F492704
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1297 | 442 | 2594 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300030733|Ga0314311_1214342|Ga0314311_12143421 |
| Length | 158 |
| Sequence | VADKGTAATGPNVPAPARPDTLGPMTQRTFVILKPDAVRRGLVGEILSRYEAKGLSIVKLEHRTIDAGMADEHYAEHVEQPWYPPLRDFVTSGPLVAAVLEGDEAIEVVRALNGATDGRKAAPGTIRGDFSLSNRENLVHGSDSPESADREIKLWFGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 111 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 112 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 113 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 114 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 115 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 116 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 117 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 202 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 203 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 205 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 208 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 211 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 225 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 235 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 254 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 259 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 260 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 263 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 264 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 265 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 266 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 267 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 268 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 269 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 270 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 271 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 272 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 273 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 274 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 275 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 276 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 277 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 278 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 279 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 280 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 281 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 282 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 283 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 284 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 287 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 288 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 289 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 355 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 356 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 357 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 358 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 359 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 360 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 362 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 363 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 364 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 365 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 366 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 367 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 368 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 395 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 407 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 408 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 409 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 424 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 425 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 426 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 427 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 430 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 431 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 432 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 433 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 434 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 435 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 436 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 437 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 438 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 439 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 440 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 441 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 442 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.54 |
| Metatranscriptomes | 0.54 |
| Isolates | 0.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.15 |
| Bulb | 0 |
| Endosphere | 6.09 |
| Nodule | 0 |
| Rhizoplane | 8.25 |
| Rhizosphere | 83.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.08 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0314311_1214342 | 3300030733 | Bacteria | 1133 |
| 2 | LJQas_1004621 | 3300000549 | Bacteria | 1783 |
| 3 | JGI24740J21852_10083557 | 3300001979 | Bacteria | 833 |
| 4 | JGI24739J22299_10103608 | 3300001989 | Bacteria | 857 |
| 5 | JGI24737J22298_10226241 | 3300001990 | Bacteria | 552 |
| 6 | JGI24737J22298_10251388 | 3300001990 | Bacteria | 522 |
| 7 | JGI24738J21930_10013118 | 3300002075 | Bacteria | 1797 |
| 8 | JGI24738J21930_10031848 | 3300002075 | Bacteria | 1075 |
| 9 | Ga0070658_10179980 | 3300005327 | Bacteria | 1779 |
| 10 | Ga0070683_100001049 | 3300005329 | Bacteria | 20741 |
| 11 | Ga0070683_100003297 | 3300005329 | Bacteria | 13045 |
| 12 | Ga0070683_100025448 | 3300005329 | Bacteria | 5315 |
| 13 | Ga0070683_100030750 | 3300005329 | Bacteria | 4878 |
| 14 | Ga0070683_100044814 | 3300005329 | Bacteria | 4080 |
| 15 | Ga0070683_100049206 | 3300005329 | Bacteria | 3898 |
| 16 | Ga0070683_100143693 | 3300005329 | Bacteria | 2260 |
| 17 | Ga0070683_100168821 | 3300005329 | Bacteria | 2076 |
| 18 | Ga0070683_100179135 | 3300005329 | Bacteria | 2012 |
| 19 | Ga0070683_100380727 | 3300005329 | Bacteria | 1345 |
| 20 | Ga0070683_100436690 | 3300005329 | Bacteria | 1249 |
| 21 | Ga0070683_100917085 | 3300005329 | Bacteria | 840 |
| 22 | Ga0070683_100989056 | 3300005329 | Bacteria | 807 |
| 23 | Ga0070670_100016510 | 3300005331 | Bacteria | 6338 |
| 24 | Ga0068869_100118398 | 3300005334 | Bacteria | 2023 |
| 25 | Ga0068869_101044449 | 3300005334 | Bacteria | 713 |
| 26 | Ga0070680_100025051 | 3300005336 | Bacteria | 4769 |
| 27 | Ga0070682_100062861 | 3300005337 | Bacteria | 2352 |
| 28 | Ga0070682_100357489 | 3300005337 | Bacteria | 1091 |
| 29 | Ga0070682_101442825 | 3300005337 | Bacteria | 590 |
| 30 | Ga0068868_100066218 | 3300005338 | Bacteria | 2871 |
| 31 | Ga0068868_100243399 | 3300005338 | Bacteria | 1512 |
| 32 | Ga0068868_100847373 | 3300005338 | Bacteria | 828 |
| 33 | Ga0068868_101530381 | 3300005338 | Bacteria | 625 |
| 34 | Ga0070660_100302694 | 3300005339 | Bacteria | 1311 |
| 35 | Ga0070660_100320104 | 3300005339 | Bacteria | 1274 |
| 36 | Ga0070660_100348650 | 3300005339 | Bacteria | 1219 |
| 37 | Ga0070660_100427520 | 3300005339 | Bacteria | 1097 |
| 38 | Ga0070689_100435419 | 3300005340 | Bacteria | 1113 |
| 39 | Ga0070689_100482017 | 3300005340 | Bacteria | 1060 |
| 40 | Ga0070691_10007979 | 3300005341 | Bacteria | 4841 |
| 41 | Ga0070691_10088069 | 3300005341 | Bacteria | 1528 |
| 42 | Ga0070687_100056070 | 3300005343 | Bacteria | 2061 |
| 43 | Ga0070661_100351675 | 3300005344 | Bacteria | 1156 |
| 44 | Ga0070661_100424870 | 3300005344 | Bacteria | 1054 |
| 45 | Ga0070661_100737249 | 3300005344 | Bacteria | 805 |
| 46 | Ga0070661_101763969 | 3300005344 | Bacteria | 525 |
| 47 | Ga0070692_10002528 | 3300005345 | Bacteria | 7113 |
| 48 | Ga0070692_10497542 | 3300005345 | Bacteria | 789 |
| 49 | Ga0070692_10858717 | 3300005345 | Bacteria | 624 |
| 50 | Ga0070668_100000590 | 3300005347 | Bacteria | 24324 |
| 51 | Ga0070668_100025560 | 3300005347 | Bacteria | 4478 |
| 52 | Ga0070668_100254163 | 3300005347 | Bacteria | 1460 |
| 53 | Ga0070668_100486686 | 3300005347 | Bacteria | 1066 |
| 54 | Ga0070668_100681944 | 3300005347 | Bacteria | 905 |
| 55 | Ga0070669_100273624 | 3300005353 | Bacteria | 1351 |
| 56 | Ga0070669_100592968 | 3300005353 | Bacteria | 928 |
| 57 | Ga0070675_100146644 | 3300005354 | Bacteria | 2021 |
| 58 | Ga0070675_100208810 | 3300005354 | Bacteria | 1697 |
| 59 | Ga0070671_100384235 | 3300005355 | Bacteria | 1200 |
| 60 | Ga0070674_100099915 | 3300005356 | Bacteria | 2112 |
| 61 | Ga0070674_100139306 | 3300005356 | Bacteria | 1819 |
| 62 | Ga0070674_100182751 | 3300005356 | Bacteria | 1608 |
| 63 | Ga0070674_100454636 | 3300005356 | Bacteria | 1058 |
| 64 | Ga0070674_101395355 | 3300005356 | Bacteria | 627 |
| 65 | Ga0070688_101201689 | 3300005365 | Bacteria | 609 |
| 66 | Ga0070659_100017763 | 3300005366 | Bacteria | 5357 |
| 67 | Ga0070659_100057950 | 3300005366 | Bacteria | 3055 |
| 68 | Ga0070659_100330778 | 3300005366 | Bacteria | 1275 |
| 69 | Ga0070659_100547078 | 3300005366 | Bacteria | 991 |
| 70 | Ga0070659_100709760 | 3300005366 | Bacteria | 870 |
| 71 | Ga0070659_100739122 | 3300005366 | Bacteria | 853 |
| 72 | Ga0070667_100852818 | 3300005367 | Bacteria | 847 |
| 73 | Ga0070714_100054083 | 3300005435 | Bacteria | 3429 |
| 74 | Ga0070714_100597391 | 3300005435 | Bacteria | 1060 |
| 75 | Ga0070714_100966826 | 3300005435 | Bacteria | 828 |
| 76 | Ga0070713_100016526 | 3300005436 | Bacteria | 5549 |
| 77 | Ga0070713_101421663 | 3300005436 | Bacteria | 673 |
| 78 | Ga0070710_10301056 | 3300005437 | Bacteria | 1047 |
| 79 | Ga0070700_100317301 | 3300005441 | Bacteria | 1144 |
| 80 | Ga0070700_100396849 | 3300005441 | Bacteria | 1036 |
| 81 | Ga0070700_101379467 | 3300005441 | Bacteria | 595 |
| 82 | Ga0070694_101312896 | 3300005444 | Bacteria | 609 |
| 83 | Ga0070708_100834914 | 3300005445 | Bacteria | 866 |
| 84 | Ga0070663_100201049 | 3300005455 | Bacteria | 1555 |
| 85 | Ga0070663_100295609 | 3300005455 | Bacteria | 1295 |
| 86 | Ga0070663_101254166 | 3300005455 | Bacteria | 653 |
| 87 | Ga0070678_100004765 | 3300005456 | Bacteria | 7738 |
| 88 | Ga0070678_100361027 | 3300005456 | Bacteria | 1252 |
| 89 | Ga0070678_100531435 | 3300005456 | Bacteria | 1042 |
| 90 | Ga0070662_100069041 | 3300005457 | Bacteria | 2600 |
| 91 | Ga0070662_100440541 | 3300005457 | Bacteria | 1080 |
| 92 | Ga0070681_10023644 | 3300005458 | Bacteria | 6183 |
| 93 | Ga0070681_10337392 | 3300005458 | Bacteria | 1417 |
| 94 | Ga0070681_11936590 | 3300005458 | Bacteria | 517 |
| 95 | Ga0068867_100028221 | 3300005459 | Bacteria | 4040 |
| 96 | Ga0068867_100550679 | 3300005459 | Bacteria | 999 |
| 97 | Ga0070685_10358055 | 3300005466 | Bacteria | 1000 |
| 98 | Ga0070685_10557578 | 3300005466 | Bacteria | 819 |
| 99 | Ga0070706_100658583 | 3300005467 | Bacteria | 972 |
| 100 | Ga0070707_101034651 | 3300005468 | Bacteria | 787 |
| 101 | Ga0070698_100018611 | 3300005471 | Bacteria | 7312 |
| 102 | Ga0070698_100340528 | 3300005471 | Bacteria | 1431 |
| 103 | Ga0070699_100017915 | 3300005518 | Archaea | 6082 |
| 104 | Ga0070679_100026379 | 3300005530 | Bacteria | 5707 |
| 105 | Ga0070679_100151610 | 3300005530 | Bacteria | 2294 |
| 106 | Ga0070679_101335033 | 3300005530 | Bacteria | 663 |
| 107 | Ga0070684_100000789 | 3300005535 | Bacteria | 21987 |
| 108 | Ga0070684_100001346 | 3300005535 | Bacteria | 17608 |
| 109 | Ga0070684_100009409 | 3300005535 | Bacteria | 7694 |
| 110 | Ga0070684_100017306 | 3300005535 | Bacteria | 5912 |
| 111 | Ga0070684_100025677 | 3300005535 | Bacteria | 4955 |
| 112 | Ga0070684_100112946 | 3300005535 | Bacteria | 2437 |
| 113 | Ga0070684_100157631 | 3300005535 | Bacteria | 2058 |
| 114 | Ga0070684_100158676 | 3300005535 | Bacteria | 2051 |
| 115 | Ga0070684_100583236 | 3300005535 | Bacteria | 1039 |
| 116 | Ga0070684_100773412 | 3300005535 | Bacteria | 897 |
| 117 | Ga0070684_100852822 | 3300005535 | Bacteria | 853 |
| 118 | Ga0070697_100087737 | 3300005536 | Archaea | 2569 |
| 119 | Ga0070697_100095055 | 3300005536 | Archaea | 2470 |
| 120 | Ga0068853_100958835 | 3300005539 | Bacteria | 823 |
| 121 | Ga0070672_100067473 | 3300005543 | Bacteria | 2834 |
| 122 | Ga0070672_100429394 | 3300005543 | Bacteria | 1136 |
| 123 | Ga0070672_100440768 | 3300005543 | Bacteria | 1121 |
| 124 | Ga0070686_100010126 | 3300005544 | Bacteria | 5306 |
| 125 | Ga0070686_100334120 | 3300005544 | Bacteria | 1134 |
| 126 | Ga0070695_100068715 | 3300005545 | Archaea | 2314 |
| 127 | Ga0070695_100255484 | 3300005545 | Bacteria | 1277 |
| 128 | Ga0070693_100006493 | 3300005547 | Bacteria | 5670 |
| 129 | Ga0070665_100071496 | 3300005548 | Bacteria | 3476 |
| 130 | Ga0070665_100132717 | 3300005548 | Bacteria | 2492 |
| 131 | Ga0068855_100103863 | 3300005563 | Bacteria | 3269 |
| 132 | Ga0068855_101955504 | 3300005563 | Bacteria | 593 |
| 133 | Ga0070664_100006150 | 3300005564 | Bacteria | 9705 |
| 134 | Ga0070664_100012395 | 3300005564 | Bacteria | 6928 |
| 135 | Ga0070664_101460601 | 3300005564 | Bacteria | 647 |
| 136 | Ga0068857_100000049 | 3300005577 | Bacteria | 66755 |
| 137 | Ga0068857_100009622 | 3300005577 | Bacteria | 8397 |
| 138 | Ga0068857_100066232 | 3300005577 | Bacteria | 3213 |
| 139 | Ga0068857_100993192 | 3300005577 | Bacteria | 808 |
| 140 | Ga0068854_100295002 | 3300005578 | Bacteria | 1310 |
| 141 | Ga0068854_101441923 | 3300005578 | Bacteria | 623 |
| 142 | Ga0068856_100001926 | 3300005614 | Bacteria | 21640 |
| 143 | Ga0068856_100180096 | 3300005614 | Bacteria | 2126 |
| 144 | Ga0068856_100373643 | 3300005614 | Bacteria | 1444 |
| 145 | Ga0068856_100787675 | 3300005614 | Bacteria | 971 |
| 146 | Ga0068856_100915610 | 3300005614 | Bacteria | 896 |
| 147 | Ga0070702_100002194 | 3300005615 | Bacteria | 8319 |
| 148 | Ga0068852_100010997 | 3300005616 | Bacteria | 6788 |
| 149 | Ga0068852_100368523 | 3300005616 | Bacteria | 1407 |
| 150 | Ga0068859_100375629 | 3300005617 | Bacteria | 1517 |
| 151 | Ga0068864_100109881 | 3300005618 | Bacteria | 2455 |
| 152 | Ga0068864_100336567 | 3300005618 | Bacteria | 1421 |
| 153 | Ga0068866_10635385 | 3300005718 | Bacteria | 725 |
| 154 | Ga0068866_11123852 | 3300005718 | Bacteria | 564 |
| 155 | Ga0068861_100036348 | 3300005719 | Bacteria | 3654 |
| 156 | Ga0068861_100096130 | 3300005719 | Bacteria | 2347 |
| 157 | Ga0068861_100693417 | 3300005719 | Bacteria | 945 |
| 158 | Ga0068861_102547950 | 3300005719 | Bacteria | 515 |
| 159 | Ga0068851_10263679 | 3300005834 | Bacteria | 981 |
| 160 | Ga0068870_10008883 | 3300005840 | Bacteria | 4539 |
| 161 | Ga0068870_10017164 | 3300005840 | Unclassified | 3474 |
| 162 | Ga0068870_10179056 | 3300005840 | Bacteria | 1271 |
| 163 | Ga0068863_101110377 | 3300005841 | Bacteria | 795 |
| 164 | Ga0068863_101276885 | 3300005841 | Bacteria | 741 |
| 165 | Ga0068858_100053466 | 3300005842 | Bacteria | 3735 |
| 166 | Ga0068858_101246903 | 3300005842 | Bacteria | 731 |
| 167 | Ga0068860_100171471 | 3300005843 | Bacteria | 2096 |
| 168 | Ga0068862_100028413 | 3300005844 | Bacteria | 4710 |
| 169 | Ga0068862_100032567 | 3300005844 | Bacteria | 4405 |
| 170 | Ga0068862_100200952 | 3300005844 | Bacteria | 1797 |
| 171 | Ga0081455_10006745 | 3300005937 | Bacteria | 12256 |
| 172 | Ga0081455_10009622 | 3300005937 | Bacteria | 9926 |
| 173 | Ga0081455_10024299 | 3300005937 | Bacteria | 5615 |
| 174 | Ga0081455_10043052 | 3300005937 | Bacteria | 3955 |
| 175 | Ga0081455_10359689 | 3300005937 | Bacteria | 1024 |
| 176 | Ga0081455_10551554 | 3300005937 | Bacteria | 762 |
| 177 | Ga0081538_10000991 | 3300005981 | Bacteria | 30132 |
| 178 | Ga0081538_10026155 | 3300005981 | Bacteria | 4090 |
| 179 | Ga0081540_1006355 | 3300005983 | Bacteria | 8628 |
| 180 | Ga0081540_1168274 | 3300005983 | Bacteria | 839 |
| 181 | Ga0081539_10017208 | 3300005985 | Bacteria | 5089 |
| 182 | Ga0081539_10019195 | 3300005985 | Bacteria | 4691 |
