F492704

General Info

Members Datasets Scaffolds Average Seq Length
1297 442 2594 138

Family's Representative Sequence

Representative Sequence 3300030733|Ga0314311_1214342|Ga0314311_12143421
Length 158
Sequence VADKGTAATGPNVPAPARPDTLGPMTQRTFVILKPDAVRRGLVGEILSRYEAKGLSIVKLEHRTIDAGMADEHYAEHVEQPWYPPLRDFVTSGPLVAAVLEGDEAIEVVRALNGATDGRKAAPGTIRGDFSLSNRENLVHGSDSPESADREIKLWFGA

Samples

Sample ID Description Type Environment
1 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
111 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
112 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
113 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
114 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
115 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
116 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
201 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
202 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
203 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
204 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
205 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
225 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
234 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
235 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
247 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
248 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
254 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
255 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
256 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
257 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
258 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
259 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
260 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
263 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
264 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
265 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
266 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
267 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
268 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
269 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
270 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
271 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
272 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
273 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
274 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
275 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
276 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
277 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
278 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
279 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
280 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
281 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
282 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
283 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
284 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
287 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
288 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
289 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
290 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
291 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
292 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
298 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
299 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
300 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
303 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
304 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
308 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
309 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
310 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
311 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
312 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
313 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
314 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
315 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
316 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
317 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
318 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
319 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
320 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
321 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
322 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
323 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
324 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
325 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
328 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
329 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
330 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
331 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
332 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
333 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
334 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
335 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
336 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
337 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
338 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
339 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
340 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
341 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
344 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
345 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
346 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
347 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
352 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
353 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
354 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
355 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
356 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
357 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
360 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
361 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
362 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
363 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
364 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
365 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
366 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
367 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
381 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
384 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
385 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
386 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
387 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
388 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
389 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
390 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
391 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
392 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
393 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
394 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
395 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
396 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
397 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
398 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
399 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
401 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
402 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
403 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
404 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
405 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
406 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
407 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
408 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
409 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
410 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
411 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
412 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
413 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
414 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
415 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
416 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
417 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
418 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
419 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
420 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
421 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
422 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
423 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
424 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
425 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
426 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
427 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
428 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
429 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
430 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
431 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
432 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
433 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
434 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
435 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
436 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
437 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
438 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
439 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
440 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
441 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
442 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 98.54
Metatranscriptomes 0.54
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.15
Bulb 0
Endosphere 6.09
Nodule 0
Rhizoplane 8.25
Rhizosphere 83.89
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0314311_1214342 3300030733 Bacteria 1133
2 LJQas_1004621 3300000549 Bacteria 1783
3 JGI24740J21852_10083557 3300001979 Bacteria 833
4 JGI24739J22299_10103608 3300001989 Bacteria 857
5 JGI24737J22298_10226241 3300001990 Bacteria 552
6 JGI24737J22298_10251388 3300001990 Bacteria 522
7 JGI24738J21930_10013118 3300002075 Bacteria 1797
8 JGI24738J21930_10031848 3300002075 Bacteria 1075
9 Ga0070658_10179980 3300005327 Bacteria 1779
10 Ga0070683_100001049 3300005329 Bacteria 20741
11 Ga0070683_100003297 3300005329 Bacteria 13045
12 Ga0070683_100025448 3300005329 Bacteria 5315
13 Ga0070683_100030750 3300005329 Bacteria 4878
14 Ga0070683_100044814 3300005329 Bacteria 4080
15 Ga0070683_100049206 3300005329 Bacteria 3898
16 Ga0070683_100143693 3300005329 Bacteria 2260
17 Ga0070683_100168821 3300005329 Bacteria 2076
18 Ga0070683_100179135 3300005329 Bacteria 2012
19 Ga0070683_100380727 3300005329 Bacteria 1345
20 Ga0070683_100436690 3300005329 Bacteria 1249
21 Ga0070683_100917085 3300005329 Bacteria 840
22 Ga0070683_100989056 3300005329 Bacteria 807
23 Ga0070670_100016510 3300005331 Bacteria 6338
24 Ga0068869_100118398 3300005334 Bacteria 2023
25 Ga0068869_101044449 3300005334 Bacteria 713
26 Ga0070680_100025051 3300005336 Bacteria 4769
27 Ga0070682_100062861 3300005337 Bacteria 2352
28 Ga0070682_100357489 3300005337 Bacteria 1091
29 Ga0070682_101442825 3300005337 Bacteria 590
30 Ga0068868_100066218 3300005338 Bacteria 2871
31 Ga0068868_100243399 3300005338 Bacteria 1512
32 Ga0068868_100847373 3300005338 Bacteria 828
33 Ga0068868_101530381 3300005338 Bacteria 625
34 Ga0070660_100302694 3300005339 Bacteria 1311
35 Ga0070660_100320104 3300005339 Bacteria 1274
36 Ga0070660_100348650 3300005339 Bacteria 1219
37 Ga0070660_100427520 3300005339 Bacteria 1097
38 Ga0070689_100435419 3300005340 Bacteria 1113
39 Ga0070689_100482017 3300005340 Bacteria 1060
40 Ga0070691_10007979 3300005341 Bacteria 4841
41 Ga0070691_10088069 3300005341 Bacteria 1528
42 Ga0070687_100056070 3300005343 Bacteria 2061
43 Ga0070661_100351675 3300005344 Bacteria 1156
44 Ga0070661_100424870 3300005344 Bacteria 1054
45 Ga0070661_100737249 3300005344 Bacteria 805
46 Ga0070661_101763969 3300005344 Bacteria 525
47 Ga0070692_10002528 3300005345 Bacteria 7113
48 Ga0070692_10497542 3300005345 Bacteria 789
49 Ga0070692_10858717 3300005345 Bacteria 624
50 Ga0070668_100000590 3300005347 Bacteria 24324
51 Ga0070668_100025560 3300005347 Bacteria 4478
52 Ga0070668_100254163 3300005347 Bacteria 1460
53 Ga0070668_100486686 3300005347 Bacteria 1066
54 Ga0070668_100681944 3300005347 Bacteria 905
55 Ga0070669_100273624 3300005353 Bacteria 1351
56 Ga0070669_100592968 3300005353 Bacteria 928
57 Ga0070675_100146644 3300005354 Bacteria 2021
58 Ga0070675_100208810 3300005354 Bacteria 1697
59 Ga0070671_100384235 3300005355 Bacteria 1200
60 Ga0070674_100099915 3300005356 Bacteria 2112
61 Ga0070674_100139306 3300005356 Bacteria 1819
