0157380_100410063 110
716 3300014326 Ga0157380_10270971 Ga0157380_102709712 110
717 3300014326 Ga0157380_10504538 Ga0157380_105045382 110
718 3300014326 Ga0157380_10593595 Ga0157380_105935952 110
719 3300014326 Ga0157380_11151082 Ga0157380_111510822 110
720 3300014326 Ga0157380_11965845 Ga0157380_119658451 110
721 3300014326 Ga0157380_12322664 Ga0157380_123226642 110
722 3300014326 Ga0157380_12453947 Ga0157380_124539471 110
723 3300014745 Ga0157377_10183115 Ga0157377_101831152 110
724 3300014745 Ga0157377_10192309 Ga0157377_101923092 110
725 3300014745 Ga0157377_10301550 Ga0157377_103015502 110
726 3300014968 Ga0157379_10025079 Ga0157379_100250795 110
727 3300014968 Ga0157379_10290117 Ga0157379_102901172 110
728 3300014968 Ga0157379_10607894 Ga0157379_106078943 110
729 3300014968 Ga0157379_11001281 Ga0157379_110012812 110
730 3300014968 Ga0157379_12451966 Ga0157379_124519661 110
731 3300014969 Ga0157376_10014842 Ga0157376_100148424 110
732 3300014969 Ga0157376_10906771 Ga0157376_109067711 110
733 3300014969 Ga0157376_12131772 Ga0157376_121317721 110
734 3300015265 Ga0182005_1188179 Ga0182005_11881792 110
735 3300017792 Ga0163161_10032403 Ga0163161_100324033 110
736 3300017792 Ga0163161_11040389 Ga0163161_110403892 110
737 3300021384 Ga0213876_10000355 Ga0213876_100003554 110
738 3300021384 Ga0213876_10013377 Ga0213876_100133772 110
739 3300025315 Ga0207697_10013752 Ga0207697_100137522 110
740 3300025315 Ga0207697_10453508 Ga0207697_104535081 110
741 3300025321 Ga0207656_10456840 Ga0207656_104568402 110
742 3300025885 Ga0207653_10198873 Ga0207653_101988732 110
743 3300025885 Ga0207653_10394520 Ga0207653_103945201 110
744 3300025893 Ga0207682_10236035 Ga0207682_102360351 110
745 3300025893 Ga0207682_10297446 Ga0207682_102974462 110
746 3300025899 Ga0207642_10288671 Ga0207642_102886712 110
747 3300025899 Ga0207642_11009843 Ga0207642_110098431 110
748 3300025901 Ga0207688_10080312 Ga0207688_100803123 110
749 3300025901 Ga0207688_10664907 Ga0207688_106649072 110
750 3300025901 Ga0207688_10712843 Ga0207688_107128432 110
751 3300025903 Ga0207680_10062476 Ga0207680_100624763 110
752 3300025904 Ga0207647_10084981 Ga0207647_100849812 110
753 3300025904 Ga0207647_10233759 Ga0207647_102337592 110
754 3300025904 Ga0207647_10556535 Ga0207647_105565351 110
755 3300025904 Ga0207647_10585535 Ga0207647_105855351 110
756 3300025907 Ga0207645_10034311 Ga0207645_100343111 110
757 3300025907 Ga0207645_10348438 Ga0207645_103484382 110
758 3300025907 Ga0207645_10574935 Ga0207645_105749352 110
759 3300025908 Ga0207643_10007213 Ga0207643_100072138 110
760 3300025908 Ga0207643_10010917 Ga0207643_100109176 110
761 3300025908 Ga0207643_10228242 Ga0207643_102282422 110
762 3300025908 Ga0207643_10398919 Ga0207643_103989192 110
763 3300025908 Ga0207643_10838481 Ga0207643_108384811 110
764 3300025910 Ga0207684_10007353 Ga0207684_100073537 110
765 3300025910 Ga0207684_10027931 Ga0207684_100279312 110
766 3300025910 Ga0207684_10089034 Ga0207684_100890344 110
767 3300025910 Ga0207684_10116395 Ga0207684_101163953 110
768 3300025910 Ga0207684_10447954 Ga0207684_104479542 110
769 3300025911 Ga0207654_10021305 Ga0207654_100213054 110
770 3300025911 Ga0207654_10024471 Ga0207654_100244714 110
771 3300025911 Ga0207654_10081241 Ga0207654_100812414 110
772 3300025911 Ga0207654_10375203 Ga0207654_103752032 110
773 3300025911 Ga0207654_10638415 Ga0207654_106384151 110
774 3300025911 Ga0207654_10751407 Ga0207654_107514071 110
775 3300025911 Ga0207654_10874236 Ga0207654_108742361 110
776 3300025912 Ga0207707_10046482 Ga0207707_100464824 110
777 3300025912 Ga0207707_10085543 Ga0207707_100855434 110
778 3300025913 Ga0207695_10407813 Ga0207695_104078133 110
779 3300025913 Ga0207695_10895571 Ga0207695_108955711 110
780 3300025913 Ga0207695_11705591 Ga0207695_117055912 110
781 3300025914 Ga0207671_10386649 Ga0207671_103866494 110
782 3300025914 Ga0207671_10495067 Ga0207671_104950672 110
783 3300025914 Ga0207671_10799703 Ga0207671_107997031 110
784 3300025914 Ga0207671_10817099 Ga0207671_108170992 110
785 3300025917 Ga0207660_10054047 Ga0207660_100540472 110
786 3300025917 Ga0207660_10378477 Ga0207660_103784771 110
787 3300025917 Ga0207660_10627322 Ga0207660_106273222 110
788 3300025917 Ga0207660_10697038 Ga0207660_106970382 110
789 3300025918 Ga0207662_10003190 Ga0207662_100031903 110
790 3300025918 Ga0207662_10017971 Ga0207662_100179715 110
791 3300025918 Ga0207662_10021969 Ga0207662_100219691 110
792 3300025918 Ga0207662_10112076 Ga0207662_101120762 110
793 3300025918 Ga0207662_10113569 Ga0207662_101135693 110
794 3300025918 Ga0207662_10311410 Ga0207662_103114102 110
795 3300025919 Ga0207657_10133707 Ga0207657_101337071 110