| 183 | Ga0075365_10022170 | 3300006038 | Bacteria | 3975 |
| 184 | Ga0075365_10050645 | 3300006038 | Bacteria | 2740 |
| 185 | Ga0075365_10069991 | 3300006038 | Bacteria | 2359 |
| 186 | Ga0075365_10080802 | 3300006038 | Bacteria | 2201 |
| 187 | Ga0075365_10181775 | 3300006038 | Bacteria | 1470 |
| 188 | Ga0075365_10205940 | 3300006038 | Bacteria | 1379 |
| 189 | Ga0075365_10210768 | 3300006038 | Bacteria | 1362 |
| 190 | Ga0075365_10248219 | 3300006038 | Bacteria | 1250 |
| 191 | Ga0075365_10444527 | 3300006038 | Bacteria | 915 |
| 192 | Ga0075365_10488275 | 3300006038 | Bacteria | 870 |
| 193 | Ga0075365_10672344 | 3300006038 | Bacteria | 732 |
| 194 | Ga0075368_10001368 | 3300006042 | Bacteria | 7762 |
| 195 | Ga0075368_10001555 | 3300006042 | Bacteria | 7369 |
| 196 | Ga0075368_10104738 | 3300006042 | Bacteria | 1164 |
| 197 | Ga0075363_100001987 | 3300006048 | Bacteria | 8134 |
| 198 | Ga0075363_100016457 | 3300006048 | Bacteria | 3652 |
| 199 | Ga0075363_100053059 | 3300006048 | Bacteria | 2165 |
| 200 | Ga0075363_100121778 | 3300006048 | Bacteria | 1457 |
| 201 | Ga0075363_100237034 | 3300006048 | Bacteria | 1048 |
| 202 | Ga0075363_100388881 | 3300006048 | Bacteria | 818 |
| 203 | Ga0075363_100554717 | 3300006048 | Bacteria | 686 |
| 204 | Ga0075364_10030886 | 3300006051 | Bacteria | 3440 |
| 205 | Ga0075364_10852332 | 3300006051 | Bacteria | 621 |
| 206 | Ga0075364_11037997 | 3300006051 | Bacteria | 557 |
| 207 | Ga0075432_10035480 | 3300006058 | Bacteria | 1732 |
| 208 | Ga0075432_10265657 | 3300006058 | Bacteria | 701 |
| 209 | Ga0075432_10289166 | 3300006058 | Bacteria | 677 |
| 210 | Ga0070715_10085225 | 3300006163 | Archaea | 1443 |
| 211 | Ga0070712_101651969 | 3300006175 | Bacteria | 561 |
| 212 | Ga0075362_10072659 | 3300006177 | Bacteria | 1574 |
| 213 | Ga0075362_10146917 | 3300006177 | Bacteria | 1129 |
| 214 | Ga0075367_10016900 | 3300006178 | Bacteria | 3993 |
| 215 | Ga0075367_10133466 | 3300006178 | Bacteria | 1535 |
| 216 | Ga0075367_10181727 | 3300006178 | Bacteria | 1311 |
| 217 | Ga0075367_10515624 | 3300006178 | Bacteria | 759 |
| 218 | Ga0097621_100245409 | 3300006237 | Bacteria | 1567 |
| 219 | Ga0075370_10001859 | 3300006353 | Bacteria | 9457 |
| 220 | Ga0075370_10013364 | 3300006353 | Bacteria | 4361 |
| 221 | Ga0075370_10022023 | 3300006353 | Bacteria | 3495 |
| 222 | Ga0075370_10099799 | 3300006353 | Bacteria | 1680 |
| 223 | Ga0075370_10569323 | 3300006353 | Bacteria | 686 |
| 224 | Ga0068871_101844247 | 3300006358 | Bacteria | 574 |
| 225 | Ga0075428_100096948 | 3300006844 | Bacteria | 3215 |
| 226 | Ga0075428_100228142 | 3300006844 | Bacteria | 2010 |
| 227 | Ga0075428_100916187 | 3300006844 | Bacteria | 929 |
| 228 | Ga0075430_100031516 | 3300006846 | Bacteria | 4500 |
| 229 | Ga0075430_100102275 | 3300006846 | Bacteria | 2392 |
| 230 | Ga0075430_100157312 | 3300006846 | Bacteria | 1892 |
| 231 | Ga0075431_100018073 | 3300006847 | Bacteria | 7172 |
| 232 | Ga0075431_100072638 | 3300006847 | Bacteria | 3550 |
| 233 | Ga0075431_100247833 | 3300006847 | Bacteria | 1810 |
| 234 | Ga0075431_100552414 | 3300006847 | Bacteria | 1139 |
| 235 | Ga0075431_100994343 | 3300006847 | Bacteria | 806 |
| 236 | Ga0075431_101057047 | 3300006847 | Bacteria | 777 |
| 237 | Ga0075433_10085696 | 3300006852 | Bacteria | 2781 |
| 238 | Ga0075433_10317391 | 3300006852 | Bacteria | 1379 |
| 239 | Ga0075433_10376719 | 3300006852 | Bacteria | 1253 |
| 240 | Ga0075433_10680091 | 3300006852 | Bacteria | 902 |
| 241 | Ga0075434_100170226 | 3300006871 | Bacteria | 2198 |
| 242 | Ga0075434_100217813 | 3300006871 | Bacteria | 1929 |
| 243 | Ga0075434_100919081 | 3300006871 | Bacteria | 890 |
| 244 | Ga0075429_100065939 | 3300006880 | Bacteria | 3152 |
| 245 | Ga0075429_100286470 | 3300006880 | Bacteria | 1442 |
| 246 | Ga0075429_100329354 | 3300006880 | Bacteria | 1336 |
| 247 | Ga0068865_100012214 | 3300006881 | Bacteria | 5402 |
| 248 | Ga0068865_100128854 | 3300006881 | Bacteria | 1893 |
| 249 | Ga0068865_100254447 | 3300006881 | Bacteria | 1387 |
| 250 | Ga0068865_100291436 | 3300006881 | Bacteria | 1303 |
| 251 | Ga0075436_100004843 | 3300006914 | Bacteria | 9251 |
| 252 | Ga0075436_100578698 | 3300006914 | Unclassified | 826 |
| 253 | Ga0075436_100638549 | 3300006914 | Unclassified | 786 |
| 254 | Ga0097620_100375605 | 3300006931 | Bacteria | 1517 |
| 255 | Ga0075435_100053694 | 3300007076 | Bacteria | 3250 |
| 256 | Ga0075435_100056047 | 3300007076 | Bacteria | 3185 |
| 257 | Ga0099794_10171359 | 3300007265 | Archaea | 1106 |
| 258 | Ga0111539_10054227 | 3300009094 | Bacteria | 4770 |
| 259 | Ga0111539_10121948 | 3300009094 | Bacteria | 3054 |
| 260 | Ga0111539_10267602 | 3300009094 | Bacteria | 1990 |
| 261 | Ga0111539_10335191 | 3300009094 | Bacteria | 1761 |
| 262 | Ga0111539_10688204 | 3300009094 | Bacteria | 1190 |
| 263 | Ga0111539_10853940 | 3300009094 | Bacteria | 1059 |
| 264 | Ga0105245_10009867 | 3300009098 | Bacteria | 8316 |
| 265 | Ga0105245_10031744 | 3300009098 | Bacteria | 4676 |
| 266 | Ga0105245_10056527 | 3300009098 | Bacteria | 3527 |
| 267 | Ga0105245_10082688 | 3300009098 | Bacteria | 2938 |
| 268 | Ga0105245_10101126 | 3300009098 | Bacteria | 2668 |
| 269 | Ga0105245_10114068 | 3300009098 | Bacteria | 2517 |
| 270 | Ga0105247_10574177 | 3300009101 | Bacteria | 832 |
| 271 | Ga0114129_10091089 | 3300009147 | Bacteria | 4226 |
| 272 | Ga0114129_10105276 | 3300009147 | Bacteria | 3899 |
| 273 | Ga0114129_10275863 | 3300009147 | Bacteria | 2248 |
| 274 | Ga0114129_10687933 | 3300009147 | Bacteria | 1316 |
| 275 | Ga0105243_10002686 | 3300009148 | Bacteria | 14782 |
| 276 | Ga0105243_10012657 | 3300009148 | Bacteria | 6373 |
| 277 | Ga0105243_10143096 | 3300009148 | Bacteria | 2043 |
| 278 | Ga0105243_10240926 | 3300009148 | Bacteria | 1609 |
| 279 | Ga0105243_10274301 | 3300009148 | Bacteria | 1516 |
| 280 | Ga0105243_10285118 | 3300009148 | Bacteria | 1489 |
| 281 | Ga0105243_10687605 | 3300009148 | Bacteria | 996 |
| 282 | Ga0105243_10912383 | 3300009148 | Bacteria | 875 |
| 283 | Ga0105243_11186688 | 3300009148 | Bacteria | 776 |
| 284 | Ga0105243_11208803 | 3300009148 | Bacteria | 769 |
| 285 | Ga0105243_12343996 | 3300009148 | Bacteria | 572 |
| 286 | Ga0105241_10274263 | 3300009174 | Bacteria | 1438 |
| 287 | Ga0105241_11675978 | 3300009174 | Bacteria | 617 |
| 288 | Ga0105241_12247208 | 3300009174 | Bacteria | 542 |
| 289 | Ga0105242_10039331 | 3300009176 | Bacteria | 3806 |
| 290 | Ga0105242_10521723 | 3300009176 | Bacteria | 1133 |
| 291 | Ga0105248_10476678 | 3300009177 | Bacteria | 1407 |
| 292 | Ga0105237_10078765 | 3300009545 | Bacteria | 3285 |
| 293 | Ga0105237_11232872 | 3300009545 | Bacteria | 754 |
| 294 | Ga0105238_10268135 | 3300009551 | Bacteria | 1688 |
| 295 | Ga0105238_10429507 | 3300009551 | Bacteria | 1317 |
| 296 | Ga0105238_10595633 | 3300009551 | Bacteria | 1113 |
| 297 | Ga0105238_10605407 | 3300009551 | Bacteria | 1104 |
| 298 | Ga0105249_10037012 | 3300009553 | Bacteria | 4428 |
| 299 | Ga0105249_10062217 | 3300009553 | Bacteria | 3427 |
| 300 | Ga0105249_10590405 | 3300009553 | Bacteria | 1165 |
| 301 | Ga0105249_10776232 | 3300009553 | Bacteria | 1021 |
| 302 | Ga0105239_10249036 | 3300010375 | Bacteria | 1995 |
| 303 | Ga0105239_10363856 | 3300010375 | Bacteria | 1634 |
| 304 | Ga0105239_10381986 | 3300010375 | Bacteria | 1592 |
| 305 | Ga0105246_10051047 | 3300011119 | Bacteria | 2839 |
| 306 | Ga0105246_10199756 | 3300011119 | Bacteria | 1553 |
| 307 | Ga0105246_10258746 | 3300011119 | Bacteria | 1385 |
| 308 | Ga0105246_11102218 | 3300011119 | Bacteria | 725 |
| 309 | Ga0105246_11196627 | 3300011119 | Bacteria | 699 |
| 310 | Ga0157320_1031276 | 3300012481 | Bacteria | 538 |
| 311 | Ga0157325_1003308 | 3300012485 | Bacteria | 881 |
| 312 | Ga0157345_1006741 | 3300012498 | Bacteria | 923 |
| 313 | Ga0157313_1044403 | 3300012503 | Bacteria | 557 |
| 314 | Ga0157339_1035448 | 3300012505 | Bacteria | 604 |
| 315 | Ga0157316_1003846 | 3300012510 | Bacteria | 1108 |
| 316 | Ga0157326_1010535 | 3300012513 | Bacteria | 1032 |
| 317 | Ga0157371_10057438 | 3300013102 | Bacteria | 2760 |
| 318 | Ga0157371_10133911 | 3300013102 | Bacteria | 1764 |
| 319 | Ga0157371_10581890 | 3300013102 | Bacteria | 832 |
| 320 | Ga0157371_10690713 | 3300013102 | Bacteria | 763 |
| 321 | Ga0157370_10686886 | 3300013104 | Bacteria | 935 |
| 322 | Ga0157369_10007989 | 3300013105 | Bacteria | 12153 |
| 323 | Ga0157369_10638235 | 3300013105 | Bacteria | 1099 |
| 324 | Ga0157369_10986432 | 3300013105 | Bacteria | 863 |
| 325 | Ga0157369_11895579 | 3300013105 | Bacteria | 605 |
| 326 | Ga0157369_12172800 | 3300013105 | Bacteria | 563 |
| 327 | Ga0157374_10281602 | 3300013296 | Bacteria | 1642 |
| 328 | Ga0157374_10473943 | 3300013296 | Bacteria | 1254 |
| 329 | Ga0157378_10415366 | 3300013297 | Bacteria | 1329 |
| 330 | Ga0157378_10995870 | 3300013297 | Bacteria | 872 |
| 331 | Ga0157378_11386105 | 3300013297 | Bacteria | 746 |
| 332 | Ga0163162_10023432 | 3300013306 | Bacteria | 6093 |
| 333 | Ga0163162_10217897 | 3300013306 | Bacteria | 2039 |
| 334 | Ga0163162_10626841 | 3300013306 | Bacteria | 1200 |
| 335 | Ga0157372_10024844 | 3300013307 | Bacteria | 6512 |
| 336 | Ga0157372_10043420 | 3300013307 | Bacteria | 4976 |
| 337 | Ga0157372_10301443 | 3300013307 | Bacteria | 1864 |
| 338 | Ga0157372_10569810 | 3300013307 | Bacteria | 1320 |
| 339 | Ga0157372_11426029 | 3300013307 | Bacteria | 798 |
| 340 | Ga0157372_11446346 | 3300013307 | Bacteria | 792 |
| 341 | Ga0157372_12198257 | 3300013307 | Bacteria | 634 |
| 342 | Ga0157375_10321216 | 3300013308 | Bacteria | 1713 |
| 343 | Ga0157375_10364197 | 3300013308 | Bacteria | 1612 |
| 344 | Ga0157375_10775492 | 3300013308 | Bacteria | 1109 |
| 345 | Ga0157375_12793632 | 3300013308 | Bacteria | 584 |
| 346 | Ga0163163_10924164 | 3300014325 | Bacteria | 936 |
| 347 | Ga0163163_11423726 | 3300014325 | Bacteria | 755 |
| 348 | Ga0163163_11731653 | 3300014325 | Bacteria | 686 |
| 349 | Ga0163163_12066327 | 3300014325 | Bacteria | 629 |
| 350 | Ga0163163_12233016 | 3300014325 | Bacteria | 606 |
| 351 | Ga0163163_12459500 | 3300014325 | Bacteria | 579 |
| 352 | Ga0157380_10019024 | 3300014326 | Bacteria | 5111 |
| 353 | Ga0157380_10107939 | 3300014326 | Bacteria | 2332 |
| 354 | Ga0157380_10135274 | 3300014326 | Bacteria | 2109 |
| 355 | Ga0157380_10358833 | 3300014326 | Bacteria | 1367 |
| 356 | Ga0157380_11604499 | 3300014326 | Bacteria | 706 |
| 357 | Ga0157380_12020099 | 3300014326 | Bacteria | 638 |
| 358 | Ga0182008_10157917 | 3300014497 | Bacteria | 1140 |
| 359 | Ga0182008_10220361 | 3300014497 | Bacteria | 970 |
| 360 | Ga0182008_10445139 | 3300014497 | Bacteria | 703 |
| 361 | Ga0182008_10660180 | 3300014497 | Bacteria | 593 |
| 362 | Ga0157377_10055967 | 3300014745 | Bacteria | 2238 |
| 363 | Ga0157377_10306734 | 3300014745 | Bacteria | 1050 |
| 364 | Ga0157377_10363840 | 3300014745 | Bacteria | 974 |
| 365 | Ga0157379_10717617 | 3300014968 | Bacteria | 939 |
| 366 | Ga0157376_10575677 | 3300014969 | Bacteria | 1118 |
| 367 | Ga0157376_11938530 | 3300014969 | Bacteria | 626 |
| 368 | Ga0163161_10010383 | 3300017792 | Bacteria | 6448 |
| 369 | Ga0163161_10135627 | 3300017792 | Bacteria | 1860 |
| 370 | Ga0206356_11902212 | 3300020070 | Unclassified | 1181 |
| 371 | Ga0206349_1251648 | 3300020075 | Unclassified | 726 |
| 372 | Ga0206354_10753636 | 3300020081 | Bacteria | 547 |
| 373 | Ga0206354_11048389 | 3300020081 | Bacteria | 724 |
| 374 | Ga0206353_11655497 | 3300020082 | Bacteria | 2519 |
| 375 | Ga0224712_10004575 | 3300022467 | Bacteria | 3745 |
| 376 | Ga0224712_10005001 | 3300022467 | Bacteria | 3643 |
| 377 | Ga0207697_10085522 | 3300025315 | Bacteria | 1332 |
| 378 | Ga0207656_10572095 | 3300025321 | Bacteria | 576 |
| 379 | Ga0207692_10871216 | 3300025898 | Bacteria | 591 |
| 380 | Ga0207642_10107628 | 3300025899 | Bacteria | 1413 |
| 381 | Ga0207642_10816027 | 3300025899 | Bacteria | 594 |
| 382 | Ga0207710_10566902 | 3300025900 | Bacteria | 592 |
| 383 | Ga0207688_10002263 | 3300025901 | Bacteria | 10362 |
| 384 | Ga0207688_10006046 | 3300025901 | Bacteria | 6587 |
| 385 | Ga0207688_10028851 | 3300025901 | Bacteria | 3052 |
| 386 | Ga0207680_10395076 | 3300025903 | Bacteria | 976 |
| 387 | Ga0207647_10039538 | 3300025904 | Bacteria | 2974 |
| 388 | Ga0207699_10083460 | 3300025906 | Bacteria | 1987 |
| 389 | Ga0207643_10071100 | 3300025908 | Bacteria | 2002 |
| 390 | Ga0207705_10081285 | 3300025909 | Bacteria | 2362 |
| 391 | Ga0207705_10515648 | 3300025909 | Bacteria | 929 |
| 392 | Ga0207684_10547618 | 3300025910 | Bacteria | 990 |
| 393 | Ga0207654_10833390 | 3300025911 | Bacteria | 667 |
| 394 | Ga0207654_10852799 | 3300025911 | Bacteria | 659 |
| 395 | Ga0207707_10371994 | 3300025912 | Bacteria | 1229 |
| 396 | Ga0207707_10698883 | 3300025912 | Bacteria | 851 |
| 397 | Ga0207707_10854964 | 3300025912 | Bacteria | 755 |
| 398 | Ga0207671_10087900 | 3300025914 | Bacteria | 2337 |
| 399 | Ga0207671_10857000 | 3300025914 | Bacteria | 719 |
| 400 | Ga0207693_10220907 | 3300025915 | Unclassified | 1489 |
| 401 | Ga0207693_10221956 | 3300025915 | Bacteria | 1485 |
| 402 | Ga0207663_10253289 | 3300025916 | Bacteria | 1297 |
| 403 | Ga0207660_10055167 | 3300025917 | Bacteria | 2838 |
| 404 | Ga0207660_10062273 | 3300025917 | Bacteria | 2687 |
| 405 | Ga0207662_10013678 | 3300025918 | Bacteria | 4542 |
| 406 | Ga0207662_10676021 | 3300025918 | Bacteria | 722 |
| 407 | Ga0207657_10030451 | 3300025919 | Bacteria | 4898 |
| 408 | Ga0207657_10326722 | 3300025919 | Bacteria | 1212 |
| 409 | Ga0207657_10495530 | 3300025919 | Bacteria | 957 |
| 410 | Ga0207657_10525802 | 3300025919 | Bacteria | 926 |
| 411 | Ga0207649_10118853 | 3300025920 | Unclassified | 1779 |
| 412 | Ga0207649_10309218 | 3300025920 | Bacteria | 1158 |
| 413 | Ga0207649_10456386 | 3300025920 | Bacteria | 965 |
| 414 | Ga0207652_10028765 | 3300025921 | Bacteria | 4639 |
| 415 | Ga0207652_10116794 | 3300025921 | Unclassified | 2371 |
| 416 | Ga0207652_10182445 | 3300025921 | Bacteria | 1886 |
| 417 | Ga0207652_10227168 | 3300025921 | Bacteria | 1682 |
| 418 | Ga0207652_10410472 | 3300025921 | Bacteria | 1222 |
| 419 | Ga0207681_10360947 | 3300025923 | Bacteria | 1165 |
| 420 | Ga0207681_10600134 | 3300025923 | Bacteria | 910 |
| 421 | Ga0207694_10005510 | 3300025924 | Bacteria | 9715 |
| 422 | Ga0207694_10274876 | 3300025924 | Bacteria | 1382 |
| 423 | Ga0207694_10433437 | 3300025924 | Bacteria | 1096 |
| 424 | Ga0207650_10005827 | 3300025925 | Bacteria | 8406 |
| 425 | Ga0207650_10388986 | 3300025925 | Bacteria | 1153 |
| 426 | Ga0207659_10107398 | 3300025926 | Bacteria | 2115 |
| 427 | Ga0207659_10141318 | 3300025926 | Bacteria | 1869 |
| 428 | Ga0207687_10010008 | 3300025927 | Bacteria | 6204 |
| 429 | Ga0207687_10033318 | 3300025927 | Bacteria | 3494 |
| 430 | Ga0207687_10050468 | 3300025927 | Bacteria | 2896 |
| 431 | Ga0207687_10202442 | 3300025927 | Bacteria | 1553 |
| 432 | Ga0207687_10804735 | 3300025927 | Bacteria | 802 |
| 433 | Ga0207687_11423877 | 3300025927 | Bacteria | 596 |
| 434 | Ga0207700_10057208 | 3300025928 | Bacteria | 2939 |
| 435 | Ga0207700_11499021 | 3300025928 | Bacteria | 598 |
| 436 | Ga0207700_11622302 | 3300025928 | Bacteria | 572 |
| 437 | Ga0207664_10057502 | 3300025929 | Bacteria | 3091 |
| 438 | Ga0207664_10516511 | 3300025929 | Bacteria | 1070 |
| 439 | Ga0207690_10014913 | 3300025932 | Bacteria | 4704 |
| 440 | Ga0207690_10143201 | 3300025932 | Bacteria | 1764 |
| 441 | Ga0207690_11084159 | 3300025932 | Bacteria | 667 |
| 442 | Ga0207690_11229757 | 3300025932 | Bacteria | 626 |
| 443 | Ga0207706_10037907 | 3300025933 | Bacteria | 4278 |
| 444 | Ga0207706_10198100 | 3300025933 | Bacteria | 1761 |
| 445 | Ga0207706_10252454 | 3300025933 | Bacteria | 1540 |
| 446 | Ga0207686_10009994 | 3300025934 | Bacteria | 5160 |
| 447 | Ga0207709_10035006 | 3300025935 | Bacteria | 2965 |
| 448 | Ga0207709_10052142 | 3300025935 | Bacteria | 2511 |
| 449 | Ga0207709_10180746 | 3300025935 | Bacteria | 1489 |
| 450 | Ga0207709_10235486 | 3300025935 | Bacteria | 1329 |
| 451 | Ga0207709_10799803 | 3300025935 | Bacteria | 761 |
