F492647

General Info

Members Datasets Scaffolds Average Seq Length
1292 395 2584 78

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_11003768|Ga0070658_110037682
Length 81
Sequence MINPRIDELLDQVDSRYALVIVAAKRARQINNYHHQLGEGTFDEFAPPLIQSRSKNYLTMALEEIAEGKIVYDYSKTGAPR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
107 3300013062 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
126 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
199 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
211 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
212 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
213 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
214 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
215 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
216 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
220 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
242 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
243 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
244 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
245 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
246 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
249 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
250 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
251 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
252 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
253 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
254 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
255 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
258 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
259 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
260 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
261 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
262 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
263 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
264 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
265 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
271 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
272 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
273 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
283 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
284 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
306 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
307 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
312 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
325 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
326 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
327 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
328 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
329 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
330 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
331 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
332 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
348 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
349 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
350 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
351 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
352 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
353 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
354 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
355 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
361 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
362 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
366 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
373 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
374 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
375 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
394 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
395 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.75
Metatranscriptomes 3.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.52
Rhizosphere 89.71
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11003768 3300005327 Bacteria 726
2 JGI24737J22298_10192572 3300001990 Bacteria 602
3 JGI24743J22301_10119710 3300001991 Bacteria 576
4 Ga0058863_10058229 3300004799 Bacteria 510
5 Ga0070658_10159250 3300005327 Bacteria 1893
6 Ga0070658_10378361 3300005327 Bacteria 1214
7 Ga0070658_11238415 3300005327 Bacteria 648
8 Ga0070676_10121968 3300005328 Bacteria 1637
9 Ga0070683_100004462 3300005329 Bacteria 11548
10 Ga0070683_100065117 3300005329 Bacteria 3393
11 Ga0070683_100160124 3300005329 Bacteria 2135
12 Ga0070683_100196034 3300005329 Bacteria 1918
13 Ga0070683_100414338 3300005329 Bacteria 1285
14 Ga0070683_100444207 3300005329 Bacteria 1237
15 Ga0070683_100445415 3300005329 Bacteria 1236
16 Ga0070690_100071641 3300005330 Bacteria 2252
17 Ga0070670_100343018 3300005331 Bacteria 1312
18 Ga0070670_100429998 3300005331 Bacteria 1168
19 Ga0068869_100060026 3300005334 Bacteria 2786
20 Ga0068869_100070985 3300005334 Bacteria 2578
21 Ga0068869_100140466 3300005334 Bacteria 1865
22 Ga0070666_10158979 3300005335 Bacteria 1579
23 Ga0070680_100060097 3300005336 Bacteria 3110
24 Ga0070680_100112057 3300005336 Bacteria 2272
25 Ga0070680_100139899 3300005336 Bacteria 2029
26 Ga0070682_100014416 3300005337 Bacteria 4567
27 Ga0070682_100137438 3300005337 Bacteria 1662
28 Ga0070682_100684036 3300005337 Bacteria 821
29 Ga0070682_100765564 3300005337 Unclassified 781
30 Ga0068868_100076587 3300005338 Bacteria 2674
31 Ga0068868_100087772 3300005338 Bacteria 2502
32 Ga0068868_100099234 3300005338 Bacteria 2355
33 Ga0068868_101384345 3300005338 Bacteria 656
34 Ga0070660_100008187 3300005339 Bacteria 7307
35 Ga0070660_100100458 3300005339 Bacteria 2291
36 Ga0070660_100254230 3300005339 Bacteria 1433
37 Ga0070660_101301863 3300005339 Bacteria 617
38 Ga0070689_100072495 3300005340 Bacteria 2692
39 Ga0070691_10118420 3300005341 Bacteria 1331
40 Ga0070691_10996327 3300005341 Unclassified 523
41 Ga0070687_100867805 3300005343 Bacteria 645
42 Ga0070661_100006256 3300005344 Bacteria 8215
43 Ga0070661_100006849 3300005344 Bacteria 7859
44 Ga0070661_100309189 3300005344 Bacteria 1232
45 Ga0070661_100537834 3300005344 Bacteria 939
46 Ga0070661_100999972 3300005344 Bacteria 694
47 Ga0070661_101595747 3300005344 Bacteria 551
48 Ga0070692_10026063 3300005345 Bacteria 2887
49 Ga0070692_10088380 3300005345 Bacteria 1681
50 Ga0070692_10168062 3300005345 Bacteria 1262
51 Ga0070668_100177452 3300005347 Bacteria 1738
52 Ga0070668_100248601 3300005347 Bacteria 1475
53 Ga0070668_100383945 3300005347 Bacteria 1196
54 Ga0070675_102139345 3300005354 Unclassified 516
55 Ga0070671_100366415 3300005355 Bacteria 1230
56 Ga0070671_100372968 3300005355 Bacteria 1219
57 Ga0070671_101450758 3300005355 Bacteria 607
58 Ga0070674_100019333 3300005356 Bacteria 4325
59 Ga0070674_100111213 3300005356 Bacteria 2011
60 Ga0070674_100854502 3300005356 Bacteria 789
61 Ga0070674_101824461 3300005356 Bacteria 552
62 Ga0070673_100120177 3300005364 Bacteria 2191
63 Ga0070688_100069583 3300005365 Bacteria 2248
64 Ga0070688_100397045 3300005365 Bacteria 1020
65 Ga0070659_100011282 3300005366 Bacteria 6603
66 Ga0070659_100183843 3300005366 Bacteria 1716
67 Ga0070659_102110098 3300005366 Bacteria 507
68 Ga0070667_100011225 3300005367 Bacteria 7411
69 Ga0070667_101041637 3300005367 Bacteria 764
70 Ga0070703_10622931 3300005406 Bacteria 500
71 Ga0070709_10049444 3300005434 Bacteria 2629
72 Ga0070709_10451344 3300005434 Bacteria 969
73 Ga0070709_10602919 3300005434 Bacteria 846
74 Ga0070714_100042327 3300005435 Bacteria 3848
75 Ga0070714_100089193 3300005435 Bacteria 2699
76 Ga0070714_100177169 3300005435 Bacteria 1938
77 Ga0070714_100187934 3300005435 Bacteria 1883
78 Ga0070714_100605272 3300005435 Bacteria 1052
79 Ga0070714_100954282 3300005435 Bacteria 834
80 Ga0070714_102188542 3300005435 Bacteria 538
81 Ga0070713_100170141 3300005436 Bacteria 1951
82 Ga0070713_100465035 3300005436 Bacteria 1190
83 Ga0070713_101248067 3300005436 Bacteria 720
84 Ga0070713_101753198 3300005436 Bacteria 603
85 Ga0070710_10265355 3300005437 Bacteria 1108
86 Ga0070710_10291344 3300005437 Bacteria 1062
87 Ga0070710_10664933 3300005437 Bacteria 732
88 Ga0070701_10078474 3300005438 Bacteria 1782
89 Ga0070701_10625996 3300005438 Unclassified 716
90 Ga0070711_100023255 3300005439 Bacteria 4028
91 Ga0070711_100324185 3300005439 Bacteria 1231
92 Ga0070711_100573418 3300005439 Bacteria 939
93 Ga0070705_100060215 3300005440 Bacteria 2251
94 Ga0070705_100165974 3300005440 Bacteria 1481
95 Ga0070705_100940423 3300005440 Unclassified 698
96 Ga0070700_100014010 3300005441 Bacteria 4519
97 Ga0070700_100139140 3300005441 Bacteria 1647
98 Ga0070700_100226097 3300005441 Bacteria 1329
99 Ga0070700_100511664 3300005441 Bacteria 926
100 Ga0070700_100695566 3300005441 Bacteria 808
101 Ga0070694_100187759 3300005444 Bacteria 1533
102 Ga0070694_100251665 3300005444 Bacteria 1337
103 Ga0070708_100404878 3300005445 Bacteria 1287
104 Ga0070708_100448762 3300005445 Unclassified 1217
105 Ga0070663_100950492 3300005455 Bacteria 745
106 Ga0070678_100112177 3300005456 Bacteria 2135
107 Ga0070678_100193775 3300005456 Bacteria 1673
108 Ga0070678_102148742 3300005456 Bacteria 529
109 Ga0070662_100025198 3300005457 Bacteria 4105
110 Ga0070662_100214645 3300005457 Bacteria 1533
111 Ga0070662_100589825 3300005457 Bacteria 934
112 Ga0070681_10008490 3300005458 Bacteria 10055
113 Ga0070681_10028181 3300005458 Bacteria 5647
114 Ga0070681_10082635 3300005458 Bacteria 3167
115 Ga0070681_10164785 3300005458 Bacteria 2139
116 Ga0070681_10385188 3300005458 Bacteria 1313
117 Ga0070681_10415779 3300005458 Bacteria 1256
118 Ga0070681_10518753 3300005458 Bacteria 1105
119 Ga0070681_10764746 3300005458 Unclassified 883
120 Ga0070681_11218242 3300005458 Bacteria 675
121 Ga0068867_100074108 3300005459 Bacteria 2550
122 Ga0068867_100267918 3300005459 Bacteria 1395
123 Ga0068867_100839017 3300005459 Bacteria 822
124 Ga0068867_101833788 3300005459 Unclassified 571
125 Ga0070685_10141590 3300005466 Bacteria 1515
126 Ga0070685_10683379 3300005466 Bacteria 747
127 Ga0070706_101818259 3300005467 Bacteria 554
128 Ga0070707_100356451 3300005468 Unclassified 1421
129 Ga0070707_100380634 3300005468 Bacteria 1371
130 Ga0070707_100734394 3300005468 Bacteria 951
131 Ga0070698_101264799 3300005471 Bacteria 688
132 Ga0070698_101521464 3300005471 Bacteria 621
133 Ga0070699_100076728 3300005518 Bacteria 2909
134 Ga0070699_101842392 3300005518 Bacteria 554
135 Ga0070679_100087848 3300005530 Bacteria 3096
136 Ga0070679_100231236 3300005530 Bacteria 1808
137 Ga0070679_100264560 3300005530 Bacteria 1675
138 Ga0070679_100360245 3300005530 Bacteria 1402
139 Ga0070679_100882778 3300005530 Unclassified 838
140 Ga0070679_101104596 3300005530 Bacteria 738
141 Ga0070679_101126090 3300005530 Bacteria 730
142 Ga0070684_100002170 3300005535 Bacteria 14480
143 Ga0070684_100021741 3300005535 Bacteria 5343
144 Ga0070684_100078043 3300005535 Bacteria 2925
145 Ga0070684_100079373 3300005535 Bacteria 2901
146 Ga0070684_100081483 3300005535 Bacteria 2864
147 Ga0070684_100164503 3300005535 Bacteria 2013