796 3300025921 Ga0207652_10038997 Ga0207652_100389975 110
797 3300025921 Ga0207652_10126285 Ga0207652_101262853 110
798 3300025921 Ga0207652_11560473 Ga0207652_115604732 110
799 3300025922 Ga0207646_10102864 Ga0207646_101028643 110
800 3300025922 Ga0207646_10361169 Ga0207646_103611692 110
801 3300025922 Ga0207646_11520278 Ga0207646_115202781 110
802 3300025922 Ga0207646_11917737 Ga0207646_119177371 110
803 3300025923 Ga0207681_10001745 Ga0207681_100017454 110
804 3300025923 Ga0207681_10005262 Ga0207681_100052627 110
805 3300025923 Ga0207681_10011079 Ga0207681_100110796 110
806 3300025923 Ga0207681_10173897 Ga0207681_101738971 110
807 3300025923 Ga0207681_10690261 Ga0207681_106902612 110
808 3300025923 Ga0207681_10840511 Ga0207681_108405112 110
809 3300025923 Ga0207681_11631206 Ga0207681_116312061 110
810 3300025924 Ga0207694_10020544 Ga0207694_100205444 110
811 3300025924 Ga0207694_10087086 Ga0207694_100870863 110
812 3300025924 Ga0207694_10592267 Ga0207694_105922672 110
813 3300025924 Ga0207694_11395115 Ga0207694_113951152 110
814 3300025925 Ga0207650_10000001 Ga0207650_10000001216 110
815 3300025925 Ga0207650_10122387 Ga0207650_101223873 110
816 3300025925 Ga0207650_10239752 Ga0207650_102397521 110
817 3300025925 Ga0207650_10454063 Ga0207650_104540632 110
818 3300025925 Ga0207650_10502487 Ga0207650_105024872 110
819 3300025925 Ga0207650_10510627 Ga0207650_105106272 110
820 3300025925 Ga0207650_10702916 Ga0207650_107029162 110
821 3300025925 Ga0207650_10875432 Ga0207650_108754322 110
822 3300025926 Ga0207659_10059289 Ga0207659_100592893 110
823 3300025926 Ga0207659_10298746 Ga0207659_102987463 110
824 3300025926 Ga0207659_10485962 Ga0207659_104859621 110
825 3300025926 Ga0207659_11041545 Ga0207659_110415452 110
826 3300025926 Ga0207659_11413124 Ga0207659_114131242 110
827 3300025927 Ga0207687_10325267 Ga0207687_103252672 110
828 3300025927 Ga0207687_10499295 Ga0207687_104992952 110
829 3300025927 Ga0207687_11360645 Ga0207687_113606451 110
830 3300025931 Ga0207644_10024830 Ga0207644_100248302 110
831 3300025931 Ga0207644_10115193 Ga0207644_101151933 110
832 3300025932 Ga0207690_10214084 Ga0207690_102140842 110
833 3300025932 Ga0207690_11012654 Ga0207690_110126541 110
834 3300025933 Ga0207706_10062945 Ga0207706_100629454 110
835 3300025933 Ga0207706_10335404 Ga0207706_103354042 110
836 3300025933 Ga0207706_10633594 Ga0207706_106335941 110
837 3300025933 Ga0207706_11337085 Ga0207706_113370852 110
838 3300025934 Ga0207686_10033667 Ga0207686_100336673 110
839 3300025934 Ga0207686_10072162 Ga0207686_100721623 110
840 3300025934 Ga0207686_10074054 Ga0207686_100740542 110
841 3300025934 Ga0207686_10546754 Ga0207686_105467541 110
842 3300025935 Ga0207709_10037714 Ga0207709_100377142 110
843 3300025935 Ga0207709_10066783 Ga0207709_100667833 110
844 3300025935 Ga0207709_10167894 Ga0207709_101678942 110
845 3300025935 Ga0207709_11205968 Ga0207709_112059682 110
846 3300025936 Ga0207670_10000250 Ga0207670_1000025012 110
847 3300025936 Ga0207670_10060445 Ga0207670_100604454 110
848 3300025936 Ga0207670_10161749 Ga0207670_101617492 110
849 3300025936 Ga0207670_10245468 Ga0207670_102454682 110
850 3300025936 Ga0207670_10518059 Ga0207670_105180592 110
851 3300025936 Ga0207670_11267194 Ga0207670_112671941 110
852 3300025936 Ga0207670_11662353 Ga0207670_116623531 110
853 3300025937 Ga0207669_10110184 Ga0207669_101101842 110
854 3300025937 Ga0207669_11510085 Ga0207669_115100851 110
855 3300025938 Ga0207704_10109975 Ga0207704_101099753 110
856 3300025938 Ga0207704_10294809 Ga0207704_102948092 110
857 3300025938 Ga0207704_11134156 Ga0207704_111341561 110
858 3300025939 Ga0207665_10010591 Ga0207665_100105917 110
859 3300025940 Ga0207691_10001421 Ga0207691_100014216 110
860 3300025940 Ga0207691_10249155 Ga0207691_102491552 110
861 3300025940 Ga0207691_10265369 Ga0207691_102653691 110
862 3300025940 Ga0207691_10818876 Ga0207691_108188761 110
863 3300025940 Ga0207691_11218298 Ga0207691_112182981 110
864 3300025941 Ga0207711_10019129 Ga0207711_100191298 110
865 3300025941 Ga0207711_10028277 Ga0207711_100282776 110
866 3300025941 Ga0207711_10132721 Ga0207711_101327213 110
867 3300025941 Ga0207711_10159891 Ga0207711_101598913 110
868 3300025941 Ga0207711_10367803 Ga0207711_103678033 110
869 3300025941 Ga0207711_10586249 Ga0207711_105862492 110
870 3300025941 Ga0207711_11700855 Ga0207711_117008551 110
871 3300025942 Ga0207689_10002102 Ga0207689_1000210212 110
872 3300025942 Ga0207689_10009874 Ga0207689_100098746 110
873 3300025942 Ga0207689_10019251 Ga0207689_100192516 110
874 3300025942 Ga0207689_10085862 Ga0207689_100858623 110