62 Ga0070674_100182751 3300005356 Bacteria 1608
63 Ga0070674_100454636 3300005356 Bacteria 1058
64 Ga0070674_101395355 3300005356 Bacteria 627
65 Ga0070688_101201689 3300005365 Bacteria 609
66 Ga0070659_100017763 3300005366 Bacteria 5357
67 Ga0070659_100057950 3300005366 Bacteria 3055
68 Ga0070659_100330778 3300005366 Bacteria 1275
69 Ga0070659_100547078 3300005366 Bacteria 991
70 Ga0070659_100709760 3300005366 Bacteria 870
71 Ga0070659_100739122 3300005366 Bacteria 853
72 Ga0070667_100852818 3300005367 Bacteria 847
73 Ga0070714_100054083 3300005435 Bacteria 3429
74 Ga0070714_100597391 3300005435 Bacteria 1060
75 Ga0070714_100966826 3300005435 Bacteria 828
76 Ga0070713_100016526 3300005436 Bacteria 5549
77 Ga0070713_101421663 3300005436 Bacteria 673
78 Ga0070710_10301056 3300005437 Bacteria 1047
79 Ga0070700_100317301 3300005441 Bacteria 1144
80 Ga0070700_100396849 3300005441 Bacteria 1036
81 Ga0070700_101379467 3300005441 Bacteria 595
82 Ga0070694_101312896 3300005444 Bacteria 609
83 Ga0070708_100834914 3300005445 Bacteria 866
84 Ga0070663_100201049 3300005455 Bacteria 1555
85 Ga0070663_100295609 3300005455 Bacteria 1295
86 Ga0070663_101254166 3300005455 Bacteria 653
87 Ga0070678_100004765 3300005456 Bacteria 7738
88 Ga0070678_100361027 3300005456 Bacteria 1252
89 Ga0070678_100531435 3300005456 Bacteria 1042
90 Ga0070662_100069041 3300005457 Bacteria 2600
91 Ga0070662_100440541 3300005457 Bacteria 1080
92 Ga0070681_10023644 3300005458 Bacteria 6183
93 Ga0070681_10337392 3300005458 Bacteria 1417
94 Ga0070681_11936590 3300005458 Bacteria 517
95 Ga0068867_100028221 3300005459 Bacteria 4040
96 Ga0068867_100550679 3300005459 Bacteria 999
97 Ga0070685_10358055 3300005466 Bacteria 1000
98 Ga0070685_10557578 3300005466 Bacteria 819
99 Ga0070706_100658583 3300005467 Bacteria 972
100 Ga0070707_101034651 3300005468 Bacteria 787
101 Ga0070698_100018611 3300005471 Bacteria 7312
102 Ga0070698_100340528 3300005471 Bacteria 1431
103 Ga0070699_100017915 3300005518 Archaea 6082
104 Ga0070679_100026379 3300005530 Bacteria 5707
105 Ga0070679_100151610 3300005530 Bacteria 2294
106 Ga0070679_101335033 3300005530 Bacteria 663
107 Ga0070684_100000789 3300005535 Bacteria 21987
108 Ga0070684_100001346 3300005535 Bacteria 17608
109 Ga0070684_100009409 3300005535 Bacteria 7694
110 Ga0070684_100017306 3300005535 Bacteria 5912
111 Ga0070684_100025677 3300005535 Bacteria 4955
112 Ga0070684_100112946 3300005535 Bacteria 2437
113 Ga0070684_100157631 3300005535 Bacteria 2058
114 Ga0070684_100158676 3300005535 Bacteria 2051
115 Ga0070684_100583236 3300005535 Bacteria 1039
116 Ga0070684_100773412 3300005535 Bacteria 897
117 Ga0070684_100852822 3300005535 Bacteria 853
118 Ga0070697_100087737 3300005536 Archaea 2569
119 Ga0070697_100095055 3300005536 Archaea 2470
120 Ga0068853_100958835 3300005539 Bacteria 823
121 Ga0070672_100067473 3300005543 Bacteria 2834
122 Ga0070672_100429394 3300005543 Bacteria 1136
123 Ga0070672_100440768 3300005543 Bacteria 1121
124 Ga0070686_100010126 3300005544 Bacteria 5306
125 Ga0070686_100334120 3300005544 Bacteria 1134
126 Ga0070695_100068715 3300005545 Archaea 2314
127 Ga0070695_100255484 3300005545 Bacteria 1277
128 Ga0070693_100006493 3300005547 Bacteria 5670
129 Ga0070665_100071496 3300005548 Bacteria 3476
130 Ga0070665_100132717 3300005548 Bacteria 2492
131 Ga0068855_100103863 3300005563 Bacteria 3269
132 Ga0068855_101955504 3300005563 Bacteria 593
133 Ga0070664_100006150 3300005564 Bacteria 9705
134 Ga0070664_100012395 3300005564 Bacteria 6928
135 Ga0070664_101460601 3300005564 Bacteria 647
136 Ga0068857_100000049 3300005577 Bacteria 66755
137 Ga0068857_100009622 3300005577 Bacteria 8397
138 Ga0068857_100066232 3300005577 Bacteria 3213
139 Ga0068857_100993192 3300005577 Bacteria 808
140 Ga0068854_100295002 3300005578 Bacteria 1310
141 Ga0068854_101441923 3300005578 Bacteria 623
142 Ga0068856_100001926 3300005614 Bacteria 21640
143 Ga0068856_100180096 3300005614 Bacteria 2126
144 Ga0068856_100373643 3300005614 Bacteria 1444
145 Ga0068856_100787675 3300005614 Bacteria 971
146 Ga0068856_100915610 3300005614 Bacteria 896
147 Ga0070702_100002194 3300005615 Bacteria 8319
148 Ga0068852_100010997 3300005616 Bacteria 6788
149 Ga0068852_100368523 3300005616 Bacteria 1407
150 Ga0068859_100375629 3300005617 Bacteria 1517
151 Ga0068864_100109881 3300005618 Bacteria 2455
152 Ga0068864_100336567 3300005618 Bacteria 1421
153 Ga0068866_10635385 3300005718 Bacteria 725
154 Ga0068866_11123852 3300005718 Bacteria 564
155 Ga0068861_100036348 3300005719 Bacteria 3654
156 Ga0068861_100096130 3300005719 Bacteria 2347
157 Ga0068861_100693417 3300005719 Bacteria 945
158 Ga0068861_102547950 3300005719 Bacteria 515
159 Ga0068851_10263679 3300005834 Bacteria 981
160 Ga0068870_10008883 3300005840 Bacteria 4539
161 Ga0068870_10017164 3300005840 Unclassified 3474
162 Ga0068870_10179056 3300005840 Bacteria 1271
163 Ga0068863_101110377 3300005841 Bacteria 795
164 Ga0068863_101276885 3300005841 Bacteria 741
165 Ga0068858_100053466 3300005842 Bacteria 3735
166 Ga0068858_101246903 3300005842 Bacteria 731
167 Ga0068860_100171471 3300005843 Bacteria 2096
168 Ga0068862_100028413 3300005844 Bacteria 4710
169 Ga0068862_100032567 3300005844 Bacteria 4405
170 Ga0068862_100200952 3300005844 Bacteria 1797
171 Ga0081455_10006745 3300005937 Bacteria 12256
172 Ga0081455_10009622 3300005937 Bacteria 9926
173 Ga0081455_10024299 3300005937 Bacteria 5615
174 Ga0081455_10043052 3300005937 Bacteria 3955
175 Ga0081455_10359689 3300005937 Bacteria 1024
176 Ga0081455_10551554 3300005937 Bacteria 762
177 Ga0081538_10000991 3300005981 Bacteria 30132
178 Ga0081538_10026155 3300005981 Bacteria 4090
179 Ga0081540_1006355 3300005983 Bacteria 8628
180 Ga0081540_1168274 3300005983 Bacteria 839
181 Ga0081539_10017208 3300005985 Bacteria 5089
182 Ga0081539_10019195 3300005985 Bacteria 4691
183 Ga0075365_10022170 3300006038 Bacteria 3975
184 Ga0075365_10050645 3300006038 Bacteria 2740
185 Ga0075365_10069991 3300006038 Bacteria 2359
186 Ga0075365_10080802 3300006038 Bacteria 2201
187 Ga0075365_10181775 3300006038 Bacteria 1470
188 Ga0075365_10205940 3300006038 Bacteria 1379
189 Ga0075365_10210768 3300006038 Bacteria 1362
190 Ga0075365_10248219 3300006038 Bacteria 1250
191 Ga0075365_10444527 3300006038 Bacteria 915
192 Ga0075365_10488275 3300006038 Bacteria 870
193 Ga0075365_10672344 3300006038 Bacteria 732
194 Ga0075368_10001368 3300006042 Bacteria 7762
195 Ga0075368_10001555 3300006042 Bacteria 7369
196 Ga0075368_10104738 3300006042 Bacteria 1164
197 Ga0075363_100001987 3300006048 Bacteria 8134
198 Ga0075363_100016457 3300006048 Bacteria 3652
199 Ga0075363_100053059 3300006048 Bacteria 2165
200 Ga0075363_100121778 3300006048 Bacteria 1457
201 Ga0075363_100237034 3300006048 Bacteria 1048
202 Ga0075363_100388881 3300006048 Bacteria 818
203 Ga0075363_100554717 3300006048 Bacteria 686
204 Ga0075364_10030886 3300006051 Bacteria 3440
205 Ga0075364_10852332 3300006051 Bacteria 621
206 Ga0075364_11037997 3300006051 Bacteria 557
207 Ga0075432_10035480 3300006058 Bacteria 1732
208 Ga0075432_10265657 3300006058 Bacteria 701
209 Ga0075432_10289166 3300006058 Bacteria 677
210 Ga0070715_10085225 3300006163 Archaea 1443
211 Ga0070712_101651969 3300006175 Bacteria 561
212 Ga0075362_10072659 3300006177 Bacteria 1574
213 Ga0075362_10146917 3300006177 Bacteria 1129
214 Ga0075367_10016900 3300006178 Bacteria 3993
215 Ga0075367_10133466 3300006178 Bacteria 1535
216 Ga0075367_10181727 3300006178 Bacteria 1311
217 Ga0075367_10515624 3300006178 Bacteria 759
218 Ga0097621_100245409 3300006237 Bacteria 1567
219 Ga0075370_10001859 3300006353 Bacteria 9457
220 Ga0075370_10013364 3300006353 Bacteria 4361
221 Ga0075370_10022023 3300006353 Bacteria 3495
222 Ga0075370_10099799 3300006353 Bacteria 1680
223 Ga0075370_10569323 3300006353 Bacteria 686
224 Ga0068871_101844247 3300006358 Bacteria 574
225 Ga0075428_100096948 3300006844 Bacteria 3215
226 Ga0075428_100228142 3300006844 Bacteria 2010
227 Ga0075428_100916187 3300006844 Bacteria 929
228 Ga0075430_100031516 3300006846 Bacteria 4500
229 Ga0075430_100102275 3300006846 Bacteria 2392
230 Ga0075430_100157312 3300006846 Bacteria 1892
231 Ga0075431_100018073 3300006847 Bacteria 7172
232 Ga0075431_100072638 3300006847 Bacteria 3550
233 Ga0075431_100247833 3300006847 Bacteria 1810
234 Ga0075431_100552414 3300006847 Bacteria 1139
235 Ga0075431_100994343 3300006847 Bacteria 806
236 Ga0075431_101057047 3300006847 Bacteria 777
237 Ga0075433_10085696 3300006852 Bacteria 2781
238 Ga0075433_10317391 3300006852 Bacteria 1379
239 Ga0075433_10376719 3300006852 Bacteria 1253
240 Ga0075433_10680091 3300006852 Bacteria 902
241 Ga0075434_100170226 3300006871 Bacteria 2198
242 Ga0075434_100217813 3300006871 Bacteria 1929
243 Ga0075434_100919081 3300006871 Bacteria 890
244 Ga0075429_100065939 3300006880 Bacteria 3152
245 Ga0075429_100286470 3300006880 Bacteria 1442
246 Ga0075429_100329354 3300006880 Bacteria 1336
247 Ga0068865_100012214 3300006881 Bacteria 5402
248 Ga0068865_100128854 3300006881 Bacteria 1893
249 Ga0068865_100254447 3300006881 Bacteria 1387
250 Ga0068865_100291436 3300006881 Bacteria 1303
251 Ga0075436_100004843 3300006914 Bacteria 9251
252 Ga0075436_100578698 3300006914 Unclassified 826
253 Ga0075436_100638549 3300006914 Unclassified 786
254 Ga0097620_100375605 3300006931 Bacteria 1517
255 Ga0075435_100053694 3300007076 Bacteria 3250
256 Ga0075435_100056047 3300007076 Bacteria 3185
257 Ga0099794_10171359 3300007265 Archaea 1106
258 Ga0111539_10054227 3300009094 Bacteria 4770
259 Ga0111539_10121948 3300009094 Bacteria 3054
260 Ga0111539_10267602 3300009094 Bacteria 1990
261 Ga0111539_10335191 3300009094 Bacteria 1761
262 Ga0111539_10688204 3300009094 Bacteria 1190
263 Ga0111539_10853940 3300009094 Bacteria 1059
264 Ga0105245_10009867 3300009098 Bacteria 8316
265 Ga0105245_10031744 3300009098 Bacteria 4676
266 Ga0105245_10056527 3300009098 Bacteria 3527
267 Ga0105245_10082688 3300009098 Bacteria 2938
268 Ga0105245_10101126 3300009098 Bacteria 2668
269 Ga0105245_10114068 3300009098 Bacteria 2517
270 Ga0105247_10574177 3300009101 Bacteria 832
271 Ga0114129_10091089 3300009147 Bacteria 4226
272 Ga0114129_10105276 3300009147 Bacteria 3899
273 Ga0114129_10275863 3300009147 Bacteria 2248
274 Ga0114129_10687933 3300009147 Bacteria 1316
275 Ga0105243_10002686 3300009148 Bacteria 14782
276 Ga0105243_10012657 3300009148 Bacteria 6373
277 Ga0105243_10143096 3300009148 Bacteria 2043
278 Ga0105243_10240926 3300009148 Bacteria 1609
279 Ga0105243_10274301 3300009148 Bacteria 1516
280 Ga0105243_10285118 3300009148 Bacteria 1489
281 Ga0105243_10687605 3300009148 Bacteria 996
282 Ga0105243_10912383 3300009148 Bacteria 875
283 Ga0105243_11186688 3300009148 Bacteria 776
284 Ga0105243_11208803 3300009148 Bacteria 769
285 Ga0105243_12343996 3300009148 Bacteria 572
286 Ga0105241_10274263 3300009174 Bacteria 1438
287 Ga0105241_11675978 3300009174 Bacteria 617
288 Ga0105241_12247208 3300009174 Bacteria 542
289 Ga0105242_10039331 3300009176 Bacteria 3806
290 Ga0105242_10521723 3300009176 Bacteria 1133
291 Ga0105248_10476678 3300009177 Bacteria 1407
292 Ga0105237_10078765 3300009545 Bacteria 3285
293 Ga0105237_11232872 3300009545 Bacteria 754
294 Ga0105238_10268135 3300009551 Bacteria 1688
295 Ga0105238_10429507 3300009551 Bacteria 1317
296 Ga0105238_10595633 3300009551 Bacteria 1113
297 Ga0105238_10605407 3300009551 Bacteria 1104
298 Ga0105249_10037012 3300009553 Bacteria 4428
299 Ga0105249_10062217 3300009553 Bacteria 3427
300 Ga0105249_10590405 3300009553 Bacteria 1165
301 Ga0105249_10776232 3300009553 Bacteria 1021
302 Ga0105239_10249036 3300010375 Bacteria 1995
303 Ga0105239_10363856 3300010375 Bacteria 1634
304 Ga0105239_10381986 3300010375 Bacteria 1592
305 Ga0105246_10051047 3300011119 Bacteria 2839
306 Ga0105246_10199756 3300011119 Bacteria 1553
307 Ga0105246_10258746 3300011119 Bacteria 1385
308 Ga0105246_11102218 3300011119 Bacteria 725
309 Ga0105246_11196627 3300011119 Bacteria 699
310 Ga0157320_1031276 3300012481 Bacteria 538
311 Ga0157325_1003308 3300012485 Bacteria 881
312 Ga0157345_1006741 3300012498 Bacteria 923
313 Ga0157313_1044403 3300012503 Bacteria 557
314 Ga0157339_1035448 3300012505 Bacteria 604
315 Ga0157316_1003846 3300012510 Bacteria 1108
316 Ga0157326_1010535 3300012513 Bacteria 1032
317 Ga0157371_10057438 3300013102 Bacteria 2760
318 Ga0157371_10133911 3300013102 Bacteria 1764
319 Ga0157371_10581890 3300013102 Bacteria 832
320 Ga0157371_10690713 3300013102 Bacteria 763
321 Ga0157370_10686886 3300013104 Bacteria 935
322 Ga0157369_10007989 3300013105 Bacteria 12153
323 Ga0157369_10638235 3300013105 Bacteria 1099
324 Ga0157369_10986432 3300013105 Bacteria 863
325 Ga0157369_11895579 3300013105 Bacteria 605
326 Ga0157369_12172800 3300013105 Bacteria 563
327 Ga0157374_10281602 3300013296 Bacteria 1642
328 Ga0157374_10473943 3300013296 Bacteria 1254
329 Ga0157378_10415366 3300013297 Bacteria 1329
330 Ga0157378_10995870 3300013297 Bacteria 872
331 Ga0157378_11386105 3300013297 Bacteria 746
332 Ga0163162_10023432 3300013306 Bacteria 6093
333 Ga0163162_10217897 3300013306 Bacteria 2039
334 Ga0163162_10626841 3300013306 Bacteria 1200