148 Ga0070684_100210153 3300005535 Bacteria 1773
149 Ga0070684_100662989 3300005535 Bacteria 972
150 Ga0070684_100698363 3300005535 Bacteria 946
151 Ga0070684_101067416 3300005535 Bacteria 759
152 Ga0070697_100576121 3300005536 Bacteria 988
153 Ga0068853_100153385 3300005539 Bacteria 2074
154 Ga0068853_100916406 3300005539 Bacteria 842
155 Ga0068853_101007999 3300005539 Bacteria 802
156 Ga0068853_101870338 3300005539 Bacteria 582
157 Ga0070672_100236932 3300005543 Bacteria 1534
158 Ga0070672_100901697 3300005543 Bacteria 781
159 Ga0070672_100932875 3300005543 Unclassified 768
160 Ga0070672_102048240 3300005543 Bacteria 516
161 Ga0070686_100189089 3300005544 Bacteria 1468
162 Ga0070686_100239196 3300005544 Bacteria 1321
163 Ga0070695_100086659 3300005545 Bacteria 2081
164 Ga0070695_100902824 3300005545 Unclassified 714
165 Ga0070696_100020757 3300005546 Bacteria 4450
166 Ga0070696_100040965 3300005546 Bacteria 3199
167 Ga0070696_101225514 3300005546 Bacteria 635
168 Ga0070693_100271341 3300005547 Bacteria 1132
169 Ga0070693_100358776 3300005547 Bacteria 1000
170 Ga0070693_100579939 3300005547 Bacteria 807
171 Ga0070665_100080403 3300005548 Bacteria 3264
172 Ga0070665_100165863 3300005548 Bacteria 2211
173 Ga0070665_100648382 3300005548 Bacteria 1069
174 Ga0070665_100993107 3300005548 Unclassified 852
175 Ga0070665_101930054 3300005548 Bacteria 596
176 Ga0070704_100251462 3300005549 Bacteria 1452
177 Ga0070704_100392047 3300005549 Bacteria 1183
178 Ga0070704_100482764 3300005549 Bacteria 1072
179 Ga0068855_100013130 3300005563 Bacteria 9991
180 Ga0068855_100050398 3300005563 Bacteria 4906
181 Ga0068855_100197764 3300005563 Bacteria 2264
182 Ga0068855_100254597 3300005563 Bacteria 1957
183 Ga0068855_100259944 3300005563 Bacteria 1934
184 Ga0070664_100151734 3300005564 Bacteria 2046
185 Ga0070664_100153355 3300005564 Bacteria 2035
186 Ga0070664_100219932 3300005564 Bacteria 1699
187 Ga0070664_100238562 3300005564 Bacteria 1632
188 Ga0070664_100391494 3300005564 Bacteria 1270
189 Ga0068857_100010678 3300005577 Bacteria 7988
190 Ga0068857_100012513 3300005577 Bacteria 7388
191 Ga0068857_100333895 3300005577 Bacteria 1401
192 Ga0068854_100010961 3300005578 Bacteria 5882
193 Ga0068854_100125699 3300005578 Bacteria 1953
194 Ga0068854_100341720 3300005578 Bacteria 1223
195 Ga0068854_100483893 3300005578 Bacteria 1039
196 Ga0068854_101772660 3300005578 Bacteria 566
197 Ga0068856_100004589 3300005614 Bacteria 13737
198 Ga0068856_100095955 3300005614 Bacteria 2954
199 Ga0068856_100112742 3300005614 Bacteria 2717
200 Ga0068856_100114678 3300005614 Bacteria 2694
201 Ga0068856_100123757 3300005614 Bacteria 2589
202 Ga0068856_102634467 3300005614 Bacteria 509
203 Ga0070702_100012351 3300005615 Bacteria 4276
204 Ga0070702_100022944 3300005615 Bacteria 3309
205 Ga0070702_100470994 3300005615 Bacteria 916
206 Ga0068852_100154748 3300005616 Bacteria 2135
207 Ga0068852_100929244 3300005616 Bacteria 887
208 Ga0068852_100967286 3300005616 Bacteria 869
209 Ga0068852_101087536 3300005616 Bacteria 820
210 Ga0068859_100117675 3300005617 Bacteria 2723
211 Ga0068859_102342801 3300005617 Bacteria 589
212 Ga0068864_100952251 3300005618 Bacteria 850
213 Ga0068864_101175673 3300005618 Bacteria 765
214 Ga0068864_101648924 3300005618 Bacteria 646
215 Ga0068866_10100930 3300005718 Bacteria 1592
216 Ga0068866_11129362 3300005718 Bacteria 563
217 Ga0068861_100122029 3300005719 Bacteria 2104
218 Ga0068861_100238572 3300005719 Bacteria 1545
219 Ga0068861_100279508 3300005719 Bacteria 1437
220 Ga0068851_10057190 3300005834 Bacteria 1991
221 Ga0068851_10224728 3300005834 Bacteria 1056
222 Ga0068851_10250658 3300005834 Bacteria 1004
223 Ga0068870_10415491 3300005840 Bacteria 879
224 Ga0068860_100446102 3300005843 Bacteria 1286
225 Ga0068862_100205883 3300005844 Bacteria 1776
226 Ga0068862_100447871 3300005844 Bacteria 1217
227 Ga0081455_10066708 3300005937 Bacteria 3003
228 Ga0081455_10189118 3300005937 Bacteria 1552
229 Ga0081538_10000059 3300005981 Bacteria 101468
230 Ga0081538_10000939 3300005981 Bacteria 31446
231 Ga0081538_10077190 3300005981 Bacteria 1795
232 Ga0081540_1026636 3300005983 Bacteria 3294
233 Ga0081539_10379186 3300005985 Bacteria 590
234 Ga0070717_10147548 3300006028 Bacteria 2033
235 Ga0070717_10248460 3300006028 Unclassified 1571
236 Ga0070717_11320423 3300006028 Bacteria 656
237 Ga0070715_10055696 3300006163 Bacteria 1718
238 Ga0070715_10132645 3300006163 Bacteria 1201
239 Ga0070715_10729701 3300006163 Bacteria 595
240 Ga0070715_10935378 3300006163 Bacteria 536
241 Ga0070716_100199601 3300006173 Unclassified 1328
242 Ga0070716_101527192 3300006173 Bacteria 547
243 Ga0070712_100011180 3300006175 Bacteria 5682
244 Ga0070712_100085921 3300006175 Bacteria 2291
245 Ga0070712_100266530 3300006175 Bacteria 1374
246 Ga0070712_100371263 3300006175 Bacteria 1176
247 Ga0070712_100564039 3300006175 Bacteria 961
248 Ga0070712_100577247 3300006175 Bacteria 950
249 Ga0070712_100769640 3300006175 Bacteria 825
250 Ga0070712_100986707 3300006175 Bacteria 728
251 Ga0097621_100100370 3300006237 Bacteria 2435
252 Ga0097621_100658093 3300006237 Bacteria 962
253 Ga0097621_101094956 3300006237 Bacteria 748
254 Ga0068871_100137505 3300006358 Bacteria 2075
255 Ga0068871_100146961 3300006358 Bacteria 2008
256 Ga0068871_101010560 3300006358 Bacteria 775
257 Ga0068871_101862541 3300006358 Bacteria 572
258 Ga0075428_101352357 3300006844 Bacteria 748
259 Ga0075428_101525106 3300006844 Bacteria 700
260 Ga0075428_101948730 3300006844 Unclassified 610
261 Ga0075433_10096866 3300006852 Bacteria 2611
262 Ga0075433_10139122 3300006852 Bacteria 2158
263 Ga0075433_10384546 3300006852 Bacteria 1239
264 Ga0075433_10823519 3300006852 Bacteria 811
265 Ga0075434_100000288 3300006871 Bacteria 35846
266 Ga0075434_100018510 3300006871 Bacteria 6731
267 Ga0068865_100166347 3300006881 Unclassified 1687
268 Ga0068865_100799563 3300006881 Unclassified 813
269 Ga0068865_100973441 3300006881 Bacteria 742
270 Ga0068865_102050855 3300006881 Bacteria 519
271 Ga0075436_100371622 3300006914 Bacteria 1033
272 Ga0075436_101159067 3300006914 Bacteria 583
273 Ga0097620_100117671 3300006931 Bacteria 2723
274 Ga0097620_102342873 3300006931 Bacteria 589
275 Ga0075435_100009347 3300007076 Bacteria 7091
276 Ga0075435_100154157 3300007076 Bacteria 1933
277 Ga0075435_101557192 3300007076 Bacteria 580
278 Ga0075435_101638165 3300007076 Bacteria 565
279 Ga0105240_10168799 3300009093 Bacteria 2593
280 Ga0105240_10201527 3300009093 Bacteria 2332
281 Ga0105240_10523857 3300009093 Bacteria 1315
282 Ga0105240_10793271 3300009093 Bacteria 1026
283 Ga0105240_12592786 3300009093 Bacteria 524
284 Ga0111539_10992705 3300009094 Bacteria 976
285 Ga0111539_12491529 3300009094 Bacteria 600
286 Ga0111539_12629029 3300009094 Bacteria 584
287 Ga0105245_10010505 3300009098 Bacteria 8058
288 Ga0105245_10020014 3300009098 Bacteria 5866
289 Ga0105245_10066479 3300009098 Bacteria 3263
290 Ga0105245_10143417 3300009098 Bacteria 2252
291 Ga0105245_10191096 3300009098 Bacteria 1961
292 Ga0105245_10379343 3300009098 Bacteria 1407
293 Ga0105245_12258927 3300009098 Bacteria 598
294 Ga0105247_10328782 3300009101 Bacteria 1069
295 Ga0105247_11332197 3300009101 Bacteria 578
296 Ga0114129_10034735 3300009147 Bacteria 7123
297 Ga0114129_10938849 3300009147 Unclassified 1093
298 Ga0105243_10063297 3300009148 Bacteria 2964
299 Ga0105243_10129765 3300009148 Bacteria 2137
300 Ga0105243_10145258 3300009148 Bacteria 2029
301 Ga0105243_10157670 3300009148 Bacteria 1954
302 Ga0105243_10207412 3300009148 Bacteria 1723
303 Ga0105241_10232388 3300009174 Bacteria 1555
304 Ga0105241_10261041 3300009174 Bacteria 1472
305 Ga0105241_10288667 3300009174 Bacteria 1404
306 Ga0105241_10851554 3300009174 Bacteria 843
307 Ga0105242_10124875 3300009176 Unclassified 2214
308 Ga0105242_10143075 3300009176 Bacteria 2078
309 Ga0105242_10300165 3300009176 Bacteria 1466
310 Ga0105242_10585861 3300009176 Bacteria 1075
311 Ga0105242_11731854 3300009176 Bacteria 662
312 Ga0105248_10153320 3300009177 Bacteria 2599
313 Ga0105248_10386125 3300009177 Bacteria 1576
314 Ga0105237_10065849 3300009545 Bacteria 3618
315 Ga0105237_10275223 3300009545 Bacteria 1686
316 Ga0105237_10913145 3300009545 Bacteria 885
317 Ga0105238_10016816 3300009551 Bacteria 7417
318 Ga0105238_10024093 3300009551 Bacteria 6205
319 Ga0105238_10029238 3300009551 Bacteria 5615
320 Ga0105238_12048181 3300009551 Bacteria 606
321 Ga0105238_12769955 3300009551 Bacteria 527
322 Ga0105249_10053640 3300009553 Bacteria 3685
323 Ga0105249_10082731 3300009553 Bacteria 2987
324 Ga0105249_10332080 3300009553 Bacteria 1534
325 Ga0105239_10047172 3300010375 Bacteria 4721
326 Ga0105239_10165256 3300010375 Bacteria 2474
327 Ga0105239_10328527 3300010375 Bacteria 1725
328 Ga0105239_10878736 3300010375 Unclassified 1028
329 Ga0105239_12394770 3300010375 Bacteria 615
330 Ga0105246_10229334 3300011119 Bacteria 1461
331 Ga0105246_10235425 3300011119 Bacteria 1444
332 Ga0157345_1045955 3300012498 Bacteria 541
333 Ga0154010_111657 3300013062 Bacteria 543
334 Ga0157373_10029236 3300013100 Bacteria 3972
335 Ga0157373_10996037 3300013100 Bacteria 625
336 Ga0157371_10996725 3300013102 Bacteria 639
337 Ga0157370_10040599 3300013104 Bacteria 4492
338 Ga0157370_10111956 3300013104 Unclassified 2551
339 Ga0157370_10294487 3300013104 Bacteria 1499
340 Ga0157370_10619521 3300013104 Bacteria 990
341 Ga0157370_10982301 3300013104 Bacteria 765
342 Ga0157370_11354339 3300013104 Bacteria 641
343 Ga0157369_10006129 3300013105 Bacteria 13955
344 Ga0157369_10017337 3300013105 Bacteria 8096
345 Ga0157369_10018632 3300013105 Bacteria 7782
346 Ga0157369_10037075 3300013105 Bacteria 5340
347 Ga0157369_10059365 3300013105 Bacteria 4125
348 Ga0157369_10103686 3300013105 Bacteria 3030
349 Ga0157369_10267871 3300013105 Bacteria 1781
350 Ga0157369_10438866 3300013105 Bacteria 1353
351 Ga0157369_10771483 3300013105 Bacteria 988
352 Ga0157369_12549769 3300013105 Bacteria 517
353 Ga0157374_10043473 3300013296 Bacteria 4151
354 Ga0157374_10244845 3300013296 Bacteria 1764
355 Ga0157374_10478435 3300013296 Bacteria 1248
356 Ga0157374_10492826 3300013296 Bacteria 1229
357 Ga0157374_10647685 3300013296 Bacteria 1068
358 Ga0157374_10834835 3300013296 Bacteria 938
359 Ga0157374_11379835 3300013296 Bacteria 727
360 Ga0157374_12521948 3300013296 Bacteria 542
361 Ga0157378_10684821 3300013297 Bacteria 1043
362 Ga0157378_11081783 3300013297 Bacteria 838
363 Ga0157378_13054342 3300013297 Bacteria 519
364 Ga0163162_10065811 3300013306 Bacteria 3673
365 Ga0163162_10147565 3300013306 Bacteria 2469
366 Ga0163162_10425474 3300013306 Bacteria 1460
367 Ga0163162_10512933 3300013306 Bacteria 1329
368 Ga0163162_11041298 3300013306 Bacteria 926
369 Ga0157372_10016430 3300013307 Bacteria 7941
370 Ga0157372_10067351 3300013307 Bacteria 4023
371 Ga0157372_10069442 3300013307 Bacteria 3962
372 Ga0157372_10102553 3300013307 Bacteria 3268
373 Ga0157372_10301713 3300013307 Bacteria 1863
374 Ga0157372_11849121 3300013307 Bacteria 694
375 Ga0157372_12274164 3300013307 Bacteria 623
376 Ga0157375_10394539 3300013308 Bacteria 1551
377 Ga0157375_10523633 3300013308 Bacteria 1349