| 452 | Ga0207709_10968484 | 3300025935 | Bacteria | 694 |
| 453 | Ga0207670_10841485 | 3300025936 | Bacteria | 766 |
| 454 | Ga0207669_10349816 | 3300025937 | Bacteria | 1141 |
| 455 | Ga0207669_10417421 | 3300025937 | Bacteria | 1055 |
| 456 | Ga0207669_10576854 | 3300025937 | Bacteria | 911 |
| 457 | Ga0207669_11225694 | 3300025937 | Bacteria | 636 |
| 458 | Ga0207704_10045603 | 3300025938 | Bacteria | 2605 |
| 459 | Ga0207704_10050681 | 3300025938 | Bacteria | 2505 |
| 460 | Ga0207704_10232188 | 3300025938 | Bacteria | 1373 |
| 461 | Ga0207704_10383057 | 3300025938 | Bacteria | 1104 |
| 462 | Ga0207704_10475084 | 3300025938 | Bacteria | 1002 |
| 463 | Ga0207691_10011852 | 3300025940 | Bacteria | 8368 |
| 464 | Ga0207691_10133082 | 3300025940 | Bacteria | 2195 |
| 465 | Ga0207691_10942234 | 3300025940 | Bacteria | 722 |
| 466 | Ga0207689_10212445 | 3300025942 | Bacteria | 1599 |
| 467 | Ga0207689_10271054 | 3300025942 | Bacteria | 1405 |
| 468 | Ga0207689_10444211 | 3300025942 | Bacteria | 1084 |
| 469 | Ga0207661_10000292 | 3300025944 | Bacteria | 31716 |
| 470 | Ga0207661_10001315 | 3300025944 | Bacteria | 16624 |
| 471 | Ga0207661_10027515 | 3300025944 | Bacteria | 4344 |
| 472 | Ga0207661_10036687 | 3300025944 | Bacteria | 3828 |
| 473 | Ga0207661_10050549 | 3300025944 | Bacteria | 3312 |
| 474 | Ga0207661_10110770 | 3300025944 | Bacteria | 2321 |
| 475 | Ga0207661_10205996 | 3300025944 | Bacteria | 1731 |
| 476 | Ga0207661_10489627 | 3300025944 | Bacteria | 1123 |
| 477 | Ga0207661_10595872 | 3300025944 | Bacteria | 1014 |
| 478 | Ga0207661_10615882 | 3300025944 | Bacteria | 997 |
| 479 | Ga0207661_10645936 | 3300025944 | Bacteria | 972 |
| 480 | Ga0207661_11450718 | 3300025944 | Bacteria | 629 |
| 481 | Ga0207679_10019263 | 3300025945 | Bacteria | 4582 |
| 482 | Ga0207679_10059956 | 3300025945 | Bacteria | 2825 |
| 483 | Ga0207679_10553327 | 3300025945 | Bacteria | 1032 |
| 484 | Ga0207679_12006562 | 3300025945 | Bacteria | 527 |
| 485 | Ga0207679_12111295 | 3300025945 | Bacteria | 512 |
| 486 | Ga0207667_10345591 | 3300025949 | Bacteria | 1517 |
| 487 | Ga0207667_11526411 | 3300025949 | Bacteria | 638 |
| 488 | Ga0207712_10014366 | 3300025961 | Bacteria | 5093 |
| 489 | Ga0207712_10014929 | 3300025961 | Bacteria | 5002 |
| 490 | Ga0207712_10061461 | 3300025961 | Bacteria | 2666 |
| 491 | Ga0207712_11047001 | 3300025961 | Bacteria | 725 |
| 492 | Ga0207712_11577711 | 3300025961 | Unclassified | 588 |
| 493 | Ga0207668_10002263 | 3300025972 | Bacteria | 11229 |
| 494 | Ga0207668_10010876 | 3300025972 | Bacteria | 5515 |
| 495 | Ga0207668_10051446 | 3300025972 | Bacteria | 2845 |
| 496 | Ga0207668_10380673 | 3300025972 | Bacteria | 1188 |
| 497 | Ga0207668_10519808 | 3300025972 | Bacteria | 1027 |
| 498 | Ga0207640_10260273 | 3300025981 | Bacteria | 1351 |
| 499 | Ga0207640_11124208 | 3300025981 | Bacteria | 696 |
| 500 | Ga0207640_11419404 | 3300025981 | Bacteria | 622 |
| 501 | Ga0207658_10033125 | 3300025986 | Bacteria | 3683 |
| 502 | Ga0207658_10355857 | 3300025986 | Bacteria | 1276 |
| 503 | Ga0207677_10170045 | 3300026023 | Bacteria | 1703 |
| 504 | Ga0207677_10183253 | 3300026023 | Bacteria | 1649 |
| 505 | Ga0207677_10816032 | 3300026023 | Bacteria | 836 |
| 506 | Ga0207703_10022643 | 3300026035 | Bacteria | 4932 |
| 507 | Ga0207639_10352173 | 3300026041 | Bacteria | 1315 |
| 508 | Ga0207639_10964288 | 3300026041 | Bacteria | 798 |
| 509 | Ga0207639_11342263 | 3300026041 | Bacteria | 671 |
| 510 | Ga0207678_10433510 | 3300026067 | Bacteria | 1141 |
| 511 | Ga0207678_10678639 | 3300026067 | Bacteria | 906 |
| 512 | Ga0207678_10982741 | 3300026067 | Bacteria | 747 |
| 513 | Ga0207708_10031287 | 3300026075 | Bacteria | 4039 |
| 514 | Ga0207708_10136545 | 3300026075 | Bacteria | 1921 |
| 515 | Ga0207708_10179081 | 3300026075 | Bacteria | 1683 |
| 516 | Ga0207708_10521619 | 3300026075 | Bacteria | 998 |
| 517 | Ga0207702_10004483 | 3300026078 | Bacteria | 12392 |
| 518 | Ga0207702_10011683 | 3300026078 | Bacteria | 7312 |
| 519 | Ga0207702_10042588 | 3300026078 | Bacteria | 3809 |
| 520 | Ga0207702_10230748 | 3300026078 | Bacteria | 1730 |
| 521 | Ga0207702_10243829 | 3300026078 | Bacteria | 1685 |
| 522 | Ga0207702_10252733 | 3300026078 | Bacteria | 1656 |
| 523 | Ga0207702_10656184 | 3300026078 | Bacteria | 1032 |
| 524 | Ga0207702_11784155 | 3300026078 | Bacteria | 607 |
| 525 | Ga0207702_12215730 | 3300026078 | Bacteria | 538 |
| 526 | Ga0207641_10067802 | 3300026088 | Bacteria | 3058 |
| 527 | Ga0207641_11262039 | 3300026088 | Bacteria | 739 |
| 528 | Ga0207648_10001192 | 3300026089 | Bacteria | 29118 |
| 529 | Ga0207648_10182214 | 3300026089 | Bacteria | 1859 |
| 530 | Ga0207648_10881936 | 3300026089 | Bacteria | 835 |
| 531 | Ga0207676_10642841 | 3300026095 | Bacteria | 1023 |
| 532 | Ga0207676_11493648 | 3300026095 | Bacteria | 673 |
| 533 | Ga0207676_11717879 | 3300026095 | Bacteria | 626 |
| 534 | Ga0207676_12096695 | 3300026095 | Bacteria | 564 |
| 535 | Ga0207674_10000027 | 3300026116 | Bacteria | 150200 |
| 536 | Ga0207674_10012854 | 3300026116 | Bacteria | 9346 |
| 537 | Ga0207674_10019122 | 3300026116 | Bacteria | 7425 |
| 538 | Ga0207674_10048634 | 3300026116 | Bacteria | 4340 |
| 539 | Ga0207674_10075250 | 3300026116 | Bacteria | 3387 |
| 540 | Ga0207674_10138670 | 3300026116 | Bacteria | 2393 |
| 541 | Ga0207674_11269742 | 3300026116 | Bacteria | 706 |
| 542 | Ga0207675_100014819 | 3300026118 | Bacteria | 7275 |
| 543 | Ga0207675_100059029 | 3300026118 | Bacteria | 3580 |
| 544 | Ga0207675_100141323 | 3300026118 | Bacteria | 2287 |
| 545 | Ga0207675_100543637 | 3300026118 | Bacteria | 1160 |
| 546 | Ga0207675_101732449 | 3300026118 | Bacteria | 644 |
| 547 | Ga0207683_10194119 | 3300026121 | Bacteria | 1844 |
| 548 | Ga0207683_10209465 | 3300026121 | Bacteria | 1774 |
| 549 | Ga0207683_10528320 | 3300026121 | Bacteria | 1090 |
| 550 | Ga0207683_11500598 | 3300026121 | Unclassified | 622 |
| 551 | Ga0207698_10926901 | 3300026142 | Bacteria | 879 |
| 552 | Ga0207698_10933513 | 3300026142 | Bacteria | 876 |
| 553 | Ga0207698_11261418 | 3300026142 | Bacteria | 753 |
| 554 | Ga0209813_10005252 | 3300027866 | Bacteria | 3134 |
| 555 | Ga0207428_10012230 | 3300027907 | Bacteria | 7549 |
| 556 | Ga0207428_10469972 | 3300027907 | Bacteria | 916 |
| 557 | Ga0207428_10860312 | 3300027907 | Bacteria | 642 |
| 558 | Ga0268266_10176872 | 3300028379 | Bacteria | 1941 |
| 559 | Ga0268265_10056093 | 3300028380 | Bacteria | 2996 |
| 560 | Ga0268265_10127466 | 3300028380 | Bacteria | 2109 |
| 561 | Ga0268265_11226714 | 3300028380 | Bacteria | 748 |
| 562 | Ga0268264_10017415 | 3300028381 | Bacteria | 5884 |
| 563 | Ga0265318_10102930 | 3300028577 | Bacteria | 1050 |
| 564 | Ga0265318_10274656 | 3300028577 | Bacteria | 615 |
| 565 | Ga0265323_10052471 | 3300028653 | Unclassified | 1442 |
| 566 | Ga0265322_10023701 | 3300028654 | Bacteria | 1755 |
| 567 | Ga0265338_10115954 | 3300028800 | Bacteria | 2147 |
| 568 | Ga0307512_10114783 | 3300030522 | Bacteria | 1757 |
| 569 | Ga0265330_10044072 | 3300031235 | Unclassified | 1971 |
| 570 | Ga0265330_10152416 | 3300031235 | Unclassified | 982 |
| 571 | Ga0265330_10418761 | 3300031235 | Bacteria | 567 |
| 572 | Ga0265316_10017267 | 3300031344 | Bacteria | 6243 |
| 573 | Ga0265316_10035843 | 3300031344 | Unclassified | 4015 |
| 574 | Ga0265316_10061048 | 3300031344 | Bacteria | 2929 |
| 575 | Ga0265316_10285801 | 3300031344 | Bacteria | 1204 |
| 576 | Ga0307513_10233603 | 3300031456 | Bacteria | 1650 |
| 577 | Ga0307509_10082273 | 3300031507 | Bacteria | 3322 |
| 578 | Ga0307408_100552402 | 3300031548 | Bacteria | 1016 |
| 579 | Ga0316579_10052161 | 3300031691 | Bacteria | 1915 |
| 580 | Ga0265342_10056249 | 3300031712 | Bacteria | 2332 |
| 581 | Ga0307516_10401940 | 3300031730 | Bacteria | 1029 |
| 582 | Ga0307405_10316842 | 3300031731 | Bacteria | 1190 |
| 583 | Ga0307405_10739712 | 3300031731 | Bacteria | 818 |
| 584 | Ga0307413_10299460 | 3300031824 | Bacteria | 1219 |
| 585 | Ga0307413_10312710 | 3300031824 | Bacteria | 1196 |
| 586 | Ga0307413_10490612 | 3300031824 | Bacteria | 984 |
| 587 | Ga0307413_11137079 | 3300031824 | Bacteria | 676 |
| 588 | Ga0307413_11922681 | 3300031824 | Bacteria | 532 |
| 589 | Ga0307410_10022477 | 3300031852 | Bacteria | 3900 |
| 590 | Ga0307410_10249974 | 3300031852 | Bacteria | 1378 |
| 591 | Ga0307410_10300626 | 3300031852 | Bacteria | 1266 |
| 592 | Ga0307410_11473573 | 3300031852 | Bacteria | 599 |
| 593 | Ga0307406_10063424 | 3300031901 | Bacteria | 2394 |
| 594 | Ga0307406_10514944 | 3300031901 | Bacteria | 972 |
| 595 | Ga0307406_10822107 | 3300031901 | Bacteria | 786 |
| 596 | Ga0307406_11117233 | 3300031901 | Bacteria | 681 |
| 597 | Ga0307407_10212672 | 3300031903 | Bacteria | 1303 |
| 598 | Ga0307407_10217408 | 3300031903 | Bacteria | 1290 |
| 599 | Ga0307407_10244438 | 3300031903 | Bacteria | 1226 |
| 600 | Ga0307412_10161682 | 3300031911 | Bacteria | 1665 |
| 601 | Ga0307412_10394074 | 3300031911 | Bacteria | 1125 |
| 602 | Ga0307412_10441783 | 3300031911 | Bacteria | 1069 |
| 603 | Ga0307412_11143876 | 3300031911 | Bacteria | 695 |
| 604 | Ga0307409_100124192 | 3300031995 | Bacteria | 2192 |
| 605 | Ga0307409_100168873 | 3300031995 | Bacteria | 1923 |
| 606 | Ga0307409_100272846 | 3300031995 | Bacteria | 1558 |
| 607 | Ga0307409_100365689 | 3300031995 | Bacteria | 1366 |
| 608 | Ga0307409_100389024 | 3300031995 | Bacteria | 1328 |
| 609 | Ga0307409_100579575 | 3300031995 | Bacteria | 1106 |
| 610 | Ga0307409_100835451 | 3300031995 | Bacteria | 931 |
| 611 | Ga0307409_101775356 | 3300031995 | Bacteria | 646 |
| 612 | Ga0307416_100023382 | 3300032002 | Bacteria | 4484 |
| 613 | Ga0307416_100137620 | 3300032002 | Bacteria | 2213 |
| 614 | Ga0307416_100288609 | 3300032002 | Bacteria | 1623 |
| 615 | Ga0307416_100360582 | 3300032002 | Bacteria | 1476 |
| 616 | Ga0307416_100385860 | 3300032002 | Bacteria | 1433 |
| 617 | Ga0307416_101061357 | 3300032002 | Bacteria | 914 |
| 618 | Ga0307416_103161136 | 3300032002 | Bacteria | 551 |
| 619 | Ga0307414_11591185 | 3300032004 | Bacteria | 609 |
| 620 | Ga0307411_10269149 | 3300032005 | Bacteria | 1350 |
| 621 | Ga0307411_10335696 | 3300032005 | Bacteria | 1226 |
| 622 | Ga0307411_11447824 | 3300032005 | Bacteria | 630 |
| 623 | Ga0307415_100000363 | 3300032126 | Bacteria | 19318 |
| 624 | Ga0307415_100040254 | 3300032126 | Bacteria | 3095 |
| 625 | Ga0307415_100050810 | 3300032126 | Bacteria | 2811 |
| 626 | Ga0307415_100574444 | 3300032126 | Bacteria | 999 |
| 627 | Ga0307415_100622039 | 3300032126 | Bacteria | 964 |
| 628 | Ga0307415_100899807 | 3300032126 | Bacteria | 816 |
| 629 | Ga0307415_101221536 | 3300032126 | Bacteria | 709 |
| 630 | Ga0307415_101316751 | 3300032126 | Bacteria | 685 |
| 631 | Ga0307415_102484971 | 3300032126 | Bacteria | 510 |
| 632 | Ga0307507_10039358 | 3300033179 | Bacteria | 4774 |
| 633 | Ga0307507_10595500 | 3300033179 | Bacteria | 572 |
| 634 | Ga0373934_0345265 | 3300035086 | Bacteria | 619 |
| 635 | Ga0373944_0128757 | 3300035089 | Bacteria | 878 |
| 636 | Ga0373949_0061402 | 3300035090 | Bacteria | 968 |
| 637 | Ga0373939_0289817 | 3300035114 | Bacteria | 649 |
| 638 | Ga0373939_0320897 | 3300035114 | Bacteria | 623 |
| 639 | Ga0373939_0365292 | 3300035114 | Bacteria | 591 |
| 640 | Ga0373939_0433588 | 3300035114 | Bacteria | 550 |
| 641 | Ga0373941_0383856 | 3300035115 | Bacteria | 578 |
| 642 | Ga0373945_0383026 | 3300035116 | Bacteria | 614 |
| 643 | Ga0373953_0093415 | 3300035117 | Unclassified | 1260 |
| 644 | Ga0373954_0003376 | 3300035118 | Bacteria | 6757 |
| 645 | Ga0373954_0079232 | 3300035118 | Bacteria | 1568 |
| 646 | Ga0373956_0000483 | 3300035119 | Bacteria | 16366 |
| 647 | Ga0373956_0146200 | 3300035119 | Bacteria | 1111 |
| 648 | Ga0373957_0140978 | 3300035120 | Bacteria | 985 |
| 649 | Ga0373960_0460596 | 3300035121 | Bacteria | 500 |
| 650 | Ga0373943_0170651 | 3300035170 | Bacteria | 1190 |
| 651 | Ga0373943_0920636 | 3300035170 | Bacteria | 523 |
| 652 | Ga0373946_0424495 | 3300035171 | Unclassified | 674 |
| 653 | Ga0373955_0127866 | 3300035172 | Unclassified | 1481 |
| 654 | Ga0373955_0380132 | 3300035172 | Bacteria | 857 |
| 655 | Ga0373924_0015464 | 3300035410 | Bacteria | 2902 |
| 656 | Ga0373931_0068322 | 3300035691 | Bacteria | 1934 |
| 657 | Ga0373931_0188109 | 3300035691 | Bacteria | 1227 |
| 658 | Ga0373935_0016869 | 3300035692 | Bacteria | 4422 |
| 659 | Ga0373935_0077935 | 3300035692 | Bacteria | 2149 |
| 660 | Ga0373935_0332076 | 3300035692 | Unclassified | 1081 |
| 661 | Ga0373927_0000026 | 3300035695 | Bacteria | 113549 |
| 662 | Ga0373927_0013036 | 3300035695 | Bacteria | 5530 |
| 663 | Ga0373933_0121480 | 3300035724 | Bacteria | 1636 |
| 664 | Ga0373933_0445046 | 3300035724 | Bacteria | 847 |
| 665 | Ga0373933_0535113 | 3300035724 | Bacteria | 768 |
| 666 | Ga0373937_0259391 | 3300036401 | Unclassified | 1639 |
| 667 | Ga0373937_0261652 | 3300036401 | Bacteria | 1631 |
| 668 | Ga0373925_0004578 | 3300037068 | Bacteria | 10453 |
| 669 | Ga0373925_0184635 | 3300037068 | Unclassified | 1653 |
| 670 | Ga0395899_0008747 | 3300037312 | Bacteria | 7791 |
| 671 | Ga0395899_0027813 | 3300037312 | Bacteria | 4260 |
| 672 | Ga0395899_0028473 | 3300037312 | Bacteria | 4206 |
| 673 | Ga0395899_0048504 | 3300037312 | Bacteria | 3160 |
| 674 | Ga0395899_0049645 | 3300037312 | Bacteria | 3118 |
| 675 | Ga0395899_0052120 | 3300037312 | Bacteria | 3034 |
| 676 | Ga0395899_0181201 | 3300037312 | Bacteria | 1479 |
| 677 | Ga0395899_0232637 | 3300037312 | Bacteria | 1272 |
| 678 | Ga0395899_0278926 | 3300037312 | Bacteria | 1138 |
| 679 | Ga0395899_0423233 | 3300037312 | Bacteria | 877 |
| 680 | Ga0395899_0424950 | 3300037312 | Bacteria | 875 |
| 681 | Ga0395899_0445100 | 3300037312 | Bacteria | 849 |
| 682 | Ga0395900_0012498 | 3300037418 | Bacteria | 8683 |
| 683 | Ga0395900_0014497 | 3300037418 | Bacteria | 8041 |
| 684 | Ga0395900_0031855 | 3300037418 | Bacteria | 5420 |
| 685 | Ga0395900_0031891 | 3300037418 | Bacteria | 5417 |
| 686 | Ga0395900_0040438 | 3300037418 | Bacteria | 4805 |
| 687 | Ga0395900_0042133 | 3300037418 | Bacteria | 4703 |
| 688 | Ga0395900_0044820 | 3300037418 | Bacteria | 4556 |
| 689 | Ga0395900_0087556 | 3300037418 | Bacteria | 3201 |
| 690 | Ga0395900_0088664 | 3300037418 | Bacteria | 3180 |
| 691 | Ga0395900_0300108 | 3300037418 | Bacteria | 1593 |
| 692 | Ga0395900_0314124 | 3300037418 | Bacteria | 1549 |
| 693 | Ga0395900_0359191 | 3300037418 | Bacteria | 1428 |
| 694 | Ga0395900_0631071 | 3300037418 | Bacteria | 1010 |
| 695 | Ga0395900_0769122 | 3300037418 | Bacteria | 892 |
| 696 | Ga0395900_0863994 | 3300037418 | Bacteria | 829 |
| 697 | Ga0395900_0888385 | 3300037418 | Bacteria | 815 |
| 698 | Ga0395900_1068076 | 3300037418 | Bacteria | 725 |
| 699 | Ga0395900_1346382 | 3300037418 | Bacteria | 627 |
| 700 | Ga0395900_1705982 | 3300037418 | Bacteria | 541 |
| 701 | Ga0395900_1877267 | 3300037418 | Bacteria | 510 |
| 702 | Ga0395898_0004469 | 3300037466 | Bacteria | 15287 |
| 703 | Ga0395898_0009356 | 3300037466 | Bacteria | 10293 |
| 704 | Ga0395898_0029128 | 3300037466 | Bacteria | 5531 |
| 705 | Ga0395898_0032676 | 3300037466 | Bacteria | 5194 |
| 706 | Ga0395898_0051934 | 3300037466 | Bacteria | 4006 |
| 707 | Ga0395898_0053677 | 3300037466 | Bacteria | 3936 |
| 708 | Ga0395898_0054555 | 3300037466 | Bacteria | 3899 |
| 709 | Ga0395898_0084710 | 3300037466 | Bacteria | 3055 |
| 710 | Ga0395898_0122881 | 3300037466 | Bacteria | 2487 |
| 711 | Ga0395898_0134414 | 3300037466 | Bacteria | 2368 |
| 712 | Ga0395898_0143267 | 3300037466 | Bacteria | 2288 |
| 713 | Ga0395898_0165363 | 3300037466 | Bacteria | 2116 |
| 714 | Ga0395898_0209137 | 3300037466 | Bacteria | 1861 |
| 715 | Ga0395898_0219518 | 3300037466 | Bacteria | 1814 |
| 716 | Ga0395898_0354617 | 3300037466 | Bacteria | 1399 |
| 717 | Ga0395898_0404311 | 3300037466 | Bacteria | 1302 |
| 718 | Ga0395898_0587399 | 3300037466 | Bacteria | 1056 |
| 719 | Ga0395898_0593404 | 3300037466 | Unclassified | 1050 |
| 720 | Ga0395898_0862045 | 3300037466 | Bacteria | 845 |