335 Ga0157372_10024844 3300013307 Bacteria 6512
336 Ga0157372_10043420 3300013307 Bacteria 4976
337 Ga0157372_10301443 3300013307 Bacteria 1864
338 Ga0157372_10569810 3300013307 Bacteria 1320
339 Ga0157372_11426029 3300013307 Bacteria 798
340 Ga0157372_11446346 3300013307 Bacteria 792
341 Ga0157372_12198257 3300013307 Bacteria 634
342 Ga0157375_10321216 3300013308 Bacteria 1713
343 Ga0157375_10364197 3300013308 Bacteria 1612
344 Ga0157375_10775492 3300013308 Bacteria 1109
345 Ga0157375_12793632 3300013308 Bacteria 584
346 Ga0163163_10924164 3300014325 Bacteria 936
347 Ga0163163_11423726 3300014325 Bacteria 755
348 Ga0163163_11731653 3300014325 Bacteria 686
349 Ga0163163_12066327 3300014325 Bacteria 629
350 Ga0163163_12233016 3300014325 Bacteria 606
351 Ga0163163_12459500 3300014325 Bacteria 579
352 Ga0157380_10019024 3300014326 Bacteria 5111
353 Ga0157380_10107939 3300014326 Bacteria 2332
354 Ga0157380_10135274 3300014326 Bacteria 2109
355 Ga0157380_10358833 3300014326 Bacteria 1367
356 Ga0157380_11604499 3300014326 Bacteria 706
357 Ga0157380_12020099 3300014326 Bacteria 638
358 Ga0182008_10157917 3300014497 Bacteria 1140
359 Ga0182008_10220361 3300014497 Bacteria 970
360 Ga0182008_10445139 3300014497 Bacteria 703
361 Ga0182008_10660180 3300014497 Bacteria 593
362 Ga0157377_10055967 3300014745 Bacteria 2238
363 Ga0157377_10306734 3300014745 Bacteria 1050
364 Ga0157377_10363840 3300014745 Bacteria 974
365 Ga0157379_10717617 3300014968 Bacteria 939
366 Ga0157376_10575677 3300014969 Bacteria 1118
367 Ga0157376_11938530 3300014969 Bacteria 626
368 Ga0163161_10010383 3300017792 Bacteria 6448
369 Ga0163161_10135627 3300017792 Bacteria 1860
370 Ga0206356_11902212 3300020070 Unclassified 1181
371 Ga0206349_1251648 3300020075 Unclassified 726
372 Ga0206354_10753636 3300020081 Bacteria 547
373 Ga0206354_11048389 3300020081 Bacteria 724
374 Ga0206353_11655497 3300020082 Bacteria 2519
375 Ga0224712_10004575 3300022467 Bacteria 3745
376 Ga0224712_10005001 3300022467 Bacteria 3643
377 Ga0207697_10085522 3300025315 Bacteria 1332
378 Ga0207656_10572095 3300025321 Bacteria 576
379 Ga0207692_10871216 3300025898 Bacteria 591
380 Ga0207642_10107628 3300025899 Bacteria 1413
381 Ga0207642_10816027 3300025899 Bacteria 594
382 Ga0207710_10566902 3300025900 Bacteria 592
383 Ga0207688_10002263 3300025901 Bacteria 10362
384 Ga0207688_10006046 3300025901 Bacteria 6587
385 Ga0207688_10028851 3300025901 Bacteria 3052
386 Ga0207680_10395076 3300025903 Bacteria 976
387 Ga0207647_10039538 3300025904 Bacteria 2974
388 Ga0207699_10083460 3300025906 Bacteria 1987
389 Ga0207643_10071100 3300025908 Bacteria 2002
390 Ga0207705_10081285 3300025909 Bacteria 2362
391 Ga0207705_10515648 3300025909 Bacteria 929
392 Ga0207684_10547618 3300025910 Bacteria 990
393 Ga0207654_10833390 3300025911 Bacteria 667
394 Ga0207654_10852799 3300025911 Bacteria 659
395 Ga0207707_10371994 3300025912 Bacteria 1229
396 Ga0207707_10698883 3300025912 Bacteria 851
397 Ga0207707_10854964 3300025912 Bacteria 755
398 Ga0207671_10087900 3300025914 Bacteria 2337
399 Ga0207671_10857000 3300025914 Bacteria 719
400 Ga0207693_10220907 3300025915 Unclassified 1489
401 Ga0207693_10221956 3300025915 Bacteria 1485
402 Ga0207663_10253289 3300025916 Bacteria 1297
403 Ga0207660_10055167 3300025917 Bacteria 2838
404 Ga0207660_10062273 3300025917 Bacteria 2687
405 Ga0207662_10013678 3300025918 Bacteria 4542
406 Ga0207662_10676021 3300025918 Bacteria 722
407 Ga0207657_10030451 3300025919 Bacteria 4898
408 Ga0207657_10326722 3300025919 Bacteria 1212
409 Ga0207657_10495530 3300025919 Bacteria 957
410 Ga0207657_10525802 3300025919 Bacteria 926
411 Ga0207649_10118853 3300025920 Unclassified 1779
412 Ga0207649_10309218 3300025920 Bacteria 1158
413 Ga0207649_10456386 3300025920 Bacteria 965
414 Ga0207652_10028765 3300025921 Bacteria 4639
415 Ga0207652_10116794 3300025921 Unclassified 2371
416 Ga0207652_10182445 3300025921 Bacteria 1886
417 Ga0207652_10227168 3300025921 Bacteria 1682
418 Ga0207652_10410472 3300025921 Bacteria 1222
419 Ga0207681_10360947 3300025923 Bacteria 1165
420 Ga0207681_10600134 3300025923 Bacteria 910
421 Ga0207694_10005510 3300025924 Bacteria 9715
422 Ga0207694_10274876 3300025924 Bacteria 1382
423 Ga0207694_10433437 3300025924 Bacteria 1096
424 Ga0207650_10005827 3300025925 Bacteria 8406
425 Ga0207650_10388986 3300025925 Bacteria 1153
426 Ga0207659_10107398 3300025926 Bacteria 2115
427 Ga0207659_10141318 3300025926 Bacteria 1869
428 Ga0207687_10010008 3300025927 Bacteria 6204
429 Ga0207687_10033318 3300025927 Bacteria 3494
430 Ga0207687_10050468 3300025927 Bacteria 2896
431 Ga0207687_10202442 3300025927 Bacteria 1553
432 Ga0207687_10804735 3300025927 Bacteria 802
433 Ga0207687_11423877 3300025927 Bacteria 596
434 Ga0207700_10057208 3300025928 Bacteria 2939
435 Ga0207700_11499021 3300025928 Bacteria 598
436 Ga0207700_11622302 3300025928 Bacteria 572
437 Ga0207664_10057502 3300025929 Bacteria 3091
438 Ga0207664_10516511 3300025929 Bacteria 1070
439 Ga0207690_10014913 3300025932 Bacteria 4704
440 Ga0207690_10143201 3300025932 Bacteria 1764
441 Ga0207690_11084159 3300025932 Bacteria 667
442 Ga0207690_11229757 3300025932 Bacteria 626
443 Ga0207706_10037907 3300025933 Bacteria 4278
444 Ga0207706_10198100 3300025933 Bacteria 1761
445 Ga0207706_10252454 3300025933 Bacteria 1540
446 Ga0207686_10009994 3300025934 Bacteria 5160
447 Ga0207709_10035006 3300025935 Bacteria 2965
448 Ga0207709_10052142 3300025935 Bacteria 2511
449 Ga0207709_10180746 3300025935 Bacteria 1489
450 Ga0207709_10235486 3300025935 Bacteria 1329
451 Ga0207709_10799803 3300025935 Bacteria 761
452 Ga0207709_10968484 3300025935 Bacteria 694
453 Ga0207670_10841485 3300025936 Bacteria 766
454 Ga0207669_10349816 3300025937 Bacteria 1141
455 Ga0207669_10417421 3300025937 Bacteria 1055
456 Ga0207669_10576854 3300025937 Bacteria 911
457 Ga0207669_11225694 3300025937 Bacteria 636
458 Ga0207704_10045603 3300025938 Bacteria 2605
459 Ga0207704_10050681 3300025938 Bacteria 2505
460 Ga0207704_10232188 3300025938 Bacteria 1373
461 Ga0207704_10383057 3300025938 Bacteria 1104
462 Ga0207704_10475084 3300025938 Bacteria 1002
463 Ga0207691_10011852 3300025940 Bacteria 8368
464 Ga0207691_10133082 3300025940 Bacteria 2195
465 Ga0207691_10942234 3300025940 Bacteria 722
466 Ga0207689_10212445 3300025942 Bacteria 1599
467 Ga0207689_10271054 3300025942 Bacteria 1405
468 Ga0207689_10444211 3300025942 Bacteria 1084
469 Ga0207661_10000292 3300025944 Bacteria 31716
470 Ga0207661_10001315 3300025944 Bacteria 16624
471 Ga0207661_10027515 3300025944 Bacteria 4344
472 Ga0207661_10036687 3300025944 Bacteria 3828
473 Ga0207661_10050549 3300025944 Bacteria 3312
474 Ga0207661_10110770 3300025944 Bacteria 2321
475 Ga0207661_10205996 3300025944 Bacteria 1731
476 Ga0207661_10489627 3300025944 Bacteria 1123
477 Ga0207661_10595872 3300025944 Bacteria 1014
478 Ga0207661_10615882 3300025944 Bacteria 997
479 Ga0207661_10645936 3300025944 Bacteria 972
480 Ga0207661_11450718 3300025944 Bacteria 629
481 Ga0207679_10019263 3300025945 Bacteria 4582
482 Ga0207679_10059956 3300025945 Bacteria 2825
483 Ga0207679_10553327 3300025945 Bacteria 1032
484 Ga0207679_12006562 3300025945 Bacteria 527
485 Ga0207679_12111295 3300025945 Bacteria 512
486 Ga0207667_10345591 3300025949 Bacteria 1517
487 Ga0207667_11526411 3300025949 Bacteria 638
488 Ga0207712_10014366 3300025961 Bacteria 5093
489 Ga0207712_10014929 3300025961 Bacteria 5002
490 Ga0207712_10061461 3300025961 Bacteria 2666
491 Ga0207712_11047001 3300025961 Bacteria 725
492 Ga0207712_11577711 3300025961 Unclassified 588
493 Ga0207668_10002263 3300025972 Bacteria 11229
494 Ga0207668_10010876 3300025972 Bacteria 5515
495 Ga0207668_10051446 3300025972 Bacteria 2845
496 Ga0207668_10380673 3300025972 Bacteria 1188
497 Ga0207668_10519808 3300025972 Bacteria 1027
498 Ga0207640_10260273 3300025981 Bacteria 1351
499 Ga0207640_11124208 3300025981 Bacteria 696
500 Ga0207640_11419404 3300025981 Bacteria 622
501 Ga0207658_10033125 3300025986 Bacteria 3683
502 Ga0207658_10355857 3300025986 Bacteria 1276
503 Ga0207677_10170045 3300026023 Bacteria 1703
504 Ga0207677_10183253 3300026023 Bacteria 1649
505 Ga0207677_10816032 3300026023 Bacteria 836
506 Ga0207703_10022643 3300026035 Bacteria 4932
507 Ga0207639_10352173 3300026041 Bacteria 1315
508 Ga0207639_10964288 3300026041 Bacteria 798
509 Ga0207639_11342263 3300026041 Bacteria 671
510 Ga0207678_10433510 3300026067 Bacteria 1141
511 Ga0207678_10678639 3300026067 Bacteria 906
512 Ga0207678_10982741 3300026067 Bacteria 747
513 Ga0207708_10031287 3300026075 Bacteria 4039
514 Ga0207708_10136545 3300026075 Bacteria 1921
515 Ga0207708_10179081 3300026075 Bacteria 1683
516 Ga0207708_10521619 3300026075 Bacteria 998
517 Ga0207702_10004483 3300026078 Bacteria 12392
518 Ga0207702_10011683 3300026078 Bacteria 7312
519 Ga0207702_10042588 3300026078 Bacteria 3809
520 Ga0207702_10230748 3300026078 Bacteria 1730
521 Ga0207702_10243829 3300026078 Bacteria 1685
522 Ga0207702_10252733 3300026078 Bacteria 1656
523 Ga0207702_10656184 3300026078 Bacteria 1032
524 Ga0207702_11784155 3300026078 Bacteria 607
525 Ga0207702_12215730 3300026078 Bacteria 538
526 Ga0207641_10067802 3300026088 Bacteria 3058
527 Ga0207641_11262039 3300026088 Bacteria 739
528 Ga0207648_10001192 3300026089 Bacteria 29118
529 Ga0207648_10182214 3300026089 Bacteria 1859
530 Ga0207648_10881936 3300026089 Bacteria 835
531 Ga0207676_10642841 3300026095 Bacteria 1023
532 Ga0207676_11493648 3300026095 Bacteria 673
533 Ga0207676_11717879 3300026095 Bacteria 626
534 Ga0207676_12096695 3300026095 Bacteria 564
535 Ga0207674_10000027 3300026116 Bacteria 150200
536 Ga0207674_10012854 3300026116 Bacteria 9346
537 Ga0207674_10019122 3300026116 Bacteria 7425
538 Ga0207674_10048634 3300026116 Bacteria 4340
539 Ga0207674_10075250 3300026116 Bacteria 3387
540 Ga0207674_10138670 3300026116 Bacteria 2393
541 Ga0207674_11269742 3300026116 Bacteria 706
542 Ga0207675_100014819 3300026118 Bacteria 7275
543 Ga0207675_100059029 3300026118 Bacteria 3580
544 Ga0207675_100141323 3300026118 Bacteria 2287
545 Ga0207675_100543637 3300026118 Bacteria 1160
546 Ga0207675_101732449 3300026118 Bacteria 644
547 Ga0207683_10194119 3300026121 Bacteria 1844
548 Ga0207683_10209465 3300026121 Bacteria 1774
549 Ga0207683_10528320 3300026121 Bacteria 1090
550 Ga0207683_11500598 3300026121 Unclassified 622
551 Ga0207698_10926901 3300026142 Bacteria 879
552 Ga0207698_10933513 3300026142 Bacteria 876
553 Ga0207698_11261418 3300026142 Bacteria 753
554 Ga0209813_10005252 3300027866 Bacteria 3134
555 Ga0207428_10012230 3300027907 Bacteria 7549
556 Ga0207428_10469972 3300027907 Bacteria 916
557 Ga0207428_10860312 3300027907 Bacteria 642
558 Ga0268266_10176872 3300028379 Bacteria 1941
559 Ga0268265_10056093 3300028380 Bacteria 2996
560 Ga0268265_10127466 3300028380 Bacteria 2109
561 Ga0268265_11226714 3300028380 Bacteria 748
562 Ga0268264_10017415 3300028381 Bacteria 5884
563 Ga0265318_10102930 3300028577 Bacteria 1050
564 Ga0265318_10274656 3300028577 Bacteria 615
565 Ga0265323_10052471 3300028653 Unclassified 1442
566 Ga0265322_10023701 3300028654 Bacteria 1755
567 Ga0265338_10115954 3300028800 Bacteria 2147
568 Ga0307512_10114783 3300030522 Bacteria 1757
569 Ga0265330_10044072 3300031235 Unclassified 1971
570 Ga0265330_10152416 3300031235 Unclassified 982
571 Ga0265330_10418761 3300031235 Bacteria 567
572 Ga0265316_10017267 3300031344 Bacteria 6243
573 Ga0265316_10035843 3300031344 Unclassified 4015
574 Ga0265316_10061048 3300031344 Bacteria 2929
575 Ga0265316_10285801 3300031344 Bacteria 1204
576 Ga0307513_10233603 3300031456 Bacteria 1650
577 Ga0307509_10082273 3300031507 Bacteria 3322
578 Ga0307408_100552402 3300031548 Bacteria 1016
579 Ga0316579_10052161 3300031691 Bacteria 1915
580 Ga0265342_10056249 3300031712 Bacteria 2332
581 Ga0307516_10401940 3300031730 Bacteria 1029
582 Ga0307405_10316842 3300031731 Bacteria 1190
583 Ga0307405_10739712 3300031731 Bacteria 818
584 Ga0307413_10299460 3300031824 Bacteria 1219
585 Ga0307413_10312710 3300031824 Bacteria 1196
586 Ga0307413_10490612 3300031824 Bacteria 984
587 Ga0307413_11137079 3300031824 Bacteria 676
588 Ga0307413_11922681 3300031824 Bacteria 532
589 Ga0307410_10022477 3300031852 Bacteria 3900
590 Ga0307410_10249974 3300031852 Bacteria 1378
591 Ga0307410_10300626 3300031852 Bacteria 1266
592 Ga0307410_11473573 3300031852 Bacteria 599
593 Ga0307406_10063424 3300031901 Bacteria 2394
594 Ga0307406_10514944 3300031901 Bacteria 972
595 Ga0307406_10822107 3300031901 Bacteria 786
596 Ga0307406_11117233 3300031901 Bacteria 681
597 Ga0307407_10212672 3300031903 Bacteria 1303
598 Ga0307407_10217408 3300031903 Bacteria 1290
599 Ga0307407_10244438 3300031903 Bacteria 1226
600 Ga0307412_10161682 3300031911 Bacteria 1665
601 Ga0307412_10394074 3300031911 Bacteria 1125
602 Ga0307412_10441783 3300031911 Bacteria 1069
603 Ga0307412_11143876 3300031911 Bacteria 695
604 Ga0307409_100124192 3300031995 Bacteria 2192
605 Ga0307409_100168873 3300031995 Bacteria 1923
606 Ga0307409_100272846 3300031995 Bacteria 1558
607 Ga0307409_100365689 3300031995 Bacteria 1366
608 Ga0307409_100389024 3300031995 Bacteria 1328
609 Ga0307409_100579575 3300031995 Bacteria 1106