378 Ga0157375_10686347 3300013308 Bacteria 1178
379 Ga0163163_10005491 3300014325 Bacteria 10972
380 Ga0163163_12209976 3300014325 Bacteria 609
381 Ga0157380_10326743 3300014326 Bacteria 1424
382 Ga0157380_10968685 3300014326 Bacteria 882
383 Ga0157380_11716452 3300014326 Unclassified 686
384 Ga0157377_10000811 3300014745 Bacteria 12922
385 Ga0157377_10883623 3300014745 Bacteria 667
386 Ga0157379_10119216 3300014968 Bacteria 2373
387 Ga0157376_10012411 3300014969 Bacteria 6324
388 Ga0157376_10109890 3300014969 Unclassified 2425
389 Ga0157376_10216561 3300014969 Bacteria 1771
390 Ga0157376_10439367 3300014969 Bacteria 1270
391 Ga0157376_12627093 3300014969 Bacteria 543
392 Ga0182006_1166591 3300015261 Bacteria 740
393 Ga0197907_10272433 3300020069 Bacteria 650
394 Ga0197907_10520340 3300020069 Bacteria 1053
395 Ga0197907_10540602 3300020069 Bacteria 756
396 Ga0206356_10002683 3300020070 Bacteria 1102
397 Ga0206356_10142702 3300020070 Bacteria 1262
398 Ga0206356_10915817 3300020070 Bacteria 870
399 Ga0206356_11241351 3300020070 Bacteria 1384
400 Ga0206356_11889777 3300020070 Bacteria 665
401 Ga0206356_11906180 3300020070 Bacteria 2962
402 Ga0206355_1150212 3300020076 Bacteria 754
403 Ga0206352_10568934 3300020078 Bacteria 618
404 Ga0206350_10432168 3300020080 Unclassified 1006
405 Ga0206350_10517347 3300020080 Bacteria 1047
406 Ga0206350_10827546 3300020080 Bacteria 539
407 Ga0206350_11491362 3300020080 Bacteria 990
408 Ga0206354_10323697 3300020081 Bacteria 553
409 Ga0206353_10260902 3300020082 Bacteria 2037
410 Ga0206353_10311011 3300020082 Bacteria 1242
411 Ga0206353_11315790 3300020082 Bacteria 1329
412 Ga0213873_10100442 3300021358 Bacteria 831
413 Ga0224712_10046400 3300022467 Bacteria 1667
414 Ga0224712_10125171 3300022467 Bacteria 1117
415 Ga0224712_10141618 3300022467 Bacteria 1059
416 Ga0224712_10178621 3300022467 Bacteria 955
417 Ga0224712_10275539 3300022467 Bacteria 782
418 Ga0224712_10336736 3300022467 Bacteria 711
419 Ga0224712_10365394 3300022467 Bacteria 684
420 Ga0207697_10265251 3300025315 Bacteria 760
421 Ga0207656_10188603 3300025321 Bacteria 992
422 Ga0207653_10388320 3300025885 Bacteria 547
423 Ga0207692_10112452 3300025898 Bacteria 1512
424 Ga0207692_10461573 3300025898 Bacteria 801
425 Ga0207692_10628970 3300025898 Bacteria 692
426 Ga0207692_11217474 3300025898 Bacteria 500
427 Ga0207642_10019598 3300025899 Bacteria 2622
428 Ga0207642_10051877 3300025899 Bacteria 1858
429 Ga0207710_10149755 3300025900 Bacteria 1131
430 Ga0207688_10039319 3300025901 Bacteria 2627
431 Ga0207688_10089851 3300025901 Bacteria 1763
432 Ga0207688_10101483 3300025901 Bacteria 1662
433 Ga0207680_10034303 3300025903 Bacteria 2903
434 Ga0207647_10137924 3300025904 Bacteria 1430
435 Ga0207685_10102907 3300025905 Bacteria 1224
436 Ga0207685_10524243 3300025905 Bacteria 627
437 Ga0207685_10577360 3300025905 Bacteria 601
438 Ga0207699_10016150 3300025906 Bacteria 3897
439 Ga0207699_10222621 3300025906 Bacteria 1289
440 Ga0207645_10387589 3300025907 Bacteria 939
441 Ga0207645_10447812 3300025907 Bacteria 871
442 Ga0207643_10124032 3300025908 Bacteria 1532
443 Ga0207705_10045265 3300025909 Bacteria 3163
444 Ga0207705_10049149 3300025909 Bacteria 3036
445 Ga0207705_10169123 3300025909 Unclassified 1645
446 Ga0207705_10657734 3300025909 Bacteria 815
447 Ga0207684_11071152 3300025910 Bacteria 672
448 Ga0207654_10126066 3300025911 Bacteria 1614
449 Ga0207654_10280082 3300025911 Bacteria 1128
450 Ga0207654_10494570 3300025911 Bacteria 863
451 Ga0207654_10943099 3300025911 Bacteria 626
452 Ga0207707_10002473 3300025912 Bacteria 16636
453 Ga0207707_10023064 3300025912 Bacteria 5445
454 Ga0207707_10094470 3300025912 Bacteria 2612
455 Ga0207707_10128466 3300025912 Bacteria 2216
456 Ga0207707_10176916 3300025912 Bacteria 1864
457 Ga0207707_10184948 3300025912 Bacteria 1818
458 Ga0207707_10306361 3300025912 Bacteria 1373
459 Ga0207695_10276705 3300025913 Bacteria 1573
460 Ga0207695_10510539 3300025913 Unclassified 1084
461 Ga0207695_10708641 3300025913 Bacteria 887
462 Ga0207671_10212941 3300025914 Bacteria 1512
463 Ga0207671_10268542 3300025914 Bacteria 1344
464 Ga0207671_10305684 3300025914 Bacteria 1257
465 Ga0207693_10006129 3300025915 Bacteria 9966
466 Ga0207693_10025865 3300025915 Bacteria 4648
467 Ga0207693_10044783 3300025915 Bacteria 3477
468 Ga0207693_10074077 3300025915 Bacteria 2666
469 Ga0207693_10204051 3300025915 Bacteria 1554
470 Ga0207693_10403358 3300025915 Bacteria 1069
471 Ga0207693_10638075 3300025915 Bacteria 828
472 Ga0207663_10025472 3300025916 Bacteria 3420
473 Ga0207663_10287232 3300025916 Bacteria 1224
474 Ga0207663_10345354 3300025916 Bacteria 1125
475 Ga0207660_10008507 3300025917 Bacteria 6638
476 Ga0207660_10075618 3300025917 Bacteria 2461
477 Ga0207660_10098807 3300025917 Bacteria 2178
478 Ga0207660_11126474 3300025917 Unclassified 639
479 Ga0207662_10032222 3300025918 Bacteria 3049
480 Ga0207657_10019359 3300025919 Bacteria 6467
481 Ga0207657_10033039 3300025919 Bacteria 4668
482 Ga0207657_10105190 3300025919 Bacteria 2337
483 Ga0207657_10216334 3300025919 Bacteria 1536
484 Ga0207657_10415502 3300025919 Bacteria 1058
485 Ga0207649_10177829 3300025920 Bacteria 1487
486 Ga0207649_10284283 3300025920 Bacteria 1204
487 Ga0207649_10397061 3300025920 Bacteria 1031
488 Ga0207649_11615809 3300025920 Bacteria 513
489 Ga0207652_10067465 3300025921 Bacteria 3102
490 Ga0207652_10241497 3300025921 Bacteria 1628
491 Ga0207652_10262084 3300025921 Bacteria 1559
492 Ga0207652_10588360 3300025921 Unclassified 999
493 Ga0207652_10914696 3300025921 Bacteria 774
494 Ga0207646_10187358 3300025922 Bacteria 1869
495 Ga0207646_10337993 3300025922 Bacteria 1360
496 Ga0207646_10398279 3300025922 Bacteria 1243
497 Ga0207646_10644175 3300025922 Bacteria 949
498 Ga0207681_10191033 3300025923 Bacteria 1567
499 Ga0207694_10102874 3300025924 Bacteria 2265
500 Ga0207694_10124866 3300025924 Bacteria 2058
501 Ga0207694_10198717 3300025924 Bacteria 1631
502 Ga0207650_10524621 3300025925 Bacteria 991
503 Ga0207650_10926864 3300025925 Bacteria 740
504 Ga0207659_11646523 3300025926 Bacteria 547
505 Ga0207687_10003687 3300025927 Bacteria 10313
506 Ga0207687_10004292 3300025927 Bacteria 9522
507 Ga0207687_10013761 3300025927 Bacteria 5284
508 Ga0207687_10031947 3300025927 Bacteria 3562
509 Ga0207687_10298609 3300025927 Bacteria 1297
510 Ga0207700_10496362 3300025928 Bacteria 1080
511 Ga0207700_11192616 3300025928 Bacteria 680
512 Ga0207700_11276402 3300025928 Bacteria 655
513 Ga0207700_11355393 3300025928 Bacteria 633
514 Ga0207700_11464177 3300025928 Bacteria 606
515 Ga0207664_10118764 3300025929 Unclassified 2209
516 Ga0207664_10140364 3300025929 Bacteria 2043
517 Ga0207664_10167829 3300025929 Bacteria 1876
518 Ga0207664_10199711 3300025929 Bacteria 1725
519 Ga0207664_10271932 3300025929 Bacteria 1485
520 Ga0207664_10462616 3300025929 Bacteria 1133
521 Ga0207664_11647957 3300025929 Bacteria 564
522 Ga0207664_11794616 3300025929 Unclassified 536
523 Ga0207644_10115487 3300025931 Bacteria 2036
524 Ga0207644_10121456 3300025931 Bacteria 1989
525 Ga0207644_11671426 3300025931 Bacteria 534
526 Ga0207690_10012160 3300025932 Bacteria 5150
527 Ga0207690_10050575 3300025932 Bacteria 2775
528 Ga0207690_10070800 3300025932 Bacteria 2403
529 Ga0207706_10194609 3300025933 Bacteria 1779
530 Ga0207706_10345534 3300025933 Bacteria 1294
531 Ga0207706_11516764 3300025933 Unclassified 546
532 Ga0207709_10058973 3300025935 Bacteria 2387
533 Ga0207709_10102752 3300025935 Bacteria 1893
534 Ga0207709_10415859 3300025935 Bacteria 1032
535 Ga0207709_10446687 3300025935 Bacteria 999
536 Ga0207669_10010168 3300025937 Bacteria 4519
537 Ga0207669_10145783 3300025937 Bacteria 1651
538 Ga0207669_10421050 3300025937 Bacteria 1051
539 Ga0207669_10472729 3300025937 Unclassified 998
540 Ga0207704_10020469 3300025938 Bacteria 3501
541 Ga0207704_10518636 3300025938 Unclassified 963
542 Ga0207704_10817461 3300025938 Bacteria 779
543 Ga0207704_11287902 3300025938 Bacteria 625
544 Ga0207665_10213942 3300025939 Bacteria 1409
545 Ga0207665_10915058 3300025939 Bacteria 696
546 Ga0207691_10322435 3300025940 Bacteria 1324
547 Ga0207691_10804414 3300025940 Bacteria 790
548 Ga0207711_10369982 3300025941 Bacteria 1329
549 Ga0207711_11673813 3300025941 Unclassified 580
550 Ga0207689_10032246 3300025942 Bacteria 4359
551 Ga0207689_10051166 3300025942 Bacteria 3405
552 Ga0207661_10017694 3300025944 Bacteria 5281
553 Ga0207661_10027657 3300025944 Bacteria 4334
554 Ga0207661_10101307 3300025944 Bacteria 2419
555 Ga0207661_10214956 3300025944 Bacteria 1696
556 Ga0207661_10439909 3300025944 Bacteria 1186
557 Ga0207661_10490526 3300025944 Bacteria 1122
558 Ga0207661_10795976 3300025944 Bacteria 870
559 Ga0207661_10811701 3300025944 Bacteria 861
560 Ga0207661_10903207 3300025944 Unclassified 813
561 Ga0207661_10991166 3300025944 Bacteria 774
562 Ga0207661_11076974 3300025944 Bacteria 740
563 Ga0207679_10191835 3300025945 Bacteria 1699
564 Ga0207679_10259310 3300025945 Bacteria 1482
565 Ga0207667_10024089 3300025949 Bacteria 6693
566 Ga0207667_10063012 3300025949 Bacteria 3875
567 Ga0207667_10078675 3300025949 Bacteria 3417
568 Ga0207667_10080330 3300025949 Bacteria 3378
569 Ga0207667_10613458 3300025949 Unclassified 1096
570 Ga0207667_11039917 3300025949 Bacteria 805
571 Ga0207667_11938835 3300025949 Bacteria 550
572 Ga0207651_10152349 3300025960 Bacteria 1802
573 Ga0207651_10596858 3300025960 Bacteria 965
574 Ga0207712_10241330 3300025961 Bacteria 1456
575 Ga0207712_10348099 3300025961 Bacteria 1231
576 Ga0207668_10098892 3300025972 Bacteria 2163
577 Ga0207640_10051928 3300025981 Bacteria 2667
578 Ga0207640_10107500 3300025981 Unclassified 1970
579 Ga0207640_10768400 3300025981 Bacteria 832
580 Ga0207640_11380948 3300025981 Bacteria 631
581 Ga0207640_11748610 3300025981 Unclassified 562
582 Ga0207658_10003886 3300025986 Bacteria 10519
583 Ga0207658_11297012 3300025986 Bacteria 666
584 Ga0207658_11500641 3300025986 Bacteria 616
585 Ga0207677_10010576 3300026023 Bacteria 5228
586 Ga0207677_10432945 3300026023 Bacteria 1123
587 Ga0207677_10457699 3300026023 Bacteria 1094
588 Ga0207677_10635272 3300026023 Bacteria 941
589 Ga0207677_11392620 3300026023 Unclassified 646
590 Ga0207703_10052430 3300026035 Bacteria 3312
591 Ga0207639_10108692 3300026041 Bacteria 2255
592 Ga0207639_10141253 3300026041 Unclassified 2007
593 Ga0207639_10278971 3300026041 Bacteria 1469
594 Ga0207639_10925941 3300026041 Bacteria 815
595 Ga0207639_11896082 3300026041 Unclassified 557
596 Ga0207678_10154748 3300026067 Bacteria 1957
597 Ga0207678_10195549 3300026067 Bacteria 1729
598 Ga0207678_10831595 3300026067 Unclassified 816
599 Ga0207678_11171405 3300026067 Bacteria 680
600 Ga0207708_10004675 3300026075 Bacteria 10069
601 Ga0207708_10045109 3300026075 Bacteria 3360
602 Ga0207708_10859500 3300026075 Bacteria 783
603 Ga0207708_11514145 3300026075 Bacteria 589
604 Ga0207708_12003123 3300026075 Bacteria 507
605 Ga0207702_10008420 3300026078 Bacteria 8701
606 Ga0207702_10070367 3300026078 Bacteria 3009
607 Ga0207702_10179603 3300026078 Bacteria 1948
608 Ga0207702_10237286 3300026078 Bacteria 1707