| 721 | Ga0395898_0959807 | 3300037466 | Bacteria | 792 |
| 722 | Ga0395898_1042076 | 3300037466 | Bacteria | 753 |
| 723 | Ga0395905_0008922 | 3300037471 | Bacteria | 9847 |
| 724 | Ga0395905_0012630 | 3300037471 | Bacteria | 8125 |
| 725 | Ga0395905_0026626 | 3300037471 | Bacteria | 5452 |
| 726 | Ga0395905_0073724 | 3300037471 | Bacteria | 3200 |
| 727 | Ga0395905_0076192 | 3300037471 | Bacteria | 3144 |
| 728 | Ga0395905_0101810 | 3300037471 | Bacteria | 2696 |
| 729 | Ga0395905_0118770 | 3300037471 | Bacteria | 2485 |
| 730 | Ga0395905_0145483 | 3300037471 | Bacteria | 2230 |
| 731 | Ga0395905_0158118 | 3300037471 | Bacteria | 2131 |
| 732 | Ga0395905_0334152 | 3300037471 | Bacteria | 1406 |
| 733 | Ga0395905_0528340 | 3300037471 | Bacteria | 1080 |
| 734 | Ga0395905_1405929 | 3300037471 | Bacteria | 602 |
| 735 | Ga0436364_0914540 | 3300037853 | Bacteria | 1420 |
| 736 | Ga0436364_1241145 | 3300037853 | Bacteria | 2286 |
| 737 | Ga0395901_0015770 | 3300038443 | Bacteria | 7699 |
| 738 | Ga0395901_0025335 | 3300038443 | Bacteria | 6089 |
| 739 | Ga0395901_0026746 | 3300038443 | Bacteria | 5923 |
| 740 | Ga0395901_0031214 | 3300038443 | Bacteria | 5493 |
| 741 | Ga0395901_0044370 | 3300038443 | Bacteria | 4611 |
| 742 | Ga0395901_0103232 | 3300038443 | Bacteria | 2991 |
| 743 | Ga0395901_0103360 | 3300038443 | Bacteria | 2989 |
| 744 | Ga0395901_0105111 | 3300038443 | Bacteria | 2963 |
| 745 | Ga0395901_0113988 | 3300038443 | Bacteria | 2839 |
| 746 | Ga0395901_0226598 | 3300038443 | Bacteria | 1952 |
| 747 | Ga0395901_0241540 | 3300038443 | Bacteria | 1884 |
| 748 | Ga0395901_0291470 | 3300038443 | Bacteria | 1693 |
| 749 | Ga0395901_0304917 | 3300038443 | Bacteria | 1650 |
| 750 | Ga0395901_0379642 | 3300038443 | Bacteria | 1455 |
| 751 | Ga0395901_0510225 | 3300038443 | Bacteria | 1223 |
| 752 | Ga0395901_0556003 | 3300038443 | Bacteria | 1162 |
| 753 | Ga0395901_0570620 | 3300038443 | Bacteria | 1144 |
| 754 | Ga0395901_0608474 | 3300038443 | Bacteria | 1101 |
| 755 | Ga0395901_1632410 | 3300038443 | Bacteria | 597 |
| 756 | Ga0436360_0319483 | 3300039438 | Bacteria | 1190 |
| 757 | Ga0436363_0517822 | 3300039450 | Bacteria | 1833 |
| 758 | Ga0451789_1250776 | 3300041443 | Bacteria | 774 |
| 759 | Ga0451793_0679931 | 3300041452 | Bacteria | 1089 |
| 760 | Ga0451793_0701646 | 3300041452 | Bacteria | 750 |
| 761 | Ga0451793_0760524 | 3300041452 | Bacteria | 3351 |
| 762 | Ga0451802_1134197 | 3300041460 | Bacteria | 539 |
| 763 | Ga0451806_401815 | 3300041462 | Bacteria | 784 |
| 764 | Ga0451833_0203593 | 3300041491 | Bacteria | 10134 |
| 765 | Ga0451833_1359684 | 3300041491 | Bacteria | 662 |
| 766 | Ga0451833_1470194 | 3300041491 | Bacteria | 1064 |
| 767 | Ga0451851_0158388 | 3300041507 | Bacteria | 1065 |
| 768 | Ga0451843_0421537 | 3300041509 | Bacteria | 1070 |
| 769 | Ga0451853_1584429 | 3300041512 | Bacteria | 2598 |
| 770 | Ga0439448_0003027 | 3300042005 | Bacteria | 4618 |
| 771 | Ga0439448_0113132 | 3300042005 | Bacteria | 928 |
| 772 | Ga0439448_0170091 | 3300042005 | Bacteria | 760 |
| 773 | Ga0439450_087044 | 3300042008 | Bacteria | 782 |
| 774 | Ga0439454_029482 | 3300042011 | Bacteria | 853 |
| 775 | Ga0439463_020240 | 3300042016 | Bacteria | 1659 |
| 776 | Ga0450907_002740 | 3300042146 | Bacteria | 3273 |
| 777 | Ga0439458_0006874 | 3300042157 | Bacteria | 2536 |
| 778 | Ga0439444_0049133 | 3300042437 | Bacteria | 852 |
| 779 | Ga0439464_0223506 | 3300042439 | Bacteria | 604 |
| 780 | Ga0439460_0127504 | 3300042461 | Bacteria | 837 |
| 781 | Ga0451577_0829296 | 3300042876 | Bacteria | 835 |
| 782 | Ga0451577_1253805 | 3300042876 | Bacteria | 660 |
| 783 | Ga0439440_0040968 | 3300042993 | Bacteria | 1129 |
| 784 | Ga0439440_0061932 | 3300042993 | Bacteria | 957 |
| 785 | Ga0466969_0042453 | 3300044656 | Bacteria | 2271 |
| 786 | Ga0466969_0141291 | 3300044656 | Bacteria | 1113 |
| 787 | Ga0466972_0006438 | 3300044658 | Bacteria | 5899 |
| 788 | Ga0466965_0019736 | 3300044683 | Bacteria | 3237 |
| 789 | Ga0466965_0104375 | 3300044683 | Bacteria | 1452 |
| 790 | Ga0466965_0193136 | 3300044683 | Bacteria | 1077 |
| 791 | Ga0466965_0300615 | 3300044683 | Bacteria | 871 |
| 792 | Ga0466965_0561479 | 3300044683 | Bacteria | 645 |
| 793 | Ga0466965_0619370 | 3300044683 | Bacteria | 616 |
| 794 | Ga0466965_0709244 | 3300044683 | Bacteria | 578 |
| 795 | Ga0466966_0018855 | 3300044684 | Bacteria | 4546 |
| 796 | Ga0466966_0151904 | 3300044684 | Bacteria | 1412 |
| 797 | Ga0466961_0011157 | 3300044693 | Bacteria | 5744 |
| 798 | Ga0466961_0038925 | 3300044693 | Bacteria | 3049 |
| 799 | Ga0466961_0711146 | 3300044693 | Bacteria | 602 |
| 800 | Ga0466963_0030288 | 3300044694 | Bacteria | 3491 |
| 801 | Ga0466963_0035757 | 3300044694 | Bacteria | 3236 |
| 802 | Ga0466963_0279868 | 3300044694 | Bacteria | 1172 |
| 803 | Ga0466963_0330324 | 3300044694 | Bacteria | 1073 |
| 804 | Ga0466963_0950244 | 3300044694 | Bacteria | 605 |
| 805 | Ga0466964_0031346 | 3300044706 | Bacteria | 2108 |
| 806 | Ga0466971_0012142 | 3300044719 | Bacteria | 3774 |
| 807 | Ga0466971_0077065 | 3300044719 | Bacteria | 1517 |
| 808 | Ga0466971_0321859 | 3300044719 | Bacteria | 745 |
| 809 | Ga0466968_0066476 | 3300044735 | Bacteria | 1562 |
| 810 | Ga0466970_0015868 | 3300044765 | Bacteria | 3878 |
| 811 | Ga0466970_0016905 | 3300044765 | Bacteria | 3765 |
| 812 | Ga0466970_0111610 | 3300044765 | Bacteria | 1493 |
| 813 | Ga0466970_0235383 | 3300044765 | Bacteria | 1024 |
| 814 | Ga0466970_0276217 | 3300044765 | Bacteria | 944 |
| 815 | Ga0466957_0008423 | 3300044842 | Bacteria | 5864 |
| 816 | Ga0466957_0117329 | 3300044842 | Bacteria | 1694 |
| 817 | Ga0466957_0325845 | 3300044842 | Bacteria | 1037 |
| 818 | Ga0466957_0477600 | 3300044842 | Bacteria | 862 |
| 819 | Ga0466957_0867804 | 3300044842 | Bacteria | 644 |
| 820 | Ga0466960_0002889 | 3300044901 | Bacteria | 6525 |
| 821 | Ga0466960_0021348 | 3300044901 | Bacteria | 2881 |
| 822 | Ga0466960_0022406 | 3300044901 | Bacteria | 2824 |
| 823 | Ga0466960_0045709 | 3300044901 | Bacteria | 2093 |
| 824 | Ga0466960_0108854 | 3300044901 | Bacteria | 1437 |
| 825 | Ga0466960_0137514 | 3300044901 | Bacteria | 1295 |
| 826 | Ga0466960_0353594 | 3300044901 | Bacteria | 838 |
| 827 | Ga0466959_0010301 | 3300045049 | Bacteria | 6677 |
| 828 | Ga0451576_0986570 | 3300045051 | Bacteria | 883 |
| 829 | Ga0466958_0025758 | 3300045836 | Bacteria | 3470 |
| 830 | Ga0466958_0033899 | 3300045836 | Bacteria | 3044 |
| 831 | Ga0466958_0066091 | 3300045836 | Bacteria | 2207 |
| 832 | Ga0466958_0106717 | 3300045836 | Bacteria | 1746 |
| 833 | Ga0466967_0010143 | 3300045976 | Bacteria | 7045 |
| 834 | Ga0466967_0018278 | 3300045976 | Bacteria | 5597 |
| 835 | Ga0466967_0058609 | 3300045976 | Bacteria | 3404 |
| 836 | Ga0466967_0093387 | 3300045976 | Bacteria | 2738 |
| 837 | Ga0466967_0236420 | 3300045976 | Bacteria | 1741 |
| 838 | Ga0466967_0336901 | 3300045976 | Bacteria | 1458 |
| 839 | Ga0466967_0375482 | 3300045976 | Bacteria | 1380 |
| 840 | Ga0466967_0572052 | 3300045976 | Bacteria | 1113 |
| 841 | Ga0466967_0709297 | 3300045976 | Bacteria | 997 |
| 842 | Ga0466967_0715582 | 3300045976 | Bacteria | 992 |
| 843 | Ga0466967_0931867 | 3300045976 | Bacteria | 864 |
| 844 | Ga0466967_1660923 | 3300045976 | Bacteria | 636 |
| 845 | Ga0495627_193887 | 3300046453 | Bacteria | 560 |
| 846 | Ga0495641_0038761 | 3300046461 | Bacteria | 2225 |
| 847 | Ga0495651_0054830 | 3300046462 | Bacteria | 3063 |
| 848 | Ga0495653_0192997 | 3300046463 | Bacteria | 1388 |
| 849 | Ga0495653_0290604 | 3300046463 | Bacteria | 1069 |
| 850 | Ga0495639_0139103 | 3300046475 | Bacteria | 1166 |
| 851 | Ga0495662_0065101 | 3300046476 | Bacteria | 1762 |
| 852 | Ga0495664_0319838 | 3300046477 | Bacteria | 936 |
| 853 | Ga0495664_0704810 | 3300046477 | Bacteria | 596 |
| 854 | Ga0495585_0053598 | 3300046492 | Bacteria | 2232 |
| 855 | Ga0495585_0163977 | 3300046492 | Bacteria | 1152 |
| 856 | Ga0495585_0552770 | 3300046492 | Bacteria | 544 |
| 857 | Ga0495585_0554174 | 3300046492 | Bacteria | 543 |
| 858 | Ga0495607_0094204 | 3300046501 | Bacteria | 1616 |
| 859 | Ga0495608_0030998 | 3300046511 | Bacteria | 3616 |
| 860 | Ga0495608_0304998 | 3300046511 | Bacteria | 985 |
| 861 | Ga0495610_0264581 | 3300046512 | Bacteria | 676 |
| 862 | Ga0495616_0065623 | 3300046513 | Bacteria | 1768 |
| 863 | Ga0495618_0084575 | 3300046514 | Bacteria | 2027 |
| 864 | Ga0495618_0579885 | 3300046514 | Bacteria | 669 |
| 865 | Ga0495620_0024782 | 3300046515 | Bacteria | 2848 |
| 866 | Ga0495620_0035832 | 3300046515 | Bacteria | 2227 |
| 867 | Ga0495620_0143016 | 3300046515 | Bacteria | 935 |
| 868 | Ga0495628_0128697 | 3300046516 | Bacteria | 1938 |
| 869 | Ga0495628_0375780 | 3300046516 | Bacteria | 1041 |
| 870 | Ga0495628_0592116 | 3300046516 | Bacteria | 793 |
| 871 | Ga0495630_0046763 | 3300046517 | Bacteria | 3235 |
| 872 | Ga0495630_0503604 | 3300046517 | Bacteria | 929 |
| 873 | Ga0495632_0054499 | 3300046519 | Bacteria | 1960 |
| 874 | Ga0495637_0115687 | 3300046520 | Bacteria | 1036 |
| 875 | Ga0495637_0237979 | 3300046520 | Bacteria | 658 |
| 876 | Ga0495637_0289478 | 3300046520 | Bacteria | 583 |
| 877 | Ga0495643_0245107 | 3300046522 | Bacteria | 839 |
| 878 | Ga0495644_0048864 | 3300046523 | Bacteria | 1589 |
| 879 | Ga0495663_0008525 | 3300046525 | Bacteria | 2842 |
| 880 | Ga0495663_0133538 | 3300046525 | Bacteria | 839 |
| 881 | Ga0495663_0151040 | 3300046525 | Bacteria | 793 |
| 882 | Ga0495652_0042715 | 3300046529 | Bacteria | 3908 |
| 883 | Ga0495652_0376672 | 3300046529 | Bacteria | 1010 |
| 884 | Ga0495652_0813403 | 3300046529 | Bacteria | 621 |
| 885 | Ga0495665_0242361 | 3300046531 | Bacteria | 929 |
| 886 | Ga0495640_0119830 | 3300046533 | Bacteria | 1712 |
| 887 | Ga0495586_0053744 | 3300046535 | Bacteria | 2182 |
| 888 | Ga0495586_0179071 | 3300046535 | Bacteria | 1199 |
| 889 | Ga0495587_0016874 | 3300046536 | Bacteria | 4540 |
| 890 | Ga0495598_0095844 | 3300046537 | Bacteria | 975 |
| 891 | Ga0495609_0032246 | 3300046538 | Bacteria | 2381 |
| 892 | Ga0495609_0222845 | 3300046538 | Bacteria | 783 |
| 893 | Ga0495597_0038400 | 3300046542 | Bacteria | 2146 |
| 894 | Ga0495645_0230945 | 3300046543 | Bacteria | 1239 |
| 895 | Ga0495667_0150892 | 3300046559 | Bacteria | 1496 |
| 896 | Ga0495656_0072736 | 3300046615 | Bacteria | 1531 |
| 897 | Ga0495656_0089799 | 3300046615 | Bacteria | 1403 |
| 898 | Ga0495656_0096436 | 3300046615 | Bacteria | 1361 |
| 899 | Ga0495668_0000213 | 3300046616 | Bacteria | 84412 |
| 900 | Ga0495668_0700429 | 3300046616 | Bacteria | 560 |
| 901 | Ga0495634_0033635 | 3300046642 | Bacteria | 3522 |
| 902 | Ga0495634_0382415 | 3300046642 | Bacteria | 839 |
| 903 | Ga0495611_0278366 | 3300046648 | Bacteria | 773 |
| 904 | Ga0495625_0002483 | 3300046660 | Bacteria | 19877 |
| 905 | Ga0495625_0342464 | 3300046660 | Bacteria | 947 |
| 906 | Ga0495625_0359903 | 3300046660 | Bacteria | 918 |
| 907 | Ga0495625_0372461 | 3300046660 | Bacteria | 898 |
| 908 | Ga0495635_0068184 | 3300046663 | Bacteria | 2440 |
| 909 | Ga0495635_0222850 | 3300046663 | Bacteria | 1275 |
| 910 | Ga0495588_0327749 | 3300046674 | Bacteria | 805 |
| 911 | Ga0495657_0026841 | 3300046675 | Bacteria | 4073 |
| 912 | Ga0495657_0234882 | 3300046675 | Bacteria | 1108 |
| 913 | Ga0495599_0549853 | 3300046678 | Bacteria | 676 |
| 914 | Ga0495623_0018318 | 3300046679 | Bacteria | 4522 |
| 915 | Ga0495646_0028847 | 3300046680 | Bacteria | 3472 |
| 916 | Ga0495646_0487573 | 3300046680 | Bacteria | 634 |
| 917 | Ga0495647_0035839 | 3300046681 | Bacteria | 1865 |
| 918 | Ga0495658_0096659 | 3300046683 | Bacteria | 1757 |
| 919 | Ga0495669_0040586 | 3300046684 | Bacteria | 2065 |
| 920 | Ga0495613_0425020 | 3300046689 | Bacteria | 903 |
| 921 | Ga0495613_0552720 | 3300046689 | Bacteria | 770 |
| 922 | Ga0495613_0740690 | 3300046689 | Bacteria | 645 |
| 923 | Ga0495624_0160392 | 3300046690 | Bacteria | 1374 |
| 924 | Ga0495670_0096603 | 3300046691 | Bacteria | 1517 |
| 925 | Ga0495670_0238932 | 3300046691 | Bacteria | 967 |
| 926 | Ga0495670_0528356 | 3300046691 | Bacteria | 641 |
| 927 | Ga0495671_0068006 | 3300046692 | Bacteria | 1752 |
| 928 | Ga0495671_0189615 | 3300046692 | Bacteria | 998 |
| 929 | Ga0495589_0090451 | 3300046794 | Bacteria | 1486 |
| 930 | Ga0495581_0051277 | 3300047315 | Bacteria | 2383 |
| 931 | Ga0495581_0080318 | 3300047315 | Bacteria | 1887 |
| 932 | Ga0495581_0446043 | 3300047315 | Bacteria | 754 |
| 933 | Ga0495604_0035414 | 3300047317 | Bacteria | 3942 |
| 934 | Ga0495636_0154989 | 3300047318 | Bacteria | 1030 |
| 935 | Ga0495674_0053641 | 3300047319 | Bacteria | 3543 |
| 936 | Ga0495674_0107170 | 3300047319 | Bacteria | 2372 |
| 937 | Ga0495674_0241664 | 3300047319 | Bacteria | 1488 |
| 938 | Ga0495674_0352355 | 3300047319 | Bacteria | 1195 |
| 939 | Ga0495674_0546633 | 3300047319 | Bacteria | 922 |
| 940 | Ga0495676_0074724 | 3300047321 | Bacteria | 2594 |
| 941 | Ga0495676_0492617 | 3300047321 | Bacteria | 805 |
| 942 | Ga0495680_0014362 | 3300047322 | Bacteria | 6860 |
| 943 | Ga0495680_0030936 | 3300047322 | Bacteria | 4361 |
| 944 | Ga0495683_0398995 | 3300047323 | Bacteria | 572 |
| 945 | Ga0495683_0463278 | 3300047323 | Bacteria | 519 |
| 946 | Ga0495677_0100450 | 3300047445 | Bacteria | 1095 |
| 947 | Ga0495679_061605 | 3300047446 | Bacteria | 1099 |
| 948 | Ga0495684_0078704 | 3300047471 | Bacteria | 2502 |
| 949 | Ga0495684_0167555 | 3300047471 | Bacteria | 1636 |
| 950 | Ga0495593_0057991 | 3300047673 | Bacteria | 2032 |
| 951 | Ga0495602_0047953 | 3300048088 | Bacteria | 3844 |
| 952 | Ga0495626_0000656 | 3300048091 | Bacteria | 33341 |
| 953 | Ga0495626_0130722 | 3300048091 | Bacteria | 1072 |
| 954 | Ga0495626_0191205 | 3300048091 | Bacteria | 844 |
| 955 | Ga0496100_0578621 | 3300048903 | Bacteria | 870 |
| 956 | Ga0496100_0896681 | 3300048903 | Bacteria | 696 |
| 957 | Ga0496100_1395037 | 3300048903 | Bacteria | 553 |
| 958 | Ga0496101_0020254 | 3300048904 | Bacteria | 4550 |
| 959 | Ga0496101_0072790 | 3300048904 | Bacteria | 2523 |
| 960 | Ga0496101_0073914 | 3300048904 | Bacteria | 2505 |
| 961 | Ga0496101_0328845 | 3300048904 | Bacteria | 1200 |
| 962 | Ga0496101_0724929 | 3300048904 | Bacteria | 785 |
| 963 | Ga0496102_0175572 | 3300048905 | Bacteria | 2017 |
| 964 | Ga0496102_0201154 | 3300048905 | Bacteria | 1878 |
| 965 | Ga0496102_0272612 | 3300048905 | Bacteria | 1595 |
| 966 | Ga0496102_0436712 | 3300048905 | Bacteria | 1229 |
| 967 | Ga0496102_1614405 | 3300048905 | Bacteria | 567 |
| 968 | Ga0496103_0005348 | 3300048906 | Bacteria | 7695 |
| 969 | Ga0496103_0056286 | 3300048906 | Bacteria | 2441 |
| 970 | Ga0496104_0001713 | 3300048907 | Bacteria | 18934 |
| 971 | Ga0496104_0014519 | 3300048907 | Bacteria | 7115 |
| 972 | Ga0496104_0062575 | 3300048907 | Bacteria | 3529 |
| 973 | Ga0496104_0366683 | 3300048907 | Bacteria | 1353 |
| 974 | Ga0496104_0404531 | 3300048907 | Bacteria | 1277 |
| 975 | Ga0496104_0508522 | 3300048907 | Bacteria | 1116 |
| 976 | Ga0496104_1007726 | 3300048907 | Bacteria | 737 |
| 977 | Ga0496104_1242821 | 3300048907 | Bacteria | 648 |
| 978 | Ga0496105_0000128 | 3300048908 | Bacteria | 51033 |
| 979 | Ga0496105_0105160 | 3300048908 | Bacteria | 2330 |
| 980 | Ga0496105_0538936 | 3300048908 | Bacteria | 912 |
| 981 | Ga0496105_0741361 | 3300048908 | Bacteria | 751 |
| 982 | Ga0496105_0770002 | 3300048908 | Unclassified | 734 |
| 983 | Ga0496105_1259028 | 3300048908 | Unclassified | 542 |
| 984 | Ga0496106_0082392 | 3300048909 | Bacteria | 2473 |
| 985 | Ga0496106_0623088 | 3300048909 | Bacteria | 863 |
| 986 | Ga0496106_1022245 | 3300048909 | Bacteria | 649 |
| 987 | Ga0496107_0188029 | 3300048910 | Bacteria | 1534 |
| 988 | Ga0496107_0499459 | 3300048910 | Bacteria | 902 |
| 989 | Ga0496107_1003219 | 3300048910 | Bacteria | 606 |
| 990 | Ga0496108_0018761 | 3300048911 | Bacteria | 5670 |
| 991 | Ga0496108_0024079 | 3300048911 | Bacteria | 5011 |
| 992 | Ga0496108_0399103 | 3300048911 | Bacteria | 1201 |
| 993 | Ga0496108_0478203 | 3300048911 | Bacteria | 1088 |
| 994 | Ga0496108_0555613 | 3300048911 | Bacteria | 1001 |