875 3300025942 Ga0207689_10257770 Ga0207689_102577702 110
876 3300025942 Ga0207689_10282044 Ga0207689_102820442 110
877 3300025942 Ga0207689_10510964 Ga0207689_105109641 110
878 3300025942 Ga0207689_10542066 Ga0207689_105420662 110
879 3300025942 Ga0207689_10648118 Ga0207689_106481182 110
880 3300025942 Ga0207689_10707242 Ga0207689_107072422 110
881 3300025942 Ga0207689_10754913 Ga0207689_107549132 110
882 3300025942 Ga0207689_10788582 Ga0207689_107885822 110
883 3300025942 Ga0207689_10926654 Ga0207689_109266542 110
884 3300025942 Ga0207689_10944754 Ga0207689_109447542 110
885 3300025942 Ga0207689_11332472 Ga0207689_113324721 110
886 3300025945 Ga0207679_10106366 Ga0207679_101063663 110
887 3300025945 Ga0207679_10166511 Ga0207679_101665112 110
888 3300025945 Ga0207679_10170112 Ga0207679_101701123 110
889 3300025945 Ga0207679_10229146 Ga0207679_102291462 110
890 3300025945 Ga0207679_10277000 Ga0207679_102770001 110
891 3300025949 Ga0207667_10847312 Ga0207667_108473122 110
892 3300025960 Ga0207651_10055671 Ga0207651_100556712 110
893 3300025960 Ga0207651_10059925 Ga0207651_100599253 110
894 3300025960 Ga0207651_10294305 Ga0207651_102943052 110
895 3300025960 Ga0207651_10661637 Ga0207651_106616372 110
896 3300025960 Ga0207651_10727138 Ga0207651_107271382 110
897 3300025960 Ga0207651_10970417 Ga0207651_109704172 110
898 3300025961 Ga0207712_10000925 Ga0207712_1000092517 110
899 3300025961 Ga0207712_10005189 Ga0207712_1000518910 110
900 3300025961 Ga0207712_10060667 Ga0207712_100606671 110
901 3300025961 Ga0207712_10402521 Ga0207712_104025212 110
902 3300025961 Ga0207712_10551239 Ga0207712_105512391 110
903 3300025972 Ga0207668_10005063 Ga0207668_100050638 110
904 3300025972 Ga0207668_10757806 Ga0207668_107578062 110
905 3300025972 Ga0207668_10776161 Ga0207668_107761611 110
906 3300025981 Ga0207640_10129325 Ga0207640_101293254 110
907 3300025981 Ga0207640_10255625 Ga0207640_102556253 110
908 3300025981 Ga0207640_10265896 Ga0207640_102658962 110
909 3300025981 Ga0207640_10419195 Ga0207640_104191952 110
910 3300025981 Ga0207640_10470027 Ga0207640_104700272 110
911 3300025981 Ga0207640_10482314 Ga0207640_104823143 110
912 3300025981 Ga0207640_10848135 Ga0207640_108481352 110
913 3300025981 Ga0207640_11213186 Ga0207640_112131862 110
914 3300025986 Ga0207658_11556665 Ga0207658_115566651 110
915 3300026023 Ga0207677_10299601 Ga0207677_102996012 110
916 3300026023 Ga0207677_10732929 Ga0207677_107329291 110
917 3300026023 Ga0207677_11268258 Ga0207677_112682582 110
918 3300026023 Ga0207677_12002085 Ga0207677_120020852 110
919 3300026035 Ga0207703_10016211 Ga0207703_100162115 110
920 3300026035 Ga0207703_10102323 Ga0207703_101023233 110
921 3300026035 Ga0207703_10103548 Ga0207703_101035483 110
922 3300026035 Ga0207703_10108277 Ga0207703_101082774 110
923 3300026035 Ga0207703_10108349 Ga0207703_101083492 110
924 3300026035 Ga0207703_10134608 Ga0207703_101346083 110
925 3300026035 Ga0207703_10299400 Ga0207703_102994001 110
926 3300026035 Ga0207703_10337432 Ga0207703_103374321 110
927 3300026035 Ga0207703_10773934 Ga0207703_107739342 110
928 3300026041 Ga0207639_10130352 Ga0207639_101303521 110
929 3300026041 Ga0207639_10875156 Ga0207639_108751562 110
930 3300026041 Ga0207639_11616690 Ga0207639_116166901 110
931 3300026041 Ga0207639_11744465 Ga0207639_117444652 110
932 3300026041 Ga0207639_12095856 Ga0207639_120958561 110
933 3300026067 Ga0207678_10618636 Ga0207678_106186361 110
934 3300026067 Ga0207678_10817605 Ga0207678_108176051 110
935 3300026075 Ga0207708_10000196 Ga0207708_1000019633 110
936 3300026075 Ga0207708_10024519 Ga0207708_100245195 110
937 3300026075 Ga0207708_10025822 Ga0207708_100258222 110
938 3300026075 Ga0207708_10097546 Ga0207708_100975461 110
939 3300026075 Ga0207708_10167033 Ga0207708_101670333 110
940 3300026075 Ga0207708_10448049 Ga0207708_104480492 110
941 3300026075 Ga0207708_10716997 Ga0207708_107169972 110
942 3300026078 Ga0207702_10023166 Ga0207702_100231664 110
943 3300026078 Ga0207702_10865586 Ga0207702_108655862 110
944 3300026088 Ga0207641_10053400 Ga0207641_100534003 110
945 3300026088 Ga0207641_10066364 Ga0207641_100663642 110
946 3300026088 Ga0207641_10229101 Ga0207641_102291012 110
947 3300026088 Ga0207641_10235805 Ga0207641_102358051 110
948 3300026088 Ga0207641_10390624 Ga0207641_103906242 110
949 3300026088 Ga0207641_10402557 Ga0207641_104025571 110
950 3300026088 Ga0207641_10758443 Ga0207641_107584432 110
951 3300026088 Ga0207641_10774450 Ga0207641_107744502 110
952 3300026088 Ga0207641_11474433 Ga0207641_114744331 110
953 3300026088 Ga0207641_11489598 Ga0207641_114895981 110
954 3300026088 Ga0207641_12206487 Ga0207641_122064871 110