609 Ga0207702_10796681 3300026078 Bacteria 934
610 Ga0207648_10036192 3300026089 Bacteria 4348
611 Ga0207648_10069681 3300026089 Bacteria 3064
612 Ga0207676_10431708 3300026095 Bacteria 1238
613 Ga0207676_10941329 3300026095 Bacteria 849
614 Ga0207676_11141198 3300026095 Bacteria 771
615 Ga0207674_10004135 3300026116 Bacteria 17554
616 Ga0207674_10009602 3300026116 Bacteria 11037
617 Ga0207674_10024193 3300026116 Bacteria 6494
618 Ga0207674_10072348 3300026116 Bacteria 3464
619 Ga0207674_10084616 3300026116 Bacteria 3169
620 Ga0207674_11079527 3300026116 Bacteria 772
621 Ga0207675_100004546 3300026118 Bacteria 13386
622 Ga0207675_100020968 3300026118 Bacteria 6094
623 Ga0207675_100360851 3300026118 Bacteria 1425
624 Ga0207683_10005639 3300026121 Bacteria 10734
625 Ga0207683_10111906 3300026121 Bacteria 2445
626 Ga0207683_10436745 3300026121 Bacteria 1206
627 Ga0207683_11065943 3300026121 Unclassified 750
628 Ga0207683_11329015 3300026121 Bacteria 665
629 Ga0207698_10092693 3300026142 Bacteria 2477
630 Ga0207698_10860151 3300026142 Bacteria 912
631 Ga0207698_11204396 3300026142 Bacteria 771
632 Ga0207698_11346523 3300026142 Bacteria 729
633 Ga0209966_1052986 3300027695 Unclassified 866
634 Ga0209974_10196561 3300027876 Unclassified 744
635 Ga0207428_10386307 3300027907 Bacteria 1026
636 Ga0268266_10093454 3300028379 Bacteria 2639
637 Ga0268266_10632639 3300028379 Bacteria 1029
638 Ga0268265_10212127 3300028380 Bacteria 1688
639 Ga0268265_12038097 3300028380 Unclassified 581
640 Ga0268265_12632724 3300028380 Unclassified 509
641 Ga0268264_10458896 3300028381 Bacteria 1236
642 Ga0268264_10605819 3300028381 Bacteria 1080
643 Ga0268264_11630368 3300028381 Bacteria 656
644 Ga0268264_11805915 3300028381 Unclassified 621
645 Ga0265338_10053011 3300028800 Bacteria 3634
646 Ga0265338_10081986 3300028800 Bacteria 2702
647 Ga0265338_10360334 3300028800 Bacteria 1043
648 Ga0265328_10046362 3300031239 Bacteria 1598
649 Ga0265327_10005348 3300031251 Bacteria 10749
650 Ga0265327_10025102 3300031251 Bacteria 3482
651 Ga0265327_10043117 3300031251 Bacteria 2417
652 Ga0307408_100731485 3300031548 Bacteria 892
653 Ga0265313_10365476 3300031595 Bacteria 570
654 Ga0307405_11409823 3300031731 Bacteria 609
655 Ga0307412_10713555 3300031911 Bacteria 862
656 Ga0307409_100428292 3300031995 Bacteria 1271
657 Ga0307415_100980212 3300032126 Bacteria 784
658 Ga0373948_0143803 3300034817 Bacteria 592
659 Ga0373926_0033608 3300035083 Bacteria 1813
660 Ga0373928_0112888 3300035084 Bacteria 721
661 Ga0373934_0053026 3300035086 Bacteria 1609
662 Ga0373944_0005822 3300035089 Bacteria 3260
663 Ga0373944_0029250 3300035089 Bacteria 1646
664 Ga0373944_0094392 3300035089 Bacteria 1003
665 Ga0373944_0187308 3300035089 Bacteria 744
666 Ga0373949_0026207 3300035090 Bacteria 1365
667 Ga0373923_0027686 3300035111 Bacteria 2262
668 Ga0373923_0126032 3300035111 Bacteria 1148
669 Ga0373936_0004255 3300035113 Bacteria 5405
670 Ga0373945_0005048 3300035116 Bacteria 4205
671 Ga0373945_0005353 3300035116 Bacteria 4109
672 Ga0373945_0124517 3300035116 Bacteria 1027
673 Ga0373954_0274243 3300035118 Bacteria 831
674 Ga0373943_0000948 3300035170 Bacteria 12836
675 Ga0373943_0005005 3300035170 Bacteria 5977
676 Ga0373943_0029909 3300035170 Bacteria 2575
677 Ga0373943_0091068 3300035170 Bacteria 1579
678 Ga0373943_0921681 3300035170 Bacteria 522
679 Ga0373946_0028313 3300035171 Bacteria 2222
680 Ga0373946_0034334 3300035171 Bacteria 2048
681 Ga0373946_0049788 3300035171 Bacteria 1748
682 Ga0373955_0081204 3300035172 Bacteria 1832
683 Ga0373961_0407873 3300035241 Bacteria 523
684 Ga0373962_0069989 3300035242 Bacteria 1047
685 Ga0373924_0304370 3300035410 Bacteria 708
686 Ga0373931_0851639 3300035691 Bacteria 610
687 Ga0373931_1211222 3300035691 Unclassified 517
688 Ga0373935_0020566 3300035692 Bacteria 4034
689 Ga0373935_0039711 3300035692 Bacteria 2951
690 Ga0373935_0092235 3300035692 Bacteria 1984
691 Ga0373935_0133805 3300035692 Bacteria 1668
692 Ga0373935_0703428 3300035692 Bacteria 743
693 Ga0373927_0013935 3300035695 Bacteria 5334
694 Ga0373927_0188986 3300035695 Bacteria 1351
695 Ga0373927_0703717 3300035695 Bacteria 667
696 Ga0373933_0053922 3300035724 Bacteria 2408
697 Ga0373947_0003156 3300035725 Bacteria 9813
698 Ga0373947_0011478 3300035725 Bacteria 5082
699 Ga0373947_0020606 3300035725 Bacteria 3808
700 Ga0373947_0032831 3300035725 Bacteria 3061
701 Ga0373947_0629307 3300035725 Bacteria 731
702 Ga0373937_0242408 3300036401 Bacteria 1698
703 Ga0373937_0288184 3300036401 Bacteria 1551
704 Ga0373937_0575187 3300036401 Bacteria 1070
705 Ga0373925_0013684 3300037068 Bacteria 5875
706 Ga0373925_0055953 3300037068 Bacteria 2954
707 Ga0373925_0590428 3300037068 Bacteria 914
708 Ga0373925_0709030 3300037068 Bacteria 829
709 Ga0395899_0000857 3300037312 Bacteria 29102
710 Ga0395899_0022381 3300037312 Bacteria 4793
711 Ga0395899_0286300 3300037312 Bacteria 1119
712 Ga0395899_0489570 3300037312 Bacteria 799
713 Ga0395900_0006983 3300037418 Bacteria 11698
714 Ga0395900_0008169 3300037418 Bacteria 10773
715 Ga0395900_0026920 3300037418 Bacteria 5886
716 Ga0395900_0052733 3300037418 Bacteria 4187
717 Ga0395900_0120580 3300037418 Bacteria 2691
718 Ga0395900_0146384 3300037418 Bacteria 2415
719 Ga0395900_0176437 3300037418 Bacteria 2173
720 Ga0395900_0232975 3300037418 Unclassified 1851
721 Ga0395900_0258735 3300037418 Bacteria 1739
722 Ga0395900_0284944 3300037418 Bacteria 1643
723 Ga0395900_0343602 3300037418 Bacteria 1467
724 Ga0395900_0568862 3300037418 Bacteria 1076
725 Ga0395900_1874177 3300037418 Bacteria 510
726 Ga0395898_0001107 3300037466 Bacteria 41584
727 Ga0395898_0003086 3300037466 Bacteria 18838
728 Ga0395898_0026599 3300037466 Bacteria 5819
729 Ga0395898_0041591 3300037466 Bacteria 4539
730 Ga0395898_0077048 3300037466 Bacteria 3219
731 Ga0395898_0083596 3300037466 Bacteria 3077
732 Ga0395898_0120968 3300037466 Bacteria 2508
733 Ga0395898_0137249 3300037466 Bacteria 2342
734 Ga0395898_1468889 3300037466 Bacteria 608
735 Ga0395898_1623872 3300037466 Bacteria 570
736 Ga0395905_0006650 3300037471 Bacteria 11593
737 Ga0395905_0028323 3300037471 Bacteria 5280
738 Ga0395905_0090864 3300037471 Unclassified 2863
739 Ga0395905_0228732 3300037471 Bacteria 1739
740 Ga0395905_0412021 3300037471 Bacteria 1247
741 Ga0395905_0549727 3300037471 Bacteria 1056
742 Ga0395905_0601511 3300037471 Bacteria 1001
743 Ga0395905_1476474 3300037471 Bacteria 584
744 Ga0395901_0009580 3300038443 Bacteria 9830
745 Ga0395901_0010735 3300038443 Bacteria 9286
746 Ga0395901_0014827 3300038443 Bacteria 7918
747 Ga0395901_0032782 3300038443 Bacteria 5359
748 Ga0395901_0033026 3300038443 Bacteria 5340
749 Ga0395901_0057261 3300038443 Bacteria 4054
750 Ga0395901_0081453 3300038443 Bacteria 3381
751 Ga0395901_0190919 3300038443 Unclassified 2148
752 Ga0395901_0587348 3300038443 Bacteria 1125
753 Ga0395901_0618580 3300038443 Bacteria 1090
754 Ga0395901_0622690 3300038443 Bacteria 1086
755 Ga0395901_0722601 3300038443 Bacteria 991
756 Ga0395901_0818168 3300038443 Bacteria 919
757 Ga0395901_1612657 3300038443 Bacteria 602
758 Ga0436365_0081418 3300039437 Bacteria 596
759 Ga0436361_0951993 3300039447 Bacteria 672
760 Ga0436363_1216359 3300039450 Bacteria 577
761 Ga0436363_1436042 3300039450 Bacteria 568
762 Ga0436362_0307992 3300039453 Bacteria 849
763 Ga0436362_0511863 3300039453 Bacteria 3044
764 Ga0451789_0948195 3300041443 Bacteria 792
765 Ga0451835_0360775 3300041492 Bacteria 583
766 Ga0451837_0243006 3300041494 Bacteria 586
767 Ga0451839_0578465 3300041496 Bacteria 553
768 Ga0451839_0601551 3300041496 Bacteria 507
769 Ga0451853_2386811 3300041512 Bacteria 611
770 Ga0451853_2929055 3300041512 Bacteria 925
771 Ga0451853_4020500 3300041512 Unclassified 889
772 Ga0439448_0079382 3300042005 Bacteria 1100
773 Ga0439450_142461 3300042008 Bacteria 626
774 Ga0439456_124799 3300042013 Bacteria 592
775 Ga0439462_0039407 3300042015 Bacteria 1260
776 Ga0450907_024247 3300042146 Bacteria 1025
777 Ga0439458_0185125 3300042157 Bacteria 566
778 Ga0439440_0180680 3300042993 Bacteria 618
779 Ga0466969_0347538 3300044656 Bacteria 671
780 Ga0466965_0232828 3300044683 Bacteria 984
781 Ga0466966_0021194 3300044684 Bacteria 4268
782 Ga0466966_0026087 3300044684 Bacteria 3815
783 Ga0466966_0053244 3300044684 Bacteria 2568
784 Ga0466966_0195067 3300044684 Bacteria 1226
785 Ga0466961_0020291 3300044693 Bacteria 4275
786 Ga0466961_0140784 3300044693 Bacteria 1510
787 Ga0466961_0262862 3300044693 Bacteria 1058
788 Ga0466961_0323221 3300044693 Bacteria 941
789 Ga0466963_0016292 3300044694 Bacteria 4620
790 Ga0466963_0017022 3300044694 Bacteria 4528
791 Ga0466963_0037220 3300044694 Bacteria 3176
792 Ga0466963_0084841 3300044694 Bacteria 2149
793 Ga0466963_0154898 3300044694 Bacteria 1592
794 Ga0466963_0221103 3300044694 Bacteria 1326
795 Ga0466963_0381511 3300044694 Bacteria 993
796 Ga0466963_0430999 3300044694 Bacteria 930
797 Ga0466963_0566640 3300044694 Bacteria 802
798 Ga0466963_1273424 3300044694 Bacteria 516
799 Ga0466964_0004892 3300044706 Bacteria 4951
800 Ga0466964_0008108 3300044706 Bacteria 3940
801 Ga0466964_0054372 3300044706 Unclassified 1650
802 Ga0466964_0825009 3300044706 Bacteria 526
803 Ga0466971_0103752 3300044719 Bacteria 1308
804 Ga0466971_0479954 3300044719 Unclassified 612
805 Ga0466968_0005563 3300044735 Bacteria 4720
806 Ga0466968_0120121 3300044735 Bacteria 1188
807 Ga0466968_0373812 3300044735 Bacteria 695
808 Ga0466970_0024022 3300044765 Bacteria 3187
809 Ga0466957_0216887 3300044842 Bacteria 1262
810 Ga0466957_0670521 3300044842 Bacteria 730
811 Ga0466957_1126591 3300044842 Bacteria 566
812 Ga0466960_0251774 3300044901 Bacteria 981
813 Ga0466959_0014461 3300045049 Bacteria 5735
814 Ga0466959_0084559 3300045049 Bacteria 2284
815 Ga0466959_0629943 3300045049 Bacteria 720
816 Ga0451576_0143068 3300045051 Bacteria 2494
817 Ga0451576_1644379 3300045051 Bacteria 666
818 Ga0451576_2157330 3300045051 Bacteria 572
819 Ga0466958_0016073 3300045836 Bacteria 4304
820 Ga0466958_0021158 3300045836 Bacteria 3797
821 Ga0466958_0125161 3300045836 Bacteria 1611
822 Ga0466958_0157298 3300045836 Bacteria 1435
823 Ga0466958_0223615 3300045836 Bacteria 1201
824 Ga0466958_0794382 3300045836 Bacteria 617
825 Ga0466967_0002964 3300045976 Bacteria 10850
826 Ga0466967_0003721 3300045976 Bacteria 10050
827 Ga0466967_0018586 3300045976 Bacteria 5560
828 Ga0466967_0021070 3300045976 Bacteria 5282
829 Ga0466967_0024277 3300045976 Bacteria 4982
830 Ga0466967_0080388 3300045976 Bacteria 2941
831 Ga0466967_0120948 3300045976 Bacteria 2419
832 Ga0466967_0132870 3300045976 Bacteria 2312
833 Ga0466967_0151283 3300045976 Bacteria 2169
834 Ga0466967_0203962 3300045976 Bacteria 1873
835 Ga0466967_0355216 3300045976 Bacteria 1419
836 Ga0466967_0361058 3300045976 Bacteria 1407
837 Ga0466967_0703727 3300045976 Bacteria 1001
838 Ga0466967_2593790 3300045976 Bacteria 501
839 Ga0495592_0081801 3300046454 Bacteria 2335
840 Ga0495592_0227232 3300046454 Bacteria 1244
841 Ga0495592_0279435 3300046454 Bacteria 1092
842 Ga0495603_0017920 3300046455 Bacteria 4286
843 Ga0495603_0140061 3300046455 Bacteria 1407
844 Ga0495603_0370571 3300046455 Bacteria 821