610 Ga0307409_100835451 3300031995 Bacteria 931
611 Ga0307409_101775356 3300031995 Bacteria 646
612 Ga0307416_100023382 3300032002 Bacteria 4484
613 Ga0307416_100137620 3300032002 Bacteria 2213
614 Ga0307416_100288609 3300032002 Bacteria 1623
615 Ga0307416_100360582 3300032002 Bacteria 1476
616 Ga0307416_100385860 3300032002 Bacteria 1433
617 Ga0307416_101061357 3300032002 Bacteria 914
618 Ga0307416_103161136 3300032002 Bacteria 551
619 Ga0307414_11591185 3300032004 Bacteria 609
620 Ga0307411_10269149 3300032005 Bacteria 1350
621 Ga0307411_10335696 3300032005 Bacteria 1226
622 Ga0307411_11447824 3300032005 Bacteria 630
623 Ga0307415_100000363 3300032126 Bacteria 19318
624 Ga0307415_100040254 3300032126 Bacteria 3095
625 Ga0307415_100050810 3300032126 Bacteria 2811
626 Ga0307415_100574444 3300032126 Bacteria 999
627 Ga0307415_100622039 3300032126 Bacteria 964
628 Ga0307415_100899807 3300032126 Bacteria 816
629 Ga0307415_101221536 3300032126 Bacteria 709
630 Ga0307415_101316751 3300032126 Bacteria 685
631 Ga0307415_102484971 3300032126 Bacteria 510
632 Ga0307507_10039358 3300033179 Bacteria 4774
633 Ga0307507_10595500 3300033179 Bacteria 572
634 Ga0373934_0345265 3300035086 Bacteria 619
635 Ga0373944_0128757 3300035089 Bacteria 878
636 Ga0373949_0061402 3300035090 Bacteria 968
637 Ga0373939_0289817 3300035114 Bacteria 649
638 Ga0373939_0320897 3300035114 Bacteria 623
639 Ga0373939_0365292 3300035114 Bacteria 591
640 Ga0373939_0433588 3300035114 Bacteria 550
641 Ga0373941_0383856 3300035115 Bacteria 578
642 Ga0373945_0383026 3300035116 Bacteria 614
643 Ga0373953_0093415 3300035117 Unclassified 1260
644 Ga0373954_0003376 3300035118 Bacteria 6757
645 Ga0373954_0079232 3300035118 Bacteria 1568
646 Ga0373956_0000483 3300035119 Bacteria 16366
647 Ga0373956_0146200 3300035119 Bacteria 1111
648 Ga0373957_0140978 3300035120 Bacteria 985
649 Ga0373960_0460596 3300035121 Bacteria 500
650 Ga0373943_0170651 3300035170 Bacteria 1190
651 Ga0373943_0920636 3300035170 Bacteria 523
652 Ga0373946_0424495 3300035171 Unclassified 674
653 Ga0373955_0127866 3300035172 Unclassified 1481
654 Ga0373955_0380132 3300035172 Bacteria 857
655 Ga0373924_0015464 3300035410 Bacteria 2902
656 Ga0373931_0068322 3300035691 Bacteria 1934
657 Ga0373931_0188109 3300035691 Bacteria 1227
658 Ga0373935_0016869 3300035692 Bacteria 4422
659 Ga0373935_0077935 3300035692 Bacteria 2149
660 Ga0373935_0332076 3300035692 Unclassified 1081
661 Ga0373927_0000026 3300035695 Bacteria 113549
662 Ga0373927_0013036 3300035695 Bacteria 5530
663 Ga0373933_0121480 3300035724 Bacteria 1636
664 Ga0373933_0445046 3300035724 Bacteria 847
665 Ga0373933_0535113 3300035724 Bacteria 768
666 Ga0373937_0259391 3300036401 Unclassified 1639
667 Ga0373937_0261652 3300036401 Bacteria 1631
668 Ga0373925_0004578 3300037068 Bacteria 10453
669 Ga0373925_0184635 3300037068 Unclassified 1653
670 Ga0395899_0008747 3300037312 Bacteria 7791
671 Ga0395899_0027813 3300037312 Bacteria 4260
672 Ga0395899_0028473 3300037312 Bacteria 4206
673 Ga0395899_0048504 3300037312 Bacteria 3160
674 Ga0395899_0049645 3300037312 Bacteria 3118
675 Ga0395899_0052120 3300037312 Bacteria 3034
676 Ga0395899_0181201 3300037312 Bacteria 1479
677 Ga0395899_0232637 3300037312 Bacteria 1272
678 Ga0395899_0278926 3300037312 Bacteria 1138
679 Ga0395899_0423233 3300037312 Bacteria 877
680 Ga0395899_0424950 3300037312 Bacteria 875
681 Ga0395899_0445100 3300037312 Bacteria 849
682 Ga0395900_0012498 3300037418 Bacteria 8683
683 Ga0395900_0014497 3300037418 Bacteria 8041
684 Ga0395900_0031855 3300037418 Bacteria 5420
685 Ga0395900_0031891 3300037418 Bacteria 5417
686 Ga0395900_0040438 3300037418 Bacteria 4805
687 Ga0395900_0042133 3300037418 Bacteria 4703
688 Ga0395900_0044820 3300037418 Bacteria 4556
689 Ga0395900_0087556 3300037418 Bacteria 3201
690 Ga0395900_0088664 3300037418 Bacteria 3180
691 Ga0395900_0300108 3300037418 Bacteria 1593
692 Ga0395900_0314124 3300037418 Bacteria 1549
693 Ga0395900_0359191 3300037418 Bacteria 1428
694 Ga0395900_0631071 3300037418 Bacteria 1010
695 Ga0395900_0769122 3300037418 Bacteria 892
696 Ga0395900_0863994 3300037418 Bacteria 829
697 Ga0395900_0888385 3300037418 Bacteria 815
698 Ga0395900_1068076 3300037418 Bacteria 725
699 Ga0395900_1346382 3300037418 Bacteria 627
700 Ga0395900_1705982 3300037418 Bacteria 541
701 Ga0395900_1877267 3300037418 Bacteria 510
702 Ga0395898_0004469 3300037466 Bacteria 15287
703 Ga0395898_0009356 3300037466 Bacteria 10293
704 Ga0395898_0029128 3300037466 Bacteria 5531
705 Ga0395898_0032676 3300037466 Bacteria 5194
706 Ga0395898_0051934 3300037466 Bacteria 4006
707 Ga0395898_0053677 3300037466 Bacteria 3936
708 Ga0395898_0054555 3300037466 Bacteria 3899
709 Ga0395898_0084710 3300037466 Bacteria 3055
710 Ga0395898_0122881 3300037466 Bacteria 2487
711 Ga0395898_0134414 3300037466 Bacteria 2368
712 Ga0395898_0143267 3300037466 Bacteria 2288
713 Ga0395898_0165363 3300037466 Bacteria 2116
714 Ga0395898_0209137 3300037466 Bacteria 1861
715 Ga0395898_0219518 3300037466 Bacteria 1814
716 Ga0395898_0354617 3300037466 Bacteria 1399
717 Ga0395898_0404311 3300037466 Bacteria 1302
718 Ga0395898_0587399 3300037466 Bacteria 1056
719 Ga0395898_0593404 3300037466 Unclassified 1050
720 Ga0395898_0862045 3300037466 Bacteria 845
721 Ga0395898_0959807 3300037466 Bacteria 792
722 Ga0395898_1042076 3300037466 Bacteria 753
723 Ga0395905_0008922 3300037471 Bacteria 9847
724 Ga0395905_0012630 3300037471 Bacteria 8125
725 Ga0395905_0026626 3300037471 Bacteria 5452
726 Ga0395905_0073724 3300037471 Bacteria 3200
727 Ga0395905_0076192 3300037471 Bacteria 3144
728 Ga0395905_0101810 3300037471 Bacteria 2696
729 Ga0395905_0118770 3300037471 Bacteria 2485
730 Ga0395905_0145483 3300037471 Bacteria 2230
731 Ga0395905_0158118 3300037471 Bacteria 2131
732 Ga0395905_0334152 3300037471 Bacteria 1406
733 Ga0395905_0528340 3300037471 Bacteria 1080
734 Ga0395905_1405929 3300037471 Bacteria 602
735 Ga0436364_0914540 3300037853 Bacteria 1420
736 Ga0436364_1241145 3300037853 Bacteria 2286
737 Ga0395901_0015770 3300038443 Bacteria 7699
738 Ga0395901_0025335 3300038443 Bacteria 6089
739 Ga0395901_0026746 3300038443 Bacteria 5923
740 Ga0395901_0031214 3300038443 Bacteria 5493
741 Ga0395901_0044370 3300038443 Bacteria 4611
742 Ga0395901_0103232 3300038443 Bacteria 2991
743 Ga0395901_0103360 3300038443 Bacteria 2989
744 Ga0395901_0105111 3300038443 Bacteria 2963
745 Ga0395901_0113988 3300038443 Bacteria 2839
746 Ga0395901_0226598 3300038443 Bacteria 1952
747 Ga0395901_0241540 3300038443 Bacteria 1884
748 Ga0395901_0291470 3300038443 Bacteria 1693
749 Ga0395901_0304917 3300038443 Bacteria 1650
750 Ga0395901_0379642 3300038443 Bacteria 1455
751 Ga0395901_0510225 3300038443 Bacteria 1223
752 Ga0395901_0556003 3300038443 Bacteria 1162
753 Ga0395901_0570620 3300038443 Bacteria 1144
754 Ga0395901_0608474 3300038443 Bacteria 1101
755 Ga0395901_1632410 3300038443 Bacteria 597
756 Ga0436360_0319483 3300039438 Bacteria 1190
757 Ga0436363_0517822 3300039450 Bacteria 1833
758 Ga0451789_1250776 3300041443 Bacteria 774
759 Ga0451793_0679931 3300041452 Bacteria 1089
760 Ga0451793_0701646 3300041452 Bacteria 750
761 Ga0451793_0760524 3300041452 Bacteria 3351
762 Ga0451802_1134197 3300041460 Bacteria 539
763 Ga0451806_401815 3300041462 Bacteria 784
764 Ga0451833_0203593 3300041491 Bacteria 10134
765 Ga0451833_1359684 3300041491 Bacteria 662
766 Ga0451833_1470194 3300041491 Bacteria 1064
767 Ga0451851_0158388 3300041507 Bacteria 1065
768 Ga0451843_0421537 3300041509 Bacteria 1070
769 Ga0451853_1584429 3300041512 Bacteria 2598
770 Ga0439448_0003027 3300042005 Bacteria 4618
771 Ga0439448_0113132 3300042005 Bacteria 928
772 Ga0439448_0170091 3300042005 Bacteria 760
773 Ga0439450_087044 3300042008 Bacteria 782
774 Ga0439454_029482 3300042011 Bacteria 853
775 Ga0439463_020240 3300042016 Bacteria 1659
776 Ga0450907_002740 3300042146 Bacteria 3273
777 Ga0439458_0006874 3300042157 Bacteria 2536
778 Ga0439444_0049133 3300042437 Bacteria 852
779 Ga0439464_0223506 3300042439 Bacteria 604
780 Ga0439460_0127504 3300042461 Bacteria 837
781 Ga0451577_0829296 3300042876 Bacteria 835
782 Ga0451577_1253805 3300042876 Bacteria 660
783 Ga0439440_0040968 3300042993 Bacteria 1129
784 Ga0439440_0061932 3300042993 Bacteria 957
785 Ga0466969_0042453 3300044656 Bacteria 2271
786 Ga0466969_0141291 3300044656 Bacteria 1113
787 Ga0466972_0006438 3300044658 Bacteria 5899
788 Ga0466965_0019736 3300044683 Bacteria 3237
789 Ga0466965_0104375 3300044683 Bacteria 1452
790 Ga0466965_0193136 3300044683 Bacteria 1077
791 Ga0466965_0300615 3300044683 Bacteria 871
792 Ga0466965_0561479 3300044683 Bacteria 645
793 Ga0466965_0619370 3300044683 Bacteria 616
794 Ga0466965_0709244 3300044683 Bacteria 578
795 Ga0466966_0018855 3300044684 Bacteria 4546
796 Ga0466966_0151904 3300044684 Bacteria 1412
797 Ga0466961_0011157 3300044693 Bacteria 5744
798 Ga0466961_0038925 3300044693 Bacteria 3049
799 Ga0466961_0711146 3300044693 Bacteria 602
800 Ga0466963_0030288 3300044694 Bacteria 3491
801 Ga0466963_0035757 3300044694 Bacteria 3236
802 Ga0466963_0279868 3300044694 Bacteria 1172
803 Ga0466963_0330324 3300044694 Bacteria 1073
804 Ga0466963_0950244 3300044694 Bacteria 605
805 Ga0466964_0031346 3300044706 Bacteria 2108
806 Ga0466971_0012142 3300044719 Bacteria 3774
807 Ga0466971_0077065 3300044719 Bacteria 1517
808 Ga0466971_0321859 3300044719 Bacteria 745
809 Ga0466968_0066476 3300044735 Bacteria 1562
810 Ga0466970_0015868 3300044765 Bacteria 3878
811 Ga0466970_0016905 3300044765 Bacteria 3765
812 Ga0466970_0111610 3300044765 Bacteria 1493
813 Ga0466970_0235383 3300044765 Bacteria 1024
814 Ga0466970_0276217 3300044765 Bacteria 944
815 Ga0466957_0008423 3300044842 Bacteria 5864
816 Ga0466957_0117329 3300044842 Bacteria 1694
817 Ga0466957_0325845 3300044842 Bacteria 1037
818 Ga0466957_0477600 3300044842 Bacteria 862
819 Ga0466957_0867804 3300044842 Bacteria 644
820 Ga0466960_0002889 3300044901 Bacteria 6525
821 Ga0466960_0021348 3300044901 Bacteria 2881
822 Ga0466960_0022406 3300044901 Bacteria 2824
823 Ga0466960_0045709 3300044901 Bacteria 2093
824 Ga0466960_0108854 3300044901 Bacteria 1437
825 Ga0466960_0137514 3300044901 Bacteria 1295
826 Ga0466960_0353594 3300044901 Bacteria 838
827 Ga0466959_0010301 3300045049 Bacteria 6677
828 Ga0451576_0986570 3300045051 Bacteria 883
829 Ga0466958_0025758 3300045836 Bacteria 3470
830 Ga0466958_0033899 3300045836 Bacteria 3044
831 Ga0466958_0066091 3300045836 Bacteria 2207
832 Ga0466958_0106717 3300045836 Bacteria 1746
833 Ga0466967_0010143 3300045976 Bacteria 7045
834 Ga0466967_0018278 3300045976 Bacteria 5597
835 Ga0466967_0058609 3300045976 Bacteria 3404
836 Ga0466967_0093387 3300045976 Bacteria 2738
837 Ga0466967_0236420 3300045976 Bacteria 1741
838 Ga0466967_0336901 3300045976 Bacteria 1458
839 Ga0466967_0375482 3300045976 Bacteria 1380
840 Ga0466967_0572052 3300045976 Bacteria 1113
841 Ga0466967_0709297 3300045976 Bacteria 997
842 Ga0466967_0715582 3300045976 Bacteria 992
843 Ga0466967_0931867 3300045976 Bacteria 864
844 Ga0466967_1660923 3300045976 Bacteria 636
845 Ga0495627_193887 3300046453 Bacteria 560
846 Ga0495641_0038761 3300046461 Bacteria 2225
847 Ga0495651_0054830 3300046462 Bacteria 3063
848 Ga0495653_0192997 3300046463 Bacteria 1388
849 Ga0495653_0290604 3300046463 Bacteria 1069
850 Ga0495639_0139103 3300046475 Bacteria 1166
851 Ga0495662_0065101 3300046476 Bacteria 1762
852 Ga0495664_0319838 3300046477 Bacteria 936
853 Ga0495664_0704810 3300046477 Bacteria 596
854 Ga0495585_0053598 3300046492 Bacteria 2232
855 Ga0495585_0163977 3300046492 Bacteria 1152
856 Ga0495585_0552770 3300046492 Bacteria 544
857 Ga0495585_0554174 3300046492 Bacteria 543
858 Ga0495607_0094204 3300046501 Bacteria 1616
859 Ga0495608_0030998 3300046511 Bacteria 3616
860 Ga0495608_0304998 3300046511 Bacteria 985
861 Ga0495610_0264581 3300046512 Bacteria 676
862 Ga0495616_0065623 3300046513 Bacteria 1768
863 Ga0495618_0084575 3300046514 Bacteria 2027
864 Ga0495618_0579885 3300046514 Bacteria 669
865 Ga0495620_0024782 3300046515 Bacteria 2848
866 Ga0495620_0035832 3300046515 Bacteria 2227
867 Ga0495620_0143016 3300046515 Bacteria 935
868 Ga0495628_0128697 3300046516 Bacteria 1938
869 Ga0495628_0375780 3300046516 Bacteria 1041
870 Ga0495628_0592116 3300046516 Bacteria 793
871 Ga0495630_0046763 3300046517 Bacteria 3235
872 Ga0495630_0503604 3300046517 Bacteria 929
873 Ga0495632_0054499 3300046519 Bacteria 1960
874 Ga0495637_0115687 3300046520 Bacteria 1036
875 Ga0495637_0237979 3300046520 Bacteria 658
876 Ga0495637_0289478 3300046520 Bacteria 583
877 Ga0495643_0245107 3300046522 Bacteria 839
878 Ga0495644_0048864 3300046523 Bacteria 1589
879 Ga0495663_0008525 3300046525 Bacteria 2842
880 Ga0495663_0133538 3300046525 Bacteria 839
881 Ga0495663_0151040 3300046525 Bacteria 793
882 Ga0495652_0042715 3300046529 Bacteria 3908
883 Ga0495652_0376672 3300046529 Bacteria 1010
884 Ga0495652_0813403 3300046529 Bacteria 621
885 Ga0495665_0242361 3300046531 Bacteria 929
886 Ga0495640_0119830 3300046533 Bacteria 1712
887 Ga0495586_0053744 3300046535 Bacteria 2182
888 Ga0495586_0179071 3300046535 Bacteria 1199
889 Ga0495587_0016874 3300046536 Bacteria 4540