955 3300026089 Ga0207648_10025398 Ga0207648_100253984 110
956 3300026089 Ga0207648_10041315 Ga0207648_100413152 110
957 3300026089 Ga0207648_10052268 Ga0207648_100522681 110
958 3300026089 Ga0207648_10052499 Ga0207648_100524993 110
959 3300026089 Ga0207648_10085766 Ga0207648_100857664 110
960 3300026089 Ga0207648_10209835 Ga0207648_102098352 110
961 3300026089 Ga0207648_10323595 Ga0207648_103235952 110
962 3300026089 Ga0207648_10889543 Ga0207648_108895432 110
963 3300026095 Ga0207676_10003808 Ga0207676_1000380812 110
964 3300026095 Ga0207676_10022718 Ga0207676_100227184 110
965 3300026095 Ga0207676_10037473 Ga0207676_100374735 110
966 3300026095 Ga0207676_10057488 Ga0207676_100574884 110
967 3300026095 Ga0207676_10135355 Ga0207676_101353552 110
968 3300026095 Ga0207676_10205522 Ga0207676_102055223 110
969 3300026095 Ga0207676_10358770 Ga0207676_103587701 110
970 3300026095 Ga0207676_10376937 Ga0207676_103769372 110
971 3300026095 Ga0207676_10700037 Ga0207676_107000372 110
972 3300026095 Ga0207676_10750417 Ga0207676_107504172 110
973 3300026095 Ga0207676_10767034 Ga0207676_107670342 110
974 3300026095 Ga0207676_10779227 Ga0207676_107792272 110
975 3300026095 Ga0207676_10813426 Ga0207676_108134261 110
976 3300026095 Ga0207676_11488444 Ga0207676_114884442 110
977 3300026095 Ga0207676_12000387 Ga0207676_120003871 110
978 3300026095 Ga0207676_12101541 Ga0207676_121015411 110
979 3300026116 Ga0207674_10001115 Ga0207674_1000111523 110
980 3300026116 Ga0207674_10033931 Ga0207674_100339314 110
981 3300026116 Ga0207674_10141200 Ga0207674_101412003 110
982 3300026116 Ga0207674_10303859 Ga0207674_103038592 110
983 3300026116 Ga0207674_10308047 Ga0207674_103080472 110
984 3300026116 Ga0207674_10453802 Ga0207674_104538023 110
985 3300026116 Ga0207674_10564187 Ga0207674_105641872 110
986 3300026116 Ga0207674_10575997 Ga0207674_105759971 110
987 3300026116 Ga0207674_10697484 Ga0207674_106974841 110
988 3300026116 Ga0207674_10861047 Ga0207674_108610472 110
989 3300026116 Ga0207674_11416742 Ga0207674_114167422 110
990 3300026116 Ga0207674_11433392 Ga0207674_114333921 110
991 3300026116 Ga0207674_11481291 Ga0207674_114812911 110
992 3300026116 Ga0207674_11957967 Ga0207674_119579671 110
993 3300026118 Ga0207675_100008300 Ga0207675_1000083008 110
994 3300026118 Ga0207675_100010894 Ga0207675_1000108949 110
995 3300026118 Ga0207675_100017343 Ga0207675_1000173434 110
996 3300026118 Ga0207675_100027734 Ga0207675_1000277344 110
997 3300026118 Ga0207675_100037404 Ga0207675_1000374042 110
998 3300026118 Ga0207675_100188276 Ga0207675_1001882762 110
999 3300026118 Ga0207675_100233282 Ga0207675_1002332821 110
1000 3300026118 Ga0207675_101488183 Ga0207675_1014881831 110
1001 3300026121 Ga0207683_10622903 Ga0207683_106229032 110
1002 3300026121 Ga0207683_10870574 Ga0207683_108705742 110
1003 3300026142 Ga0207698_10201010 Ga0207698_102010102 110
1004 3300026142 Ga0207698_10420263 Ga0207698_104202632 110
1005 3300026142 Ga0207698_10490958 Ga0207698_104909582 110
1006 3300026142 Ga0207698_10636677 Ga0207698_106366772 110
1007 3300026142 Ga0207698_11330789 Ga0207698_113307891 110
1008 3300026142 Ga0207698_11516620 Ga0207698_115166201 110
1009 3300027907 Ga0207428_10003589 Ga0207428_1000358911 110
1010 3300027907 Ga0207428_10144878 Ga0207428_101448783 110
1011 3300028379 Ga0268266_11929848 Ga0268266_119298481 110
1012 3300028380 Ga0268265_10131993 Ga0268265_101319933 110
1013 3300028380 Ga0268265_10160070 Ga0268265_101600703 110
1014 3300028380 Ga0268265_10223551 Ga0268265_102235513 110
1015 3300028380 Ga0268265_10247986 Ga0268265_102479861 110
1016 3300028380 Ga0268265_10412166 Ga0268265_104121661 110
1017 3300028380 Ga0268265_10685754 Ga0268265_106857542 110
1018 3300028380 Ga0268265_11058294 Ga0268265_110582941 110
1019 3300028380 Ga0268265_11116515 Ga0268265_111165152 110
1020 3300028380 Ga0268265_11299895 Ga0268265_112998952 110
1021 3300028380 Ga0268265_12635367 Ga0268265_126353672 110
1022 3300028381 Ga0268264_10027695 Ga0268264_100276955 110
1023 3300028381 Ga0268264_10036791 Ga0268264_100367911 110
1024 3300028381 Ga0268264_10049768 Ga0268264_100497683 110
1025 3300028381 Ga0268264_10055988 Ga0268264_100559885 110
1026 3300028381 Ga0268264_10117447 Ga0268264_101174472 110
1027 3300028381 Ga0268264_10147987 Ga0268264_101479872 110
1028 3300028381 Ga0268264_10149519 Ga0268264_101495192 110
1029 3300028381 Ga0268264_11503126 Ga0268264_115031262 110
1030 3300030733 Ga0314311_1194228 Ga0314311_11942282 110
1031 3300031548 Ga0307408_100013384 Ga0307408_1000133847 110
1032 3300031548 Ga0307408_100042473 Ga0307408_1000424732 110
1033 3300031548 Ga0307408_100078016 Ga0307408_1000780164 110