845 Ga0495629_0009258 3300046459 Bacteria 7205
846 Ga0495629_0020903 3300046459 Bacteria 4672
847 Ga0495629_0052145 3300046459 Bacteria 2863
848 Ga0495629_0100124 3300046459 Bacteria 2022
849 Ga0495629_0171740 3300046459 Bacteria 1504
850 Ga0495629_0264958 3300046459 Bacteria 1181
851 Ga0495629_0410323 3300046459 Bacteria 920
852 Ga0495629_1030761 3300046459 Bacteria 534
853 Ga0495641_0000793 3300046461 Bacteria 26791
854 Ga0495641_0013263 3300046461 Bacteria 4541
855 Ga0495641_0017097 3300046461 Bacteria 3792
856 Ga0495641_0041713 3300046461 Bacteria 2131
857 Ga0495641_0082519 3300046461 Bacteria 1439
858 Ga0495641_0227177 3300046461 Bacteria 837
859 Ga0495651_0023372 3300046462 Bacteria 4806
860 Ga0495651_0039755 3300046462 Bacteria 3660
861 Ga0495651_0113961 3300046462 Bacteria 1995
862 Ga0495651_0620115 3300046462 Bacteria 681
863 Ga0495651_0774996 3300046462 Bacteria 593
864 Ga0495653_0056093 3300046463 Bacteria 3004
865 Ga0495653_0383379 3300046463 Bacteria 897
866 Ga0495653_0520910 3300046463 Bacteria 739
867 Ga0495580_0026424 3300046472 Bacteria 4232
868 Ga0495580_0101146 3300046472 Bacteria 2005
869 Ga0495580_0985033 3300046472 Bacteria 538
870 Ga0495582_0003686 3300046473 Bacteria 8633
871 Ga0495582_0004168 3300046473 Bacteria 8126
872 Ga0495582_0033145 3300046473 Bacteria 2839
873 Ga0495582_0055842 3300046473 Bacteria 2177
874 Ga0495582_0093913 3300046473 Bacteria 1674
875 Ga0495639_0002486 3300046475 Bacteria 8042
876 Ga0495639_0019251 3300046475 Bacteria 2978
877 Ga0495639_0095558 3300046475 Bacteria 1398
878 Ga0495662_0003248 3300046476 Bacteria 8215
879 Ga0495662_0005102 3300046476 Bacteria 6577
880 Ga0495662_0061974 3300046476 Bacteria 1807
881 Ga0495662_0272122 3300046476 Bacteria 834
882 Ga0495664_0018878 3300046477 Bacteria 3958
883 Ga0495664_0067639 3300046477 Bacteria 2131
884 Ga0495594_0017126 3300046499 Bacteria 3825
885 Ga0495594_0281453 3300046499 Bacteria 948
886 Ga0495594_0466104 3300046499 Bacteria 718
887 Ga0495596_0407787 3300046500 Bacteria 530
888 Ga0495608_0010163 3300046511 Bacteria 6568
889 Ga0495608_0021288 3300046511 Bacteria 4451
890 Ga0495608_0316661 3300046511 Bacteria 964
891 Ga0495618_0210702 3300046514 Bacteria 1228
892 Ga0495618_0463724 3300046514 Bacteria 767
893 Ga0495618_0624252 3300046514 Bacteria 639
894 Ga0495618_0765979 3300046514 Bacteria 564
895 Ga0495628_0387188 3300046516 Bacteria 1023
896 Ga0495628_1061886 3300046516 Bacteria 555
897 Ga0495630_0003748 3300046517 Bacteria 10605
898 Ga0495630_0089179 3300046517 Bacteria 2329
899 Ga0495630_0166820 3300046517 Bacteria 1676
900 Ga0495630_0271651 3300046517 Bacteria 1295
901 Ga0495630_0769723 3300046517 Bacteria 735
902 Ga0495630_0769790 3300046517 Bacteria 735
903 Ga0495630_1115974 3300046517 Bacteria 598
904 Ga0495630_1126812 3300046517 Bacteria 594
905 Ga0495666_0009556 3300046526 Bacteria 4846
906 Ga0495666_0032459 3300046526 Bacteria 2555
907 Ga0495652_0043940 3300046529 Bacteria 3849
908 Ga0495652_0169334 3300046529 Bacteria 1687
909 Ga0495652_0238105 3300046529 Bacteria 1356
910 Ga0495652_0596574 3300046529 Bacteria 754
911 Ga0495652_0969412 3300046529 Bacteria 558
912 Ga0495665_0001332 3300046531 Bacteria 13180
913 Ga0495665_0004084 3300046531 Bacteria 7873
914 Ga0495665_0201757 3300046531 Bacteria 1031
915 Ga0495665_0367695 3300046531 Bacteria 731
916 Ga0495640_0027400 3300046533 Bacteria 4110
917 Ga0495640_0063043 3300046533 Bacteria 2512
918 Ga0495640_0320308 3300046533 Bacteria 960
919 Ga0495586_0086592 3300046535 Bacteria 1727
920 Ga0495586_0202095 3300046535 Bacteria 1126
921 Ga0495586_0801874 3300046535 Bacteria 543
922 Ga0495587_0033023 3300046536 Bacteria 3125
923 Ga0495587_0834915 3300046536 Bacteria 503
924 Ga0495645_0029351 3300046543 Bacteria 4000
925 Ga0495645_0115284 3300046543 Bacteria 1898
926 Ga0495645_0435634 3300046543 Bacteria 829
927 Ga0495667_0006114 3300046559 Bacteria 8151
928 Ga0495667_0013391 3300046559 Bacteria 5552
929 Ga0495667_0025494 3300046559 Bacteria 3983
930 Ga0495667_0072648 3300046559 Bacteria 2242
931 Ga0495634_0028676 3300046642 Bacteria 3861
932 Ga0495634_0034982 3300046642 Bacteria 3443
933 Ga0495634_0056253 3300046642 Bacteria 2629
934 Ga0495634_0445671 3300046642 Unclassified 764
935 Ga0495634_0771572 3300046642 Bacteria 549
936 Ga0495635_0011984 3300046663 Bacteria 6074
937 Ga0495635_0045493 3300046663 Bacteria 3029
938 Ga0495635_0301828 3300046663 Bacteria 1074
939 Ga0495588_0017324 3300046674 Bacteria 3495
940 Ga0495588_0494800 3300046674 Bacteria 641
941 Ga0495588_0508335 3300046674 Bacteria 631
942 Ga0495657_0012099 3300046675 Bacteria 6420
943 Ga0495657_0064273 3300046675 Bacteria 2418
944 Ga0495657_0392136 3300046675 Bacteria 818
945 Ga0495657_0601870 3300046675 Bacteria 636
946 Ga0495599_0130705 3300046678 Bacteria 1559
947 Ga0495599_0820827 3300046678 Bacteria 530
948 Ga0495599_0895370 3300046678 Bacteria 503
949 Ga0495646_0080992 3300046680 Bacteria 1893
950 Ga0495646_0276236 3300046680 Bacteria 894
951 Ga0495647_0002012 3300046681 Bacteria 6349
952 Ga0495647_0003805 3300046681 Bacteria 4855
953 Ga0495647_0254878 3300046681 Bacteria 782
954 Ga0495658_0000379 3300046683 Bacteria 24931
955 Ga0495658_0011720 3300046683 Bacteria 4418
956 Ga0495658_0024560 3300046683 Bacteria 3211
957 Ga0495658_0088213 3300046683 Bacteria 1833
958 Ga0495658_0555003 3300046683 Bacteria 735
959 Ga0495658_1088822 3300046683 Bacteria 509
960 Ga0495613_0001753 3300046689 Bacteria 16515
961 Ga0495613_0013003 3300046689 Bacteria 6184
962 Ga0495613_0403886 3300046689 Bacteria 931
963 Ga0495613_0603580 3300046689 Bacteria 730
964 Ga0495613_0724424 3300046689 Bacteria 653
965 Ga0495613_0736660 3300046689 Bacteria 647
966 Ga0495613_1049164 3300046689 Bacteria 522
967 Ga0495624_0015742 3300046690 Bacteria 5099
968 Ga0495624_0205909 3300046690 Bacteria 1194
969 Ga0495624_0264618 3300046690 Bacteria 1039
970 Ga0495624_0328108 3300046690 Unclassified 921
971 Ga0495624_0489836 3300046690 Bacteria 736
972 Ga0495624_0534403 3300046690 Bacteria 700
973 Ga0495600_0008198 3300046809 Bacteria 6415
974 Ga0495600_0042616 3300046809 Bacteria 2959
975 Ga0495600_0052274 3300046809 Bacteria 2668
976 Ga0495600_0289085 3300046809 Bacteria 1036
977 Ga0495600_0856731 3300046809 Bacteria 538
978 Ga0495600_0890680 3300046809 Unclassified 526
979 Ga0495581_0002043 3300047315 Bacteria 11350
980 Ga0495581_0005670 3300047315 Bacteria 7241
981 Ga0495581_0195302 3300047315 Bacteria 1184
982 Ga0495581_0864114 3300047315 Bacteria 517
983 Ga0495604_0065911 3300047317 Bacteria 2756
984 Ga0495604_0068890 3300047317 Bacteria 2683
985 Ga0495604_0176181 3300047317 Bacteria 1499
986 Ga0495604_0337720 3300047317 Bacteria 1003
987 Ga0495604_0922598 3300047317 Bacteria 544
988 Ga0495674_0000944 3300047319 Bacteria 27747
989 Ga0495674_0034090 3300047319 Bacteria 4606
990 Ga0495674_0039755 3300047319 Bacteria 4213
991 Ga0495674_0126250 3300047319 Bacteria 2158
992 Ga0495674_0230014 3300047319 Bacteria 1530
993 Ga0495674_0398048 3300047319 Bacteria 1112
994 Ga0495674_0641062 3300047319 Bacteria 838
995 Ga0495676_0002172 3300047321 Bacteria 17365
996 Ga0495676_0043365 3300047321 Bacteria 3682
997 Ga0495676_0052135 3300047321 Bacteria 3268
998 Ga0495676_0082881 3300047321 Bacteria 2425
999 Ga0495680_0000491 3300047322 Bacteria 44586
1000 Ga0495680_0050186 3300047322 Bacteria 3263
1001 Ga0495680_0127060 3300047322 Bacteria 1876
1002 Ga0495680_0167091 3300047322 Bacteria 1594
1003 Ga0495680_0321908 3300047322 Bacteria 1082
1004 Ga0495680_0510562 3300047322 Bacteria 815
1005 Ga0495680_0622641 3300047322 Bacteria 720
1006 Ga0495675_0140167 3300047444 Bacteria 1499
1007 Ga0495675_0377835 3300047444 Bacteria 829
1008 Ga0495684_0005173 3300047471 Bacteria 10166
1009 Ga0495593_0010191 3300047673 Bacteria 5432
1010 Ga0495593_0019130 3300047673 Bacteria 3843
1011 Ga0495593_0149968 3300047673 Bacteria 1179
1012 Ga0495602_0054170 3300048088 Bacteria 3544
1013 Ga0495602_0070809 3300048088 Bacteria 2981
1014 Ga0495602_0197369 3300048088 Bacteria 1538
1015 Ga0495602_0261909 3300048088 Bacteria 1282
1016 Ga0495614_0007391 3300048089 Bacteria 4893
1017 Ga0495614_0050939 3300048089 Bacteria 1774
1018 Ga0495614_0482077 3300048089 Bacteria 589
1019 Ga0495614_0621487 3300048089 Bacteria 520
1020 Ga0496100_0014411 3300048903 Bacteria 4590
1021 Ga0496100_0015773 3300048903 Bacteria 4418
1022 Ga0496100_0076332 3300048903 Bacteria 2250
1023 Ga0496100_0087868 3300048903 Bacteria 2114
1024 Ga0496100_0268500 3300048903 Bacteria 1268
1025 Ga0496101_0002875 3300048904 Bacteria 10590
1026 Ga0496101_0018591 3300048904 Bacteria 4728
1027 Ga0496101_0024995 3300048904 Bacteria 4140
1028 Ga0496101_0027032 3300048904 Bacteria 3992
1029 Ga0496101_0038693 3300048904 Bacteria 3388
1030 Ga0496101_0047663 3300048904 Bacteria 3077
1031 Ga0496101_0148534 3300048904 Bacteria 1791
1032 Ga0496101_0297997 3300048904 Bacteria 1263
1033 Ga0496101_0542756 3300048904 Bacteria 919
1034 Ga0496101_0935578 3300048904 Bacteria 682
1035 Ga0496101_1109941 3300048904 Bacteria 621
1036 Ga0496102_0006393 3300048905 Bacteria 10043
1037 Ga0496102_0007158 3300048905 Bacteria 9524
1038 Ga0496102_0031961 3300048905 Bacteria 4726
1039 Ga0496102_0057760 3300048905 Bacteria 3544
1040 Ga0496102_0178118 3300048905 Bacteria 2002
1041 Ga0496102_0433599 3300048905 Unclassified 1234
1042 Ga0496102_0525950 3300048905 Bacteria 1105
1043 Ga0496102_0671417 3300048905 Bacteria 959
1044 Ga0496102_0848720 3300048905 Unclassified 835
1045 Ga0496102_1013955 3300048905 Bacteria 751
1046 Ga0496102_1754552 3300048905 Bacteria 538
1047 Ga0496103_0004333 3300048906 Bacteria 8618
1048 Ga0496103_0098308 3300048906 Bacteria 1851
1049 Ga0496103_0108037 3300048906 Bacteria 1765
1050 Ga0496103_0340335 3300048906 Bacteria 965
1051 Ga0496103_0589067 3300048906 Bacteria 709
1052 Ga0496103_1046432 3300048906 Bacteria 507
1053 Ga0496103_1060481 3300048906 Bacteria 503
1054 Ga0496104_0003577 3300048907 Bacteria 13415
1055 Ga0496104_0057348 3300048907 Bacteria 3685
1056 Ga0496104_0352908 3300048907 Bacteria 1383
1057 Ga0496104_0806886 3300048907 Bacteria 844
1058 Ga0496104_1000512 3300048907 Bacteria 740
1059 Ga0496104_1306538 3300048907 Bacteria 628
1060 Ga0496104_1465912 3300048907 Bacteria 585
1061 Ga0496104_1580963 3300048907 Bacteria 558
1062 Ga0496105_0004361 3300048908 Bacteria 10651
1063 Ga0496105_0007507 3300048908 Bacteria 8447
1064 Ga0496105_0049383 3300048908 Bacteria 3473
1065 Ga0496105_0250894 3300048908 Bacteria 1434
1066 Ga0496105_0880567 3300048908 Bacteria 676
1067 Ga0496105_0922002 3300048908 Bacteria 657
1068 Ga0496105_1274609 3300048908 Bacteria 538
1069 Ga0496106_0004788 3300048909 Bacteria 10010
1070 Ga0496106_0005708 3300048909 Bacteria 9207
1071 Ga0496106_0040068 3300048909 Bacteria 3507
1072 Ga0496106_0068056 3300048909 Bacteria 2716
1073 Ga0496106_0079533 3300048909 Bacteria 2517
1074 Ga0496106_0160808 3300048909 Bacteria 1776
1075 Ga0496106_0923661 3300048909 Bacteria 688
1076 Ga0496107_0002187 3300048910 Bacteria 12564
1077 Ga0496107_0051696 3300048910 Bacteria 2964
1078 Ga0496107_0559746 3300048910 Bacteria 846
1079 Ga0496107_0815262 3300048910 Bacteria 683
1080 Ga0496107_0931149 3300048910 Bacteria 632