890 Ga0495598_0095844 3300046537 Bacteria 975
891 Ga0495609_0032246 3300046538 Bacteria 2381
892 Ga0495609_0222845 3300046538 Bacteria 783
893 Ga0495597_0038400 3300046542 Bacteria 2146
894 Ga0495645_0230945 3300046543 Bacteria 1239
895 Ga0495667_0150892 3300046559 Bacteria 1496
896 Ga0495656_0072736 3300046615 Bacteria 1531
897 Ga0495656_0089799 3300046615 Bacteria 1403
898 Ga0495656_0096436 3300046615 Bacteria 1361
899 Ga0495668_0000213 3300046616 Bacteria 84412
900 Ga0495668_0700429 3300046616 Bacteria 560
901 Ga0495634_0033635 3300046642 Bacteria 3522
902 Ga0495634_0382415 3300046642 Bacteria 839
903 Ga0495611_0278366 3300046648 Bacteria 773
904 Ga0495625_0002483 3300046660 Bacteria 19877
905 Ga0495625_0342464 3300046660 Bacteria 947
906 Ga0495625_0359903 3300046660 Bacteria 918
907 Ga0495625_0372461 3300046660 Bacteria 898
908 Ga0495635_0068184 3300046663 Bacteria 2440
909 Ga0495635_0222850 3300046663 Bacteria 1275
910 Ga0495588_0327749 3300046674 Bacteria 805
911 Ga0495657_0026841 3300046675 Bacteria 4073
912 Ga0495657_0234882 3300046675 Bacteria 1108
913 Ga0495599_0549853 3300046678 Bacteria 676
914 Ga0495623_0018318 3300046679 Bacteria 4522
915 Ga0495646_0028847 3300046680 Bacteria 3472
916 Ga0495646_0487573 3300046680 Bacteria 634
917 Ga0495647_0035839 3300046681 Bacteria 1865
918 Ga0495658_0096659 3300046683 Bacteria 1757
919 Ga0495669_0040586 3300046684 Bacteria 2065
920 Ga0495613_0425020 3300046689 Bacteria 903
921 Ga0495613_0552720 3300046689 Bacteria 770
922 Ga0495613_0740690 3300046689 Bacteria 645
923 Ga0495624_0160392 3300046690 Bacteria 1374
924 Ga0495670_0096603 3300046691 Bacteria 1517
925 Ga0495670_0238932 3300046691 Bacteria 967
926 Ga0495670_0528356 3300046691 Bacteria 641
927 Ga0495671_0068006 3300046692 Bacteria 1752
928 Ga0495671_0189615 3300046692 Bacteria 998
929 Ga0495589_0090451 3300046794 Bacteria 1486
930 Ga0495581_0051277 3300047315 Bacteria 2383
931 Ga0495581_0080318 3300047315 Bacteria 1887
932 Ga0495581_0446043 3300047315 Bacteria 754
933 Ga0495604_0035414 3300047317 Bacteria 3942
934 Ga0495636_0154989 3300047318 Bacteria 1030
935 Ga0495674_0053641 3300047319 Bacteria 3543
936 Ga0495674_0107170 3300047319 Bacteria 2372
937 Ga0495674_0241664 3300047319 Bacteria 1488
938 Ga0495674_0352355 3300047319 Bacteria 1195
939 Ga0495674_0546633 3300047319 Bacteria 922
940 Ga0495676_0074724 3300047321 Bacteria 2594
941 Ga0495676_0492617 3300047321 Bacteria 805
942 Ga0495680_0014362 3300047322 Bacteria 6860
943 Ga0495680_0030936 3300047322 Bacteria 4361
944 Ga0495683_0398995 3300047323 Bacteria 572
945 Ga0495683_0463278 3300047323 Bacteria 519
946 Ga0495677_0100450 3300047445 Bacteria 1095
947 Ga0495679_061605 3300047446 Bacteria 1099
948 Ga0495684_0078704 3300047471 Bacteria 2502
949 Ga0495684_0167555 3300047471 Bacteria 1636
950 Ga0495593_0057991 3300047673 Bacteria 2032
951 Ga0495602_0047953 3300048088 Bacteria 3844
952 Ga0495626_0000656 3300048091 Bacteria 33341
953 Ga0495626_0130722 3300048091 Bacteria 1072
954 Ga0495626_0191205 3300048091 Bacteria 844
955 Ga0496100_0578621 3300048903 Bacteria 870
956 Ga0496100_0896681 3300048903 Bacteria 696
957 Ga0496100_1395037 3300048903 Bacteria 553
958 Ga0496101_0020254 3300048904 Bacteria 4550
959 Ga0496101_0072790 3300048904 Bacteria 2523
960 Ga0496101_0073914 3300048904 Bacteria 2505
961 Ga0496101_0328845 3300048904 Bacteria 1200
962 Ga0496101_0724929 3300048904 Bacteria 785
963 Ga0496102_0175572 3300048905 Bacteria 2017
964 Ga0496102_0201154 3300048905 Bacteria 1878
965 Ga0496102_0272612 3300048905 Bacteria 1595
966 Ga0496102_0436712 3300048905 Bacteria 1229
967 Ga0496102_1614405 3300048905 Bacteria 567
968 Ga0496103_0005348 3300048906 Bacteria 7695
969 Ga0496103_0056286 3300048906 Bacteria 2441
970 Ga0496104_0001713 3300048907 Bacteria 18934
971 Ga0496104_0014519 3300048907 Bacteria 7115
972 Ga0496104_0062575 3300048907 Bacteria 3529
973 Ga0496104_0366683 3300048907 Bacteria 1353
974 Ga0496104_0404531 3300048907 Bacteria 1277
975 Ga0496104_0508522 3300048907 Bacteria 1116
976 Ga0496104_1007726 3300048907 Bacteria 737
977 Ga0496104_1242821 3300048907 Bacteria 648
978 Ga0496105_0000128 3300048908 Bacteria 51033
979 Ga0496105_0105160 3300048908 Bacteria 2330
980 Ga0496105_0538936 3300048908 Bacteria 912
981 Ga0496105_0741361 3300048908 Bacteria 751
982 Ga0496105_0770002 3300048908 Unclassified 734
983 Ga0496105_1259028 3300048908 Unclassified 542
984 Ga0496106_0082392 3300048909 Bacteria 2473
985 Ga0496106_0623088 3300048909 Bacteria 863
986 Ga0496106_1022245 3300048909 Bacteria 649
987 Ga0496107_0188029 3300048910 Bacteria 1534
988 Ga0496107_0499459 3300048910 Bacteria 902
989 Ga0496107_1003219 3300048910 Bacteria 606
990 Ga0496108_0018761 3300048911 Bacteria 5670
991 Ga0496108_0024079 3300048911 Bacteria 5011
992 Ga0496108_0399103 3300048911 Bacteria 1201
993 Ga0496108_0478203 3300048911 Bacteria 1088
994 Ga0496108_0555613 3300048911 Bacteria 1001
995 Ga0496108_0587669 3300048911 Bacteria 971
996 Ga0496108_0648051 3300048911 Bacteria 918
997 Ga0496108_1454921 3300048911 Bacteria 571
998 Ga0496109_0000408 3300048912 Bacteria 38367
999 Ga0496109_0008215 3300048912 Bacteria 8857
1000 Ga0496109_0013354 3300048912 Bacteria 7121
1001 Ga0496109_0062912 3300048912 Bacteria 3394
1002 Ga0496109_0077537 3300048912 Bacteria 3058
1003 Ga0496109_0081602 3300048912 Bacteria 2980
1004 Ga0496109_0119303 3300048912 Bacteria 2456
1005 Ga0496109_0598985 3300048912 Bacteria 1038
1006 Ga0496109_0656158 3300048912 Bacteria 986
1007 Ga0496109_0806862 3300048912 Bacteria 876
1008 Ga0496110_0000289 3300048913 Bacteria 32969
1009 Ga0496110_0000929 3300048913 Bacteria 20551
1010 Ga0496110_0057708 3300048913 Bacteria 3418
1011 Ga0496110_0077824 3300048913 Bacteria 2951
1012 Ga0496110_0088894 3300048913 Bacteria 2760
1013 Ga0496110_0123505 3300048913 Bacteria 2334
1014 Ga0496110_0240830 3300048913 Bacteria 1646
1015 Ga0496110_0263278 3300048913 Bacteria 1569
1016 Ga0496110_0463663 3300048913 Bacteria 1154
1017 Ga0496110_0493670 3300048913 Bacteria 1115
1018 Ga0496110_0595659 3300048913 Bacteria 1003
1019 Ga0496110_0678847 3300048913 Bacteria 931
1020 Ga0496110_1506529 3300048913 Bacteria 582
1021 Ga0496111_0000145 3300048914 Bacteria 31804
1022 Ga0496111_0001006 3300048914 Bacteria 15459
1023 Ga0496111_0007092 3300048914 Bacteria 7323
1024 Ga0496111_0031569 3300048914 Bacteria 3774
1025 Ga0496111_0163432 3300048914 Bacteria 1653
1026 Ga0496111_0197416 3300048914 Bacteria 1496
1027 Ga0496111_0229873 3300048914 Bacteria 1378
1028 Ga0496111_0357146 3300048914 Bacteria 1081
1029 Ga0496111_0723103 3300048914 Bacteria 723
1030 Ga0496111_0815489 3300048914 Bacteria 675
1031 Ga0496111_1057002 3300048914 Bacteria 580
1032 Ga0496111_1164809 3300048914 Bacteria 547
1033 Ga0496112_0061889 3300048915 Bacteria 3691
1034 Ga0496112_0120442 3300048915 Bacteria 2594
1035 Ga0496112_0164344 3300048915 Bacteria 2185
1036 Ga0496112_0328138 3300048915 Bacteria 1474
1037 Ga0496112_0687952 3300048915 Bacteria 951
1038 Ga0496112_1154516 3300048915 Bacteria 692
1039 Ga0496112_1162982 3300048915 Bacteria 689
1040 Ga0496113_0028768 3300048916 Bacteria 4001
1041 Ga0496113_0230183 3300048916 Bacteria 1478
1042 Ga0496113_0294524 3300048916 Bacteria 1299
1043 Ga0496113_0296900 3300048916 Bacteria 1293
1044 Ga0496113_0596492 3300048916 Bacteria 885
1045 Ga0496113_1590628 3300048916 Bacteria 503
1046 Ga0496114_0001039 3300048917 Bacteria 20885
1047 Ga0496114_0002645 3300048917 Bacteria 13671
1048 Ga0496114_0157750 3300048917 Bacteria 1971
1049 Ga0496114_0725367 3300048917 Bacteria 870
1050 Ga0496114_1301120 3300048917 Bacteria 614
1051 Ga0496115_0011744 3300048918 Bacteria 6578
1052 Ga0496115_0181771 3300048918 Bacteria 1738
1053 Ga0496115_0246438 3300048918 Bacteria 1472
1054 Ga0496115_0264092 3300048918 Bacteria 1415
1055 Ga0496115_0925345 3300048918 Bacteria 671
1056 Ga0501031_0002307 3300049568 Bacteria 12093
1057 Ga0501031_0047671 3300049568 Bacteria 2793
1058 Ga0501031_0196187 3300049568 Bacteria 1318
1059 Ga0501031_0437567 3300049568 Bacteria 845
1060 Ga0501032_0000134 3300049569 Bacteria 60304
1061 Ga0501032_0128464 3300049569 Bacteria 1673
1062 Ga0501033_0001709 3300049570 Bacteria 19227
1063 Ga0501033_0222770 3300049570 Bacteria 1342
1064 Ga0501034_0007950 3300049571 Bacteria 11264
1065 Ga0501034_0783871 3300049571 Bacteria 847
1066 Ga0501036_0001932 3300049572 Bacteria 16090
1067 Ga0501036_0147095 3300049572 Bacteria 1988
1068 Ga0501036_0263232 3300049572 Bacteria 1444
1069 Ga0501036_0574854 3300049572 Bacteria 936
1070 Ga0501036_0701283 3300049572 Bacteria 836
1071 Ga0501036_1729413 3300049572 Bacteria 504
1072 Ga0501037_0003907 3300049573 Bacteria 10809
1073 Ga0501038_0000554 3300049574 Bacteria 32977
1074 Ga0501038_0422444 3300049574 Bacteria 1028
1075 Ga0501038_0490631 3300049574 Bacteria 940
1076 Ga0501039_0001152 3300049575 Bacteria 19481
1077 Ga0501039_0006353 3300049575 Bacteria 8977
1078 Ga0501039_0191731 3300049575 Bacteria 1607
1079 Ga0501039_0467154 3300049575 Bacteria 991
1080 Ga0501039_0579079 3300049575 Bacteria 880
1081 Ga0501039_0615944 3300049575 Bacteria 851
1082 Ga0501040_0012064 3300049576 Bacteria 5656
1083 Ga0501040_0306054 3300049576 Bacteria 1136
1084 Ga0501040_0434227 3300049576 Bacteria 945
1085 Ga0501041_0041904 3300049577 Bacteria 2781
1086 Ga0501041_0054234 3300049577 Bacteria 2446
1087 Ga0501041_0219842 3300049577 Bacteria 1192
1088 Ga0501041_0350506 3300049577 Bacteria 933
1089 Ga0501041_0607933 3300049577 Bacteria 698
1090 Ga0501041_0709541 3300049577 Bacteria 644
1091 Ga0501042_0107309 3300049578 Bacteria 2010
1092 Ga0501042_0148959 3300049578 Bacteria 1687
1093 Ga0501042_0347159 3300049578 Bacteria 1073
1094 Ga0501042_0535152 3300049578 Bacteria 851
1095 Ga0501042_1234789 3300049578 Bacteria 545
1096 Ga0501043_0002482 3300049579 Bacteria 15606
1097 Ga0501046_0000172 3300049580 Bacteria 65712
1098 Ga0501046_0489161 3300049580 Bacteria 882
1099 Ga0501047_0000114 3300049581 Bacteria 97220
1100 Ga0501047_0026206 3300049581 Bacteria 5607
1101 Ga0501048_0003343 3300049582 Bacteria 12200
1102 Ga0501048_0113221 3300049582 Bacteria 1916
1103 Ga0501048_0198473 3300049582 Bacteria 1422
1104 Ga0501048_0872779 3300049582 Bacteria 647
1105 Ga0501067_0030285 3300049583 Bacteria 3001
1106 Ga0501067_0198789 3300049583 Bacteria 1116
1107 Ga0501067_0231537 3300049583 Bacteria 1028
1108 Ga0501068_0706426 3300049584 Bacteria 659
1109 Ga0501069_0064048 3300049585 Bacteria 2054
1110 Ga0501069_0170130 3300049585 Bacteria 1257
1111 Ga0501069_0216927 3300049585 Bacteria 1111
1112 Ga0501069_0313982 3300049585 Bacteria 920
1113 Ga0501069_0399708 3300049585 Bacteria 813
1114 Ga0501070_0000900 3300049586 Bacteria 27095
1115 Ga0501070_0015519 3300049586 Bacteria 6407
1116 Ga0501070_0190788 3300049586 Bacteria 1684
1117 Ga0501070_0324105 3300049586 Bacteria 1253
1118 Ga0501070_0710350 3300049586 Bacteria 794
1119 Ga0501071_0007623 3300049587 Bacteria 7129
1120 Ga0501071_0303278 3300049587 Bacteria 1211
1121 Ga0501071_0510957 3300049587 Bacteria 922
1122 Ga0501071_1442347 3300049587 Bacteria 531
1123 Ga0501072_0033399 3300049588 Bacteria 4032
1124 Ga0501072_0103584 3300049588 Bacteria 2262
1125 Ga0501072_0183886 3300049588 Bacteria 1667
1126 Ga0501072_0541297 3300049588 Bacteria 920
1127 Ga0501072_1181494 3300049588 Bacteria 594
1128 Ga0501073_0003847 3300049589 Bacteria 11262
1129 Ga0501073_0035211 3300049589 Bacteria 3560
1130 Ga0501074_0002120 3300049590 Bacteria 13704
1131 Ga0501074_0129821 3300049590 Bacteria 1803
1132 Ga0501074_0220722 3300049590 Bacteria 1350
1133 Ga0501074_0281730 3300049590 Bacteria 1182
1134 Ga0501074_0362678 3300049590 Bacteria 1028
1135 Ga0501074_0598980 3300049590 Bacteria 779
1136 Ga0501075_0051304 3300049591 Bacteria 3102
1137 Ga0501075_0323065 3300049591 Bacteria 1176
1138 Ga0501075_1301713 3300049591 Bacteria 551
1139 Ga0501076_0017143 3300049592 Bacteria 5502
1140 Ga0501076_0100627 3300049592 Bacteria 2329
1141 Ga0501076_0168107 3300049592 Bacteria 1787
1142 Ga0501076_0571824 3300049592 Bacteria 932
1143 Ga0501076_0979547 3300049592 Bacteria 697
1144 Ga0501076_1179299 3300049592 Bacteria 630
1145 Ga0501077_0005556 3300049593 Bacteria 7674
1146 Ga0501077_0059995 3300049593 Bacteria 2414
1147 Ga0501077_0691637 3300049593 Bacteria 655
1148 Ga0501077_0692550 3300049593 Bacteria 655
1149 Ga0501250_089778 3300049680 Bacteria 534
1150 Ga0501079_0013295 3300049741 Bacteria 6276
1151 Ga0501079_0170911 3300049741 Bacteria 1695
1152 Ga0501079_0505551 3300049741 Bacteria 950
1153 Ga0501079_0789404 3300049741 Bacteria 748
1154 Ga0501079_0830253 3300049741 Bacteria 728
1155 Ga0501080_0001104 3300049742 Bacteria 22226
1156 Ga0501080_0216037 3300049742 Bacteria 1756
1157 Ga0501080_0282827 3300049742 Bacteria 1508
1158 Ga0501080_0339022 3300049742 Bacteria 1359
1159 Ga0501081_0014542 3300049743 Bacteria 5192
1160 Ga0501081_0198462 3300049743 Bacteria 1455
1161 Ga0501083_0005006 3300049744 Bacteria 9391
1162 Ga0501035_0019227 3300049822 Bacteria 6288
1163 Ga0501044_0015622 3300049823 Bacteria 8177
1164 Ga0501044_0673078 3300049823 Bacteria 922
1165 Ga0501045_0006569 3300049824 Bacteria 8059
1166 Ga0501045_0036943 3300049824 Bacteria 3549
1167 Ga0501045_0223990 3300049824 Bacteria 1400