1034 3300031548 Ga0307408_100133239 Ga0307408_1001332393 110
1035 3300031548 Ga0307408_100312757 Ga0307408_1003127572 110
1036 3300031548 Ga0307408_100447848 Ga0307408_1004478482 110
1037 3300031548 Ga0307408_100654400 Ga0307408_1006544002 110
1038 3300031548 Ga0307408_100994338 Ga0307408_1009943382 110
1039 3300031548 Ga0307408_101918147 Ga0307408_1019181471 110
1040 3300031731 Ga0307405_10015061 Ga0307405_100150614 110
1041 3300031731 Ga0307405_10018481 Ga0307405_100184812 110
1042 3300031731 Ga0307405_10046932 Ga0307405_100469322 110
1043 3300031731 Ga0307405_10415295 Ga0307405_104152952 110
1044 3300031731 Ga0307405_10706150 Ga0307405_107061502 110
1045 3300031824 Ga0307413_10036152 Ga0307413_100361523 110
1046 3300031824 Ga0307413_10100182 Ga0307413_101001822 110
1047 3300031824 Ga0307413_11238427 Ga0307413_112384272 110
1048 3300031852 Ga0307410_10002023 Ga0307410_100020234 110
1049 3300031852 Ga0307410_10061258 Ga0307410_100612582 110
1050 3300031901 Ga0307406_10007704 Ga0307406_100077046 110
1051 3300031901 Ga0307406_10092030 Ga0307406_100920302 110
1052 3300031903 Ga0307407_10009256 Ga0307407_100092561 110
1053 3300031903 Ga0307407_10061460 Ga0307407_100614602 110
1054 3300031911 Ga0307412_10018014 Ga0307412_100180144 110
1055 3300031911 Ga0307412_10215432 Ga0307412_102154322 110
1056 3300031911 Ga0307412_10271605 Ga0307412_102716052 110
1057 3300031911 Ga0307412_10458779 Ga0307412_104587792 110
1058 3300031911 Ga0307412_11048530 Ga0307412_110485301 110
1059 3300031911 Ga0307412_12140038 Ga0307412_121400381 110
1060 3300031995 Ga0307409_100075645 Ga0307409_1000756453 110
1061 3300031995 Ga0307409_100173127 Ga0307409_1001731271 110
1062 3300031995 Ga0307409_100603566 Ga0307409_1006035662 110
1063 3300031995 Ga0307409_100684462 Ga0307409_1006844622 110
1064 3300031995 Ga0307409_101788176 Ga0307409_1017881762 110
1065 3300032002 Ga0307416_100010309 Ga0307416_1000103094 110
1066 3300032002 Ga0307416_100172642 Ga0307416_1001726422 110
1067 3300032002 Ga0307416_100224473 Ga0307416_1002244734 110
1068 3300032002 Ga0307416_100563007 Ga0307416_1005630072 110
1069 3300032004 Ga0307414_10007653 Ga0307414_100076534 110
1070 3300032004 Ga0307414_10512349 Ga0307414_105123491 110
1071 3300032004 Ga0307414_10513069 Ga0307414_105130691 110
1072 3300032004 Ga0307414_10657281 Ga0307414_106572811 110
1073 3300032005 Ga0307411_10028911 Ga0307411_100289115 110
1074 3300032005 Ga0307411_10056612 Ga0307411_100566124 110
1075 3300032005 Ga0307411_10298789 Ga0307411_102987891 110
1076 3300032126 Ga0307415_100007828 Ga0307415_1000078287 110
1077 3300032126 Ga0307415_100009415 Ga0307415_1000094152 110
1078 3300032126 Ga0307415_100277030 Ga0307415_1002770302 110
1079 3300032126 Ga0307415_100792534 Ga0307415_1007925342 110
1080 3300032126 Ga0307415_100948819 Ga0307415_1009488191 110
1081 3300034816 Ga0373930_0070262 Ga0373930_0070262_189_524 110
1082 3300035088 Ga0373940_0092151 Ga0373940_0092151_457_792 110
1083 3300035091 Ga0373951_0000266 Ga0373951_0000266_2425_2760 110
1084 3300035091 Ga0373951_0043101 Ga0373951_0043101_353_688 110
1085 3300035115 Ga0373941_0009951 Ga0373941_0009951_270_605 110
1086 3300035115 Ga0373941_0070196 Ga0373941_0070196_609_944 110
1087 3300035115 Ga0373941_0101565 Ga0373941_0101565_321_656 110
1088 3300035172 Ga0373955_0236707 Ga0373955_0236707_600_932 110
1089 3300035691 Ga0373931_0134736 Ga0373931_0134736_295_630 110
1090 3300036401 Ga0373937_0026568 Ga0373937_0026568_1892_2224 110
1091 3300037418 Ga0395900_0071081 Ga0395900_0071081_67_402 110
1092 3300037418 Ga0395900_0174348 Ga0395900_0174348_267_656 110
1093 3300037418 Ga0395900_1741907 Ga0395900_1741907_127_462 110
1094 3300037466 Ga0395898_0042223 Ga0395898_0042223_3457_3792 110
1095 3300037466 Ga0395898_0689554 Ga0395898_0689554_562_897 110
1096 3300037466 Ga0395898_0890092 Ga0395898_0890092_224_613 110
1097 3300037471 Ga0395905_0001898 Ga0395905_0001898_21151_21486 110
1098 3300037471 Ga0395905_0149690 Ga0395905_0149690_847_1236 110
1099 3300038443 Ga0395901_1863149 Ga0395901_1863149_180_515 110
1100 3300038699 Ga0242422_00216 Ga0242422_00216_1298_1633 110
1101 3300038996 Ga0242420_004095 Ga0242420_004095_92_427 110
1102 3300039437 Ga0436365_1124199 Ga0436365_1124199_794_1129 110
1103 3300041411 Ga0439466_0120413 Ga0439466_0120413_127_471 110
1104 3300041413 Ga0439465_0407354 Ga0439465_0407354_37_369 110
1105 3300041507 Ga0451851_0683408 Ga0451851_0683408_101_433 110
1106 3300042005 Ga0439448_0113932 Ga0439448_0113932_255_590 110
1107 3300042006 Ga0439432_041430 Ga0439432_041430_126_470 110
1108 3300042012 Ga0439455_0002290 Ga0439455_0002290_1486_1821 110
1109 3300042015 Ga0439462_0089555 Ga0439462_0089555_395_730 110