1081 Ga0496107_0940025 3300048910 Unclassified 629
1082 Ga0496107_0983477 3300048910 Bacteria 613
1083 Ga0496107_1007004 3300048910 Bacteria 604
1084 Ga0496108_0007095 3300048911 Bacteria 9073
1085 Ga0496108_0047504 3300048911 Bacteria 3588
1086 Ga0496108_0137749 3300048911 Bacteria 2101
1087 Ga0496108_0189520 3300048911 Bacteria 1782
1088 Ga0496108_0666423 3300048911 Bacteria 904
1089 Ga0496108_0769616 3300048911 Bacteria 832
1090 Ga0496108_1180842 3300048911 Bacteria 648
1091 Ga0496109_0004651 3300048912 Bacteria 11458
1092 Ga0496109_0063728 3300048912 Bacteria 3372
1093 Ga0496109_0089321 3300048912 Bacteria 2848
1094 Ga0496109_0360994 3300048912 Bacteria 1372
1095 Ga0496109_0500717 3300048912 Bacteria 1147
1096 Ga0496109_0515177 3300048912 Bacteria 1129
1097 Ga0496109_0518376 3300048912 Bacteria 1125
1098 Ga0496109_0838467 3300048912 Bacteria 857
1099 Ga0496110_0005481 3300048913 Bacteria 9950
1100 Ga0496110_0058749 3300048913 Bacteria 3387
1101 Ga0496110_1629292 3300048913 Bacteria 555
1102 Ga0496111_0005981 3300048914 Bacteria 7855
1103 Ga0496111_0012824 3300048914 Bacteria 5687
1104 Ga0496111_0049942 3300048914 Bacteria 3016
1105 Ga0496111_0052158 3300048914 Bacteria 2953
1106 Ga0496111_0171945 3300048914 Bacteria 1610
1107 Ga0496111_0617552 3300048914 Bacteria 793
1108 Ga0496111_0889356 3300048914 Bacteria 642
1109 Ga0496112_0001450 3300048915 Bacteria 18215
1110 Ga0496112_0006292 3300048915 Bacteria 10415
1111 Ga0496112_0007087 3300048915 Bacteria 9908
1112 Ga0496112_0026743 3300048915 Bacteria 5558
1113 Ga0496112_0082764 3300048915 Bacteria 3174
1114 Ga0496112_0122322 3300048915 Bacteria 2573
1115 Ga0496112_0408848 3300048915 Bacteria 1296
1116 Ga0496112_0733917 3300048915 Bacteria 914
1117 Ga0496112_1549161 3300048915 Bacteria 576
1118 Ga0496113_0017566 3300048916 Bacteria 4968
1119 Ga0496113_0035844 3300048916 Bacteria 3631
1120 Ga0496113_0365991 3300048916 Bacteria 1157
1121 Ga0496113_0404147 3300048916 Bacteria 1097
1122 Ga0496113_0503207 3300048916 Bacteria 973
1123 Ga0496113_0859966 3300048916 Bacteria 719
1124 Ga0496113_0992950 3300048916 Bacteria 661
1125 Ga0496114_0001055 3300048917 Bacteria 20710
1126 Ga0496114_0029665 3300048917 Bacteria 4498
1127 Ga0496114_0103450 3300048917 Bacteria 2434
1128 Ga0496114_0131618 3300048917 Bacteria 2160
1129 Ga0496114_0154317 3300048917 Bacteria 1993
1130 Ga0496114_0194861 3300048917 Bacteria 1773
1131 Ga0496114_0282339 3300048917 Bacteria 1464
1132 Ga0496114_0716559 3300048917 Bacteria 876
1133 Ga0496114_1479363 3300048917 Bacteria 567
1134 Ga0496115_0001930 3300048918 Bacteria 14798
1135 Ga0496115_0004249 3300048918 Bacteria 10358
1136 Ga0496115_0006019 3300048918 Bacteria 8856
1137 Ga0496115_0010743 3300048918 Bacteria 6848
1138 Ga0496115_0338373 3300048918 Bacteria 1228
1139 Ga0496115_0403600 3300048918 Bacteria 1109
1140 Ga0496115_0566482 3300048918 Bacteria 906
1141 Ga0496115_0889896 3300048918 Bacteria 687
1142 Ga0501031_0050828 3300049568 Bacteria 2699
1143 Ga0501031_0806611 3300049568 Bacteria 602
1144 Ga0501032_0123521 3300049569 Bacteria 1710
1145 Ga0501033_0008059 3300049570 Bacteria 8161
1146 Ga0501034_0003184 3300049571 Bacteria 18882
1147 Ga0501034_0165777 3300049571 Bacteria 2178
1148 Ga0501034_1570177 3300049571 Bacteria 531
1149 Ga0501036_0087038 3300049572 Bacteria 2640
1150 Ga0501036_0474920 3300049572 Bacteria 1041
1151 Ga0501037_0112532 3300049573 Bacteria 1960
1152 Ga0501038_0025721 3300049574 Bacteria 5243
1153 Ga0501039_0078300 3300049575 Bacteria 2571
1154 Ga0501040_0001135 3300049576 Bacteria 16892
1155 Ga0501040_0082946 3300049576 Bacteria 2223
1156 Ga0501041_0001531 3300049577 Bacteria 12843
1157 Ga0501041_0508786 3300049577 Bacteria 766
1158 Ga0501042_0000272 3300049578 Bacteria 25276
1159 Ga0501042_0280580 3300049578 Bacteria 1203
1160 Ga0501042_0427750 3300049578 Bacteria 960
1161 Ga0501043_0009705 3300049579 Bacteria 7542
1162 Ga0501046_0000332 3300049580 Bacteria 47567
1163 Ga0501046_0262668 3300049580 Bacteria 1268
1164 Ga0501047_0056333 3300049581 Bacteria 3801
1165 Ga0501047_0142073 3300049581 Bacteria 2278
1166 Ga0501047_0144410 3300049581 Bacteria 2257
1167 Ga0501048_0002707 3300049582 Bacteria 13520
1168 Ga0501048_0687661 3300049582 Bacteria 734
1169 Ga0501048_1338667 3300049582 Bacteria 515
1170 Ga0501067_0003649 3300049583 Bacteria 8482
1171 Ga0501067_0019581 3300049583 Bacteria 3747
1172 Ga0501067_0079231 3300049583 Bacteria 1820
1173 Ga0501067_0126918 3300049583 Bacteria 1419
1174 Ga0501067_0285938 3300049583 Bacteria 918
1175 Ga0501067_0339722 3300049583 Bacteria 837
1176 Ga0501067_0444786 3300049583 Unclassified 724
1177 Ga0501068_0012786 3300049584 Bacteria 4765
1178 Ga0501068_0031718 3300049584 Bacteria 3139
1179 Ga0501068_0054832 3300049584 Bacteria 2415
1180 Ga0501068_0147597 3300049584 Bacteria 1477
1181 Ga0501068_0241486 3300049584 Bacteria 1150
1182 Ga0501069_0001571 3300049585 Bacteria 11282
1183 Ga0501069_0005861 3300049585 Bacteria 6400
1184 Ga0501069_0292651 3300049585 Bacteria 954
1185 Ga0501069_0506863 3300049585 Bacteria 720
1186 Ga0501070_0003206 3300049586 Bacteria 14226
1187 Ga0501070_0026105 3300049586 Bacteria 4901
1188 Ga0501070_0130801 3300049586 Bacteria 2073
1189 Ga0501070_0646376 3300049586 Bacteria 840
1190 Ga0501070_0652662 3300049586 Bacteria 835
1191 Ga0501070_1234740 3300049586 Bacteria 572
1192 Ga0501071_0021673 3300049587 Bacteria 4477
1193 Ga0501072_0015423 3300049588 Bacteria 5857
1194 Ga0501072_1248360 3300049588 Unclassified 577
1195 Ga0501073_0029751 3300049589 Bacteria 3903
1196 Ga0501073_0641869 3300049589 Bacteria 733
1197 Ga0501073_0722196 3300049589 Bacteria 687
1198 Ga0501074_0020747 3300049590 Bacteria 4772
1199 Ga0501074_0118067 3300049590 Bacteria 1897
1200 Ga0501074_0144407 3300049590 Bacteria 1702
1201 Ga0501074_0278737 3300049590 Bacteria 1189
1202 Ga0501075_0000659 3300049591 Bacteria 21228
1203 Ga0501075_0359962 3300049591 Bacteria 1109
1204 Ga0501075_0596221 3300049591 Bacteria 843
1205 Ga0501076_0021198 3300049592 Bacteria 4982
1206 Ga0501077_0001904 3300049593 Bacteria 12632
1207 Ga0501077_0015838 3300049593 Bacteria 4748
1208 Ga0501077_0625336 3300049593 Bacteria 692
1209 Ga0501077_0902230 3300049593 Bacteria 569
1210 Ga0501079_0000155 3300049741 Bacteria 37452
1211 Ga0501079_0189066 3300049741 Bacteria 1607
1212 Ga0501079_0271555 3300049741 Bacteria 1325
1213 Ga0501079_0322998 3300049741 Bacteria 1208
1214 Ga0501079_1174093 3300049741 Bacteria 605
1215 Ga0501079_1410411 3300049741 Bacteria 548
1216 Ga0501080_0108130 3300049742 Bacteria 2577
1217 Ga0501080_0251007 3300049742 Bacteria 1613
1218 Ga0501080_0316989 3300049742 Bacteria 1412
1219 Ga0501080_0410527 3300049742 Bacteria 1217
1220 Ga0501080_0479998 3300049742 Bacteria 1112
1221 Ga0501081_0001472 3300049743 Bacteria 14434
1222 Ga0501081_0671814 3300049743 Bacteria 777
1223 Ga0501083_0011793 3300049744 Bacteria 6124
1224 Ga0501083_0339079 3300049744 Bacteria 977
1225 Ga0501035_0118007 3300049822 Bacteria 2321
1226 Ga0501035_0181960 3300049822 Bacteria 1811
1227 Ga0501044_0044757 3300049823 Bacteria 4590
1228 Ga0501044_0161865 3300049823 Bacteria 2214
1229 Ga0501044_0507847 3300049823 Bacteria 1106
1230 Ga0501044_1541266 3300049823 Bacteria 529
1231 Ga0501045_0007803 3300049824 Bacteria 7443
1232 Ga0501045_0637527 3300049824 Bacteria 788
1233 nmdc:mga05p37_1620566_c1 3300050507 Bacteria 636
1234 nmdc:mga05p37_477167_c1 3300050507 Bacteria 1437
1235 nmdc:mga05p37_733747_c1 3300050507 Bacteria 1092
1236 nmdc:mga09592_500346_c1 3300050508 Bacteria 1046
1237 nmdc:mga06r32_1312490_c1 3300050510 Bacteria 667
1238 nmdc:mga08y16_1681672_c1 3300050511 Bacteria 590
1239 nmdc:mga08y16_1881800_c1 3300050511 Bacteria 550
1240 nmdc:mga0n895_4747_c1 3300050512 Bacteria 11229
1241 nmdc:mga0n895_66521_c1 3300050512 Bacteria 3569
1242 nmdc:mga0n895_668399_c1 3300050512 Bacteria 1036
1243 nmdc:mga0rr50_1643075_c1 3300050513 Bacteria 542
1244 nmdc:mga0rr50_726841_c1 3300050513 Bacteria 847
1245 nmdc:mga0rr50_8707_c1 3300050513 Bacteria 6328
1246 nmdc:mga08x19_396731_c1 3300050514 Bacteria 967
1247 nmdc:mga08x19_649826_c1 3300050514 Bacteria 748
1248 Ga0495601_0042101 3300053077 Bacteria 2864
1249 Ga0495601_0215016 3300053077 Bacteria 1255
1250 Ga0495601_0417007 3300053077 Unclassified 870
1251 Ga0495601_0543994 3300053077 Unclassified 747
1252 Ga0495601_0754697 3300053077 Bacteria 619
1253 Ga0495612_0267715 3300053078 Bacteria 762
1254 Ga0495612_0276073 3300053078 Bacteria 750
1255 Ga0495655_0243725 3300053083 Bacteria 602
1256 Ga0495595_0024188 3300053084 Bacteria 2681
1257 Ga0495595_0030992 3300053084 Bacteria 2401
1258 Ga0495595_0075809 3300053084 Bacteria 1596
1259 Ga0495595_0180356 3300053084 Unclassified 1047
1260 Ga0495595_0499210 3300053084 Bacteria 620
1261 Ga0495619_0010424 3300053085 Bacteria 5848
1262 Ga0495619_0039047 3300053085 Bacteria 3098
1263 Ga0495619_0050697 3300053085 Bacteria 2741
1264 Ga0495619_0057461 3300053085 Bacteria 2582
1265 Ga0495619_0266138 3300053085 Bacteria 1188
1266 Ga0501084_0006129 3300054114 Bacteria 9883
1267 Ga0501084_0166479 3300054114 Bacteria 1860
1268 Ga0501084_1726385 3300054114 Bacteria 523
1269 Ga0590074_018569 3300059423 Bacteria 1190
1270 Ga0590075_042453 3300059424 Bacteria 1163
1271 Ga0590077_053736 3300059426 Bacteria 907
1272 Ga0587066_097148 3300059490 Bacteria 664
1273 Ga0587066_135608 3300059490 Bacteria 596
1274 Ga0587070_114187 3300059491 Bacteria 638
1275 Ga0587080_151380 3300059503 Bacteria 538
1276 Ga0587083_0196014 3300059505 Bacteria 574
1277 Ga0587083_0283845 3300059505 Bacteria 505
1278 Ga0587089_052123 3300059509 Bacteria 659
1279 Ga0587091_123006 3300059511 Bacteria 632
1280 Ga0587098_034432 3300059604 Bacteria 712
1281 Ga0587106_083877 3300059605 Bacteria 625
1282 Ga0587115_111974 3300059626 Bacteria 517
1283 Ga0587067_095615 3300059640 Bacteria 680
1284 Ga0587114_080424 3300059655 Bacteria 605
1285 Ga0587111_0160298 3300060346 Bacteria 611
1286 Ga0501082_0000480 3300060353 Bacteria 35259
1287 Ga0501082_0524157 3300060353 Unclassified 1036
1288 Ga0501082_0619069 3300060353 Bacteria 947
1289 Ga0466962_0488780 3300061719 Bacteria 622
1290 Ga0530510_0000230 3300061734 Bacteria 34995
1291 Ga0530510_0073196 3300061734 Bacteria 2487
1292 Ga0530510_0116202 3300061734 Bacteria 1961
1293 Ga0070658_11003768
1294 JGI24737J22298_10192572
1295 JGI24743J22301_10119710
1296 Ga0058863_10058229
1297 Ga0070658_10159250
1298 Ga0070658_10378361
1299 Ga0070658_11238415
1300 Ga0070676_10121968
1301 Ga0070683_100004462
1302 Ga0070683_100065117
1303 Ga0070683_100160124
1304 Ga0070683_100196034
1305 Ga0070683_100414338
1306 Ga0070683_100444207
1307 Ga0070683_100445415
1308 Ga0070690_100071641
1309 Ga0070670_100343018
1310 Ga0070670_100429998
1311 Ga0068869_100060026
1312 Ga0068869_100070985
1313 Ga0068869_100140466
1314 Ga0070666_10158979
1315 Ga0070680_100060097
1316 Ga0070680_100112057
1317 Ga0070680_100139899
1318 Ga0070682_100014416
1319 Ga0070682_100137438
1320 Ga0070682_100684036
1321 Ga0070682_100765564
1322 Ga0068868_100076587
1323 Ga0068868_100087772
1324 Ga0068868_100099234
1325 Ga0068868_101384345
1326 Ga0070660_100008187
1327 Ga0070660_100100458
1328 Ga0070660_100254230