| 995 | Ga0496108_0587669 | 3300048911 | Bacteria | 971 |
| 996 | Ga0496108_0648051 | 3300048911 | Bacteria | 918 |
| 997 | Ga0496108_1454921 | 3300048911 | Bacteria | 571 |
| 998 | Ga0496109_0000408 | 3300048912 | Bacteria | 38367 |
| 999 | Ga0496109_0008215 | 3300048912 | Bacteria | 8857 |
| 1000 | Ga0496109_0013354 | 3300048912 | Bacteria | 7121 |
| 1001 | Ga0496109_0062912 | 3300048912 | Bacteria | 3394 |
| 1002 | Ga0496109_0077537 | 3300048912 | Bacteria | 3058 |
| 1003 | Ga0496109_0081602 | 3300048912 | Bacteria | 2980 |
| 1004 | Ga0496109_0119303 | 3300048912 | Bacteria | 2456 |
| 1005 | Ga0496109_0598985 | 3300048912 | Bacteria | 1038 |
| 1006 | Ga0496109_0656158 | 3300048912 | Bacteria | 986 |
| 1007 | Ga0496109_0806862 | 3300048912 | Bacteria | 876 |
| 1008 | Ga0496110_0000289 | 3300048913 | Bacteria | 32969 |
| 1009 | Ga0496110_0000929 | 3300048913 | Bacteria | 20551 |
| 1010 | Ga0496110_0057708 | 3300048913 | Bacteria | 3418 |
| 1011 | Ga0496110_0077824 | 3300048913 | Bacteria | 2951 |
| 1012 | Ga0496110_0088894 | 3300048913 | Bacteria | 2760 |
| 1013 | Ga0496110_0123505 | 3300048913 | Bacteria | 2334 |
| 1014 | Ga0496110_0240830 | 3300048913 | Bacteria | 1646 |
| 1015 | Ga0496110_0263278 | 3300048913 | Bacteria | 1569 |
| 1016 | Ga0496110_0463663 | 3300048913 | Bacteria | 1154 |
| 1017 | Ga0496110_0493670 | 3300048913 | Bacteria | 1115 |
| 1018 | Ga0496110_0595659 | 3300048913 | Bacteria | 1003 |
| 1019 | Ga0496110_0678847 | 3300048913 | Bacteria | 931 |
| 1020 | Ga0496110_1506529 | 3300048913 | Bacteria | 582 |
| 1021 | Ga0496111_0000145 | 3300048914 | Bacteria | 31804 |
| 1022 | Ga0496111_0001006 | 3300048914 | Bacteria | 15459 |
| 1023 | Ga0496111_0007092 | 3300048914 | Bacteria | 7323 |
| 1024 | Ga0496111_0031569 | 3300048914 | Bacteria | 3774 |
| 1025 | Ga0496111_0163432 | 3300048914 | Bacteria | 1653 |
| 1026 | Ga0496111_0197416 | 3300048914 | Bacteria | 1496 |
| 1027 | Ga0496111_0229873 | 3300048914 | Bacteria | 1378 |
| 1028 | Ga0496111_0357146 | 3300048914 | Bacteria | 1081 |
| 1029 | Ga0496111_0723103 | 3300048914 | Bacteria | 723 |
| 1030 | Ga0496111_0815489 | 3300048914 | Bacteria | 675 |
| 1031 | Ga0496111_1057002 | 3300048914 | Bacteria | 580 |
| 1032 | Ga0496111_1164809 | 3300048914 | Bacteria | 547 |
| 1033 | Ga0496112_0061889 | 3300048915 | Bacteria | 3691 |
| 1034 | Ga0496112_0120442 | 3300048915 | Bacteria | 2594 |
| 1035 | Ga0496112_0164344 | 3300048915 | Bacteria | 2185 |
| 1036 | Ga0496112_0328138 | 3300048915 | Bacteria | 1474 |
| 1037 | Ga0496112_0687952 | 3300048915 | Bacteria | 951 |
| 1038 | Ga0496112_1154516 | 3300048915 | Bacteria | 692 |
| 1039 | Ga0496112_1162982 | 3300048915 | Bacteria | 689 |
| 1040 | Ga0496113_0028768 | 3300048916 | Bacteria | 4001 |
| 1041 | Ga0496113_0230183 | 3300048916 | Bacteria | 1478 |
| 1042 | Ga0496113_0294524 | 3300048916 | Bacteria | 1299 |
| 1043 | Ga0496113_0296900 | 3300048916 | Bacteria | 1293 |
| 1044 | Ga0496113_0596492 | 3300048916 | Bacteria | 885 |
| 1045 | Ga0496113_1590628 | 3300048916 | Bacteria | 503 |
| 1046 | Ga0496114_0001039 | 3300048917 | Bacteria | 20885 |
| 1047 | Ga0496114_0002645 | 3300048917 | Bacteria | 13671 |
| 1048 | Ga0496114_0157750 | 3300048917 | Bacteria | 1971 |
| 1049 | Ga0496114_0725367 | 3300048917 | Bacteria | 870 |
| 1050 | Ga0496114_1301120 | 3300048917 | Bacteria | 614 |
| 1051 | Ga0496115_0011744 | 3300048918 | Bacteria | 6578 |
| 1052 | Ga0496115_0181771 | 3300048918 | Bacteria | 1738 |
| 1053 | Ga0496115_0246438 | 3300048918 | Bacteria | 1472 |
| 1054 | Ga0496115_0264092 | 3300048918 | Bacteria | 1415 |
| 1055 | Ga0496115_0925345 | 3300048918 | Bacteria | 671 |
| 1056 | Ga0501031_0002307 | 3300049568 | Bacteria | 12093 |
| 1057 | Ga0501031_0047671 | 3300049568 | Bacteria | 2793 |
| 1058 | Ga0501031_0196187 | 3300049568 | Bacteria | 1318 |
| 1059 | Ga0501031_0437567 | 3300049568 | Bacteria | 845 |
| 1060 | Ga0501032_0000134 | 3300049569 | Bacteria | 60304 |
| 1061 | Ga0501032_0128464 | 3300049569 | Bacteria | 1673 |
| 1062 | Ga0501033_0001709 | 3300049570 | Bacteria | 19227 |
| 1063 | Ga0501033_0222770 | 3300049570 | Bacteria | 1342 |
| 1064 | Ga0501034_0007950 | 3300049571 | Bacteria | 11264 |
| 1065 | Ga0501034_0783871 | 3300049571 | Bacteria | 847 |
| 1066 | Ga0501036_0001932 | 3300049572 | Bacteria | 16090 |
| 1067 | Ga0501036_0147095 | 3300049572 | Bacteria | 1988 |
| 1068 | Ga0501036_0263232 | 3300049572 | Bacteria | 1444 |
| 1069 | Ga0501036_0574854 | 3300049572 | Bacteria | 936 |
| 1070 | Ga0501036_0701283 | 3300049572 | Bacteria | 836 |
| 1071 | Ga0501036_1729413 | 3300049572 | Bacteria | 504 |
| 1072 | Ga0501037_0003907 | 3300049573 | Bacteria | 10809 |
| 1073 | Ga0501038_0000554 | 3300049574 | Bacteria | 32977 |
| 1074 | Ga0501038_0422444 | 3300049574 | Bacteria | 1028 |
| 1075 | Ga0501038_0490631 | 3300049574 | Bacteria | 940 |
| 1076 | Ga0501039_0001152 | 3300049575 | Bacteria | 19481 |
| 1077 | Ga0501039_0006353 | 3300049575 | Bacteria | 8977 |
| 1078 | Ga0501039_0191731 | 3300049575 | Bacteria | 1607 |
| 1079 | Ga0501039_0467154 | 3300049575 | Bacteria | 991 |
| 1080 | Ga0501039_0579079 | 3300049575 | Bacteria | 880 |
| 1081 | Ga0501039_0615944 | 3300049575 | Bacteria | 851 |
| 1082 | Ga0501040_0012064 | 3300049576 | Bacteria | 5656 |
| 1083 | Ga0501040_0306054 | 3300049576 | Bacteria | 1136 |
| 1084 | Ga0501040_0434227 | 3300049576 | Bacteria | 945 |
| 1085 | Ga0501041_0041904 | 3300049577 | Bacteria | 2781 |
| 1086 | Ga0501041_0054234 | 3300049577 | Bacteria | 2446 |
| 1087 | Ga0501041_0219842 | 3300049577 | Bacteria | 1192 |
| 1088 | Ga0501041_0350506 | 3300049577 | Bacteria | 933 |
| 1089 | Ga0501041_0607933 | 3300049577 | Bacteria | 698 |
| 1090 | Ga0501041_0709541 | 3300049577 | Bacteria | 644 |
| 1091 | Ga0501042_0107309 | 3300049578 | Bacteria | 2010 |
| 1092 | Ga0501042_0148959 | 3300049578 | Bacteria | 1687 |
| 1093 | Ga0501042_0347159 | 3300049578 | Bacteria | 1073 |
| 1094 | Ga0501042_0535152 | 3300049578 | Bacteria | 851 |
| 1095 | Ga0501042_1234789 | 3300049578 | Bacteria | 545 |
| 1096 | Ga0501043_0002482 | 3300049579 | Bacteria | 15606 |
| 1097 | Ga0501046_0000172 | 3300049580 | Bacteria | 65712 |
| 1098 | Ga0501046_0489161 | 3300049580 | Bacteria | 882 |
| 1099 | Ga0501047_0000114 | 3300049581 | Bacteria | 97220 |
| 1100 | Ga0501047_0026206 | 3300049581 | Bacteria | 5607 |
| 1101 | Ga0501048_0003343 | 3300049582 | Bacteria | 12200 |
| 1102 | Ga0501048_0113221 | 3300049582 | Bacteria | 1916 |
| 1103 | Ga0501048_0198473 | 3300049582 | Bacteria | 1422 |
| 1104 | Ga0501048_0872779 | 3300049582 | Bacteria | 647 |
| 1105 | Ga0501067_0030285 | 3300049583 | Bacteria | 3001 |
| 1106 | Ga0501067_0198789 | 3300049583 | Bacteria | 1116 |
| 1107 | Ga0501067_0231537 | 3300049583 | Bacteria | 1028 |
| 1108 | Ga0501068_0706426 | 3300049584 | Bacteria | 659 |
| 1109 | Ga0501069_0064048 | 3300049585 | Bacteria | 2054 |
| 1110 | Ga0501069_0170130 | 3300049585 | Bacteria | 1257 |
| 1111 | Ga0501069_0216927 | 3300049585 | Bacteria | 1111 |
| 1112 | Ga0501069_0313982 | 3300049585 | Bacteria | 920 |
| 1113 | Ga0501069_0399708 | 3300049585 | Bacteria | 813 |
| 1114 | Ga0501070_0000900 | 3300049586 | Bacteria | 27095 |
| 1115 | Ga0501070_0015519 | 3300049586 | Bacteria | 6407 |
| 1116 | Ga0501070_0190788 | 3300049586 | Bacteria | 1684 |
| 1117 | Ga0501070_0324105 | 3300049586 | Bacteria | 1253 |
| 1118 | Ga0501070_0710350 | 3300049586 | Bacteria | 794 |
| 1119 | Ga0501071_0007623 | 3300049587 | Bacteria | 7129 |
| 1120 | Ga0501071_0303278 | 3300049587 | Bacteria | 1211 |
| 1121 | Ga0501071_0510957 | 3300049587 | Bacteria | 922 |
| 1122 | Ga0501071_1442347 | 3300049587 | Bacteria | 531 |
| 1123 | Ga0501072_0033399 | 3300049588 | Bacteria | 4032 |
| 1124 | Ga0501072_0103584 | 3300049588 | Bacteria | 2262 |
| 1125 | Ga0501072_0183886 | 3300049588 | Bacteria | 1667 |
| 1126 | Ga0501072_0541297 | 3300049588 | Bacteria | 920 |
| 1127 | Ga0501072_1181494 | 3300049588 | Bacteria | 594 |
| 1128 | Ga0501073_0003847 | 3300049589 | Bacteria | 11262 |
| 1129 | Ga0501073_0035211 | 3300049589 | Bacteria | 3560 |
| 1130 | Ga0501074_0002120 | 3300049590 | Bacteria | 13704 |
| 1131 | Ga0501074_0129821 | 3300049590 | Bacteria | 1803 |
| 1132 | Ga0501074_0220722 | 3300049590 | Bacteria | 1350 |
| 1133 | Ga0501074_0281730 | 3300049590 | Bacteria | 1182 |
| 1134 | Ga0501074_0362678 | 3300049590 | Bacteria | 1028 |
| 1135 | Ga0501074_0598980 | 3300049590 | Bacteria | 779 |
| 1136 | Ga0501075_0051304 | 3300049591 | Bacteria | 3102 |
| 1137 | Ga0501075_0323065 | 3300049591 | Bacteria | 1176 |
| 1138 | Ga0501075_1301713 | 3300049591 | Bacteria | 551 |
| 1139 | Ga0501076_0017143 | 3300049592 | Bacteria | 5502 |
| 1140 | Ga0501076_0100627 | 3300049592 | Bacteria | 2329 |
| 1141 | Ga0501076_0168107 | 3300049592 | Bacteria | 1787 |
| 1142 | Ga0501076_0571824 | 3300049592 | Bacteria | 932 |
| 1143 | Ga0501076_0979547 | 3300049592 | Bacteria | 697 |
| 1144 | Ga0501076_1179299 | 3300049592 | Bacteria | 630 |
| 1145 | Ga0501077_0005556 | 3300049593 | Bacteria | 7674 |
| 1146 | Ga0501077_0059995 | 3300049593 | Bacteria | 2414 |
| 1147 | Ga0501077_0691637 | 3300049593 | Bacteria | 655 |
| 1148 | Ga0501077_0692550 | 3300049593 | Bacteria | 655 |
| 1149 | Ga0501250_089778 | 3300049680 | Bacteria | 534 |
| 1150 | Ga0501079_0013295 | 3300049741 | Bacteria | 6276 |
| 1151 | Ga0501079_0170911 | 3300049741 | Bacteria | 1695 |
| 1152 | Ga0501079_0505551 | 3300049741 | Bacteria | 950 |
| 1153 | Ga0501079_0789404 | 3300049741 | Bacteria | 748 |
| 1154 | Ga0501079_0830253 | 3300049741 | Bacteria | 728 |
| 1155 | Ga0501080_0001104 | 3300049742 | Bacteria | 22226 |
| 1156 | Ga0501080_0216037 | 3300049742 | Bacteria | 1756 |
| 1157 | Ga0501080_0282827 | 3300049742 | Bacteria | 1508 |
| 1158 | Ga0501080_0339022 | 3300049742 | Bacteria | 1359 |
| 1159 | Ga0501081_0014542 | 3300049743 | Bacteria | 5192 |
| 1160 | Ga0501081_0198462 | 3300049743 | Bacteria | 1455 |
| 1161 | Ga0501083_0005006 | 3300049744 | Bacteria | 9391 |
| 1162 | Ga0501035_0019227 | 3300049822 | Bacteria | 6288 |
| 1163 | Ga0501044_0015622 | 3300049823 | Bacteria | 8177 |
| 1164 | Ga0501044_0673078 | 3300049823 | Bacteria | 922 |
| 1165 | Ga0501045_0006569 | 3300049824 | Bacteria | 8059 |
| 1166 | Ga0501045_0036943 | 3300049824 | Bacteria | 3549 |
| 1167 | Ga0501045_0223990 | 3300049824 | Bacteria | 1400 |
| 1168 | Ga0501045_0248864 | 3300049824 | Bacteria | 1323 |
| 1169 | Ga0501045_0772180 | 3300049824 | Bacteria | 708 |
| 1170 | Ga0501045_1089641 | 3300049824 | Bacteria | 584 |
| 1171 | Ga0501045_1106754 | 3300049824 | Bacteria | 579 |
| 1172 | nmdc:mga03683_257529_c1 | 3300050489 | Bacteria | 811 |
| 1173 | nmdc:mga03683_33954_c1 | 3300050489 | Bacteria | 2062 |
| 1174 | nmdc:mga03n38_141078_c1 | 3300050490 | Bacteria | 1203 |
| 1175 | nmdc:mga03n38_167176_c1 | 3300050490 | Bacteria | 1118 |
| 1176 | nmdc:mga03n38_199216_c1 | 3300050490 | Bacteria | 1036 |
| 1177 | nmdc:mga03n38_403334_c1 | 3300050490 | Bacteria | 753 |
| 1178 | nmdc:mga03n38_530857_c1 | 3300050490 | Bacteria | 664 |
| 1179 | nmdc:mga03n38_88502_c1 | 3300050490 | Bacteria | 1469 |
| 1180 | nmdc:mga00v17_121058_c1 | 3300050491 | Bacteria | 1666 |
| 1181 | nmdc:mga00v17_1324_c1 | 3300050491 | Bacteria | 12971 |
| 1182 | nmdc:mga00v17_152907_c1 | 3300050491 | Bacteria | 1483 |
| 1183 | nmdc:mga00v17_18888_c1 | 3300050491 | Bacteria | 3924 |
| 1184 | nmdc:mga00v17_236298_c1 | 3300050491 | Bacteria | 1184 |
| 1185 | nmdc:mga00v17_283426_c1 | 3300050491 | Bacteria | 1076 |
| 1186 | nmdc:mga00v17_634318_c1 | 3300050491 | Bacteria | 688 |
| 1187 | nmdc:mga00v17_65716_c1 | 3300050491 | Bacteria | 2238 |
| 1188 | nmdc:mga0yw44_114768_c1 | 3300050492 | Bacteria | 1729 |
| 1189 | nmdc:mga0yw44_251337_c1 | 3300050492 | Bacteria | 1177 |
| 1190 | nmdc:mga0yw44_271420_c1 | 3300050492 | Bacteria | 1132 |
| 1191 | nmdc:mga0yw44_283991_c1 | 3300050492 | Bacteria | 1107 |
| 1192 | nmdc:mga0yw44_437849_c1 | 3300050492 | Bacteria | 886 |
| 1193 | nmdc:mga0yw44_438389_c1 | 3300050492 | Bacteria | 885 |
| 1194 | nmdc:mga0yw44_45624_c1 | 3300050492 | Bacteria | 2628 |
| 1195 | nmdc:mga0yw44_47916_c1 | 3300050492 | Bacteria | 2575 |
| 1196 | nmdc:mga0yw44_541547_c1 | 3300050492 | Bacteria | 790 |
| 1197 | nmdc:mga0yw44_57947_c1 | 3300050492 | Bacteria | 2365 |
| 1198 | nmdc:mga0yw44_656347_c1 | 3300050492 | Bacteria | 713 |
| 1199 | nmdc:mga0yw44_790032_c1 | 3300050492 | Bacteria | 645 |
| 1200 | nmdc:mga0yw44_79644_c1 | 3300050492 | Bacteria | 2050 |
| 1201 | nmdc:mga06z11_1030775_c1 | 3300050494 | Bacteria | 502 |
| 1202 | nmdc:mga06z11_192020_c1 | 3300050494 | Bacteria | 1183 |
| 1203 | nmdc:mga06z11_22558_c1 | 3300050494 | Bacteria | 2943 |
| 1204 | nmdc:mga06z11_800748_c1 | 3300050494 | Bacteria | 574 |
| 1205 | nmdc:mga04h51_57812_c1 | 3300050495 | Bacteria | 1321 |
| 1206 | nmdc:mga04h51_5950_c1 | 3300050495 | Bacteria | 3134 |
| 1207 | nmdc:mga07m45_21108_c1 | 3300050496 | Bacteria | 3543 |
| 1208 | nmdc:mga07m45_39082_c1 | 3300050496 | Bacteria | 2650 |
| 1209 | nmdc:mga07m45_9783_c1 | 3300050496 | Bacteria | 4987 |
| 1210 | nmdc:mga05p37_30566_c1 | 3300050507 | Bacteria | 6572 |
| 1211 | nmdc:mga05p37_43526_c1 | 3300050507 | Bacteria | 5524 |
| 1212 | nmdc:mga05p37_471850_c1 | 3300050507 | Bacteria | 1448 |
| 1213 | nmdc:mga05p37_528306_c1 | 3300050507 | Unclassified | 1348 |
| 1214 | nmdc:mga05p37_714463_c1 | 3300050507 | Bacteria | 1111 |
| 1215 | nmdc:mga09592_1105801_c1 | 3300050508 | Bacteria | 659 |
| 1216 | nmdc:mga09592_392815_c1 | 3300050508 | Bacteria | 1199 |
| 1217 | nmdc:mga09592_609531_c1 | 3300050508 | Bacteria | 935 |
| 1218 | nmdc:mga0qj67_147773_c1 | 3300050509 | Bacteria | 1906 |
| 1219 | nmdc:mga0qj67_70349_c1 | 3300050509 | Bacteria | 2791 |
| 1220 | nmdc:mga06r32_133121_c1 | 3300050510 | Bacteria | 2460 |
| 1221 | nmdc:mga06r32_205405_c1 | 3300050510 | Bacteria | 1958 |
| 1222 | nmdc:mga06r32_77962_c1 | 3300050510 | Bacteria | 3220 |
| 1223 | nmdc:mga06r32_9581_c1 | 3300050510 | Bacteria | 8748 |
| 1224 | nmdc:mga08y16_129918_c1 | 3300050511 | Bacteria | 2621 |
| 1225 | nmdc:mga08y16_141711_c1 | 3300050511 | Bacteria | 2499 |
| 1226 | nmdc:mga08y16_226021_c1 | 3300050511 | Bacteria | 1937 |
| 1227 | nmdc:mga08y16_275565_c1 | 3300050511 | Bacteria | 1736 |
| 1228 | nmdc:mga08y16_486399_c1 | 3300050511 | Bacteria | 1255 |
| 1229 | nmdc:mga08y16_533353_c1 | 3300050511 | Bacteria | 1189 |
| 1230 | nmdc:mga08y16_794814_c1 | 3300050511 | Bacteria | 939 |
| 1231 | nmdc:mga0n895_104241_c1 | 3300050512 | Bacteria | 2848 |
| 1232 | nmdc:mga0n895_1211584_c1 | 3300050512 | Bacteria | 728 |
| 1233 | nmdc:mga0n895_1683238_c1 | 3300050512 | Unclassified | 597 |
| 1234 | nmdc:mga0n895_1845956_c1 | 3300050512 | Bacteria | 564 |
| 1235 | nmdc:mga0n895_190576_c1 | 3300050512 | Bacteria | 2082 |
| 1236 | nmdc:mga0n895_1920765_c1 | 3300050512 | Bacteria | 551 |
| 1237 | nmdc:mga0n895_214736_c1 | 3300050512 | Bacteria | 1953 |
| 1238 | nmdc:mga0n895_383324_c1 | 3300050512 | Bacteria | 1422 |
| 1239 | nmdc:mga0rr50_141946_c1 | 3300050513 | Bacteria | 1933 |
| 1240 | nmdc:mga0rr50_147991_c1 | 3300050513 | Bacteria | 1895 |
| 1241 | nmdc:mga0rr50_31543_c1 | 3300050513 | Bacteria | 3765 |
| 1242 | nmdc:mga0rr50_710683_c1 | 3300050513 | Bacteria | 858 |
| 1243 | nmdc:mga0rr50_760464_c1 | 3300050513 | Bacteria | 827 |
| 1244 | nmdc:mga08x19_429010_c1 | 3300050514 | Bacteria | 929 |
| 1245 | nmdc:mga08x19_83931_c1 | 3300050514 | Bacteria | 2095 |
| 1246 | nmdc:mga0a205_137521_c1 | 3300050515 | Bacteria | 2343 |
| 1247 | nmdc:mga0a205_272355_c1 | 3300050515 | Unclassified | 1570 |
| 1248 | nmdc:mga0a205_364882_c1 | 3300050515 | Bacteria | 1310 |
| 1249 | nmdc:mga0a205_42279_c1 | 3300050515 | Bacteria | 4391 |
| 1250 | nmdc:mga0a205_711211_c1 | 3300050515 | Bacteria | 854 |
| 1251 | Ga0495601_0029525 | 3300053077 | Bacteria | 3402 |
| 1252 | Ga0495601_0681841 | 3300053077 | Bacteria | 656 |
| 1253 | Ga0495612_0090725 | 3300053078 | Bacteria | 1293 |
| 1254 | Ga0495655_0068085 | 3300053083 | Bacteria | 989 |
| 1255 | Ga0495655_0160911 | 3300053083 | Bacteria | 712 |