1110 3300042118 Ga0450914_005011 Ga0450914_005011_67_402 110
1111 3300042157 Ga0439458_0001735 Ga0439458_0001735_3121_3456 110
1112 3300042435 Ga0439434_0077574 Ga0439434_0077574_651_986 110
1113 3300042876 Ga0451577_1947822 Ga0451577_1947822_76_408 110
1114 3300045051 Ga0451576_0548841 Ga0451576_0548841_279_614 110
1115 3300046473 Ga0495582_0203607 Ga0495582_0203607_572_904 110
1116 3300046689 Ga0495613_0236034 Ga0495613_0236034_15_347 110
1117 3300048903 Ga0496100_0152678 Ga0496100_0152678_227_559 110
1118 3300048905 Ga0496102_0011427 Ga0496102_0011427_3289_3621 110
1119 3300048905 Ga0496102_0116640 Ga0496102_0116640_804_1139 110
1120 3300048905 Ga0496102_0953668 Ga0496102_0953668_420_755 110
1121 3300048906 Ga0496103_0311167 Ga0496103_0311167_317_649 110
1122 3300048907 Ga0496104_0063329 Ga0496104_0063329_2856_3188 110
1123 3300048907 Ga0496104_0349306 Ga0496104_0349306_104_439 110
1124 3300048908 Ga0496105_0667348 Ga0496105_0667348_268_603 110
1125 3300048909 Ga0496106_0234795 Ga0496106_0234795_186_521 110
1126 3300048909 Ga0496106_0476520 Ga0496106_0476520_441_776 110
1127 3300048909 Ga0496106_0531911 Ga0496106_0531911_299_631 110
1128 3300048909 Ga0496106_1307781 Ga0496106_1307781_107_442 110
1129 3300048911 Ga0496108_1061094 Ga0496108_1061094_58_393 110
1130 3300048912 Ga0496109_0512991 Ga0496109_0512991_394_729 110
1131 3300048912 Ga0496109_1193651 Ga0496109_1193651_44_379 110
1132 3300048913 Ga0496110_0499781 Ga0496110_0499781_668_1003 110
1133 3300048913 Ga0496110_1019972 Ga0496110_1019972_56_391 110
1134 3300048913 Ga0496110_1442206 Ga0496110_1442206_89_424 110
1135 3300048915 Ga0496112_0025724 Ga0496112_0025724_4093_4428 110
1136 3300048915 Ga0496112_0162595 Ga0496112_0162595_474_809 110
1137 3300048915 Ga0496112_0174008 Ga0496112_0174008_1668_2003 110
1138 3300048915 Ga0496112_0333453 Ga0496112_0333453_407_742 110
1139 3300048915 Ga0496112_0561570 Ga0496112_0561570_61_396 110
1140 3300048915 Ga0496112_0776098 Ga0496112_0776098_172_504 110
1141 3300048915 Ga0496112_1227017 Ga0496112_1227017_306_641 110
1142 3300048915 Ga0496112_1243602 Ga0496112_1243602_301_636 110
1143 3300048915 Ga0496112_1340555 Ga0496112_1340555_280_615 110
1144 3300048915 Ga0496112_1674078 Ga0496112_1674078_93_425 110
1145 3300048916 Ga0496113_0232300 Ga0496113_0232300_102_434 110
1146 3300048916 Ga0496113_0783022 Ga0496113_0783022_79_414 110
1147 3300048916 Ga0496113_1238099 Ga0496113_1238099_135_470 110
1148 3300049127 Ga0501306_025283 Ga0501306_025283_48_383 110
1149 3300049162 Ga0501307_016163 Ga0501307_016163_287_622 110
1150 3300049513 Ga0501290_004185 Ga0501290_004185_438_773 110
1151 3300049513 Ga0501290_040259 Ga0501290_040259_256_591 110
1152 3300049514 Ga0501291_009882 Ga0501291_009882_532_867 110
1153 3300049514 Ga0501291_010725 Ga0501291_010725_60_395 110
1154 3300049515 Ga0501292_003121 Ga0501292_003121_1568_1903 110
1155 3300049515 Ga0501292_003124 Ga0501292_003124_1650_1985 110
1156 3300049515 Ga0501292_015946 Ga0501292_015946_737_1072 110
1157 3300049518 Ga0501295_054568 Ga0501295_054568_310_645 110
1158 3300049518 Ga0501295_055089 Ga0501295_055089_108_443 110
1159 3300049519 Ga0501296_003503 Ga0501296_003503_103_438 110
1160 3300049519 Ga0501296_006498 Ga0501296_006498_535_870 110
1161 3300049520 Ga0501297_005098 Ga0501297_005098_506_841 110
1162 3300049520 Ga0501297_009085 Ga0501297_009085_160_495 110
1163 3300049520 Ga0501297_031024 Ga0501297_031024_295_630 110
1164 3300049521 Ga0501298_002676 Ga0501298_002676_1727_2062 110
1165 3300049521 Ga0501298_041241 Ga0501298_041241_395_730 110
1166 3300049521 Ga0501298_072257 Ga0501298_072257_174_509 110
1167 3300049521 Ga0501298_135017 Ga0501298_135017_154_486 110
1168 3300049522 Ga0501299_000754 Ga0501299_000754_1845_2180 110
1169 3300049522 Ga0501299_007263 Ga0501299_007263_433_768 110
1170 3300049522 Ga0501299_009672 Ga0501299_009672_776_1111 110
1171 3300049523 Ga0501300_004680 Ga0501300_004680_644_979 110
1172 3300049523 Ga0501300_019111 Ga0501300_019111_253_588 110
1173 3300049526 Ga0501303_005503 Ga0501303_005503_36_371 110
1174 3300049527 Ga0501311_025714 Ga0501311_025714_238_573 110
1175 3300049574 Ga0501038_0032512 Ga0501038_0032512_3673_4008 110
1176 3300049583 Ga0501067_0638052 Ga0501067_0638052_187_522 110
1177 3300049588 Ga0501072_0538087 Ga0501072_0538087_108_443 110
1178 3300049591 Ga0501075_1329767 Ga0501075_1329767_109_444 110
1179 3300049649 Ga0501198_001879 Ga0501198_001879_1000_1335 110
1180 3300049649 Ga0501198_002730 Ga0501198_002730_1866_2201 110
1181 3300049652 Ga0501202_001705 Ga0501202_001705_1850_2185 110
1182 3300049652 Ga0501202_006175 Ga0501202_006175_67_402 110