1168 Ga0501045_0248864 3300049824 Bacteria 1323
1169 Ga0501045_0772180 3300049824 Bacteria 708
1170 Ga0501045_1089641 3300049824 Bacteria 584
1171 Ga0501045_1106754 3300049824 Bacteria 579
1172 nmdc:mga03683_257529_c1 3300050489 Bacteria 811
1173 nmdc:mga03683_33954_c1 3300050489 Bacteria 2062
1174 nmdc:mga03n38_141078_c1 3300050490 Bacteria 1203
1175 nmdc:mga03n38_167176_c1 3300050490 Bacteria 1118
1176 nmdc:mga03n38_199216_c1 3300050490 Bacteria 1036
1177 nmdc:mga03n38_403334_c1 3300050490 Bacteria 753
1178 nmdc:mga03n38_530857_c1 3300050490 Bacteria 664
1179 nmdc:mga03n38_88502_c1 3300050490 Bacteria 1469
1180 nmdc:mga00v17_121058_c1 3300050491 Bacteria 1666
1181 nmdc:mga00v17_1324_c1 3300050491 Bacteria 12971
1182 nmdc:mga00v17_152907_c1 3300050491 Bacteria 1483
1183 nmdc:mga00v17_18888_c1 3300050491 Bacteria 3924
1184 nmdc:mga00v17_236298_c1 3300050491 Bacteria 1184
1185 nmdc:mga00v17_283426_c1 3300050491 Bacteria 1076
1186 nmdc:mga00v17_634318_c1 3300050491 Bacteria 688
1187 nmdc:mga00v17_65716_c1 3300050491 Bacteria 2238
1188 nmdc:mga0yw44_114768_c1 3300050492 Bacteria 1729
1189 nmdc:mga0yw44_251337_c1 3300050492 Bacteria 1177
1190 nmdc:mga0yw44_271420_c1 3300050492 Bacteria 1132
1191 nmdc:mga0yw44_283991_c1 3300050492 Bacteria 1107
1192 nmdc:mga0yw44_437849_c1 3300050492 Bacteria 886
1193 nmdc:mga0yw44_438389_c1 3300050492 Bacteria 885
1194 nmdc:mga0yw44_45624_c1 3300050492 Bacteria 2628
1195 nmdc:mga0yw44_47916_c1 3300050492 Bacteria 2575
1196 nmdc:mga0yw44_541547_c1 3300050492 Bacteria 790
1197 nmdc:mga0yw44_57947_c1 3300050492 Bacteria 2365
1198 nmdc:mga0yw44_656347_c1 3300050492 Bacteria 713
1199 nmdc:mga0yw44_790032_c1 3300050492 Bacteria 645
1200 nmdc:mga0yw44_79644_c1 3300050492 Bacteria 2050
1201 nmdc:mga06z11_1030775_c1 3300050494 Bacteria 502
1202 nmdc:mga06z11_192020_c1 3300050494 Bacteria 1183
1203 nmdc:mga06z11_22558_c1 3300050494 Bacteria 2943
1204 nmdc:mga06z11_800748_c1 3300050494 Bacteria 574
1205 nmdc:mga04h51_57812_c1 3300050495 Bacteria 1321
1206 nmdc:mga04h51_5950_c1 3300050495 Bacteria 3134
1207 nmdc:mga07m45_21108_c1 3300050496 Bacteria 3543
1208 nmdc:mga07m45_39082_c1 3300050496 Bacteria 2650
1209 nmdc:mga07m45_9783_c1 3300050496 Bacteria 4987
1210 nmdc:mga05p37_30566_c1 3300050507 Bacteria 6572
1211 nmdc:mga05p37_43526_c1 3300050507 Bacteria 5524
1212 nmdc:mga05p37_471850_c1 3300050507 Bacteria 1448
1213 nmdc:mga05p37_528306_c1 3300050507 Unclassified 1348
1214 nmdc:mga05p37_714463_c1 3300050507 Bacteria 1111
1215 nmdc:mga09592_1105801_c1 3300050508 Bacteria 659
1216 nmdc:mga09592_392815_c1 3300050508 Bacteria 1199
1217 nmdc:mga09592_609531_c1 3300050508 Bacteria 935
1218 nmdc:mga0qj67_147773_c1 3300050509 Bacteria 1906
1219 nmdc:mga0qj67_70349_c1 3300050509 Bacteria 2791
1220 nmdc:mga06r32_133121_c1 3300050510 Bacteria 2460
1221 nmdc:mga06r32_205405_c1 3300050510 Bacteria 1958
1222 nmdc:mga06r32_77962_c1 3300050510 Bacteria 3220
1223 nmdc:mga06r32_9581_c1 3300050510 Bacteria 8748
1224 nmdc:mga08y16_129918_c1 3300050511 Bacteria 2621
1225 nmdc:mga08y16_141711_c1 3300050511 Bacteria 2499
1226 nmdc:mga08y16_226021_c1 3300050511 Bacteria 1937
1227 nmdc:mga08y16_275565_c1 3300050511 Bacteria 1736
1228 nmdc:mga08y16_486399_c1 3300050511 Bacteria 1255
1229 nmdc:mga08y16_533353_c1 3300050511 Bacteria 1189
1230 nmdc:mga08y16_794814_c1 3300050511 Bacteria 939
1231 nmdc:mga0n895_104241_c1 3300050512 Bacteria 2848
1232 nmdc:mga0n895_1211584_c1 3300050512 Bacteria 728
1233 nmdc:mga0n895_1683238_c1 3300050512 Unclassified 597
1234 nmdc:mga0n895_1845956_c1 3300050512 Bacteria 564
1235 nmdc:mga0n895_190576_c1 3300050512 Bacteria 2082
1236 nmdc:mga0n895_1920765_c1 3300050512 Bacteria 551
1237 nmdc:mga0n895_214736_c1 3300050512 Bacteria 1953
1238 nmdc:mga0n895_383324_c1 3300050512 Bacteria 1422
1239 nmdc:mga0rr50_141946_c1 3300050513 Bacteria 1933
1240 nmdc:mga0rr50_147991_c1 3300050513 Bacteria 1895
1241 nmdc:mga0rr50_31543_c1 3300050513 Bacteria 3765
1242 nmdc:mga0rr50_710683_c1 3300050513 Bacteria 858
1243 nmdc:mga0rr50_760464_c1 3300050513 Bacteria 827
1244 nmdc:mga08x19_429010_c1 3300050514 Bacteria 929
1245 nmdc:mga08x19_83931_c1 3300050514 Bacteria 2095
1246 nmdc:mga0a205_137521_c1 3300050515 Bacteria 2343
1247 nmdc:mga0a205_272355_c1 3300050515 Unclassified 1570
1248 nmdc:mga0a205_364882_c1 3300050515 Bacteria 1310
1249 nmdc:mga0a205_42279_c1 3300050515 Bacteria 4391
1250 nmdc:mga0a205_711211_c1 3300050515 Bacteria 854
1251 Ga0495601_0029525 3300053077 Bacteria 3402
1252 Ga0495601_0681841 3300053077 Bacteria 656
1253 Ga0495612_0090725 3300053078 Bacteria 1293
1254 Ga0495655_0068085 3300053083 Bacteria 989
1255 Ga0495655_0160911 3300053083 Bacteria 712
1256 Ga0495595_0025928 3300053084 Bacteria 2600
1257 Ga0495595_0101381 3300053084 Bacteria 1390
1258 Ga0495619_0064871 3300053085 Unclassified 2436
1259 Ga0495619_0175690 3300053085 Bacteria 1481
1260 Ga0495619_0259114 3300053085 Bacteria 1205
1261 Ga0500644_0000128 3300053088 Bacteria 46307
1262 Ga0500644_0108472 3300053088 Bacteria 1066
1263 Ga0500554_212052 3300053102 Bacteria 646
1264 Ga0500556_0001240 3300053104 Bacteria 11816
1265 Ga0500573_0312601 3300053140 Bacteria 780
1266 Ga0501084_0000711 3300054114 Bacteria 25412
1267 Ga0501084_0283508 3300054114 Bacteria 1399
1268 Ga0501084_0429605 3300054114 Bacteria 1117
1269 Ga0501084_0481626 3300054114 Bacteria 1049
1270 Ga0501084_1704488 3300054114 Bacteria 527
1271 Ga0501082_0055233 3300060353 Bacteria 3421
1272 Ga0501082_0334723 3300060353 Bacteria 1319
1273 Ga0501082_0483830 3300060353 Bacteria 1082
1274 Ga0501082_0664487 3300060353 Bacteria 912
1275 Ga0501082_0664824 3300060353 Bacteria 912
1276 Ga0501082_0711522 3300060353 Bacteria 879
1277 Ga0501082_0861008 3300060353 Bacteria 793
1278 Ga0501082_1740424 3300060353 Bacteria 544
1279 Ga0466962_0001251 3300061719 Bacteria 11721
1280 Ga0466962_0062724 3300061719 Bacteria 1775
1281 Ga0466962_0754083 3300061719 Bacteria 501
1282 Ga0530510_0046945 3300061734 Bacteria 3120
1283 Ga0530510_0055215 3300061734 Bacteria 2869
1284 Ga0530510_0103335 3300061734 Bacteria 2084
1285 Ga0530510_1334357 3300061734 Bacteria 550
1286 2676478076 2675903058 Bacteria 6822861
1287 2753272057 2751185782 Bacteria 11227053
1288 2774393789 2773857762 Bacteria 5971770
1289 2809195335 2808606439 Bacteria 5952208
1290 2812350209 2811994878 Bacteria 5992952
1291 2827629406 2827628540 Bacteria 6858585
1292 2855387448 2855386786 Bacteria 4752232
1293 2883823597 2883821847 Bacteria 5121194
1294 2891972166 2891968417 Bacteria 5821697
1295 2897564570 2897561785 Bacteria 3256946
1296 2984577134 2984576629 Bacteria 4248407
1297 2990260455 2990256926 Bacteria 4252839
1298 Ga0314311_1214342
1299 LJQas_1004621
1300 JGI24740J21852_10083557
1301 JGI24739J22299_10103608
1302 JGI24737J22298_10226241
1303 JGI24737J22298_10251388
1304 JGI24738J21930_10013118
1305 JGI24738J21930_10031848
1306 Ga0070658_10179980
1307 Ga0070683_100001049
1308 Ga0070683_100003297
1309 Ga0070683_100025448
1310 Ga0070683_100030750
1311 Ga0070683_100044814
1312 Ga0070683_100049206
1313 Ga0070683_100143693
1314 Ga0070683_100168821
1315 Ga0070683_100179135
1316 Ga0070683_100380727
1317 Ga0070683_100436690
1318 Ga0070683_100917085
1319 Ga0070683_100989056
1320 Ga0070670_100016510
1321 Ga0068869_100118398
1322 Ga0068869_101044449
1323 Ga0070680_100025051
1324 Ga0070682_100062861
1325 Ga0070682_100357489
1326 Ga0070682_101442825
1327 Ga0068868_100066218
1328 Ga0068868_100243399
1329 Ga0068868_100847373
1330 Ga0068868_101530381
1331 Ga0070660_100302694
1332 Ga0070660_100320104
1333 Ga0070660_100348650
1334 Ga0070660_100427520
1335 Ga0070689_100435419
1336 Ga0070689_100482017
1337 Ga0070691_10007979
1338 Ga0070691_10088069
1339 Ga0070687_100056070
1340 Ga0070661_100351675
1341 Ga0070661_100424870
1342 Ga0070661_100737249
1343 Ga0070661_101763969
1344 Ga0070692_10002528
1345 Ga0070692_10497542
1346 Ga0070692_10858717
1347 Ga0070668_100000590
1348 Ga0070668_100025560
1349 Ga0070668_100254163
1350 Ga0070668_100486686
1351 Ga0070668_100681944
1352 Ga0070669_100273624
1353 Ga0070669_100592968
1354 Ga0070675_100146644
1355 Ga0070675_100208810
1356 Ga0070671_100384235
1357 Ga0070674_100099915
1358 Ga0070674_100139306
1359 Ga0070674_100182751
1360 Ga0070674_100454636
1361 Ga0070674_101395355
1362 Ga0070688_101201689
1363 Ga0070659_100017763
1364 Ga0070659_100057950
1365 Ga0070659_100330778
1366 Ga0070659_100547078
1367 Ga0070659_100709760
1368 Ga0070659_100739122
1369 Ga0070667_100852818
1370 Ga0070714_100054083
1371 Ga0070714_100597391
1372 Ga0070714_100966826
1373 Ga0070713_100016526
1374 Ga0070713_101421663
1375 Ga0070710_10301056
1376 Ga0070700_100317301
1377 Ga0070700_100396849
1378 Ga0070700_101379467
1379 Ga0070694_101312896
1380 Ga0070708_100834914
1381 Ga0070663_100201049
1382 Ga0070663_100295609
1383 Ga0070663_101254166
1384 Ga0070678_100004765
1385 Ga0070678_100361027
1386 Ga0070678_100531435
1387 Ga0070662_100069041
1388 Ga0070662_100440541
1389 Ga0070681_10023644
1390 Ga0070681_10337392
1391 Ga0070681_11936590
1392 Ga0068867_100028221
1393 Ga0068867_100550679
1394 Ga0070685_10358055
1395 Ga0070685_10557578
1396 Ga0070706_100658583
1397 Ga0070707_101034651
1398 Ga0070698_100018611
1399 Ga0070698_100340528
1400 Ga0070699_100017915
1401 Ga0070679_100026379
1402 Ga0070679_100151610
1403 Ga0070679_101335033
1404 Ga0070684_100000789
1405 Ga0070684_100001346
1406 Ga0070684_100009409
1407 Ga0070684_100017306
1408 Ga0070684_100025677
1409 Ga0070684_100112946
1410 Ga0070684_100157631
1411 Ga0070684_100158676
1412 Ga0070684_100583236
1413 Ga0070684_100773412
1414 Ga0070684_100852822
1415 Ga0070697_100087737
1416 Ga0070697_100095055
1417 Ga0068853_100958835
1418 Ga0070672_100067473
1419 Ga0070672_100429394
1420 Ga0070672_100440768
1421 Ga0070686_100010126
1422 Ga0070686_100334120
1423 Ga0070695_100068715
1424 Ga0070695_100255484
1425 Ga0070693_100006493
1426 Ga0070665_100071496
1427 Ga0070665_100132717
1428 Ga0068855_100103863
1429 Ga0068855_101955504
1430 Ga0070664_100006150
1431 Ga0070664_100012395
1432 Ga0070664_101460601
1433 Ga0068857_100000049
1434 Ga0068857_100009622
1435 Ga0068857_100066232
1436 Ga0068857_100993192
1437 Ga0068854_100295002
1438 Ga0068854_101441923
1439 Ga0068856_100001926
1440 Ga0068856_100180096
1441 Ga0068856_100373643
1442 Ga0068856_100787675
1443 Ga0068856_100915610
1444 Ga0070702_100002194
1445 Ga0068852_100010997
1446 Ga0068852_100368523
1447 Ga0068859_100375629
1448 Ga0068864_100109881
1449 Ga0068864_100336567
1450 Ga0068866_10635385
1451 Ga0068866_11123852
1452 Ga0068861_100036348
1453 Ga0068861_100096130
1454 Ga0068861_100693417
1455 Ga0068861_102547950
1456 Ga0068851_10263679
1457 Ga0068870_10008883
1458 Ga0068870_10017164
1459 Ga0068870_10179056
1460 Ga0068863_101110377
1461 Ga0068863_101276885
1462 Ga0068858_100053466
1463 Ga0068858_101246903
1464 Ga0068860_100171471
1465 Ga0068862_100028413
1466 Ga0068862_100032567
1467 Ga0068862_100200952
1468 Ga0081455_10006745
1469 Ga0081455_10009622
1470 Ga0081455_10024299
1471 Ga0081455_10043052
1472 Ga0081455_10359689
1473 Ga0081455_10551554
1474 Ga0081538_10000991
1475 Ga0081538_10026155
1476 Ga0081540_1006355
1477 Ga0081540_1168274
1478 Ga0081539_10017208
1479 Ga0081539_10019195
1480 Ga0075365_10022170
1481 Ga0075365_10050645
1482 Ga0075365_10069991
1483 Ga0075365_10080802
1484 Ga0075365_10181775
1485 Ga0075365_10205940
1486 Ga0075365_10210768
1487 Ga0075365_10248219
1488 Ga0075365_10444527
1489 Ga0075365_10488275
1490 Ga0075365_10672344
1491 Ga0075368_10001368
1492 Ga0075368_10001555
1493 Ga0075368_10104738
1494 Ga0075363_100001987
1495 Ga0075363_100016457
1496 Ga0075363_100053059
1497 Ga0075363_100121778
1498 Ga0075363_100237034
1499 Ga0075363_100388881
1500 Ga0075363_100554717
1501 Ga0075364_10030886
1502 Ga0075364_10852332
1503 Ga0075364_11037997
1504 Ga0075432_10035480
1505 Ga0075432_10265657
1506 Ga0075432_10289166
1507 Ga0070715_10085225
1508 Ga0070712_101651969
1509 Ga0075362_10072659
1510 Ga0075362_10146917
1511 Ga0075367_10016900
1512 Ga0075367_10133466
1513 Ga0075367_10181727
1514 Ga0075367_10515624
1515 Ga0097621_100245409
1516 Ga0075370_10001859
1517 Ga0075370_10013364
1518 Ga0075370_10022023
1519 Ga0075370_10099799
1520 Ga0075370_10569323
1521 Ga0068871_101844247
1522 Ga0075428_100096948
1523 Ga0075428_100228142
1524 Ga0075428_100916187
1525 Ga0075430_100031516
1526 Ga0075430_100102275
1527 Ga0075430_100157312
1528 Ga0075431_100018073
1529 Ga0075431_100072638
1530 Ga0075431_100247833
1531 Ga0075431_100552414
1532 Ga0075431_100994343
1533 Ga0075431_101057047
1534 Ga0075433_10085696
1535 Ga0075433_10317391
1536 Ga0075433_10376719
1537 Ga0075433_10680091
1538 Ga0075434_100170226
1539 Ga0075434_100217813
1540 Ga0075434_100919081
1541 Ga0075429_100065939
1542 Ga0075429_100286470
1543 Ga0075429_100329354
1544 Ga0068865_100012214
1545 Ga0068865_100128854
1546 Ga0068865_100254447
1547 Ga0068865_100291436
1548 Ga0075436_100004843
1549 Ga0075436_100578698
1550 Ga0075436_100638549
1551 Ga0097620_100375605
1552 Ga0075435_100053694
1553 Ga0075435_100056047
1554 Ga0099794_10171359
1555 Ga0111539_10054227
1556 Ga0111539_10121948
1557 Ga0111539_10267602
1558 Ga0111539_10335191
1559 Ga0111539_10688204
1560 Ga0111539_10853940
1561 Ga0105245_10009867