| 1256 | Ga0495595_0025928 | 3300053084 | Bacteria | 2600 |
| 1257 | Ga0495595_0101381 | 3300053084 | Bacteria | 1390 |
| 1258 | Ga0495619_0064871 | 3300053085 | Unclassified | 2436 |
| 1259 | Ga0495619_0175690 | 3300053085 | Bacteria | 1481 |
| 1260 | Ga0495619_0259114 | 3300053085 | Bacteria | 1205 |
| 1261 | Ga0500644_0000128 | 3300053088 | Bacteria | 46307 |
| 1262 | Ga0500644_0108472 | 3300053088 | Bacteria | 1066 |
| 1263 | Ga0500554_212052 | 3300053102 | Bacteria | 646 |
| 1264 | Ga0500556_0001240 | 3300053104 | Bacteria | 11816 |
| 1265 | Ga0500573_0312601 | 3300053140 | Bacteria | 780 |
| 1266 | Ga0501084_0000711 | 3300054114 | Bacteria | 25412 |
| 1267 | Ga0501084_0283508 | 3300054114 | Bacteria | 1399 |
| 1268 | Ga0501084_0429605 | 3300054114 | Bacteria | 1117 |
| 1269 | Ga0501084_0481626 | 3300054114 | Bacteria | 1049 |
| 1270 | Ga0501084_1704488 | 3300054114 | Bacteria | 527 |
| 1271 | Ga0501082_0055233 | 3300060353 | Bacteria | 3421 |
| 1272 | Ga0501082_0334723 | 3300060353 | Bacteria | 1319 |
| 1273 | Ga0501082_0483830 | 3300060353 | Bacteria | 1082 |
| 1274 | Ga0501082_0664487 | 3300060353 | Bacteria | 912 |
| 1275 | Ga0501082_0664824 | 3300060353 | Bacteria | 912 |
| 1276 | Ga0501082_0711522 | 3300060353 | Bacteria | 879 |
| 1277 | Ga0501082_0861008 | 3300060353 | Bacteria | 793 |
| 1278 | Ga0501082_1740424 | 3300060353 | Bacteria | 544 |
| 1279 | Ga0466962_0001251 | 3300061719 | Bacteria | 11721 |
| 1280 | Ga0466962_0062724 | 3300061719 | Bacteria | 1775 |
| 1281 | Ga0466962_0754083 | 3300061719 | Bacteria | 501 |
| 1282 | Ga0530510_0046945 | 3300061734 | Bacteria | 3120 |
| 1283 | Ga0530510_0055215 | 3300061734 | Bacteria | 2869 |
| 1284 | Ga0530510_0103335 | 3300061734 | Bacteria | 2084 |
| 1285 | Ga0530510_1334357 | 3300061734 | Bacteria | 550 |
| 1286 | 2676478076 | 2675903058 | Bacteria | 6822861 |
| 1287 | 2753272057 | 2751185782 | Bacteria | 11227053 |
| 1288 | 2774393789 | 2773857762 | Bacteria | 5971770 |
| 1289 | 2809195335 | 2808606439 | Bacteria | 5952208 |
| 1290 | 2812350209 | 2811994878 | Bacteria | 5992952 |
| 1291 | 2827629406 | 2827628540 | Bacteria | 6858585 |
| 1292 | 2855387448 | 2855386786 | Bacteria | 4752232 |
| 1293 | 2883823597 | 2883821847 | Bacteria | 5121194 |
| 1294 | 2891972166 | 2891968417 | Bacteria | 5821697 |
| 1295 | 2897564570 | 2897561785 | Bacteria | 3256946 |
| 1296 | 2984577134 | 2984576629 | Bacteria | 4248407 |
| 1297 | 2990260455 | 2990256926 | Bacteria | 4252839 |
| 1298 | Ga0314311_1214342 | |||
| 1299 | LJQas_1004621 | |||
| 1300 | JGI24740J21852_10083557 | |||
| 1301 | JGI24739J22299_10103608 | |||
| 1302 | JGI24737J22298_10226241 | |||
| 1303 | JGI24737J22298_10251388 | |||
| 1304 | JGI24738J21930_10013118 | |||
| 1305 | JGI24738J21930_10031848 | |||
| 1306 | Ga0070658_10179980 | |||
| 1307 | Ga0070683_100001049 | |||
| 1308 | Ga0070683_100003297 | |||
| 1309 | Ga0070683_100025448 | |||
| 1310 | Ga0070683_100030750 | |||
| 1311 | Ga0070683_100044814 | |||
| 1312 | Ga0070683_100049206 | |||
| 1313 | Ga0070683_100143693 | |||
| 1314 | Ga0070683_100168821 | |||
| 1315 | Ga0070683_100179135 | |||
| 1316 | Ga0070683_100380727 | |||
| 1317 | Ga0070683_100436690 | |||
| 1318 | Ga0070683_100917085 | |||
| 1319 | Ga0070683_100989056 | |||
| 1320 | Ga0070670_100016510 | |||
| 1321 | Ga0068869_100118398 | |||
| 1322 | Ga0068869_101044449 | |||
| 1323 | Ga0070680_100025051 | |||
| 1324 | Ga0070682_100062861 | |||
| 1325 | Ga0070682_100357489 | |||
| 1326 | Ga0070682_101442825 | |||
| 1327 | Ga0068868_100066218 | |||
| 1328 | Ga0068868_100243399 | |||
| 1329 | Ga0068868_100847373 | |||
| 1330 | Ga0068868_101530381 | |||
| 1331 | Ga0070660_100302694 | |||
| 1332 | Ga0070660_100320104 | |||
| 1333 | Ga0070660_100348650 | |||
| 1334 | Ga0070660_100427520 | |||
| 1335 | Ga0070689_100435419 | |||
| 1336 | Ga0070689_100482017 | |||
| 1337 | Ga0070691_10007979 | |||
| 1338 | Ga0070691_10088069 | |||
| 1339 | Ga0070687_100056070 | |||
| 1340 | Ga0070661_100351675 | |||
| 1341 | Ga0070661_100424870 | |||
| 1342 | Ga0070661_100737249 | |||
| 1343 | Ga0070661_101763969 | |||
| 1344 | Ga0070692_10002528 | |||
| 1345 | Ga0070692_10497542 | |||
| 1346 | Ga0070692_10858717 | |||
| 1347 | Ga0070668_100000590 | |||
| 1348 | Ga0070668_100025560 | |||
| 1349 | Ga0070668_100254163 | |||
| 1350 | Ga0070668_100486686 | |||
| 1351 | Ga0070668_100681944 | |||
| 1352 | Ga0070669_100273624 | |||
| 1353 | Ga0070669_100592968 | |||
| 1354 | Ga0070675_100146644 | |||
| 1355 | Ga0070675_100208810 | |||
| 1356 | Ga0070671_100384235 | |||
| 1357 | Ga0070674_100099915 | |||
| 1358 | Ga0070674_100139306 | |||
| 1359 | Ga0070674_100182751 | |||
| 1360 | Ga0070674_100454636 | |||
| 1361 | Ga0070674_101395355 | |||
| 1362 | Ga0070688_101201689 | |||
| 1363 | Ga0070659_100017763 | |||
| 1364 | Ga0070659_100057950 | |||
| 1365 | Ga0070659_100330778 | |||
| 1366 | Ga0070659_100547078 | |||
| 1367 | Ga0070659_100709760 | |||
| 1368 | Ga0070659_100739122 | |||
| 1369 | Ga0070667_100852818 | |||
| 1370 | Ga0070714_100054083 | |||
| 1371 | Ga0070714_100597391 | |||
| 1372 | Ga0070714_100966826 | |||
| 1373 | Ga0070713_100016526 | |||
| 1374 | Ga0070713_101421663 | |||
| 1375 | Ga0070710_10301056 | |||
| 1376 | Ga0070700_100317301 | |||
| 1377 | Ga0070700_100396849 | |||
| 1378 | Ga0070700_101379467 | |||
| 1379 | Ga0070694_101312896 | |||
| 1380 | Ga0070708_100834914 | |||
| 1381 | Ga0070663_100201049 | |||
| 1382 | Ga0070663_100295609 | |||
| 1383 | Ga0070663_101254166 | |||
| 1384 | Ga0070678_100004765 | |||
| 1385 | Ga0070678_100361027 | |||
| 1386 | Ga0070678_100531435 | |||
| 1387 | Ga0070662_100069041 | |||
| 1388 | Ga0070662_100440541 | |||
| 1389 | Ga0070681_10023644 | |||
| 1390 | Ga0070681_10337392 | |||
| 1391 | Ga0070681_11936590 | |||
| 1392 | Ga0068867_100028221 | |||
| 1393 | Ga0068867_100550679 | |||
| 1394 | Ga0070685_10358055 | |||
| 1395 | Ga0070685_10557578 | |||
| 1396 | Ga0070706_100658583 | |||
| 1397 | Ga0070707_101034651 | |||
| 1398 | Ga0070698_100018611 | |||
| 1399 | Ga0070698_100340528 | |||
| 1400 | Ga0070699_100017915 | |||
| 1401 | Ga0070679_100026379 | |||
| 1402 | Ga0070679_100151610 | |||
| 1403 | Ga0070679_101335033 | |||
| 1404 | Ga0070684_100000789 | |||
| 1405 | Ga0070684_100001346 | |||
| 1406 | Ga0070684_100009409 | |||
| 1407 | Ga0070684_100017306 | |||
| 1408 | Ga0070684_100025677 | |||
| 1409 | Ga0070684_100112946 | |||
| 1410 | Ga0070684_100157631 | |||
| 1411 | Ga0070684_100158676 | |||
| 1412 | Ga0070684_100583236 | |||
| 1413 | Ga0070684_100773412 | |||
| 1414 | Ga0070684_100852822 | |||
| 1415 | Ga0070697_100087737 | |||
| 1416 | Ga0070697_100095055 | |||
| 1417 | Ga0068853_100958835 | |||
| 1418 | Ga0070672_100067473 | |||
| 1419 | Ga0070672_100429394 | |||
| 1420 | Ga0070672_100440768 | |||
| 1421 | Ga0070686_100010126 | |||
| 1422 | Ga0070686_100334120 | |||
| 1423 | Ga0070695_100068715 | |||
| 1424 | Ga0070695_100255484 | |||
| 1425 | Ga0070693_100006493 | |||
| 1426 | Ga0070665_100071496 | |||
| 1427 | Ga0070665_100132717 | |||
| 1428 | Ga0068855_100103863 | |||
| 1429 | Ga0068855_101955504 | |||
| 1430 | Ga0070664_100006150 | |||
| 1431 | Ga0070664_100012395 | |||
| 1432 | Ga0070664_101460601 | |||
| 1433 | Ga0068857_100000049 | |||
| 1434 | Ga0068857_100009622 | |||
| 1435 | Ga0068857_100066232 | |||
| 1436 | Ga0068857_100993192 | |||
| 1437 | Ga0068854_100295002 | |||
| 1438 | Ga0068854_101441923 | |||
| 1439 | Ga0068856_100001926 | |||
| 1440 | Ga0068856_100180096 | |||
| 1441 | Ga0068856_100373643 | |||
| 1442 | Ga0068856_100787675 | |||
| 1443 | Ga0068856_100915610 | |||
| 1444 | Ga0070702_100002194 | |||
| 1445 | Ga0068852_100010997 | |||
| 1446 | Ga0068852_100368523 | |||
| 1447 | Ga0068859_100375629 | |||
| 1448 | Ga0068864_100109881 | |||
| 1449 | Ga0068864_100336567 | |||
| 1450 | Ga0068866_10635385 | |||
| 1451 | Ga0068866_11123852 | |||
| 1452 | Ga0068861_100036348 | |||
| 1453 | Ga0068861_100096130 | |||
| 1454 | Ga0068861_100693417 | |||
| 1455 | Ga0068861_102547950 | |||
| 1456 | Ga0068851_10263679 | |||
| 1457 | Ga0068870_10008883 | |||
| 1458 | Ga0068870_10017164 | |||
| 1459 | Ga0068870_10179056 | |||
| 1460 | Ga0068863_101110377 | |||
| 1461 | Ga0068863_101276885 | |||
| 1462 | Ga0068858_100053466 | |||
| 1463 | Ga0068858_101246903 | |||
| 1464 | Ga0068860_100171471 | |||
| 1465 | Ga0068862_100028413 | |||
| 1466 | Ga0068862_100032567 | |||
| 1467 | Ga0068862_100200952 | |||
| 1468 | Ga0081455_10006745 | |||
| 1469 | Ga0081455_10009622 | |||
| 1470 | Ga0081455_10024299 | |||
| 1471 | Ga0081455_10043052 | |||
| 1472 | Ga0081455_10359689 | |||
| 1473 | Ga0081455_10551554 | |||
| 1474 | Ga0081538_10000991 | |||
| 1475 | Ga0081538_10026155 | |||
| 1476 | Ga0081540_1006355 | |||
| 1477 | Ga0081540_1168274 | |||
| 1478 | Ga0081539_10017208 | |||
| 1479 | Ga0081539_10019195 | |||
| 1480 | Ga0075365_10022170 | |||
| 1481 | Ga0075365_10050645 | |||
| 1482 | Ga0075365_10069991 | |||
| 1483 | Ga0075365_10080802 | |||
| 1484 | Ga0075365_10181775 | |||
| 1485 | Ga0075365_10205940 | |||
| 1486 | Ga0075365_10210768 | |||
| 1487 | Ga0075365_10248219 | |||
| 1488 | Ga0075365_10444527 | |||
| 1489 | Ga0075365_10488275 | |||
| 1490 | Ga0075365_10672344 | |||
| 1491 | Ga0075368_10001368 | |||
| 1492 | Ga0075368_10001555 | |||
| 1493 | Ga0075368_10104738 | |||
| 1494 | Ga0075363_100001987 | |||
| 1495 | Ga0075363_100016457 | |||
| 1496 | Ga0075363_100053059 | |||
| 1497 | Ga0075363_100121778 | |||
| 1498 | Ga0075363_100237034 | |||
| 1499 | Ga0075363_100388881 | |||
| 1500 | Ga0075363_100554717 | |||
| 1501 | Ga0075364_10030886 | |||
| 1502 | Ga0075364_10852332 | |||
| 1503 | Ga0075364_11037997 | |||
| 1504 | Ga0075432_10035480 | |||
| 1505 | Ga0075432_10265657 | |||
| 1506 | Ga0075432_10289166 | |||
| 1507 | Ga0070715_10085225 | |||
| 1508 | Ga0070712_101651969 | |||
| 1509 | Ga0075362_10072659 | |||
| 1510 | Ga0075362_10146917 | |||
| 1511 | Ga0075367_10016900 | |||
| 1512 | Ga0075367_10133466 | |||
| 1513 | Ga0075367_10181727 | |||
| 1514 | Ga0075367_10515624 | |||
| 1515 | Ga0097621_100245409 | |||
| 1516 | Ga0075370_10001859 | |||
| 1517 | Ga0075370_10013364 | |||
| 1518 | Ga0075370_10022023 | |||
| 1519 | Ga0075370_10099799 | |||
| 1520 | Ga0075370_10569323 | |||
| 1521 | Ga0068871_101844247 | |||
| 1522 | Ga0075428_100096948 | |||
| 1523 | Ga0075428_100228142 | |||
| 1524 | Ga0075428_100916187 | |||
| 1525 | Ga0075430_100031516 | |||
| 1526 | Ga0075430_100102275 | |||
| 1527 | Ga0075430_100157312 | |||
| 1528 | Ga0075431_100018073 | |||
| 1529 | Ga0075431_100072638 | |||
| 1530 | Ga0075431_100247833 | |||
| 1531 | Ga0075431_100552414 | |||
| 1532 | Ga0075431_100994343 | |||
| 1533 | Ga0075431_101057047 | |||
| 1534 | Ga0075433_10085696 | |||
| 1535 | Ga0075433_10317391 | |||
| 1536 | Ga0075433_10376719 | |||
| 1537 | Ga0075433_10680091 | |||
| 1538 | Ga0075434_100170226 | |||
| 1539 | Ga0075434_100217813 | |||
| 1540 | Ga0075434_100919081 | |||
| 1541 | Ga0075429_100065939 | |||
| 1542 | Ga0075429_100286470 | |||
| 1543 | Ga0075429_100329354 | |||
| 1544 | Ga0068865_100012214 | |||
| 1545 | Ga0068865_100128854 | |||
| 1546 | Ga0068865_100254447 | |||
| 1547 | Ga0068865_100291436 | |||
| 1548 | Ga0075436_100004843 | |||
| 1549 | Ga0075436_100578698 | |||
| 1550 | Ga0075436_100638549 | |||
| 1551 | Ga0097620_100375605 | |||
| 1552 | Ga0075435_100053694 | |||
| 1553 | Ga0075435_100056047 | |||
| 1554 | Ga0099794_10171359 | |||
| 1555 | Ga0111539_10054227 | |||
| 1556 | Ga0111539_10121948 | |||
| 1557 | Ga0111539_10267602 | |||
| 1558 | Ga0111539_10335191 | |||
| 1559 | Ga0111539_10688204 | |||
| 1560 | Ga0111539_10853940 | |||
| 1561 | Ga0105245_10009867 | |||
| 1562 | Ga0105245_10031744 | |||
| 1563 | Ga0105245_10056527 | |||
| 1564 | Ga0105245_10082688 | |||
| 1565 | Ga0105245_10101126 | |||
| 1566 | Ga0105245_10114068 | |||
| 1567 | Ga0105247_10574177 | |||
| 1568 | Ga0114129_10091089 | |||
| 1569 | Ga0114129_10105276 | |||
| 1570 | Ga0114129_10275863 | |||
| 1571 | Ga0114129_10687933 | |||
| 1572 | Ga0105243_10002686 | |||
| 1573 | Ga0105243_10012657 | |||
| 1574 | Ga0105243_10143096 | |||
| 1575 | Ga0105243_10240926 | |||
| 1576 | Ga0105243_10274301 | |||
| 1577 | Ga0105243_10285118 | |||
| 1578 | Ga0105243_10687605 | |||
| 1579 | Ga0105243_10912383 | |||
| 1580 | Ga0105243_11186688 | |||
| 1581 | Ga0105243_11208803 | |||
| 1582 | Ga0105243_12343996 | |||
| 1583 | Ga0105241_10274263 | |||
| 1584 | Ga0105241_11675978 | |||
| 1585 | Ga0105241_12247208 | |||
| 1586 | Ga0105242_10039331 | |||
| 1587 | Ga0105242_10521723 | |||
| 1588 | Ga0105248_10476678 | |||
| 1589 | Ga0105237_10078765 | |||
| 1590 | Ga0105237_11232872 | |||
| 1591 | Ga0105238_10268135 | |||
| 1592 | Ga0105238_10429507 | |||
| 1593 | Ga0105238_10595633 | |||
| 1594 | Ga0105238_10605407 | |||
| 1595 | Ga0105249_10037012 | |||
| 1596 | Ga0105249_10062217 | |||
| 1597 | Ga0105249_10590405 | |||
| 1598 | Ga0105249_10776232 | |||
| 1599 | Ga0105239_10249036 | |||
| 1600 | Ga0105239_10363856 | |||
| 1601 | Ga0105239_10381986 | |||
| 1602 | Ga0105246_10051047 | |||
| 1603 | Ga0105246_10199756 | |||
| 1604 | Ga0105246_10258746 | |||
| 1605 | Ga0105246_11102218 | |||
| 1606 | Ga0105246_11196627 | |||
| 1607 | Ga0157320_1031276 | |||
| 1608 | Ga0157325_1003308 | |||
| 1609 | Ga0157345_1006741 | |||
| 1610 | Ga0157313_1044403 | |||
| 1611 | Ga0157339_1035448 | |||
| 1612 | Ga0157316_1003846 | |||
| 1613 | Ga0157326_1010535 | |||
| 1614 | Ga0157371_10057438 | |||
| 1615 | Ga0157371_10133911 | |||
| 1616 | Ga0157371_10581890 | |||
| 1617 | Ga0157371_10690713 | |||
| 1618 | Ga0157370_10686886 | |||
| 1619 | Ga0157369_10007989 | |||
| 1620 | Ga0157369_10638235 | |||
| 1621 | Ga0157369_10986432 | |||
| 1622 | Ga0157369_11895579 | |||
| 1623 | Ga0157369_12172800 | |||
| 1624 | Ga0157374_10281602 | |||
| 1625 | Ga0157374_10473943 | |||
| 1626 | Ga0157378_10415366 | |||
| 1627 | Ga0157378_10995870 | |||
| 1628 | Ga0157378_11386105 | |||
| 1629 | Ga0163162_10023432 | |||
| 1630 | Ga0163162_10217897 | |||
| 1631 | Ga0163162_10626841 | |||
| 1632 | Ga0157372_10024844 | |||
| 1633 | Ga0157372_10043420 | |||
| 1634 | Ga0157372_10301443 | |||
| 1635 | Ga0157372_10569810 | |||
| 1636 | Ga0157372_11426029 | |||
| 1637 | Ga0157372_11446346 | |||
| 1638 | Ga0157372_12198257 | |||
| 1639 | Ga0157375_10321216 | |||
| 1640 | Ga0157375_10364197 | |||
| 1641 | Ga0157375_10775492 | |||
| 1642 | Ga0157375_12793632 | |||
| 1643 | Ga0163163_10924164 | |||
| 1644 | Ga0163163_11423726 | |||
| 1645 | Ga0163163_11731653 | |||
| 1646 | Ga0163163_12066327 | |||
| 1647 | Ga0163163_12233016 | |||
| 1648 | Ga0163163_12459500 | |||
| 1649 | Ga0157380_10019024 | |||
| 1650 | Ga0157380_10107939 | |||
| 1651 | Ga0157380_10135274 | |||
| 1652 | Ga0157380_10358833 | |||
| 1653 | Ga0157380_11604499 | |||
| 1654 | Ga0157380_12020099 | |||
| 1655 | Ga0182008_10157917 | |||
| 1656 | Ga0182008_10220361 | |||
| 1657 | Ga0182008_10445139 | |||
| 1658 | Ga0182008_10660180 | |||
| 1659 | Ga0157377_10055967 | |||
| 1660 | Ga0157377_10306734 | |||
| 1661 | Ga0157377_10363840 | |||
| 1662 | Ga0157379_10717617 | |||
| 1663 | Ga0157376_10575677 | |||
| 1664 | Ga0157376_11938530 | |||
| 1665 | Ga0163161_10010383 | |||
| 1666 | Ga0163161_10135627 | |||
| 1667 | Ga0206356_11902212 | |||
| 1668 | Ga0206349_1251648 | |||
| 1669 | Ga0206354_10753636 | |||
| 1670 | Ga0206354_11048389 | |||
| 1671 | Ga0206353_11655497 | |||
| 1672 | Ga0224712_10004575 | |||
| 1673 | Ga0224712_10005001 | |||
| 1674 | Ga0207697_10085522 | |||
| 1675 | Ga0207656_10572095 | |||
| 1676 | Ga0207692_10871216 | |||
| 1677 | Ga0207642_10107628 | |||
| 1678 | Ga0207642_10816027 | |||
| 1679 | Ga0207710_10566902 | |||
| 1680 | Ga0207688_10002263 | |||
| 1681 | Ga0207688_10006046 | |||
| 1682 | Ga0207688_10028851 | |||
| 1683 | Ga0207680_10395076 | |||
| 1684 | Ga0207647_10039538 | |||
| 1685 | Ga0207699_10083460 | |||
| 1686 | Ga0207643_10071100 | |||
| 1687 | Ga0207705_10081285 | |||
| 1688 | Ga0207705_10515648 | |||
| 1689 | Ga0207684_10547618 | |||
| 1690 | Ga0207654_10833390 | |||
| 1691 | Ga0207654_10852799 | |||
| 1692 | Ga0207707_10371994 | |||