1183 3300049652 Ga0501202_111111 Ga0501202_111111_262_597 110
1184 3300049653 Ga0501206_003365 Ga0501206_003365_858_1193 110
1185 3300049653 Ga0501206_015357 Ga0501206_015357_530_865 110
1186 3300049655 Ga0501208_004930 Ga0501208_004930_211_546 110
1187 3300049655 Ga0501208_005660 Ga0501208_005660_33_368 110
1188 3300049656 Ga0501209_020524 Ga0501209_020524_538_873 110
1189 3300049656 Ga0501209_038598 Ga0501209_038598_874_1209 110
1190 3300049659 Ga0501214_002166 Ga0501214_002166_1263_1598 110
1191 3300049660 Ga0501216_002071 Ga0501216_002071_1231_1566 110
1192 3300049660 Ga0501216_003901 Ga0501216_003901_479_814 110
1193 3300049661 Ga0501217_000517 Ga0501217_000517_1880_2215 110
1194 3300049661 Ga0501217_002052 Ga0501217_002052_1817_2152 110
1195 3300049661 Ga0501217_127653 Ga0501217_127653_369_704 110
1196 3300049663 Ga0501223_000504 Ga0501223_000504_6648_6983 110
1197 3300049663 Ga0501223_006582 Ga0501223_006582_913_1248 110
1198 3300049663 Ga0501223_033979 Ga0501223_033979_595_930 110
1199 3300049663 Ga0501223_057581 Ga0501223_057581_70_405 110
1200 3300049664 Ga0501224_003539 Ga0501224_003539_70_405 110
1201 3300049664 Ga0501224_014757 Ga0501224_014757_270_605 110
1202 3300049664 Ga0501224_063876 Ga0501224_063876_207_542 110
1203 3300049665 Ga0501227_000295 Ga0501227_000295_2951_3286 110
1204 3300049665 Ga0501227_084440 Ga0501227_084440_102_437 110
1205 3300049667 Ga0501230_142613 Ga0501230_142613_24_359 110
1206 3300049668 Ga0501233_000556 Ga0501233_000556_3719_4054 110
1207 3300049668 Ga0501233_005685 Ga0501233_005685_451_786 110
1208 3300049668 Ga0501233_016218 Ga0501233_016218_80_415 110
1209 3300049669 Ga0501235_000590 Ga0501235_000590_1683_2018 110
1210 3300049669 Ga0501235_007415 Ga0501235_007415_1504_1839 110
1211 3300049669 Ga0501235_047113 Ga0501235_047113_64_399 110
1212 3300049669 Ga0501235_121680 Ga0501235_121680_147_482 110
1213 3300049669 Ga0501235_201190 Ga0501235_201190_54_386 110
1214 3300049671 Ga0501238_019305 Ga0501238_019305_193_528 110
1215 3300049672 Ga0501239_001368 Ga0501239_001368_686_1021 110
1216 3300049673 Ga0501240_000221 Ga0501240_000221_1291_1626 110
1217 3300049673 Ga0501240_037710 Ga0501240_037710_112_447 110
1218 3300049674 Ga0501242_044378 Ga0501242_044378_207_542 110
1219 3300049675 Ga0501243_011012 Ga0501243_011012_571_906 110
1220 3300049679 Ga0501249_013420 Ga0501249_013420_507_842 110
1221 3300049679 Ga0501249_160157 Ga0501249_160157_50_385 110
1222 3300049680 Ga0501250_001921 Ga0501250_001921_564_899 110
1223 3300049681 Ga0501251_002794 Ga0501251_002794_321_656 110
1224 3300049681 Ga0501251_008926 Ga0501251_008926_725_1060 110
1225 3300049683 Ga0501253_001363 Ga0501253_001363_1343_1678 110
1226 3300049683 Ga0501253_017879 Ga0501253_017879_170_505 110
1227 3300049683 Ga0501253_070491 Ga0501253_070491_84_419 110
1228 3300049686 Ga0501257_040736 Ga0501257_040736_233_568 110
1229 3300049686 Ga0501257_068297 Ga0501257_068297_383_718 110
1230 3300049686 Ga0501257_119225 Ga0501257_119225_188_523 110
1231 3300049688 Ga0501259_018316 Ga0501259_018316_394_729 110
1232 3300049688 Ga0501259_050077 Ga0501259_050077_366_701 110
1233 3300049689 Ga0501260_040147 Ga0501260_040147_189_524 110
1234 3300049704 Ga0501221_023102 Ga0501221_023102_685_1020 110
1235 3300049704 Ga0501221_070746 Ga0501221_070746_83_418 110
1236 3300049705 Ga0501225_0000145 Ga0501225_0000145_16000_16335 110
1237 3300049705 Ga0501225_0042408 Ga0501225_0042408_529_864 110
1238 3300049706 Ga0501229_005664 Ga0501229_005664_1043_1378 110
1239 3300049707 Ga0501234_000075 Ga0501234_000075_1339_1674 110
1240 3300049707 Ga0501234_002153 Ga0501234_002153_1640_1975 110
1241 3300049707 Ga0501234_011417 Ga0501234_011417_170_505 110
1242 3300049708 Ga0501245_007712 Ga0501245_007712_747_1082 110
1243 3300049708 Ga0501245_012891 Ga0501245_012891_672_1007 110
1244 3300049708 Ga0501245_070538 Ga0501245_070538_159_494 110
1245 3300049743 Ga0501081_0866181 Ga0501081_0866181_83_418 110
1246 3300049758 Ga0501241_163592 Ga0501241_163592_53_388 110
1247 3300049760 Ga0501263_009001 Ga0501263_009001_28_363 110
1248 3300049760 Ga0501263_044794 Ga0501263_044794_65_400 110
1249 3300049762 Ga0501265_053833 Ga0501265_053833_36_371 110
1250 3300049763 Ga0501266_022281 Ga0501266_022281_354_689 110
1251 3300049764 Ga0501267_053164 Ga0501267_053164_72_404 110
1252 3300049767 Ga0501270_051266 Ga0501270_051266_17_352 110
1253 3300049769 Ga0501272_012536 Ga0501272_012536_573_908 110
1254 3300049769 Ga0501272_023309 Ga0501272_023309_322_657 110
1255 3300049770 Ga0501273_003589 Ga0501273_003589_50_385 110
1256 3300049770 Ga0501273_011933 Ga0501273_011933_80_415 110