1329 Ga0070660_101301863
1330 Ga0070689_100072495
1331 Ga0070691_10118420
1332 Ga0070691_10996327
1333 Ga0070687_100867805
1334 Ga0070661_100006256
1335 Ga0070661_100006849
1336 Ga0070661_100309189
1337 Ga0070661_100537834
1338 Ga0070661_100999972
1339 Ga0070661_101595747
1340 Ga0070692_10026063
1341 Ga0070692_10088380
1342 Ga0070692_10168062
1343 Ga0070668_100177452
1344 Ga0070668_100248601
1345 Ga0070668_100383945
1346 Ga0070675_102139345
1347 Ga0070671_100366415
1348 Ga0070671_100372968
1349 Ga0070671_101450758
1350 Ga0070674_100019333
1351 Ga0070674_100111213
1352 Ga0070674_100854502
1353 Ga0070674_101824461
1354 Ga0070673_100120177
1355 Ga0070688_100069583
1356 Ga0070688_100397045
1357 Ga0070659_100011282
1358 Ga0070659_100183843
1359 Ga0070659_102110098
1360 Ga0070667_100011225
1361 Ga0070667_101041637
1362 Ga0070703_10622931
1363 Ga0070709_10049444
1364 Ga0070709_10451344
1365 Ga0070709_10602919
1366 Ga0070714_100042327
1367 Ga0070714_100089193
1368 Ga0070714_100177169
1369 Ga0070714_100187934
1370 Ga0070714_100605272
1371 Ga0070714_100954282
1372 Ga0070714_102188542
1373 Ga0070713_100170141
1374 Ga0070713_100465035
1375 Ga0070713_101248067
1376 Ga0070713_101753198
1377 Ga0070710_10265355
1378 Ga0070710_10291344
1379 Ga0070710_10664933
1380 Ga0070701_10078474
1381 Ga0070701_10625996
1382 Ga0070711_100023255
1383 Ga0070711_100324185
1384 Ga0070711_100573418
1385 Ga0070705_100060215
1386 Ga0070705_100165974
1387 Ga0070705_100940423
1388 Ga0070700_100014010
1389 Ga0070700_100139140
1390 Ga0070700_100226097
1391 Ga0070700_100511664
1392 Ga0070700_100695566
1393 Ga0070694_100187759
1394 Ga0070694_100251665
1395 Ga0070708_100404878
1396 Ga0070708_100448762
1397 Ga0070663_100950492
1398 Ga0070678_100112177
1399 Ga0070678_100193775
1400 Ga0070678_102148742
1401 Ga0070662_100025198
1402 Ga0070662_100214645
1403 Ga0070662_100589825
1404 Ga0070681_10008490
1405 Ga0070681_10028181
1406 Ga0070681_10082635
1407 Ga0070681_10164785
1408 Ga0070681_10385188
1409 Ga0070681_10415779
1410 Ga0070681_10518753
1411 Ga0070681_10764746
1412 Ga0070681_11218242
1413 Ga0068867_100074108
1414 Ga0068867_100267918
1415 Ga0068867_100839017
1416 Ga0068867_101833788
1417 Ga0070685_10141590
1418 Ga0070685_10683379
1419 Ga0070706_101818259
1420 Ga0070707_100356451
1421 Ga0070707_100380634
1422 Ga0070707_100734394
1423 Ga0070698_101264799
1424 Ga0070698_101521464
1425 Ga0070699_100076728
1426 Ga0070699_101842392
1427 Ga0070679_100087848
1428 Ga0070679_100231236
1429 Ga0070679_100264560
1430 Ga0070679_100360245
1431 Ga0070679_100882778
1432 Ga0070679_101104596
1433 Ga0070679_101126090
1434 Ga0070684_100002170
1435 Ga0070684_100021741
1436 Ga0070684_100078043
1437 Ga0070684_100079373
1438 Ga0070684_100081483
1439 Ga0070684_100164503
1440 Ga0070684_100210153
1441 Ga0070684_100662989
1442 Ga0070684_100698363
1443 Ga0070684_101067416
1444 Ga0070697_100576121
1445 Ga0068853_100153385
1446 Ga0068853_100916406
1447 Ga0068853_101007999
1448 Ga0068853_101870338
1449 Ga0070672_100236932
1450 Ga0070672_100901697
1451 Ga0070672_100932875
1452 Ga0070672_102048240
1453 Ga0070686_100189089
1454 Ga0070686_100239196
1455 Ga0070695_100086659
1456 Ga0070695_100902824
1457 Ga0070696_100020757
1458 Ga0070696_100040965
1459 Ga0070696_101225514
1460 Ga0070693_100271341
1461 Ga0070693_100358776
1462 Ga0070693_100579939
1463 Ga0070665_100080403
1464 Ga0070665_100165863
1465 Ga0070665_100648382
1466 Ga0070665_100993107
1467 Ga0070665_101930054
1468 Ga0070704_100251462
1469 Ga0070704_100392047
1470 Ga0070704_100482764
1471 Ga0068855_100013130
1472 Ga0068855_100050398
1473 Ga0068855_100197764
1474 Ga0068855_100254597
1475 Ga0068855_100259944
1476 Ga0070664_100151734
1477 Ga0070664_100153355
1478 Ga0070664_100219932
1479 Ga0070664_100238562
1480 Ga0070664_100391494
1481 Ga0068857_100010678
1482 Ga0068857_100012513
1483 Ga0068857_100333895
1484 Ga0068854_100010961
1485 Ga0068854_100125699
1486 Ga0068854_100341720
1487 Ga0068854_100483893
1488 Ga0068854_101772660
1489 Ga0068856_100004589
1490 Ga0068856_100095955
1491 Ga0068856_100112742
1492 Ga0068856_100114678
1493 Ga0068856_100123757
1494 Ga0068856_102634467
1495 Ga0070702_100012351
1496 Ga0070702_100022944
1497 Ga0070702_100470994
1498 Ga0068852_100154748
1499 Ga0068852_100929244
1500 Ga0068852_100967286
1501 Ga0068852_101087536
1502 Ga0068859_100117675
1503 Ga0068859_102342801
1504 Ga0068864_100952251
1505 Ga0068864_101175673
1506 Ga0068864_101648924
1507 Ga0068866_10100930
1508 Ga0068866_11129362
1509 Ga0068861_100122029
1510 Ga0068861_100238572
1511 Ga0068861_100279508
1512 Ga0068851_10057190
1513 Ga0068851_10224728
1514 Ga0068851_10250658
1515 Ga0068870_10415491
1516 Ga0068860_100446102
1517 Ga0068862_100205883
1518 Ga0068862_100447871
1519 Ga0081455_10066708
1520 Ga0081455_10189118
1521 Ga0081538_10000059
1522 Ga0081538_10000939
1523 Ga0081538_10077190
1524 Ga0081540_1026636
1525 Ga0081539_10379186
1526 Ga0070717_10147548
1527 Ga0070717_10248460
1528 Ga0070717_11320423
1529 Ga0070715_10055696
1530 Ga0070715_10132645
1531 Ga0070715_10729701
1532 Ga0070715_10935378
1533 Ga0070716_100199601
1534 Ga0070716_101527192
1535 Ga0070712_100011180
1536 Ga0070712_100085921
1537 Ga0070712_100266530
1538 Ga0070712_100371263
1539 Ga0070712_100564039
1540 Ga0070712_100577247
1541 Ga0070712_100769640
1542 Ga0070712_100986707
1543 Ga0097621_100100370
1544 Ga0097621_100658093
1545 Ga0097621_101094956
1546 Ga0068871_100137505
1547 Ga0068871_100146961
1548 Ga0068871_101010560
1549 Ga0068871_101862541
1550 Ga0075428_101352357
1551 Ga0075428_101525106
1552 Ga0075428_101948730
1553 Ga0075433_10096866
1554 Ga0075433_10139122
1555 Ga0075433_10384546
1556 Ga0075433_10823519
1557 Ga0075434_100000288
1558 Ga0075434_100018510
1559 Ga0068865_100166347
1560 Ga0068865_100799563
1561 Ga0068865_100973441
1562 Ga0068865_102050855
1563 Ga0075436_100371622
1564 Ga0075436_101159067
1565 Ga0097620_100117671
1566 Ga0097620_102342873
1567 Ga0075435_100009347
1568 Ga0075435_100154157
1569 Ga0075435_101557192
1570 Ga0075435_101638165
1571 Ga0105240_10168799
1572 Ga0105240_10201527
1573 Ga0105240_10523857
1574 Ga0105240_10793271
1575 Ga0105240_12592786
1576 Ga0111539_10992705
1577 Ga0111539_12491529
1578 Ga0111539_12629029
1579 Ga0105245_10010505
1580 Ga0105245_10020014
1581 Ga0105245_10066479
1582 Ga0105245_10143417
1583 Ga0105245_10191096
1584 Ga0105245_10379343
1585 Ga0105245_12258927
1586 Ga0105247_10328782
1587 Ga0105247_11332197
1588 Ga0114129_10034735
1589 Ga0114129_10938849
1590 Ga0105243_10063297
1591 Ga0105243_10129765
1592 Ga0105243_10145258
1593 Ga0105243_10157670
1594 Ga0105243_10207412
1595 Ga0105241_10232388
1596 Ga0105241_10261041
1597 Ga0105241_10288667
1598 Ga0105241_10851554
1599 Ga0105242_10124875
1600 Ga0105242_10143075
1601 Ga0105242_10300165
1602 Ga0105242_10585861
1603 Ga0105242_11731854
1604 Ga0105248_10153320
1605 Ga0105248_10386125
1606 Ga0105237_10065849
1607 Ga0105237_10275223
1608 Ga0105237_10913145
1609 Ga0105238_10016816
1610 Ga0105238_10024093
1611 Ga0105238_10029238
1612 Ga0105238_12048181
1613 Ga0105238_12769955
1614 Ga0105249_10053640
1615 Ga0105249_10082731
1616 Ga0105249_10332080
1617 Ga0105239_10047172
1618 Ga0105239_10165256
1619 Ga0105239_10328527
1620 Ga0105239_10878736
1621 Ga0105239_12394770
1622 Ga0105246_10229334
1623 Ga0105246_10235425
1624 Ga0157345_1045955
1625 Ga0154010_111657
1626 Ga0157373_10029236
1627 Ga0157373_10996037
1628 Ga0157371_10996725
1629 Ga0157370_10040599
1630 Ga0157370_10111956
1631 Ga0157370_10294487
1632 Ga0157370_10619521
1633 Ga0157370_10982301
1634 Ga0157370_11354339
1635 Ga0157369_10006129
1636 Ga0157369_10017337
1637 Ga0157369_10018632
1638 Ga0157369_10037075
1639 Ga0157369_10059365
1640 Ga0157369_10103686
1641 Ga0157369_10267871
1642 Ga0157369_10438866
1643 Ga0157369_10771483
1644 Ga0157369_12549769
1645 Ga0157374_10043473
1646 Ga0157374_10244845
1647 Ga0157374_10478435
1648 Ga0157374_10492826
1649 Ga0157374_10647685
1650 Ga0157374_10834835
1651 Ga0157374_11379835
1652 Ga0157374_12521948
1653 Ga0157378_10684821
1654 Ga0157378_11081783
1655 Ga0157378_13054342
1656 Ga0163162_10065811
1657 Ga0163162_10147565
1658 Ga0163162_10425474
1659 Ga0163162_10512933
1660 Ga0163162_11041298
1661 Ga0157372_10016430
1662 Ga0157372_10067351
1663 Ga0157372_10069442
1664 Ga0157372_10102553
1665 Ga0157372_10301713
1666 Ga0157372_11849121
1667 Ga0157372_12274164
1668 Ga0157375_10394539
1669 Ga0157375_10523633
1670 Ga0157375_10686347
1671 Ga0163163_10005491
1672 Ga0163163_12209976
1673 Ga0157380_10326743
1674 Ga0157380_10968685
1675 Ga0157380_11716452
1676 Ga0157377_10000811
1677 Ga0157377_10883623
1678 Ga0157379_10119216
1679 Ga0157376_10012411
1680 Ga0157376_10109890
1681 Ga0157376_10216561
1682 Ga0157376_10439367
1683 Ga0157376_12627093
1684 Ga0182006_1166591
1685 Ga0197907_10272433
1686 Ga0197907_10520340
1687 Ga0197907_10540602
1688 Ga0206356_10002683
1689 Ga0206356_10142702
1690 Ga0206356_10915817
1691 Ga0206356_11241351
1692 Ga0206356_11889777
1693 Ga0206356_11906180
1694 Ga0206355_1150212
1695 Ga0206352_10568934
1696 Ga0206350_10432168
1697 Ga0206350_10517347
1698 Ga0206350_10827546
1699 Ga0206350_11491362
1700 Ga0206354_10323697
1701 Ga0206353_10260902
1702 Ga0206353_10311011
1703 Ga0206353_11315790
1704 Ga0213873_10100442
1705 Ga0224712_10046400
1706 Ga0224712_10125171
1707 Ga0224712_10141618
1708 Ga0224712_10178621
1709 Ga0224712_10275539
1710 Ga0224712_10336736
1711 Ga0224712_10365394
1712 Ga0207697_10265251
1713 Ga0207656_10188603
1714 Ga0207653_10388320
1715 Ga0207692_10112452
1716 Ga0207692_10461573
1717 Ga0207692_10628970
1718 Ga0207692_11217474
1719 Ga0207642_10019598
1720 Ga0207642_10051877
1721 Ga0207710_10149755
1722 Ga0207688_10039319
1723 Ga0207688_10089851
1724 Ga0207688_10101483
1725 Ga0207680_10034303
1726 Ga0207647_10137924
1727 Ga0207685_10102907
1728 Ga0207685_10524243
1729 Ga0207685_10577360
1730 Ga0207699_10016150
1731 Ga0207699_10222621
1732 Ga0207645_10387589
1733 Ga0207645_10447812
1734 Ga0207643_10124032
1735 Ga0207705_10045265
1736 Ga0207705_10049149
1737 Ga0207705_10169123
1738 Ga0207705_10657734
1739 Ga0207684_11071152
1740 Ga0207654_10126066
1741 Ga0207654_10280082
1742 Ga0207654_10494570
1743 Ga0207654_10943099
1744 Ga0207707_10002473
1745 Ga0207707_10023064
1746 Ga0207707_10094470
1747 Ga0207707_10128466
1748 Ga0207707_10176916
1749 Ga0207707_10184948
1750 Ga0207707_10306361
1751 Ga0207695_10276705
1752 Ga0207695_10510539
1753 Ga0207695_10708641
1754 Ga0207671_10212941
1755 Ga0207671_10268542
1756 Ga0207671_10305684
1757 Ga0207693_10006129
1758 Ga0207693_10025865
1759 Ga0207693_10044783
1760 Ga0207693_10074077
1761 Ga0207693_10204051
1762 Ga0207693_10403358
1763 Ga0207693_10638075
1764 Ga0207663_10025472
1765 Ga0207663_10287232
1766 Ga0207663_10345354
1767 Ga0207660_10008507
1768 Ga0207660_10075618
1769 Ga0207660_10098807
1770 Ga0207660_11126474
1771 Ga0207662_10032222
1772 Ga0207657_10019359
1773 Ga0207657_10033039
1774 Ga0207657_10105190
1775 Ga0207657_10216334
1776 Ga0207657_10415502
1777 Ga0207649_10177829
1778 Ga0207649_10284283
1779 Ga0207649_10397061
1780 Ga0207649_11615809
1781 Ga0207652_10067465
1782 Ga0207652_10241497
1783 Ga0207652_10262084
1784 Ga0207652_10588360