1562 Ga0105245_10031744
1563 Ga0105245_10056527
1564 Ga0105245_10082688
1565 Ga0105245_10101126
1566 Ga0105245_10114068
1567 Ga0105247_10574177
1568 Ga0114129_10091089
1569 Ga0114129_10105276
1570 Ga0114129_10275863
1571 Ga0114129_10687933
1572 Ga0105243_10002686
1573 Ga0105243_10012657
1574 Ga0105243_10143096
1575 Ga0105243_10240926
1576 Ga0105243_10274301
1577 Ga0105243_10285118
1578 Ga0105243_10687605
1579 Ga0105243_10912383
1580 Ga0105243_11186688
1581 Ga0105243_11208803
1582 Ga0105243_12343996
1583 Ga0105241_10274263
1584 Ga0105241_11675978
1585 Ga0105241_12247208
1586 Ga0105242_10039331
1587 Ga0105242_10521723
1588 Ga0105248_10476678
1589 Ga0105237_10078765
1590 Ga0105237_11232872
1591 Ga0105238_10268135
1592 Ga0105238_10429507
1593 Ga0105238_10595633
1594 Ga0105238_10605407
1595 Ga0105249_10037012
1596 Ga0105249_10062217
1597 Ga0105249_10590405
1598 Ga0105249_10776232
1599 Ga0105239_10249036
1600 Ga0105239_10363856
1601 Ga0105239_10381986
1602 Ga0105246_10051047
1603 Ga0105246_10199756
1604 Ga0105246_10258746
1605 Ga0105246_11102218
1606 Ga0105246_11196627
1607 Ga0157320_1031276
1608 Ga0157325_1003308
1609 Ga0157345_1006741
1610 Ga0157313_1044403
1611 Ga0157339_1035448
1612 Ga0157316_1003846
1613 Ga0157326_1010535
1614 Ga0157371_10057438
1615 Ga0157371_10133911
1616 Ga0157371_10581890
1617 Ga0157371_10690713
1618 Ga0157370_10686886
1619 Ga0157369_10007989
1620 Ga0157369_10638235
1621 Ga0157369_10986432
1622 Ga0157369_11895579
1623 Ga0157369_12172800
1624 Ga0157374_10281602
1625 Ga0157374_10473943
1626 Ga0157378_10415366
1627 Ga0157378_10995870
1628 Ga0157378_11386105
1629 Ga0163162_10023432
1630 Ga0163162_10217897
1631 Ga0163162_10626841
1632 Ga0157372_10024844
1633 Ga0157372_10043420
1634 Ga0157372_10301443
1635 Ga0157372_10569810
1636 Ga0157372_11426029
1637 Ga0157372_11446346
1638 Ga0157372_12198257
1639 Ga0157375_10321216
1640 Ga0157375_10364197
1641 Ga0157375_10775492
1642 Ga0157375_12793632
1643 Ga0163163_10924164
1644 Ga0163163_11423726
1645 Ga0163163_11731653
1646 Ga0163163_12066327
1647 Ga0163163_12233016
1648 Ga0163163_12459500
1649 Ga0157380_10019024
1650 Ga0157380_10107939
1651 Ga0157380_10135274
1652 Ga0157380_10358833
1653 Ga0157380_11604499
1654 Ga0157380_12020099
1655 Ga0182008_10157917
1656 Ga0182008_10220361
1657 Ga0182008_10445139
1658 Ga0182008_10660180
1659 Ga0157377_10055967
1660 Ga0157377_10306734
1661 Ga0157377_10363840
1662 Ga0157379_10717617
1663 Ga0157376_10575677
1664 Ga0157376_11938530
1665 Ga0163161_10010383
1666 Ga0163161_10135627
1667 Ga0206356_11902212
1668 Ga0206349_1251648
1669 Ga0206354_10753636
1670 Ga0206354_11048389
1671 Ga0206353_11655497
1672 Ga0224712_10004575
1673 Ga0224712_10005001
1674 Ga0207697_10085522
1675 Ga0207656_10572095
1676 Ga0207692_10871216
1677 Ga0207642_10107628
1678 Ga0207642_10816027
1679 Ga0207710_10566902
1680 Ga0207688_10002263
1681 Ga0207688_10006046
1682 Ga0207688_10028851
1683 Ga0207680_10395076
1684 Ga0207647_10039538
1685 Ga0207699_10083460
1686 Ga0207643_10071100
1687 Ga0207705_10081285
1688 Ga0207705_10515648
1689 Ga0207684_10547618
1690 Ga0207654_10833390
1691 Ga0207654_10852799
1692 Ga0207707_10371994
1693 Ga0207707_10698883
1694 Ga0207707_10854964
1695 Ga0207671_10087900
1696 Ga0207671_10857000
1697 Ga0207693_10220907
1698 Ga0207693_10221956
1699 Ga0207663_10253289
1700 Ga0207660_10055167
1701 Ga0207660_10062273
1702 Ga0207662_10013678
1703 Ga0207662_10676021
1704 Ga0207657_10030451
1705 Ga0207657_10326722
1706 Ga0207657_10495530
1707 Ga0207657_10525802
1708 Ga0207649_10118853
1709 Ga0207649_10309218
1710 Ga0207649_10456386
1711 Ga0207652_10028765
1712 Ga0207652_10116794
1713 Ga0207652_10182445
1714 Ga0207652_10227168
1715 Ga0207652_10410472
1716 Ga0207681_10360947
1717 Ga0207681_10600134
1718 Ga0207694_10005510
1719 Ga0207694_10274876
1720 Ga0207694_10433437
1721 Ga0207650_10005827
1722 Ga0207650_10388986
1723 Ga0207659_10107398
1724 Ga0207659_10141318
1725 Ga0207687_10010008
1726 Ga0207687_10033318
1727 Ga0207687_10050468
1728 Ga0207687_10202442
1729 Ga0207687_10804735
1730 Ga0207687_11423877
1731 Ga0207700_10057208
1732 Ga0207700_11499021
1733 Ga0207700_11622302
1734 Ga0207664_10057502
1735 Ga0207664_10516511
1736 Ga0207690_10014913
1737 Ga0207690_10143201
1738 Ga0207690_11084159
1739 Ga0207690_11229757
1740 Ga0207706_10037907
1741 Ga0207706_10198100
1742 Ga0207706_10252454
1743 Ga0207686_10009994
1744 Ga0207709_10035006
1745 Ga0207709_10052142
1746 Ga0207709_10180746
1747 Ga0207709_10235486
1748 Ga0207709_10799803
1749 Ga0207709_10968484
1750 Ga0207670_10841485
1751 Ga0207669_10349816
1752 Ga0207669_10417421
1753 Ga0207669_10576854
1754 Ga0207669_11225694
1755 Ga0207704_10045603
1756 Ga0207704_10050681
1757 Ga0207704_10232188
1758 Ga0207704_10383057
1759 Ga0207704_10475084
1760 Ga0207691_10011852
1761 Ga0207691_10133082
1762 Ga0207691_10942234
1763 Ga0207689_10212445
1764 Ga0207689_10271054
1765 Ga0207689_10444211
1766 Ga0207661_10000292
1767 Ga0207661_10001315
1768 Ga0207661_10027515
1769 Ga0207661_10036687
1770 Ga0207661_10050549
1771 Ga0207661_10110770
1772 Ga0207661_10205996
1773 Ga0207661_10489627
1774 Ga0207661_10595872
1775 Ga0207661_10615882
1776 Ga0207661_10645936
1777 Ga0207661_11450718
1778 Ga0207679_10019263
1779 Ga0207679_10059956
1780 Ga0207679_10553327
1781 Ga0207679_12006562
1782 Ga0207679_12111295
1783 Ga0207667_10345591
1784 Ga0207667_11526411
1785 Ga0207712_10014366
1786 Ga0207712_10014929
1787 Ga0207712_10061461
1788 Ga0207712_11047001
1789 Ga0207712_11577711
1790 Ga0207668_10002263
1791 Ga0207668_10010876
1792 Ga0207668_10051446
1793 Ga0207668_10380673
1794 Ga0207668_10519808
1795 Ga0207640_10260273
1796 Ga0207640_11124208
1797 Ga0207640_11419404
1798 Ga0207658_10033125
1799 Ga0207658_10355857
1800 Ga0207677_10170045
1801 Ga0207677_10183253
1802 Ga0207677_10816032
1803 Ga0207703_10022643
1804 Ga0207639_10352173
1805 Ga0207639_10964288
1806 Ga0207639_11342263
1807 Ga0207678_10433510
1808 Ga0207678_10678639
1809 Ga0207678_10982741
1810 Ga0207708_10031287
1811 Ga0207708_10136545
1812 Ga0207708_10179081
1813 Ga0207708_10521619
1814 Ga0207702_10004483
1815 Ga0207702_10011683
1816 Ga0207702_10042588
1817 Ga0207702_10230748
1818 Ga0207702_10243829
1819 Ga0207702_10252733
1820 Ga0207702_10656184
1821 Ga0207702_11784155
1822 Ga0207702_12215730
1823 Ga0207641_10067802
1824 Ga0207641_11262039
1825 Ga0207648_10001192
1826 Ga0207648_10182214
1827 Ga0207648_10881936
1828 Ga0207676_10642841
1829 Ga0207676_11493648
1830 Ga0207676_11717879
1831 Ga0207676_12096695
1832 Ga0207674_10000027
1833 Ga0207674_10012854
1834 Ga0207674_10019122
1835 Ga0207674_10048634
1836 Ga0207674_10075250
1837 Ga0207674_10138670
1838 Ga0207674_11269742
1839 Ga0207675_100014819
1840 Ga0207675_100059029
1841 Ga0207675_100141323
1842 Ga0207675_100543637
1843 Ga0207675_101732449
1844 Ga0207683_10194119
1845 Ga0207683_10209465
1846 Ga0207683_10528320
1847 Ga0207683_11500598
1848 Ga0207698_10926901
1849 Ga0207698_10933513
1850 Ga0207698_11261418
1851 Ga0209813_10005252
1852 Ga0207428_10012230
1853 Ga0207428_10469972
1854 Ga0207428_10860312
1855 Ga0268266_10176872
1856 Ga0268265_10056093
1857 Ga0268265_10127466
1858 Ga0268265_11226714
1859 Ga0268264_10017415
1860 Ga0265318_10102930
1861 Ga0265318_10274656
1862 Ga0265323_10052471
1863 Ga0265322_10023701
1864 Ga0265338_10115954
1865 Ga0307512_10114783
1866 Ga0265330_10044072
1867 Ga0265330_10152416
1868 Ga0265330_10418761
1869 Ga0265316_10017267
1870 Ga0265316_10035843
1871 Ga0265316_10061048
1872 Ga0265316_10285801
1873 Ga0307513_10233603
1874 Ga0307509_10082273
1875 Ga0307408_100552402
1876 Ga0316579_10052161
1877 Ga0265342_10056249
1878 Ga0307516_10401940
1879 Ga0307405_10316842
1880 Ga0307405_10739712
1881 Ga0307413_10299460
1882 Ga0307413_10312710
1883 Ga0307413_10490612
1884 Ga0307413_11137079
1885 Ga0307413_11922681
1886 Ga0307410_10022477
1887 Ga0307410_10249974
1888 Ga0307410_10300626
1889 Ga0307410_11473573
1890 Ga0307406_10063424
1891 Ga0307406_10514944
1892 Ga0307406_10822107
1893 Ga0307406_11117233
1894 Ga0307407_10212672
1895 Ga0307407_10217408
1896 Ga0307407_10244438
1897 Ga0307412_10161682
1898 Ga0307412_10394074
1899 Ga0307412_10441783
1900 Ga0307412_11143876
1901 Ga0307409_100124192
1902 Ga0307409_100168873
1903 Ga0307409_100272846
1904 Ga0307409_100365689
1905 Ga0307409_100389024
1906 Ga0307409_100579575
1907 Ga0307409_100835451
1908 Ga0307409_101775356
1909 Ga0307416_100023382
1910 Ga0307416_100137620
1911 Ga0307416_100288609
1912 Ga0307416_100360582
1913 Ga0307416_100385860
1914 Ga0307416_101061357
1915 Ga0307416_103161136
1916 Ga0307414_11591185
1917 Ga0307411_10269149
1918 Ga0307411_10335696
1919 Ga0307411_11447824
1920 Ga0307415_100000363
1921 Ga0307415_100040254
1922 Ga0307415_100050810
1923 Ga0307415_100574444
1924 Ga0307415_100622039
1925 Ga0307415_100899807
1926 Ga0307415_101221536
1927 Ga0307415_101316751
1928 Ga0307415_102484971
1929 Ga0307507_10039358
1930 Ga0307507_10595500
1931 Ga0373934_0345265
1932 Ga0373944_0128757
1933 Ga0373949_0061402
1934 Ga0373939_0289817
1935 Ga0373939_0320897
1936 Ga0373939_0365292
1937 Ga0373939_0433588
1938 Ga0373941_0383856
1939 Ga0373945_0383026
1940 Ga0373953_0093415
1941 Ga0373954_0003376
1942 Ga0373954_0079232
1943 Ga0373956_0000483
1944 Ga0373956_0146200
1945 Ga0373957_0140978
1946 Ga0373960_0460596
1947 Ga0373943_0170651
1948 Ga0373943_0920636
1949 Ga0373946_0424495
1950 Ga0373955_0127866
1951 Ga0373955_0380132
1952 Ga0373924_0015464
1953 Ga0373931_0068322
1954 Ga0373931_0188109
1955 Ga0373935_0016869
1956 Ga0373935_0077935
1957 Ga0373935_0332076
1958 Ga0373927_0000026
1959 Ga0373927_0013036
1960 Ga0373933_0121480
1961 Ga0373933_0445046
1962 Ga0373933_0535113
1963 Ga0373937_0259391
1964 Ga0373937_0261652
1965 Ga0373925_0004578
1966 Ga0373925_0184635
1967 Ga0395899_0008747
1968 Ga0395899_0027813
1969 Ga0395899_0028473
1970 Ga0395899_0048504
1971 Ga0395899_0049645
1972 Ga0395899_0052120
1973 Ga0395899_0181201
1974 Ga0395899_0232637
1975 Ga0395899_0278926
1976 Ga0395899_0423233
1977 Ga0395899_0424950
1978 Ga0395899_0445100
1979 Ga0395900_0012498
1980 Ga0395900_0014497
1981 Ga0395900_0031855
1982 Ga0395900_0031891
1983 Ga0395900_0040438
1984 Ga0395900_0042133
1985 Ga0395900_0044820
1986 Ga0395900_0087556
1987 Ga0395900_0088664
1988 Ga0395900_0300108
1989 Ga0395900_0314124
1990 Ga0395900_0359191
1991 Ga0395900_0631071
1992 Ga0395900_0769122
1993 Ga0395900_0863994
1994 Ga0395900_0888385
1995 Ga0395900_1068076
1996 Ga0395900_1346382
1997 Ga0395900_1705982
1998 Ga0395900_1877267
1999 Ga0395898_0004469
2000 Ga0395898_0009356
2001 Ga0395898_0029128
2002 Ga0395898_0032676
2003 Ga0395898_0051934
2004 Ga0395898_0053677
2005 Ga0395898_0054555
2006 Ga0395898_0084710
2007 Ga0395898_0122881
2008 Ga0395898_0134414
2009 Ga0395898_0143267
2010 Ga0395898_0165363
2011 Ga0395898_0209137
2012 Ga0395898_0219518
2013 Ga0395898_0354617
2014 Ga0395898_0404311
2015 Ga0395898_0587399
2016 Ga0395898_0593404
2017 Ga0395898_0862045
2018 Ga0395898_0959807
2019 Ga0395898_1042076
2020 Ga0395905_0008922
2021 Ga0395905_0012630
2022 Ga0395905_0026626
2023 Ga0395905_0073724
2024 Ga0395905_0076192
2025 Ga0395905_0101810
2026 Ga0395905_0118770
2027 Ga0395905_0145483
2028 Ga0395905_0158118
2029 Ga0395905_0334152
2030 Ga0395905_0528340
2031 Ga0395905_1405929
2032 Ga0436364_0914540
2033 Ga0436364_1241145
2034 Ga0395901_0015770
2035 Ga0395901_0025335
2036 Ga0395901_0026746
2037 Ga0395901_0031214
2038 Ga0395901_0044370
2039 Ga0395901_0103232
2040 Ga0395901_0103360
2041 Ga0395901_0105111
2042 Ga0395901_0113988
2043 Ga0395901_0226598
2044 Ga0395901_0241540
2045 Ga0395901_0291470
2046 Ga0395901_0304917
2047 Ga0395901_0379642
2048 Ga0395901_0510225
2049 Ga0395901_0556003
2050 Ga0395901_0570620
2051 Ga0395901_0608474
2052 Ga0395901_1632410
2053 Ga0436360_0319483
2054 Ga0436363_0517822
2055 Ga0451789_1250776
2056 Ga0451793_0679931
2057 Ga0451793_0701646
2058 Ga0451793_0760524
2059 Ga0451802_1134197
2060 Ga0451806_401815
2061 Ga0451833_0203593
2062 Ga0451833_1359684
2063 Ga0451833_1470194
2064 Ga0451851_0158388
2065 Ga0451843_0421537
2066 Ga0451853_1584429
2067 Ga0439448_0003027
2068 Ga0439448_0113132
2069 Ga0439448_0170091
2070 Ga0439450_087044
2071 Ga0439454_029482
2072 Ga0439463_020240
2073 Ga0450907_002740
2074 Ga0439458_0006874
2075 Ga0439444_0049133
2076 Ga0439464_0223506
2077 Ga0439460_0127504
2078 Ga0451577_0829296
2079 Ga0451577_1253805
2080 Ga0439440_0040968
2081 Ga0439440_0061932
2082 Ga0466969_0042453
2083 Ga0466969_0141291
2084 Ga0466972_0006438
2085 Ga0466965_0019736
2086 Ga0466965_0104375
2087 Ga0466965_0193136
2088 Ga0466965_0300615
2089 Ga0466965_0561479
2090 Ga0466965_0619370
2091 Ga0466965_0709244
2092 Ga0466966_0018855
2093 Ga0466966_0151904
2094 Ga0466961_0011157
2095 Ga0466961_0038925
2096 Ga0466961_0711146
2097 Ga0466963_0030288
2098 Ga0466963_0035757
2099 Ga0466963_0279868
2100 Ga0466963_0330324
2101 Ga0466963_0950244
2102 Ga0466964_0031346
2103 Ga0466971_0012142
2104 Ga0466971_0077065
2105 Ga0466971_0321859
2106 Ga0466968_0066476
2107 Ga0466970_0015868
2108 Ga0466970_0016905
2109 Ga0466970_0111610
2110 Ga0466970_0235383
2111 Ga0466970_0276217
2112 Ga0466957_0008423
2113 Ga0466957_0117329
2114 Ga0466957_0325845
2115 Ga0466957_0477600
2116 Ga0466957_0867804