1257 3300049774 Ga0501278_002788 Ga0501278_002788_239_574 110
1258 3300049774 Ga0501278_004265 Ga0501278_004265_597_932 110
1259 3300049775 Ga0501279_001580 Ga0501279_001580_1369_1704 110
1260 3300049775 Ga0501279_001951 Ga0501279_001951_930_1265 110
1261 3300049779 Ga0501283_009914 Ga0501283_009914_619_954 110
1262 3300049779 Ga0501283_011895 Ga0501283_011895_793_1128 110
1263 3300049779 Ga0501283_048461 Ga0501283_048461_294_629 110
1264 3300049850 Ga0501204_015500 Ga0501204_015500_14_349 110
1265 3300049851 Ga0501212_001962 Ga0501212_001962_77_412 110
1266 3300049853 Ga0501226_002189 Ga0501226_002189_1519_1854 110
1267 3300049853 Ga0501226_005552 Ga0501226_005552_603_938 110
1268 3300050507 nmdc:mga05p37_1986380_c1 nmdc:mga05p37_1986380_c1_96_431 110
1269 3300050507 nmdc:mga05p37_275177_c1 nmdc:mga05p37_275177_c1_1105_1437 110
1270 3300050507 nmdc:mga05p37_301069_c1 nmdc:mga05p37_301069_c1_303_635 110
1271 3300050507 nmdc:mga05p37_320629_c1 nmdc:mga05p37_320629_c1_1383_1718 110
1272 3300050507 nmdc:mga05p37_558118_c1 nmdc:mga05p37_558118_c1_170_502 110
1273 3300050507 nmdc:mga05p37_860956_c1 nmdc:mga05p37_860956_c1_106_441 110
1274 3300050508 nmdc:mga09592_1449450_c1 nmdc:mga09592_1449450_c1_200_532 110
1275 3300050508 nmdc:mga09592_440863_c1 nmdc:mga09592_440863_c1_366_701 110
1276 3300050508 nmdc:mga09592_71662_c1 nmdc:mga09592_71662_c1_1287_1619 110
1277 3300050508 nmdc:mga09592_898796_c1 nmdc:mga09592_898796_c1_392_724 110
1278 3300050508 nmdc:mga09592_92749_c1 nmdc:mga09592_92749_c1_1683_2015 110
1279 3300050509 nmdc:mga0qj67_16939_c1 nmdc:mga0qj67_16939_c1_598_930 110
1280 3300050509 nmdc:mga0qj67_221311_c1 nmdc:mga0qj67_221311_c1_308_643 110
1281 3300050510 nmdc:mga06r32_136876_c1 nmdc:mga06r32_136876_c1_610_990 110
1282 3300050510 nmdc:mga06r32_171085_c1 nmdc:mga06r32_171085_c1_531_866 110
1283 3300050510 nmdc:mga06r32_210654_c1 nmdc:mga06r32_210654_c1_344_712 110
1284 3300050510 nmdc:mga06r32_831562_c1 nmdc:mga06r32_831562_c1_248_583 110
1285 3300050511 nmdc:mga08y16_143327_c1 nmdc:mga08y16_143327_c1_446_778 110
1286 3300050511 nmdc:mga08y16_325364_c1 nmdc:mga08y16_325364_c1_81_413 110
1287 3300050511 nmdc:mga08y16_3905_c1 nmdc:mga08y16_3905_c1_7468_7803 110
1288 3300050512 nmdc:mga0n895_1528387_c1 nmdc:mga0n895_1528387_c1_139_471 110
1289 3300050512 nmdc:mga0n895_163075_c1 nmdc:mga0n895_163075_c1_1501_1836 110
1290 3300050512 nmdc:mga0n895_438430_c1 nmdc:mga0n895_438430_c1_26_361 110
1291 3300050512 nmdc:mga0n895_693258_c1 nmdc:mga0n895_693258_c1_452_787 110
1292 3300050515 nmdc:mga0a205_312347_c1 nmdc:mga0a205_312347_c1_946_1281 110
1293 3300050515 nmdc:mga0a205_496004_c1 nmdc:mga0a205_496004_c1_65_400 110
1294 3300050515 nmdc:mga0a205_512442_c1 nmdc:mga0a205_512442_c1_212_544 110
1295 3300050515 nmdc:mga0a205_535885_c1 nmdc:mga0a205_535885_c1_590_925 110
1296 3300050515 nmdc:mga0a205_75331_c1 nmdc:mga0a205_75331_c1_1634_1969 110
1297 3300050515 nmdc:mga0a205_84544_c1 nmdc:mga0a205_84544_c1_2467_2802 110
1298 3300050515 nmdc:mga0a205_878738_c1 nmdc:mga0a205_878738_c1_61_393 110
1299 3300054114 Ga0501084_0801137 Ga0501084_0801137_388_723 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

8

84

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i7h-assembly3.cif.gz_C crystal sturcuture of fdx 0.928 3 94
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.899 1 94
2y5c-assembly2.cif.gz_B structure of human ferredoxin 2 (fdx2)in complex with 2fe2s cluster 0.8701 2 93
1xlq-assembly4.cif.gz_A crystal structure of reduced c73s putidaredoxin from pseudomonas putida 0.8632 2 96
6nbl-assembly2.cif.gz_D cytochrome p450cam-putidaredoxin complex bound to camphor and cyanide 0.8584 1 96
ID Description Score Start End Superfamily
1i7hA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9234 3 94 3.10.20.30
af_A4I756_34_144_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8647 2 93 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8623 2 96 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8567 3 96 3.10.20.30
af_Q9CPW2_55_168_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8557 2 94 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A2V8NQ13-F1-model_v4 (2Fe-2S)-binding protein 0.9985 1 109 GO:0009055
GO:0051537
GO:0140647
AF-A0A7T9J6Y2-F1-model_v4 deleted 0.9984 1 110
AF-A0A7V9N2T1-F1-model_v4 (2Fe-2S)-binding protein 0.9906 15 109 GO:0009055
GO:0051537
GO:0140647
AF-A0A2V8NQ13-F1-model_v4 (2Fe-2S)-binding protein 0.9805 1 109 GO:0009055
GO:0051537
GO:0140647
AF-A0A7W1DXR3-F1-model_v4 (2Fe-2S)-binding protein 0.9539 1 109 GO:0051536

Feature Viewer

pLDDT pTM Quality
89.9 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map