| 1693 | Ga0207707_10698883 | |||
| 1694 | Ga0207707_10854964 | |||
| 1695 | Ga0207671_10087900 | |||
| 1696 | Ga0207671_10857000 | |||
| 1697 | Ga0207693_10220907 | |||
| 1698 | Ga0207693_10221956 | |||
| 1699 | Ga0207663_10253289 | |||
| 1700 | Ga0207660_10055167 | |||
| 1701 | Ga0207660_10062273 | |||
| 1702 | Ga0207662_10013678 | |||
| 1703 | Ga0207662_10676021 | |||
| 1704 | Ga0207657_10030451 | |||
| 1705 | Ga0207657_10326722 | |||
| 1706 | Ga0207657_10495530 | |||
| 1707 | Ga0207657_10525802 | |||
| 1708 | Ga0207649_10118853 | |||
| 1709 | Ga0207649_10309218 | |||
| 1710 | Ga0207649_10456386 | |||
| 1711 | Ga0207652_10028765 | |||
| 1712 | Ga0207652_10116794 | |||
| 1713 | Ga0207652_10182445 | |||
| 1714 | Ga0207652_10227168 | |||
| 1715 | Ga0207652_10410472 | |||
| 1716 | Ga0207681_10360947 | |||
| 1717 | Ga0207681_10600134 | |||
| 1718 | Ga0207694_10005510 | |||
| 1719 | Ga0207694_10274876 | |||
| 1720 | Ga0207694_10433437 | |||
| 1721 | Ga0207650_10005827 | |||
| 1722 | Ga0207650_10388986 | |||
| 1723 | Ga0207659_10107398 | |||
| 1724 | Ga0207659_10141318 | |||
| 1725 | Ga0207687_10010008 | |||
| 1726 | Ga0207687_10033318 | |||
| 1727 | Ga0207687_10050468 | |||
| 1728 | Ga0207687_10202442 | |||
| 1729 | Ga0207687_10804735 | |||
| 1730 | Ga0207687_11423877 | |||
| 1731 | Ga0207700_10057208 | |||
| 1732 | Ga0207700_11499021 | |||
| 1733 | Ga0207700_11622302 | |||
| 1734 | Ga0207664_10057502 | |||
| 1735 | Ga0207664_10516511 | |||
| 1736 | Ga0207690_10014913 | |||
| 1737 | Ga0207690_10143201 | |||
| 1738 | Ga0207690_11084159 | |||
| 1739 | Ga0207690_11229757 | |||
| 1740 | Ga0207706_10037907 | |||
| 1741 | Ga0207706_10198100 | |||
| 1742 | Ga0207706_10252454 | |||
| 1743 | Ga0207686_10009994 | |||
| 1744 | Ga0207709_10035006 | |||
| 1745 | Ga0207709_10052142 | |||
| 1746 | Ga0207709_10180746 | |||
| 1747 | Ga0207709_10235486 | |||
| 1748 | Ga0207709_10799803 | |||
| 1749 | Ga0207709_10968484 | |||
| 1750 | Ga0207670_10841485 | |||
| 1751 | Ga0207669_10349816 | |||
| 1752 | Ga0207669_10417421 | |||
| 1753 | Ga0207669_10576854 | |||
| 1754 | Ga0207669_11225694 | |||
| 1755 | Ga0207704_10045603 | |||
| 1756 | Ga0207704_10050681 | |||
| 1757 | Ga0207704_10232188 | |||
| 1758 | Ga0207704_10383057 | |||
| 1759 | Ga0207704_10475084 | |||
| 1760 | Ga0207691_10011852 | |||
| 1761 | Ga0207691_10133082 | |||
| 1762 | Ga0207691_10942234 | |||
| 1763 | Ga0207689_10212445 | |||
| 1764 | Ga0207689_10271054 | |||
| 1765 | Ga0207689_10444211 | |||
| 1766 | Ga0207661_10000292 | |||
| 1767 | Ga0207661_10001315 | |||
| 1768 | Ga0207661_10027515 | |||
| 1769 | Ga0207661_10036687 | |||
| 1770 | Ga0207661_10050549 | |||
| 1771 | Ga0207661_10110770 | |||
| 1772 | Ga0207661_10205996 | |||
| 1773 | Ga0207661_10489627 | |||
| 1774 | Ga0207661_10595872 | |||
| 1775 | Ga0207661_10615882 | |||
| 1776 | Ga0207661_10645936 | |||
| 1777 | Ga0207661_11450718 | |||
| 1778 | Ga0207679_10019263 | |||
| 1779 | Ga0207679_10059956 | |||
| 1780 | Ga0207679_10553327 | |||
| 1781 | Ga0207679_12006562 | |||
| 1782 | Ga0207679_12111295 | |||
| 1783 | Ga0207667_10345591 | |||
| 1784 | Ga0207667_11526411 | |||
| 1785 | Ga0207712_10014366 | |||
| 1786 | Ga0207712_10014929 | |||
| 1787 | Ga0207712_10061461 | |||
| 1788 | Ga0207712_11047001 | |||
| 1789 | Ga0207712_11577711 | |||
| 1790 | Ga0207668_10002263 | |||
| 1791 | Ga0207668_10010876 | |||
| 1792 | Ga0207668_10051446 | |||
| 1793 | Ga0207668_10380673 | |||
| 1794 | Ga0207668_10519808 | |||
| 1795 | Ga0207640_10260273 | |||
| 1796 | Ga0207640_11124208 | |||
| 1797 | Ga0207640_11419404 | |||
| 1798 | Ga0207658_10033125 | |||
| 1799 | Ga0207658_10355857 | |||
| 1800 | Ga0207677_10170045 | |||
| 1801 | Ga0207677_10183253 | |||
| 1802 | Ga0207677_10816032 | |||
| 1803 | Ga0207703_10022643 | |||
| 1804 | Ga0207639_10352173 | |||
| 1805 | Ga0207639_10964288 | |||
| 1806 | Ga0207639_11342263 | |||
| 1807 | Ga0207678_10433510 | |||
| 1808 | Ga0207678_10678639 | |||
| 1809 | Ga0207678_10982741 | |||
| 1810 | Ga0207708_10031287 | |||
| 1811 | Ga0207708_10136545 | |||
| 1812 | Ga0207708_10179081 | |||
| 1813 | Ga0207708_10521619 | |||
| 1814 | Ga0207702_10004483 | |||
| 1815 | Ga0207702_10011683 | |||
| 1816 | Ga0207702_10042588 | |||
| 1817 | Ga0207702_10230748 | |||
| 1818 | Ga0207702_10243829 | |||
| 1819 | Ga0207702_10252733 | |||
| 1820 | Ga0207702_10656184 | |||
| 1821 | Ga0207702_11784155 | |||
| 1822 | Ga0207702_12215730 | |||
| 1823 | Ga0207641_10067802 | |||
| 1824 | Ga0207641_11262039 | |||
| 1825 | Ga0207648_10001192 | |||
| 1826 | Ga0207648_10182214 | |||
| 1827 | Ga0207648_10881936 | |||
| 1828 | Ga0207676_10642841 | |||
| 1829 | Ga0207676_11493648 | |||
| 1830 | Ga0207676_11717879 | |||
| 1831 | Ga0207676_12096695 | |||
| 1832 | Ga0207674_10000027 | |||
| 1833 | Ga0207674_10012854 | |||
| 1834 | Ga0207674_10019122 | |||
| 1835 | Ga0207674_10048634 | |||
| 1836 | Ga0207674_10075250 | |||
| 1837 | Ga0207674_10138670 | |||
| 1838 | Ga0207674_11269742 | |||
| 1839 | Ga0207675_100014819 | |||
| 1840 | Ga0207675_100059029 | |||
| 1841 | Ga0207675_100141323 | |||
| 1842 | Ga0207675_100543637 | |||
| 1843 | Ga0207675_101732449 | |||
| 1844 | Ga0207683_10194119 | |||
| 1845 | Ga0207683_10209465 | |||
| 1846 | Ga0207683_10528320 | |||
| 1847 | Ga0207683_11500598 | |||
| 1848 | Ga0207698_10926901 | |||
| 1849 | Ga0207698_10933513 | |||
| 1850 | Ga0207698_11261418 | |||
| 1851 | Ga0209813_10005252 | |||
| 1852 | Ga0207428_10012230 | |||
| 1853 | Ga0207428_10469972 | |||
| 1854 | Ga0207428_10860312 | |||
| 1855 | Ga0268266_10176872 | |||
| 1856 | Ga0268265_10056093 | |||
| 1857 | Ga0268265_10127466 | |||
| 1858 | Ga0268265_11226714 | |||
| 1859 | Ga0268264_10017415 | |||
| 1860 | Ga0265318_10102930 | |||
| 1861 | Ga0265318_10274656 | |||
| 1862 | Ga0265323_10052471 | |||
| 1863 | Ga0265322_10023701 | |||
| 1864 | Ga0265338_10115954 | |||
| 1865 | Ga0307512_10114783 | |||
| 1866 | Ga0265330_10044072 | |||
| 1867 | Ga0265330_10152416 | |||
| 1868 | Ga0265330_10418761 | |||
| 1869 | Ga0265316_10017267 | |||
| 1870 | Ga0265316_10035843 | |||
| 1871 | Ga0265316_10061048 | |||
| 1872 | Ga0265316_10285801 | |||
| 1873 | Ga0307513_10233603 | |||
| 1874 | Ga0307509_10082273 | |||
| 1875 | Ga0307408_100552402 | |||
| 1876 | Ga0316579_10052161 | |||
| 1877 | Ga0265342_10056249 | |||
| 1878 | Ga0307516_10401940 | |||
| 1879 | Ga0307405_10316842 | |||
| 1880 | Ga0307405_10739712 | |||
| 1881 | Ga0307413_10299460 | |||
| 1882 | Ga0307413_10312710 | |||
| 1883 | Ga0307413_10490612 | |||
| 1884 | Ga0307413_11137079 | |||
| 1885 | Ga0307413_11922681 | |||
| 1886 | Ga0307410_10022477 | |||
| 1887 | Ga0307410_10249974 | |||
| 1888 | Ga0307410_10300626 | |||
| 1889 | Ga0307410_11473573 | |||
| 1890 | Ga0307406_10063424 | |||
| 1891 | Ga0307406_10514944 | |||
| 1892 | Ga0307406_10822107 | |||
| 1893 | Ga0307406_11117233 | |||
| 1894 | Ga0307407_10212672 | |||
| 1895 | Ga0307407_10217408 | |||
| 1896 | Ga0307407_10244438 | |||
| 1897 | Ga0307412_10161682 | |||
| 1898 | Ga0307412_10394074 | |||
| 1899 | Ga0307412_10441783 | |||
| 1900 | Ga0307412_11143876 | |||
| 1901 | Ga0307409_100124192 | |||
| 1902 | Ga0307409_100168873 | |||
| 1903 | Ga0307409_100272846 | |||
| 1904 | Ga0307409_100365689 | |||
| 1905 | Ga0307409_100389024 | |||
| 1906 | Ga0307409_100579575 | |||
| 1907 | Ga0307409_100835451 | |||
| 1908 | Ga0307409_101775356 | |||
| 1909 | Ga0307416_100023382 | |||
| 1910 | Ga0307416_100137620 | |||
| 1911 | Ga0307416_100288609 | |||
| 1912 | Ga0307416_100360582 | |||
| 1913 | Ga0307416_100385860 | |||
| 1914 | Ga0307416_101061357 | |||
| 1915 | Ga0307416_103161136 | |||
| 1916 | Ga0307414_11591185 | |||
| 1917 | Ga0307411_10269149 | |||
| 1918 | Ga0307411_10335696 | |||
| 1919 | Ga0307411_11447824 | |||
| 1920 | Ga0307415_100000363 | |||
| 1921 | Ga0307415_100040254 | |||
| 1922 | Ga0307415_100050810 | |||
| 1923 | Ga0307415_100574444 | |||
| 1924 | Ga0307415_100622039 | |||
| 1925 | Ga0307415_100899807 | |||
| 1926 | Ga0307415_101221536 | |||
| 1927 | Ga0307415_101316751 | |||
| 1928 | Ga0307415_102484971 | |||
| 1929 | Ga0307507_10039358 | |||
| 1930 | Ga0307507_10595500 | |||
| 1931 | Ga0373934_0345265 | |||
| 1932 | Ga0373944_0128757 | |||
| 1933 | Ga0373949_0061402 | |||
| 1934 | Ga0373939_0289817 | |||
| 1935 | Ga0373939_0320897 | |||
| 1936 | Ga0373939_0365292 | |||
| 1937 | Ga0373939_0433588 | |||
| 1938 | Ga0373941_0383856 | |||
| 1939 | Ga0373945_0383026 | |||
| 1940 | Ga0373953_0093415 | |||
| 1941 | Ga0373954_0003376 | |||
| 1942 | Ga0373954_0079232 | |||
| 1943 | Ga0373956_0000483 | |||
| 1944 | Ga0373956_0146200 | |||
| 1945 | Ga0373957_0140978 | |||
| 1946 | Ga0373960_0460596 | |||
| 1947 | Ga0373943_0170651 | |||
| 1948 | Ga0373943_0920636 | |||
| 1949 | Ga0373946_0424495 | |||
| 1950 | Ga0373955_0127866 | |||
| 1951 | Ga0373955_0380132 | |||
| 1952 | Ga0373924_0015464 | |||
| 1953 | Ga0373931_0068322 | |||
| 1954 | Ga0373931_0188109 | |||
| 1955 | Ga0373935_0016869 | |||
| 1956 | Ga0373935_0077935 | |||
| 1957 | Ga0373935_0332076 | |||
| 1958 | Ga0373927_0000026 | |||
| 1959 | Ga0373927_0013036 | |||
| 1960 | Ga0373933_0121480 | |||
| 1961 | Ga0373933_0445046 | |||
| 1962 | Ga0373933_0535113 | |||
| 1963 | Ga0373937_0259391 | |||
| 1964 | Ga0373937_0261652 | |||
| 1965 | Ga0373925_0004578 | |||
| 1966 | Ga0373925_0184635 | |||
| 1967 | Ga0395899_0008747 | |||
| 1968 | Ga0395899_0027813 | |||
| 1969 | Ga0395899_0028473 | |||
| 1970 | Ga0395899_0048504 | |||
| 1971 | Ga0395899_0049645 | |||
| 1972 | Ga0395899_0052120 | |||
| 1973 | Ga0395899_0181201 | |||
| 1974 | Ga0395899_0232637 | |||
| 1975 | Ga0395899_0278926 | |||
| 1976 | Ga0395899_0423233 | |||
| 1977 | Ga0395899_0424950 | |||
| 1978 | Ga0395899_0445100 | |||
| 1979 | Ga0395900_0012498 | |||
| 1980 | Ga0395900_0014497 | |||
| 1981 | Ga0395900_0031855 | |||
| 1982 | Ga0395900_0031891 | |||
| 1983 | Ga0395900_0040438 | |||
| 1984 | Ga0395900_0042133 | |||
| 1985 | Ga0395900_0044820 | |||
| 1986 | Ga0395900_0087556 | |||
| 1987 | Ga0395900_0088664 | |||
| 1988 | Ga0395900_0300108 | |||
| 1989 | Ga0395900_0314124 | |||
| 1990 | Ga0395900_0359191 | |||
| 1991 | Ga0395900_0631071 | |||
| 1992 | Ga0395900_0769122 | |||
| 1993 | Ga0395900_0863994 | |||
| 1994 | Ga0395900_0888385 | |||
| 1995 | Ga0395900_1068076 | |||
| 1996 | Ga0395900_1346382 | |||
| 1997 | Ga0395900_1705982 | |||
| 1998 | Ga0395900_1877267 | |||
| 1999 | Ga0395898_0004469 | |||
| 2000 | Ga0395898_0009356 | |||
| 2001 | Ga0395898_0029128 | |||
| 2002 | Ga0395898_0032676 | |||
| 2003 | Ga0395898_0051934 | |||
| 2004 | Ga0395898_0053677 | |||
| 2005 | Ga0395898_0054555 | |||
| 2006 | Ga0395898_0084710 | |||
| 2007 | Ga0395898_0122881 | |||
| 2008 | Ga0395898_0134414 | |||
| 2009 | Ga0395898_0143267 | |||
| 2010 | Ga0395898_0165363 | |||
| 2011 | Ga0395898_0209137 | |||
| 2012 | Ga0395898_0219518 | |||
| 2013 | Ga0395898_0354617 | |||
| 2014 | Ga0395898_0404311 | |||
| 2015 | Ga0395898_0587399 | |||
| 2016 | Ga0395898_0593404 | |||
| 2017 | Ga0395898_0862045 | |||
| 2018 | Ga0395898_0959807 | |||
| 2019 | Ga0395898_1042076 | |||
| 2020 | Ga0395905_0008922 | |||
| 2021 | Ga0395905_0012630 | |||
| 2022 | Ga0395905_0026626 | |||
| 2023 | Ga0395905_0073724 | |||
| 2024 | Ga0395905_0076192 | |||
| 2025 | Ga0395905_0101810 | |||
| 2026 | Ga0395905_0118770 | |||
| 2027 | Ga0395905_0145483 | |||
| 2028 | Ga0395905_0158118 | |||
| 2029 | Ga0395905_0334152 | |||
| 2030 | Ga0395905_0528340 | |||
| 2031 | Ga0395905_1405929 | |||
| 2032 | Ga0436364_0914540 | |||
| 2033 | Ga0436364_1241145 | |||
| 2034 | Ga0395901_0015770 | |||
| 2035 | Ga0395901_0025335 | |||
| 2036 | Ga0395901_0026746 | |||
| 2037 | Ga0395901_0031214 | |||
| 2038 | Ga0395901_0044370 | |||
| 2039 | Ga0395901_0103232 | |||
| 2040 | Ga0395901_0103360 | |||
| 2041 | Ga0395901_0105111 | |||
| 2042 | Ga0395901_0113988 | |||
| 2043 | Ga0395901_0226598 | |||
| 2044 | Ga0395901_0241540 | |||
| 2045 | Ga0395901_0291470 | |||
| 2046 | Ga0395901_0304917 | |||
| 2047 | Ga0395901_0379642 | |||
| 2048 | Ga0395901_0510225 | |||
| 2049 | Ga0395901_0556003 | |||
| 2050 | Ga0395901_0570620 | |||
| 2051 | Ga0395901_0608474 | |||
| 2052 | Ga0395901_1632410 | |||
| 2053 | Ga0436360_0319483 | |||
| 2054 | Ga0436363_0517822 | |||
| 2055 | Ga0451789_1250776 | |||
| 2056 | Ga0451793_0679931 | |||
| 2057 | Ga0451793_0701646 | |||
| 2058 | Ga0451793_0760524 | |||
| 2059 | Ga0451802_1134197 | |||
| 2060 | Ga0451806_401815 | |||
| 2061 | Ga0451833_0203593 | |||
| 2062 | Ga0451833_1359684 | |||
| 2063 | Ga0451833_1470194 | |||
| 2064 | Ga0451851_0158388 | |||
| 2065 | Ga0451843_0421537 | |||
| 2066 | Ga0451853_1584429 | |||
| 2067 | Ga0439448_0003027 | |||
| 2068 | Ga0439448_0113132 | |||
| 2069 | Ga0439448_0170091 | |||
| 2070 | Ga0439450_087044 | |||
| 2071 | Ga0439454_029482 | |||
| 2072 | Ga0439463_020240 | |||
| 2073 | Ga0450907_002740 | |||
| 2074 | Ga0439458_0006874 | |||
| 2075 | Ga0439444_0049133 | |||
| 2076 | Ga0439464_0223506 | |||
| 2077 | Ga0439460_0127504 | |||
| 2078 | Ga0451577_0829296 | |||
| 2079 | Ga0451577_1253805 | |||
| 2080 | Ga0439440_0040968 | |||
| 2081 | Ga0439440_0061932 | |||
| 2082 | Ga0466969_0042453 | |||
| 2083 | Ga0466969_0141291 | |||
| 2084 | Ga0466972_0006438 | |||
| 2085 | Ga0466965_0019736 | |||
| 2086 | Ga0466965_0104375 | |||
| 2087 | Ga0466965_0193136 | |||
| 2088 | Ga0466965_0300615 | |||
| 2089 | Ga0466965_0561479 | |||
| 2090 | Ga0466965_0619370 | |||
| 2091 | Ga0466965_0709244 | |||
| 2092 | Ga0466966_0018855 | |||
| 2093 | Ga0466966_0151904 | |||
| 2094 | Ga0466961_0011157 | |||
| 2095 | Ga0466961_0038925 | |||
| 2096 | Ga0466961_0711146 | |||
| 2097 | Ga0466963_0030288 | |||
| 2098 | Ga0466963_0035757 | |||
| 2099 | Ga0466963_0279868 | |||
| 2100 | Ga0466963_0330324 | |||
| 2101 | Ga0466963_0950244 | |||
| 2102 | Ga0466964_0031346 | |||
| 2103 | Ga0466971_0012142 | |||
| 2104 | Ga0466971_0077065 | |||
| 2105 | Ga0466971_0321859 | |||
| 2106 | Ga0466968_0066476 | |||
| 2107 | Ga0466970_0015868 | |||
| 2108 | Ga0466970_0016905 | |||
| 2109 | Ga0466970_0111610 | |||
| 2110 | Ga0466970_0235383 | |||
| 2111 | Ga0466970_0276217 | |||
| 2112 | Ga0466957_0008423 | |||
| 2113 | Ga0466957_0117329 | |||
| 2114 | Ga0466957_0325845 | |||
| 2115 | Ga0466957_0477600 | |||
| 2116 | Ga0466957_0867804 | |||
| 2117 | Ga0466960_0002889 | |||
| 2118 | Ga0466960_0021348 | |||
| 2119 | Ga0466960_0022406 | |||
| 2120 | Ga0466960_0045709 | |||
| 2121 | Ga0466960_0108854 | |||
| 2122 | Ga0466960_0137514 | |||
| 2123 | Ga0466960_0353594 | |||
| 2124 | Ga0466959_0010301 | |||
| 2125 | Ga0451576_0986570 | |||
| 2126 | Ga0466958_0025758 | |||
| 2127 | Ga0466958_0033899 | |||
| 2128 | Ga0466958_0066091 | |||
| 2129 | Ga0466958_0106717 | |||
| 2130 | Ga0466967_0010143 | |||
| 2131 | Ga0466967_0018278 | |||
| 2132 | Ga0466967_0058609 | |||
| 2133 | Ga0466967_0093387 | |||
| 2134 | Ga0466967_0236420 | |||
| 2135 | Ga0466967_0336901 | |||
| 2136 | Ga0466967_0375482 | |||
| 2137 | Ga0466967_0572052 | |||
| 2138 | Ga0466967_0709297 | |||
| 2139 | Ga0466967_0715582 | |||
| 2140 | Ga0466967_0931867 | |||
| 2141 | Ga0466967_1660923 | |||
| 2142 | Ga0495627_193887 | |||
| 2143 | Ga0495641_0038761 | |||
| 2144 | Ga0495651_0054830 | |||
| 2145 | Ga0495653_0192997 | |||
| 2146 | Ga0495653_0290604 | |||
| 2147 | Ga0495639_0139103 | |||
| 2148 | Ga0495662_0065101 | |||
| 2149 | Ga0495664_0319838 | |||
| 2150 | Ga0495664_0704810 | |||
| 2151 | Ga0495585_0053598 | |||
| 2152 | Ga0495585_0163977 | |||
| 2153 | Ga0495585_0552770 | |||
| 2154 | Ga0495585_0554174 | |||
| 2155 | Ga0495607_0094204 | |||
| 2156 | Ga0495608_0030998 | |||
| 2157 | Ga0495608_0304998 | |||
| 2158 | Ga0495610_0264581 | |||
| 2159 | Ga0495616_0065623 | |||
| 2160 | Ga0495618_0084575 | |||
| 2161 | Ga0495618_0579885 | |||
| 2162 | Ga0495620_0024782 | |||
| 2163 | Ga0495620_0035832 | |||
| 2164 | Ga0495620_0143016 | |||
| 2165 | Ga0495628_0128697 | |||
| 2166 | Ga0495628_0375780 | |||
| 2167 | Ga0495628_0592116 | |||
| 2168 | Ga0495630_0046763 | |||
| 2169 | Ga0495630_0503604 | |||
| 2170 | Ga0495632_0054499 | |||
| 2171 | Ga0495637_0115687 | |||