2117 Ga0466960_0002889
2118 Ga0466960_0021348
2119 Ga0466960_0022406
2120 Ga0466960_0045709
2121 Ga0466960_0108854
2122 Ga0466960_0137514
2123 Ga0466960_0353594
2124 Ga0466959_0010301
2125 Ga0451576_0986570
2126 Ga0466958_0025758
2127 Ga0466958_0033899
2128 Ga0466958_0066091
2129 Ga0466958_0106717
2130 Ga0466967_0010143
2131 Ga0466967_0018278
2132 Ga0466967_0058609
2133 Ga0466967_0093387
2134 Ga0466967_0236420
2135 Ga0466967_0336901
2136 Ga0466967_0375482
2137 Ga0466967_0572052
2138 Ga0466967_0709297
2139 Ga0466967_0715582
2140 Ga0466967_0931867
2141 Ga0466967_1660923
2142 Ga0495627_193887
2143 Ga0495641_0038761
2144 Ga0495651_0054830
2145 Ga0495653_0192997
2146 Ga0495653_0290604
2147 Ga0495639_0139103
2148 Ga0495662_0065101
2149 Ga0495664_0319838
2150 Ga0495664_0704810
2151 Ga0495585_0053598
2152 Ga0495585_0163977
2153 Ga0495585_0552770
2154 Ga0495585_0554174
2155 Ga0495607_0094204
2156 Ga0495608_0030998
2157 Ga0495608_0304998
2158 Ga0495610_0264581
2159 Ga0495616_0065623
2160 Ga0495618_0084575
2161 Ga0495618_0579885
2162 Ga0495620_0024782
2163 Ga0495620_0035832
2164 Ga0495620_0143016
2165 Ga0495628_0128697
2166 Ga0495628_0375780
2167 Ga0495628_0592116
2168 Ga0495630_0046763
2169 Ga0495630_0503604
2170 Ga0495632_0054499
2171 Ga0495637_0115687
2172 Ga0495637_0237979
2173 Ga0495637_0289478
2174 Ga0495643_0245107
2175 Ga0495644_0048864
2176 Ga0495663_0008525
2177 Ga0495663_0133538
2178 Ga0495663_0151040
2179 Ga0495652_0042715
2180 Ga0495652_0376672
2181 Ga0495652_0813403
2182 Ga0495665_0242361
2183 Ga0495640_0119830
2184 Ga0495586_0053744
2185 Ga0495586_0179071
2186 Ga0495587_0016874
2187 Ga0495598_0095844
2188 Ga0495609_0032246
2189 Ga0495609_0222845
2190 Ga0495597_0038400
2191 Ga0495645_0230945
2192 Ga0495667_0150892
2193 Ga0495656_0072736
2194 Ga0495656_0089799
2195 Ga0495656_0096436
2196 Ga0495668_0000213
2197 Ga0495668_0700429
2198 Ga0495634_0033635
2199 Ga0495634_0382415
2200 Ga0495611_0278366
2201 Ga0495625_0002483
2202 Ga0495625_0342464
2203 Ga0495625_0359903
2204 Ga0495625_0372461
2205 Ga0495635_0068184
2206 Ga0495635_0222850
2207 Ga0495588_0327749
2208 Ga0495657_0026841
2209 Ga0495657_0234882
2210 Ga0495599_0549853
2211 Ga0495623_0018318
2212 Ga0495646_0028847
2213 Ga0495646_0487573
2214 Ga0495647_0035839
2215 Ga0495658_0096659
2216 Ga0495669_0040586
2217 Ga0495613_0425020
2218 Ga0495613_0552720
2219 Ga0495613_0740690
2220 Ga0495624_0160392
2221 Ga0495670_0096603
2222 Ga0495670_0238932
2223 Ga0495670_0528356
2224 Ga0495671_0068006
2225 Ga0495671_0189615
2226 Ga0495589_0090451
2227 Ga0495581_0051277
2228 Ga0495581_0080318
2229 Ga0495581_0446043
2230 Ga0495604_0035414
2231 Ga0495636_0154989
2232 Ga0495674_0053641
2233 Ga0495674_0107170
2234 Ga0495674_0241664
2235 Ga0495674_0352355
2236 Ga0495674_0546633
2237 Ga0495676_0074724
2238 Ga0495676_0492617
2239 Ga0495680_0014362
2240 Ga0495680_0030936
2241 Ga0495683_0398995
2242 Ga0495683_0463278
2243 Ga0495677_0100450
2244 Ga0495679_061605
2245 Ga0495684_0078704
2246 Ga0495684_0167555
2247 Ga0495593_0057991
2248 Ga0495602_0047953
2249 Ga0495626_0000656
2250 Ga0495626_0130722
2251 Ga0495626_0191205
2252 Ga0496100_0578621
2253 Ga0496100_0896681
2254 Ga0496100_1395037
2255 Ga0496101_0020254
2256 Ga0496101_0072790
2257 Ga0496101_0073914
2258 Ga0496101_0328845
2259 Ga0496101_0724929
2260 Ga0496102_0175572
2261 Ga0496102_0201154
2262 Ga0496102_0272612
2263 Ga0496102_0436712
2264 Ga0496102_1614405
2265 Ga0496103_0005348
2266 Ga0496103_0056286
2267 Ga0496104_0001713
2268 Ga0496104_0014519
2269 Ga0496104_0062575
2270 Ga0496104_0366683
2271 Ga0496104_0404531
2272 Ga0496104_0508522
2273 Ga0496104_1007726
2274 Ga0496104_1242821
2275 Ga0496105_0000128
2276 Ga0496105_0105160
2277 Ga0496105_0538936
2278 Ga0496105_0741361
2279 Ga0496105_0770002
2280 Ga0496105_1259028
2281 Ga0496106_0082392
2282 Ga0496106_0623088
2283 Ga0496106_1022245
2284 Ga0496107_0188029
2285 Ga0496107_0499459
2286 Ga0496107_1003219
2287 Ga0496108_0018761
2288 Ga0496108_0024079
2289 Ga0496108_0399103
2290 Ga0496108_0478203
2291 Ga0496108_0555613
2292 Ga0496108_0587669
2293 Ga0496108_0648051
2294 Ga0496108_1454921
2295 Ga0496109_0000408
2296 Ga0496109_0008215
2297 Ga0496109_0013354
2298 Ga0496109_0062912
2299 Ga0496109_0077537
2300 Ga0496109_0081602
2301 Ga0496109_0119303
2302 Ga0496109_0598985
2303 Ga0496109_0656158
2304 Ga0496109_0806862
2305 Ga0496110_0000289
2306 Ga0496110_0000929
2307 Ga0496110_0057708
2308 Ga0496110_0077824
2309 Ga0496110_0088894
2310 Ga0496110_0123505
2311 Ga0496110_0240830
2312 Ga0496110_0263278
2313 Ga0496110_0463663
2314 Ga0496110_0493670
2315 Ga0496110_0595659
2316 Ga0496110_0678847
2317 Ga0496110_1506529
2318 Ga0496111_0000145
2319 Ga0496111_0001006
2320 Ga0496111_0007092
2321 Ga0496111_0031569
2322 Ga0496111_0163432
2323 Ga0496111_0197416
2324 Ga0496111_0229873
2325 Ga0496111_0357146
2326 Ga0496111_0723103
2327 Ga0496111_0815489
2328 Ga0496111_1057002
2329 Ga0496111_1164809
2330 Ga0496112_0061889
2331 Ga0496112_0120442
2332 Ga0496112_0164344
2333 Ga0496112_0328138
2334 Ga0496112_0687952
2335 Ga0496112_1154516
2336 Ga0496112_1162982
2337 Ga0496113_0028768
2338 Ga0496113_0230183
2339 Ga0496113_0294524
2340 Ga0496113_0296900
2341 Ga0496113_0596492
2342 Ga0496113_1590628
2343 Ga0496114_0001039
2344 Ga0496114_0002645
2345 Ga0496114_0157750
2346 Ga0496114_0725367
2347 Ga0496114_1301120
2348 Ga0496115_0011744
2349 Ga0496115_0181771
2350 Ga0496115_0246438
2351 Ga0496115_0264092
2352 Ga0496115_0925345
2353 Ga0501031_0002307
2354 Ga0501031_0047671
2355 Ga0501031_0196187
2356 Ga0501031_0437567
2357 Ga0501032_0000134
2358 Ga0501032_0128464
2359 Ga0501033_0001709
2360 Ga0501033_0222770
2361 Ga0501034_0007950
2362 Ga0501034_0783871
2363 Ga0501036_0001932
2364 Ga0501036_0147095
2365 Ga0501036_0263232
2366 Ga0501036_0574854
2367 Ga0501036_0701283
2368 Ga0501036_1729413
2369 Ga0501037_0003907
2370 Ga0501038_0000554
2371 Ga0501038_0422444
2372 Ga0501038_0490631
2373 Ga0501039_0001152
2374 Ga0501039_0006353
2375 Ga0501039_0191731
2376 Ga0501039_0467154
2377 Ga0501039_0579079
2378 Ga0501039_0615944
2379 Ga0501040_0012064
2380 Ga0501040_0306054
2381 Ga0501040_0434227
2382 Ga0501041_0041904
2383 Ga0501041_0054234
2384 Ga0501041_0219842
2385 Ga0501041_0350506
2386 Ga0501041_0607933
2387 Ga0501041_0709541
2388 Ga0501042_0107309
2389 Ga0501042_0148959
2390 Ga0501042_0347159
2391 Ga0501042_0535152
2392 Ga0501042_1234789
2393 Ga0501043_0002482
2394 Ga0501046_0000172
2395 Ga0501046_0489161
2396 Ga0501047_0000114
2397 Ga0501047_0026206
2398 Ga0501048_0003343
2399 Ga0501048_0113221
2400 Ga0501048_0198473
2401 Ga0501048_0872779
2402 Ga0501067_0030285
2403 Ga0501067_0198789
2404 Ga0501067_0231537
2405 Ga0501068_0706426
2406 Ga0501069_0064048
2407 Ga0501069_0170130
2408 Ga0501069_0216927
2409 Ga0501069_0313982
2410 Ga0501069_0399708
2411 Ga0501070_0000900
2412 Ga0501070_0015519
2413 Ga0501070_0190788
2414 Ga0501070_0324105
2415 Ga0501070_0710350
2416 Ga0501071_0007623
2417 Ga0501071_0303278
2418 Ga0501071_0510957
2419 Ga0501071_1442347
2420 Ga0501072_0033399
2421 Ga0501072_0103584
2422 Ga0501072_0183886
2423 Ga0501072_0541297
2424 Ga0501072_1181494
2425 Ga0501073_0003847
2426 Ga0501073_0035211
2427 Ga0501074_0002120
2428 Ga0501074_0129821
2429 Ga0501074_0220722
2430 Ga0501074_0281730
2431 Ga0501074_0362678
2432 Ga0501074_0598980
2433 Ga0501075_0051304
2434 Ga0501075_0323065
2435 Ga0501075_1301713
2436 Ga0501076_0017143
2437 Ga0501076_0100627
2438 Ga0501076_0168107
2439 Ga0501076_0571824
2440 Ga0501076_0979547
2441 Ga0501076_1179299
2442 Ga0501077_0005556
2443 Ga0501077_0059995
2444 Ga0501077_0691637
2445 Ga0501077_0692550
2446 Ga0501250_089778
2447 Ga0501079_0013295
2448 Ga0501079_0170911
2449 Ga0501079_0505551
2450 Ga0501079_0789404
2451 Ga0501079_0830253
2452 Ga0501080_0001104
2453 Ga0501080_0216037
2454 Ga0501080_0282827
2455 Ga0501080_0339022
2456 Ga0501081_0014542
2457 Ga0501081_0198462
2458 Ga0501083_0005006
2459 Ga0501035_0019227
2460 Ga0501044_0015622
2461 Ga0501044_0673078
2462 Ga0501045_0006569
2463 Ga0501045_0036943
2464 Ga0501045_0223990
2465 Ga0501045_0248864
2466 Ga0501045_0772180
2467 Ga0501045_1089641
2468 Ga0501045_1106754
2469 nmdc:mga03683_257529_c1
2470 nmdc:mga03683_33954_c1
2471 nmdc:mga03n38_141078_c1
2472 nmdc:mga03n38_167176_c1
2473 nmdc:mga03n38_199216_c1
2474 nmdc:mga03n38_403334_c1
2475 nmdc:mga03n38_530857_c1
2476 nmdc:mga03n38_88502_c1
2477 nmdc:mga00v17_121058_c1
2478 nmdc:mga00v17_1324_c1
2479 nmdc:mga00v17_152907_c1
2480 nmdc:mga00v17_18888_c1
2481 nmdc:mga00v17_236298_c1
2482 nmdc:mga00v17_283426_c1
2483 nmdc:mga00v17_634318_c1
2484 nmdc:mga00v17_65716_c1
2485 nmdc:mga0yw44_114768_c1
2486 nmdc:mga0yw44_251337_c1
2487 nmdc:mga0yw44_271420_c1
2488 nmdc:mga0yw44_283991_c1
2489 nmdc:mga0yw44_437849_c1
2490 nmdc:mga0yw44_438389_c1
2491 nmdc:mga0yw44_45624_c1
2492 nmdc:mga0yw44_47916_c1
2493 nmdc:mga0yw44_541547_c1
2494 nmdc:mga0yw44_57947_c1
2495 nmdc:mga0yw44_656347_c1
2496 nmdc:mga0yw44_790032_c1
2497 nmdc:mga0yw44_79644_c1
2498 nmdc:mga06z11_1030775_c1
2499 nmdc:mga06z11_192020_c1
2500 nmdc:mga06z11_22558_c1
2501 nmdc:mga06z11_800748_c1
2502 nmdc:mga04h51_57812_c1
2503 nmdc:mga04h51_5950_c1
2504 nmdc:mga07m45_21108_c1
2505 nmdc:mga07m45_39082_c1
2506 nmdc:mga07m45_9783_c1
2507 nmdc:mga05p37_30566_c1
2508 nmdc:mga05p37_43526_c1
2509 nmdc:mga05p37_471850_c1
2510 nmdc:mga05p37_528306_c1
2511 nmdc:mga05p37_714463_c1
2512 nmdc:mga09592_1105801_c1
2513 nmdc:mga09592_392815_c1
2514 nmdc:mga09592_609531_c1
2515 nmdc:mga0qj67_147773_c1
2516 nmdc:mga0qj67_70349_c1
2517 nmdc:mga06r32_133121_c1
2518 nmdc:mga06r32_205405_c1
2519 nmdc:mga06r32_77962_c1
2520 nmdc:mga06r32_9581_c1
2521 nmdc:mga08y16_129918_c1
2522 nmdc:mga08y16_141711_c1
2523 nmdc:mga08y16_226021_c1
2524 nmdc:mga08y16_275565_c1
2525 nmdc:mga08y16_486399_c1
2526 nmdc:mga08y16_533353_c1
2527 nmdc:mga08y16_794814_c1
2528 nmdc:mga0n895_104241_c1
2529 nmdc:mga0n895_1211584_c1
2530 nmdc:mga0n895_1683238_c1
2531 nmdc:mga0n895_1845956_c1
2532 nmdc:mga0n895_190576_c1
2533 nmdc:mga0n895_1920765_c1
2534 nmdc:mga0n895_214736_c1
2535 nmdc:mga0n895_383324_c1
2536 nmdc:mga0rr50_141946_c1
2537 nmdc:mga0rr50_147991_c1
2538 nmdc:mga0rr50_31543_c1
2539 nmdc:mga0rr50_710683_c1
2540 nmdc:mga0rr50_760464_c1
2541 nmdc:mga08x19_429010_c1
2542 nmdc:mga08x19_83931_c1
2543 nmdc:mga0a205_137521_c1
2544 nmdc:mga0a205_272355_c1
2545 nmdc:mga0a205_364882_c1
2546 nmdc:mga0a205_42279_c1
2547 nmdc:mga0a205_711211_c1
2548 Ga0495601_0029525
2549 Ga0495601_0681841
2550 Ga0495612_0090725
2551 Ga0495655_0068085
2552 Ga0495655_0160911
2553 Ga0495595_0025928
2554 Ga0495595_0101381
2555 Ga0495619_0064871
2556 Ga0495619_0175690
2557 Ga0495619_0259114
2558 Ga0500644_0000128
2559 Ga0500644_0108472
2560 Ga0500554_212052
2561 Ga0500556_0001240
2562 Ga0500573_0312601
2563 Ga0501084_0000711
2564 Ga0501084_0283508
2565 Ga0501084_0429605
2566 Ga0501084_0481626
2567 Ga0501084_1704488
2568 Ga0501082_0055233
2569 Ga0501082_0334723
2570 Ga0501082_0483830
2571 Ga0501082_0664487
2572 Ga0501082_0664824
2573 Ga0501082_0711522
2574 Ga0501082_0861008
2575 Ga0501082_1740424
2576 Ga0466962_0001251
2577 Ga0466962_0062724
2578 Ga0466962_0754083
2579 Ga0530510_0046945
2580 Ga0530510_0055215
2581 Ga0530510_0103335
2582 Ga0530510_1334357
2583 2676478076
2584 2753272057
2585 2774393789
2586 2809195335
2587 2812350209
2588 2827629406
2589 2855387448
2590 2883823597
2591 2891972166
2592 2897564570
2593 2984577134
2594 2990260455

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00334

NDK

Nucleoside diphosphate kinase

27

158

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ay1-assembly5.cif.gz_E crystal structure of a nucleoside diphosphate kinase ndk from helicobacter pylori 0.9908 4 133
3vvu-assembly1.cif.gz_A crystal structure of reconstructed bacterial ancestral ndk, bac1 0.9876 4 133
6joh-assembly3.cif.gz_I the crystal of nucleoside diphosphate kinase from aspergillus flavus 0.9869 4 133
1ndk-assembly1.cif.gz_A x-ray structure of nucleoside diphosphate kinase 0.9868 4 133
2nck-assembly1.cif.gz_R crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution 0.9868 2 133
ID Description Score Start End Superfamily
af_C6T4F9_81_235_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9887 3 133 3.30.70.141
af_A0A1D6EH51_54_191_3.30.70.141 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9865 21 133 3.30.70.141
1k44A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.985 4 136 3.30.70.141
4w98A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9786 1 133 3.30.70.141
6ay1G00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleoside diphosphate kinase-like domain 0.9781 4 133 3.30.70.141
ID Description Score Start End GO Terms
AF-Q6A9I7-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9986 3 134 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A810MV00-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9983 3 134 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A1H1XVF1-F1-model_v4 Nucleoside diphosphate kinase (NDK) (NDP kinase) (EC 2.7.4.6) (Nucleoside-2-P kinase) 0.9976 3 134 GO:0004550
GO:0005524
GO:0005737
GO:0006183
GO:0006228
GO:0006241
GO:0046872
AF-A0A4R6LSG3-F1-model_v4 deleted 0.9968 1 136
AF-A0A542T7V1-F1-model_v4 deleted 0.9967 3 135

Map