| 2172 | Ga0495637_0237979 | |||
| 2173 | Ga0495637_0289478 | |||
| 2174 | Ga0495643_0245107 | |||
| 2175 | Ga0495644_0048864 | |||
| 2176 | Ga0495663_0008525 | |||
| 2177 | Ga0495663_0133538 | |||
| 2178 | Ga0495663_0151040 | |||
| 2179 | Ga0495652_0042715 | |||
| 2180 | Ga0495652_0376672 | |||
| 2181 | Ga0495652_0813403 | |||
| 2182 | Ga0495665_0242361 | |||
| 2183 | Ga0495640_0119830 | |||
| 2184 | Ga0495586_0053744 | |||
| 2185 | Ga0495586_0179071 | |||
| 2186 | Ga0495587_0016874 | |||
| 2187 | Ga0495598_0095844 | |||
| 2188 | Ga0495609_0032246 | |||
| 2189 | Ga0495609_0222845 | |||
| 2190 | Ga0495597_0038400 | |||
| 2191 | Ga0495645_0230945 | |||
| 2192 | Ga0495667_0150892 | |||
| 2193 | Ga0495656_0072736 | |||
| 2194 | Ga0495656_0089799 | |||
| 2195 | Ga0495656_0096436 | |||
| 2196 | Ga0495668_0000213 | |||
| 2197 | Ga0495668_0700429 | |||
| 2198 | Ga0495634_0033635 | |||
| 2199 | Ga0495634_0382415 | |||
| 2200 | Ga0495611_0278366 | |||
| 2201 | Ga0495625_0002483 | |||
| 2202 | Ga0495625_0342464 | |||
| 2203 | Ga0495625_0359903 | |||
| 2204 | Ga0495625_0372461 | |||
| 2205 | Ga0495635_0068184 | |||
| 2206 | Ga0495635_0222850 | |||
| 2207 | Ga0495588_0327749 | |||
| 2208 | Ga0495657_0026841 | |||
| 2209 | Ga0495657_0234882 | |||
| 2210 | Ga0495599_0549853 | |||
| 2211 | Ga0495623_0018318 | |||
| 2212 | Ga0495646_0028847 | |||
| 2213 | Ga0495646_0487573 | |||
| 2214 | Ga0495647_0035839 | |||
| 2215 | Ga0495658_0096659 | |||
| 2216 | Ga0495669_0040586 | |||
| 2217 | Ga0495613_0425020 | |||
| 2218 | Ga0495613_0552720 | |||
| 2219 | Ga0495613_0740690 | |||
| 2220 | Ga0495624_0160392 | |||
| 2221 | Ga0495670_0096603 | |||
| 2222 | Ga0495670_0238932 | |||
| 2223 | Ga0495670_0528356 | |||
| 2224 | Ga0495671_0068006 | |||
| 2225 | Ga0495671_0189615 | |||
| 2226 | Ga0495589_0090451 | |||
| 2227 | Ga0495581_0051277 | |||
| 2228 | Ga0495581_0080318 | |||
| 2229 | Ga0495581_0446043 | |||
| 2230 | Ga0495604_0035414 | |||
| 2231 | Ga0495636_0154989 | |||
| 2232 | Ga0495674_0053641 | |||
| 2233 | Ga0495674_0107170 | |||
| 2234 | Ga0495674_0241664 | |||
| 2235 | Ga0495674_0352355 | |||
| 2236 | Ga0495674_0546633 | |||
| 2237 | Ga0495676_0074724 | |||
| 2238 | Ga0495676_0492617 | |||
| 2239 | Ga0495680_0014362 | |||
| 2240 | Ga0495680_0030936 | |||
| 2241 | Ga0495683_0398995 | |||
| 2242 | Ga0495683_0463278 | |||
| 2243 | Ga0495677_0100450 | |||
| 2244 | Ga0495679_061605 | |||
| 2245 | Ga0495684_0078704 | |||
| 2246 | Ga0495684_0167555 | |||
| 2247 | Ga0495593_0057991 | |||
| 2248 | Ga0495602_0047953 | |||
| 2249 | Ga0495626_0000656 | |||
| 2250 | Ga0495626_0130722 | |||
| 2251 | Ga0495626_0191205 | |||
| 2252 | Ga0496100_0578621 | |||
| 2253 | Ga0496100_0896681 | |||
| 2254 | Ga0496100_1395037 | |||
| 2255 | Ga0496101_0020254 | |||
| 2256 | Ga0496101_0072790 | |||
| 2257 | Ga0496101_0073914 | |||
| 2258 | Ga0496101_0328845 | |||
| 2259 | Ga0496101_0724929 | |||
| 2260 | Ga0496102_0175572 | |||
| 2261 | Ga0496102_0201154 | |||
| 2262 | Ga0496102_0272612 | |||
| 2263 | Ga0496102_0436712 | |||
| 2264 | Ga0496102_1614405 | |||
| 2265 | Ga0496103_0005348 | |||
| 2266 | Ga0496103_0056286 | |||
| 2267 | Ga0496104_0001713 | |||
| 2268 | Ga0496104_0014519 | |||
| 2269 | Ga0496104_0062575 | |||
| 2270 | Ga0496104_0366683 | |||
| 2271 | Ga0496104_0404531 | |||
| 2272 | Ga0496104_0508522 | |||
| 2273 | Ga0496104_1007726 | |||
| 2274 | Ga0496104_1242821 | |||
| 2275 | Ga0496105_0000128 | |||
| 2276 | Ga0496105_0105160 | |||
| 2277 | Ga0496105_0538936 | |||
| 2278 | Ga0496105_0741361 | |||
| 2279 | Ga0496105_0770002 | |||
| 2280 | Ga0496105_1259028 | |||
| 2281 | Ga0496106_0082392 | |||
| 2282 | Ga0496106_0623088 | |||
| 2283 | Ga0496106_1022245 | |||
| 2284 | Ga0496107_0188029 | |||
| 2285 | Ga0496107_0499459 | |||
| 2286 | Ga0496107_1003219 | |||
| 2287 | Ga0496108_0018761 | |||
| 2288 | Ga0496108_0024079 | |||
| 2289 | Ga0496108_0399103 | |||
| 2290 | Ga0496108_0478203 | |||
| 2291 | Ga0496108_0555613 | |||
| 2292 | Ga0496108_0587669 | |||
| 2293 | Ga0496108_0648051 | |||
| 2294 | Ga0496108_1454921 | |||
| 2295 | Ga0496109_0000408 | |||
| 2296 | Ga0496109_0008215 | |||
| 2297 | Ga0496109_0013354 | |||
| 2298 | Ga0496109_0062912 | |||
| 2299 | Ga0496109_0077537 | |||
| 2300 | Ga0496109_0081602 | |||
| 2301 | Ga0496109_0119303 | |||
| 2302 | Ga0496109_0598985 | |||
| 2303 | Ga0496109_0656158 | |||
| 2304 | Ga0496109_0806862 | |||
| 2305 | Ga0496110_0000289 | |||
| 2306 | Ga0496110_0000929 | |||
| 2307 | Ga0496110_0057708 | |||
| 2308 | Ga0496110_0077824 | |||
| 2309 | Ga0496110_0088894 | |||
| 2310 | Ga0496110_0123505 | |||
| 2311 | Ga0496110_0240830 | |||
| 2312 | Ga0496110_0263278 | |||
| 2313 | Ga0496110_0463663 | |||
| 2314 | Ga0496110_0493670 | |||
| 2315 | Ga0496110_0595659 | |||
| 2316 | Ga0496110_0678847 | |||
| 2317 | Ga0496110_1506529 | |||
| 2318 | Ga0496111_0000145 | |||
| 2319 | Ga0496111_0001006 | |||
| 2320 | Ga0496111_0007092 | |||
| 2321 | Ga0496111_0031569 | |||
| 2322 | Ga0496111_0163432 | |||
| 2323 | Ga0496111_0197416 | |||
| 2324 | Ga0496111_0229873 | |||
| 2325 | Ga0496111_0357146 | |||
| 2326 | Ga0496111_0723103 | |||
| 2327 | Ga0496111_0815489 | |||
| 2328 | Ga0496111_1057002 | |||
| 2329 | Ga0496111_1164809 | |||
| 2330 | Ga0496112_0061889 | |||
| 2331 | Ga0496112_0120442 | |||
| 2332 | Ga0496112_0164344 | |||
| 2333 | Ga0496112_0328138 | |||
| 2334 | Ga0496112_0687952 | |||
| 2335 | Ga0496112_1154516 | |||
| 2336 | Ga0496112_1162982 | |||
| 2337 | Ga0496113_0028768 | |||
| 2338 | Ga0496113_0230183 | |||
| 2339 | Ga0496113_0294524 | |||
| 2340 | Ga0496113_0296900 | |||
| 2341 | Ga0496113_0596492 | |||
| 2342 | Ga0496113_1590628 | |||
| 2343 | Ga0496114_0001039 | |||
| 2344 | Ga0496114_0002645 | |||
| 2345 | Ga0496114_0157750 | |||
| 2346 | Ga0496114_0725367 | |||
| 2347 | Ga0496114_1301120 | |||
| 2348 | Ga0496115_0011744 | |||
| 2349 | Ga0496115_0181771 | |||
| 2350 | Ga0496115_0246438 | |||
| 2351 | Ga0496115_0264092 | |||
| 2352 | Ga0496115_0925345 | |||
| 2353 | Ga0501031_0002307 | |||
| 2354 | Ga0501031_0047671 | |||
| 2355 | Ga0501031_0196187 | |||
| 2356 | Ga0501031_0437567 | |||
| 2357 | Ga0501032_0000134 | |||
| 2358 | Ga0501032_0128464 | |||
| 2359 | Ga0501033_0001709 | |||
| 2360 | Ga0501033_0222770 | |||
| 2361 | Ga0501034_0007950 | |||
| 2362 | Ga0501034_0783871 | |||
| 2363 | Ga0501036_0001932 | |||
| 2364 | Ga0501036_0147095 | |||
| 2365 | Ga0501036_0263232 | |||
| 2366 | Ga0501036_0574854 | |||
| 2367 | Ga0501036_0701283 | |||
| 2368 | Ga0501036_1729413 | |||
| 2369 | Ga0501037_0003907 | |||
| 2370 | Ga0501038_0000554 | |||
| 2371 | Ga0501038_0422444 | |||
| 2372 | Ga0501038_0490631 | |||
| 2373 | Ga0501039_0001152 | |||
| 2374 | Ga0501039_0006353 | |||
| 2375 | Ga0501039_0191731 | |||
| 2376 | Ga0501039_0467154 | |||
| 2377 | Ga0501039_0579079 | |||
| 2378 | Ga0501039_0615944 | |||
| 2379 | Ga0501040_0012064 | |||
| 2380 | Ga0501040_0306054 | |||
| 2381 | Ga0501040_0434227 | |||
| 2382 | Ga0501041_0041904 | |||
| 2383 | Ga0501041_0054234 | |||
| 2384 | Ga0501041_0219842 | |||
| 2385 | Ga0501041_0350506 | |||
| 2386 | Ga0501041_0607933 | |||
| 2387 | Ga0501041_0709541 | |||
| 2388 | Ga0501042_0107309 | |||
| 2389 | Ga0501042_0148959 | |||
| 2390 | Ga0501042_0347159 | |||
| 2391 | Ga0501042_0535152 | |||
| 2392 | Ga0501042_1234789 | |||
| 2393 | Ga0501043_0002482 | |||
| 2394 | Ga0501046_0000172 | |||
| 2395 | Ga0501046_0489161 | |||
| 2396 | Ga0501047_0000114 | |||
| 2397 | Ga0501047_0026206 | |||
| 2398 | Ga0501048_0003343 | |||
| 2399 | Ga0501048_0113221 | |||
| 2400 | Ga0501048_0198473 | |||
| 2401 | Ga0501048_0872779 | |||
| 2402 | Ga0501067_0030285 | |||
| 2403 | Ga0501067_0198789 | |||
| 2404 | Ga0501067_0231537 | |||
| 2405 | Ga0501068_0706426 | |||
| 2406 | Ga0501069_0064048 | |||
| 2407 | Ga0501069_0170130 | |||
| 2408 | Ga0501069_0216927 | |||
| 2409 | Ga0501069_0313982 | |||
| 2410 | Ga0501069_0399708 | |||
| 2411 | Ga0501070_0000900 | |||
| 2412 | Ga0501070_0015519 | |||
| 2413 | Ga0501070_0190788 | |||
| 2414 | Ga0501070_0324105 | |||
| 2415 | Ga0501070_0710350 | |||
| 2416 | Ga0501071_0007623 | |||
| 2417 | Ga0501071_0303278 | |||
| 2418 | Ga0501071_0510957 | |||
| 2419 | Ga0501071_1442347 | |||
| 2420 | Ga0501072_0033399 | |||
| 2421 | Ga0501072_0103584 | |||
| 2422 | Ga0501072_0183886 | |||
| 2423 | Ga0501072_0541297 | |||
| 2424 | Ga0501072_1181494 | |||
| 2425 | Ga0501073_0003847 | |||
| 2426 | Ga0501073_0035211 | |||
| 2427 | Ga0501074_0002120 | |||
| 2428 | Ga0501074_0129821 | |||
| 2429 | Ga0501074_0220722 | |||
| 2430 | Ga0501074_0281730 | |||
| 2431 | Ga0501074_0362678 | |||
| 2432 | Ga0501074_0598980 | |||
| 2433 | Ga0501075_0051304 | |||
| 2434 | Ga0501075_0323065 | |||
| 2435 | Ga0501075_1301713 | |||
| 2436 | Ga0501076_0017143 | |||
| 2437 | Ga0501076_0100627 | |||
| 2438 | Ga0501076_0168107 | |||
| 2439 | Ga0501076_0571824 | |||
| 2440 | Ga0501076_0979547 | |||
| 2441 | Ga0501076_1179299 | |||
| 2442 | Ga0501077_0005556 | |||
| 2443 | Ga0501077_0059995 | |||
| 2444 | Ga0501077_0691637 | |||
| 2445 | Ga0501077_0692550 | |||
| 2446 | Ga0501250_089778 | |||
| 2447 | Ga0501079_0013295 | |||
| 2448 | Ga0501079_0170911 | |||
| 2449 | Ga0501079_0505551 | |||
| 2450 | Ga0501079_0789404 | |||
| 2451 | Ga0501079_0830253 | |||
| 2452 | Ga0501080_0001104 | |||
| 2453 | Ga0501080_0216037 | |||
| 2454 | Ga0501080_0282827 | |||
| 2455 | Ga0501080_0339022 | |||
| 2456 | Ga0501081_0014542 | |||
| 2457 | Ga0501081_0198462 | |||
| 2458 | Ga0501083_0005006 | |||
| 2459 | Ga0501035_0019227 | |||
| 2460 | Ga0501044_0015622 | |||
| 2461 | Ga0501044_0673078 | |||
| 2462 | Ga0501045_0006569 | |||
| 2463 | Ga0501045_0036943 | |||
| 2464 | Ga0501045_0223990 | |||
| 2465 | Ga0501045_0248864 | |||
| 2466 | Ga0501045_0772180 | |||
| 2467 | Ga0501045_1089641 | |||
| 2468 | Ga0501045_1106754 | |||
| 2469 | nmdc:mga03683_257529_c1 | |||
| 2470 | nmdc:mga03683_33954_c1 | |||
| 2471 | nmdc:mga03n38_141078_c1 | |||
| 2472 | nmdc:mga03n38_167176_c1 | |||
| 2473 | nmdc:mga03n38_199216_c1 | |||
| 2474 | nmdc:mga03n38_403334_c1 | |||
| 2475 | nmdc:mga03n38_530857_c1 | |||
| 2476 | nmdc:mga03n38_88502_c1 | |||
| 2477 | nmdc:mga00v17_121058_c1 | |||
| 2478 | nmdc:mga00v17_1324_c1 | |||
| 2479 | nmdc:mga00v17_152907_c1 | |||
| 2480 | nmdc:mga00v17_18888_c1 | |||
| 2481 | nmdc:mga00v17_236298_c1 | |||
| 2482 | nmdc:mga00v17_283426_c1 | |||
| 2483 | nmdc:mga00v17_634318_c1 | |||
| 2484 | nmdc:mga00v17_65716_c1 | |||
| 2485 | nmdc:mga0yw44_114768_c1 | |||
| 2486 | nmdc:mga0yw44_251337_c1 | |||
| 2487 | nmdc:mga0yw44_271420_c1 | |||
| 2488 | nmdc:mga0yw44_283991_c1 | |||
| 2489 | nmdc:mga0yw44_437849_c1 | |||
| 2490 | nmdc:mga0yw44_438389_c1 | |||
| 2491 | nmdc:mga0yw44_45624_c1 | |||
| 2492 | nmdc:mga0yw44_47916_c1 | |||
| 2493 | nmdc:mga0yw44_541547_c1 | |||
| 2494 | nmdc:mga0yw44_57947_c1 | |||
| 2495 | nmdc:mga0yw44_656347_c1 | |||
| 2496 | nmdc:mga0yw44_790032_c1 | |||
| 2497 | nmdc:mga0yw44_79644_c1 | |||
| 2498 | nmdc:mga06z11_1030775_c1 | |||
| 2499 | nmdc:mga06z11_192020_c1 | |||
| 2500 | nmdc:mga06z11_22558_c1 | |||
| 2501 | nmdc:mga06z11_800748_c1 | |||
| 2502 | nmdc:mga04h51_57812_c1 | |||
| 2503 | nmdc:mga04h51_5950_c1 | |||
| 2504 | nmdc:mga07m45_21108_c1 | |||
| 2505 | nmdc:mga07m45_39082_c1 | |||
| 2506 | nmdc:mga07m45_9783_c1 | |||
| 2507 | nmdc:mga05p37_30566_c1 | |||
| 2508 | nmdc:mga05p37_43526_c1 | |||
| 2509 | nmdc:mga05p37_471850_c1 | |||
| 2510 | nmdc:mga05p37_528306_c1 | |||
| 2511 | nmdc:mga05p37_714463_c1 | |||
| 2512 | nmdc:mga09592_1105801_c1 | |||
| 2513 | nmdc:mga09592_392815_c1 | |||
| 2514 | nmdc:mga09592_609531_c1 | |||
| 2515 | nmdc:mga0qj67_147773_c1 | |||
| 2516 | nmdc:mga0qj67_70349_c1 | |||
| 2517 | nmdc:mga06r32_133121_c1 | |||
| 2518 | nmdc:mga06r32_205405_c1 | |||
| 2519 | nmdc:mga06r32_77962_c1 | |||
| 2520 | nmdc:mga06r32_9581_c1 | |||
| 2521 | nmdc:mga08y16_129918_c1 | |||
| 2522 | nmdc:mga08y16_141711_c1 | |||
| 2523 | nmdc:mga08y16_226021_c1 | |||
| 2524 | nmdc:mga08y16_275565_c1 | |||
| 2525 | nmdc:mga08y16_486399_c1 | |||
| 2526 | nmdc:mga08y16_533353_c1 | |||
| 2527 | nmdc:mga08y16_794814_c1 | |||
| 2528 | nmdc:mga0n895_104241_c1 | |||
| 2529 | nmdc:mga0n895_1211584_c1 | |||
| 2530 | nmdc:mga0n895_1683238_c1 | |||
| 2531 | nmdc:mga0n895_1845956_c1 | |||
| 2532 | nmdc:mga0n895_190576_c1 | |||
| 2533 | nmdc:mga0n895_1920765_c1 | |||
| 2534 | nmdc:mga0n895_214736_c1 | |||
| 2535 | nmdc:mga0n895_383324_c1 | |||
| 2536 | nmdc:mga0rr50_141946_c1 | |||
| 2537 | nmdc:mga0rr50_147991_c1 | |||
| 2538 | nmdc:mga0rr50_31543_c1 | |||
| 2539 | nmdc:mga0rr50_710683_c1 | |||
| 2540 | nmdc:mga0rr50_760464_c1 | |||
| 2541 | nmdc:mga08x19_429010_c1 | |||
| 2542 | nmdc:mga08x19_83931_c1 | |||
| 2543 | nmdc:mga0a205_137521_c1 | |||
| 2544 | nmdc:mga0a205_272355_c1 | |||
| 2545 | nmdc:mga0a205_364882_c1 | |||
| 2546 | nmdc:mga0a205_42279_c1 | |||
| 2547 | nmdc:mga0a205_711211_c1 | |||
| 2548 | Ga0495601_0029525 | |||
| 2549 | Ga0495601_0681841 | |||
| 2550 | Ga0495612_0090725 | |||
| 2551 | Ga0495655_0068085 | |||
| 2552 | Ga0495655_0160911 | |||
| 2553 | Ga0495595_0025928 | |||
| 2554 | Ga0495595_0101381 | |||
| 2555 | Ga0495619_0064871 | |||
| 2556 | Ga0495619_0175690 | |||
| 2557 | Ga0495619_0259114 | |||
| 2558 | Ga0500644_0000128 | |||
| 2559 | Ga0500644_0108472 | |||
| 2560 | Ga0500554_212052 | |||
| 2561 | Ga0500556_0001240 | |||
| 2562 | Ga0500573_0312601 | |||
| 2563 | Ga0501084_0000711 | |||
| 2564 | Ga0501084_0283508 | |||
| 2565 | Ga0501084_0429605 | |||
| 2566 | Ga0501084_0481626 | |||
| 2567 | Ga0501084_1704488 | |||
| 2568 | Ga0501082_0055233 | |||
| 2569 | Ga0501082_0334723 | |||
| 2570 | Ga0501082_0483830 | |||
| 2571 | Ga0501082_0664487 | |||
| 2572 | Ga0501082_0664824 | |||
| 2573 | Ga0501082_0711522 | |||
| 2574 | Ga0501082_0861008 | |||
| 2575 | Ga0501082_1740424 | |||
| 2576 | Ga0466962_0001251 | |||
| 2577 | Ga0466962_0062724 | |||
| 2578 | Ga0466962_0754083 | |||
| 2579 | Ga0530510_0046945 | |||
| 2580 | Ga0530510_0055215 | |||
| 2581 | Ga0530510_0103335 | |||
| 2582 | Ga0530510_1334357 | |||
| 2583 | 2676478076 | |||
| 2584 | 2753272057 | |||
| 2585 | 2774393789 | |||
| 2586 | 2809195335 | |||
| 2587 | 2812350209 | |||
| 2588 | 2827629406 | |||
| 2589 | 2855387448 | |||
| 2590 | 2883823597 | |||
| 2591 | 2891972166 | |||
| 2592 | 2897564570 | |||
| 2593 | 2984577134 | |||
| 2594 | 2990260455 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ay1-assembly5.cif.gz_E | crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori | 0.9908 | 4 | 133 |
| 3vvu-assembly1.cif.gz_A | crystal structure of reconstructed bacterial ancestral ndk, bac1 | 0.9876 | 4 | 133 |
| 6joh-assembly3.cif.gz_I | the crystal of nucleoside diphosphate kinase from aspergillus flavus | 0.9869 | 4 | 133 |
| 1ndk-assembly1.cif.gz_A | x-ray structure of nucleoside diphosphate kinase | 0.9868 | 4 | 133 |
| 2nck-assembly1.cif.gz_R | crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution | 0.9868 | 2 | 133 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_C6T4F9_81_235_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9887 | 3 | 133 | 3.30.70.141 |
| af_A0A1D6EH51_54_191_3.30.70.141 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9865 | 21 | 133 | 3.30.70.141 |
| 1k44A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.985 | 4 | 136 | 3.30.70.141 |
| 4w98A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9786 | 1 | 133 | 3.30.70.141 |
| 6ay1G00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain | 0.9781 | 4 | 133 | 3.30.70.141 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-Q6A9I7-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 0.9986 | 3 | 134 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A810MV00-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 0.9983 | 3 | 134 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A1H1XVF1-F1-model_v4 | Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) | 0.9976 | 3 | 134 |
GO:0004550
GO:0005524 GO:0005737 GO:0006183 GO:0006228 GO:0006241 GO:0046872 |
| AF-A0A4R6LSG3-F1-model_v4 | deleted | 0.9968 | 1 | 136 |
|
| AF-A0A542T7V1-F1-model_v4 | deleted | 0.9967 | 3 | 135 |
|