1785 Ga0207652_10914696
1786 Ga0207646_10187358
1787 Ga0207646_10337993
1788 Ga0207646_10398279
1789 Ga0207646_10644175
1790 Ga0207681_10191033
1791 Ga0207694_10102874
1792 Ga0207694_10124866
1793 Ga0207694_10198717
1794 Ga0207650_10524621
1795 Ga0207650_10926864
1796 Ga0207659_11646523
1797 Ga0207687_10003687
1798 Ga0207687_10004292
1799 Ga0207687_10013761
1800 Ga0207687_10031947
1801 Ga0207687_10298609
1802 Ga0207700_10496362
1803 Ga0207700_11192616
1804 Ga0207700_11276402
1805 Ga0207700_11355393
1806 Ga0207700_11464177
1807 Ga0207664_10118764
1808 Ga0207664_10140364
1809 Ga0207664_10167829
1810 Ga0207664_10199711
1811 Ga0207664_10271932
1812 Ga0207664_10462616
1813 Ga0207664_11647957
1814 Ga0207664_11794616
1815 Ga0207644_10115487
1816 Ga0207644_10121456
1817 Ga0207644_11671426
1818 Ga0207690_10012160
1819 Ga0207690_10050575
1820 Ga0207690_10070800
1821 Ga0207706_10194609
1822 Ga0207706_10345534
1823 Ga0207706_11516764
1824 Ga0207709_10058973
1825 Ga0207709_10102752
1826 Ga0207709_10415859
1827 Ga0207709_10446687
1828 Ga0207669_10010168
1829 Ga0207669_10145783
1830 Ga0207669_10421050
1831 Ga0207669_10472729
1832 Ga0207704_10020469
1833 Ga0207704_10518636
1834 Ga0207704_10817461
1835 Ga0207704_11287902
1836 Ga0207665_10213942
1837 Ga0207665_10915058
1838 Ga0207691_10322435
1839 Ga0207691_10804414
1840 Ga0207711_10369982
1841 Ga0207711_11673813
1842 Ga0207689_10032246
1843 Ga0207689_10051166
1844 Ga0207661_10017694
1845 Ga0207661_10027657
1846 Ga0207661_10101307
1847 Ga0207661_10214956
1848 Ga0207661_10439909
1849 Ga0207661_10490526
1850 Ga0207661_10795976
1851 Ga0207661_10811701
1852 Ga0207661_10903207
1853 Ga0207661_10991166
1854 Ga0207661_11076974
1855 Ga0207679_10191835
1856 Ga0207679_10259310
1857 Ga0207667_10024089
1858 Ga0207667_10063012
1859 Ga0207667_10078675
1860 Ga0207667_10080330
1861 Ga0207667_10613458
1862 Ga0207667_11039917
1863 Ga0207667_11938835
1864 Ga0207651_10152349
1865 Ga0207651_10596858
1866 Ga0207712_10241330
1867 Ga0207712_10348099
1868 Ga0207668_10098892
1869 Ga0207640_10051928
1870 Ga0207640_10107500
1871 Ga0207640_10768400
1872 Ga0207640_11380948
1873 Ga0207640_11748610
1874 Ga0207658_10003886
1875 Ga0207658_11297012
1876 Ga0207658_11500641
1877 Ga0207677_10010576
1878 Ga0207677_10432945
1879 Ga0207677_10457699
1880 Ga0207677_10635272
1881 Ga0207677_11392620
1882 Ga0207703_10052430
1883 Ga0207639_10108692
1884 Ga0207639_10141253
1885 Ga0207639_10278971
1886 Ga0207639_10925941
1887 Ga0207639_11896082
1888 Ga0207678_10154748
1889 Ga0207678_10195549
1890 Ga0207678_10831595
1891 Ga0207678_11171405
1892 Ga0207708_10004675
1893 Ga0207708_10045109
1894 Ga0207708_10859500
1895 Ga0207708_11514145
1896 Ga0207708_12003123
1897 Ga0207702_10008420
1898 Ga0207702_10070367
1899 Ga0207702_10179603
1900 Ga0207702_10237286
1901 Ga0207702_10796681
1902 Ga0207648_10036192
1903 Ga0207648_10069681
1904 Ga0207676_10431708
1905 Ga0207676_10941329
1906 Ga0207676_11141198
1907 Ga0207674_10004135
1908 Ga0207674_10009602
1909 Ga0207674_10024193
1910 Ga0207674_10072348
1911 Ga0207674_10084616
1912 Ga0207674_11079527
1913 Ga0207675_100004546
1914 Ga0207675_100020968
1915 Ga0207675_100360851
1916 Ga0207683_10005639
1917 Ga0207683_10111906
1918 Ga0207683_10436745
1919 Ga0207683_11065943
1920 Ga0207683_11329015
1921 Ga0207698_10092693
1922 Ga0207698_10860151
1923 Ga0207698_11204396
1924 Ga0207698_11346523
1925 Ga0209966_1052986
1926 Ga0209974_10196561
1927 Ga0207428_10386307
1928 Ga0268266_10093454
1929 Ga0268266_10632639
1930 Ga0268265_10212127
1931 Ga0268265_12038097
1932 Ga0268265_12632724
1933 Ga0268264_10458896
1934 Ga0268264_10605819
1935 Ga0268264_11630368
1936 Ga0268264_11805915
1937 Ga0265338_10053011
1938 Ga0265338_10081986
1939 Ga0265338_10360334
1940 Ga0265328_10046362
1941 Ga0265327_10005348
1942 Ga0265327_10025102
1943 Ga0265327_10043117
1944 Ga0307408_100731485
1945 Ga0265313_10365476
1946 Ga0307405_11409823
1947 Ga0307412_10713555
1948 Ga0307409_100428292
1949 Ga0307415_100980212
1950 Ga0373948_0143803
1951 Ga0373926_0033608
1952 Ga0373928_0112888
1953 Ga0373934_0053026
1954 Ga0373944_0005822
1955 Ga0373944_0029250
1956 Ga0373944_0094392
1957 Ga0373944_0187308
1958 Ga0373949_0026207
1959 Ga0373923_0027686
1960 Ga0373923_0126032
1961 Ga0373936_0004255
1962 Ga0373945_0005048
1963 Ga0373945_0005353
1964 Ga0373945_0124517
1965 Ga0373954_0274243
1966 Ga0373943_0000948
1967 Ga0373943_0005005
1968 Ga0373943_0029909
1969 Ga0373943_0091068
1970 Ga0373943_0921681
1971 Ga0373946_0028313
1972 Ga0373946_0034334
1973 Ga0373946_0049788
1974 Ga0373955_0081204
1975 Ga0373961_0407873
1976 Ga0373962_0069989
1977 Ga0373924_0304370
1978 Ga0373931_0851639
1979 Ga0373931_1211222
1980 Ga0373935_0020566
1981 Ga0373935_0039711
1982 Ga0373935_0092235
1983 Ga0373935_0133805
1984 Ga0373935_0703428
1985 Ga0373927_0013935
1986 Ga0373927_0188986
1987 Ga0373927_0703717
1988 Ga0373933_0053922
1989 Ga0373947_0003156
1990 Ga0373947_0011478
1991 Ga0373947_0020606
1992 Ga0373947_0032831
1993 Ga0373947_0629307
1994 Ga0373937_0242408
1995 Ga0373937_0288184
1996 Ga0373937_0575187
1997 Ga0373925_0013684
1998 Ga0373925_0055953
1999 Ga0373925_0590428
2000 Ga0373925_0709030
2001 Ga0395899_0000857
2002 Ga0395899_0022381
2003 Ga0395899_0286300
2004 Ga0395899_0489570
2005 Ga0395900_0006983
2006 Ga0395900_0008169
2007 Ga0395900_0026920
2008 Ga0395900_0052733
2009 Ga0395900_0120580
2010 Ga0395900_0146384
2011 Ga0395900_0176437
2012 Ga0395900_0232975
2013 Ga0395900_0258735
2014 Ga0395900_0284944
2015 Ga0395900_0343602
2016 Ga0395900_0568862
2017 Ga0395900_1874177
2018 Ga0395898_0001107
2019 Ga0395898_0003086
2020 Ga0395898_0026599
2021 Ga0395898_0041591
2022 Ga0395898_0077048
2023 Ga0395898_0083596
2024 Ga0395898_0120968
2025 Ga0395898_0137249
2026 Ga0395898_1468889
2027 Ga0395898_1623872
2028 Ga0395905_0006650
2029 Ga0395905_0028323
2030 Ga0395905_0090864
2031 Ga0395905_0228732
2032 Ga0395905_0412021
2033 Ga0395905_0549727
2034 Ga0395905_0601511
2035 Ga0395905_1476474
2036 Ga0395901_0009580
2037 Ga0395901_0010735
2038 Ga0395901_0014827
2039 Ga0395901_0032782
2040 Ga0395901_0033026
2041 Ga0395901_0057261
2042 Ga0395901_0081453
2043 Ga0395901_0190919
2044 Ga0395901_0587348
2045 Ga0395901_0618580
2046 Ga0395901_0622690
2047 Ga0395901_0722601
2048 Ga0395901_0818168
2049 Ga0395901_1612657
2050 Ga0436365_0081418
2051 Ga0436361_0951993
2052 Ga0436363_1216359
2053 Ga0436363_1436042
2054 Ga0436362_0307992
2055 Ga0436362_0511863
2056 Ga0451789_0948195
2057 Ga0451835_0360775
2058 Ga0451837_0243006
2059 Ga0451839_0578465
2060 Ga0451839_0601551
2061 Ga0451853_2386811
2062 Ga0451853_2929055
2063 Ga0451853_4020500
2064 Ga0439448_0079382
2065 Ga0439450_142461
2066 Ga0439456_124799
2067 Ga0439462_0039407
2068 Ga0450907_024247
2069 Ga0439458_0185125
2070 Ga0439440_0180680
2071 Ga0466969_0347538
2072 Ga0466965_0232828
2073 Ga0466966_0021194
2074 Ga0466966_0026087
2075 Ga0466966_0053244
2076 Ga0466966_0195067
2077 Ga0466961_0020291
2078 Ga0466961_0140784
2079 Ga0466961_0262862
2080 Ga0466961_0323221
2081 Ga0466963_0016292
2082 Ga0466963_0017022
2083 Ga0466963_0037220
2084 Ga0466963_0084841
2085 Ga0466963_0154898
2086 Ga0466963_0221103
2087 Ga0466963_0381511
2088 Ga0466963_0430999
2089 Ga0466963_0566640
2090 Ga0466963_1273424
2091 Ga0466964_0004892
2092 Ga0466964_0008108
2093 Ga0466964_0054372
2094 Ga0466964_0825009
2095 Ga0466971_0103752
2096 Ga0466971_0479954
2097 Ga0466968_0005563
2098 Ga0466968_0120121
2099 Ga0466968_0373812
2100 Ga0466970_0024022
2101 Ga0466957_0216887
2102 Ga0466957_0670521
2103 Ga0466957_1126591
2104 Ga0466960_0251774
2105 Ga0466959_0014461
2106 Ga0466959_0084559
2107 Ga0466959_0629943
2108 Ga0451576_0143068
2109 Ga0451576_1644379
2110 Ga0451576_2157330
2111 Ga0466958_0016073
2112 Ga0466958_0021158
2113 Ga0466958_0125161
2114 Ga0466958_0157298
2115 Ga0466958_0223615
2116 Ga0466958_0794382
2117 Ga0466967_0002964
2118 Ga0466967_0003721
2119 Ga0466967_0018586
2120 Ga0466967_0021070
2121 Ga0466967_0024277
2122 Ga0466967_0080388
2123 Ga0466967_0120948
2124 Ga0466967_0132870
2125 Ga0466967_0151283
2126 Ga0466967_0203962
2127 Ga0466967_0355216
2128 Ga0466967_0361058
2129 Ga0466967_0703727
2130 Ga0466967_2593790
2131 Ga0495592_0081801
2132 Ga0495592_0227232
2133 Ga0495592_0279435
2134 Ga0495603_0017920
2135 Ga0495603_0140061
2136 Ga0495603_0370571
2137 Ga0495629_0009258
2138 Ga0495629_0020903
2139 Ga0495629_0052145
2140 Ga0495629_0100124
2141 Ga0495629_0171740
2142 Ga0495629_0264958
2143 Ga0495629_0410323
2144 Ga0495629_1030761
2145 Ga0495641_0000793
2146 Ga0495641_0013263
2147 Ga0495641_0017097
2148 Ga0495641_0041713
2149 Ga0495641_0082519
2150 Ga0495641_0227177
2151 Ga0495651_0023372
2152 Ga0495651_0039755
2153 Ga0495651_0113961
2154 Ga0495651_0620115
2155 Ga0495651_0774996
2156 Ga0495653_0056093
2157 Ga0495653_0383379
2158 Ga0495653_0520910
2159 Ga0495580_0026424
2160 Ga0495580_0101146
2161 Ga0495580_0985033
2162 Ga0495582_0003686
2163 Ga0495582_0004168
2164 Ga0495582_0033145
2165 Ga0495582_0055842
2166 Ga0495582_0093913
2167 Ga0495639_0002486
2168 Ga0495639_0019251
2169 Ga0495639_0095558
2170 Ga0495662_0003248
2171 Ga0495662_0005102
2172 Ga0495662_0061974
2173 Ga0495662_0272122
2174 Ga0495664_0018878
2175 Ga0495664_0067639
2176 Ga0495594_0017126
2177 Ga0495594_0281453
2178 Ga0495594_0466104
2179 Ga0495596_0407787
2180 Ga0495608_0010163
2181 Ga0495608_0021288
2182 Ga0495608_0316661
2183 Ga0495618_0210702
2184 Ga0495618_0463724
2185 Ga0495618_0624252
2186 Ga0495618_0765979
2187 Ga0495628_0387188
2188 Ga0495628_1061886
2189 Ga0495630_0003748
2190 Ga0495630_0089179
2191 Ga0495630_0166820
2192 Ga0495630_0271651
2193 Ga0495630_0769723
2194 Ga0495630_0769790
2195 Ga0495630_1115974
2196 Ga0495630_1126812
2197 Ga0495666_0009556
2198 Ga0495666_0032459
2199 Ga0495652_0043940
2200 Ga0495652_0169334
2201 Ga0495652_0238105
2202 Ga0495652_0596574
2203 Ga0495652_0969412
2204 Ga0495665_0001332
2205 Ga0495665_0004084
2206 Ga0495665_0201757
2207 Ga0495665_0367695
2208 Ga0495640_0027400
2209 Ga0495640_0063043
2210 Ga0495640_0320308
2211 Ga0495586_0086592
2212 Ga0495586_0202095
2213 Ga0495586_0801874
2214 Ga0495587_0033023
2215 Ga0495587_0834915
2216 Ga0495645_0029351
2217 Ga0495645_0115284
2218 Ga0495645_0435634
2219 Ga0495667_0006114
2220 Ga0495667_0013391
2221 Ga0495667_0025494
2222 Ga0495667_0072648
2223 Ga0495634_0028676
2224 Ga0495634_0034982
2225 Ga0495634_0056253
2226 Ga0495634_0445671
2227 Ga0495634_0771572
2228 Ga0495635_0011984
2229 Ga0495635_0045493
2230 Ga0495635_0301828
2231 Ga0495588_0017324
2232 Ga0495588_0494800
2233 Ga0495588_0508335
2234 Ga0495657_0012099
2235 Ga0495657_0064273
2236 Ga0495657_0392136
2237 Ga0495657_0601870
2238 Ga0495599_0130705
2239 Ga0495599_0820827
2240 Ga0495599_0895370
2241 Ga0495646_0080992
2242 Ga0495646_0276236
2243 Ga0495647_0002012
2244 Ga0495647_0003805
2245 Ga0495647_0254878
2246 Ga0495658_0000379
2247 Ga0495658_0011720
2248 Ga0495658_0024560
2249 Ga0495658_0088213
2250 Ga0495658_0555003
2251 Ga0495658_1088822
2252 Ga0495613_0001753
2253 Ga0495613_0013003
2254 Ga0495613_0403886
2255 Ga0495613_0603580
2256 Ga0495613_0724424
2257 Ga0495613_0736660
2258 Ga0495613_1049164
2259 Ga0495624_0015742
2260 Ga0495624_0205909
2261 Ga0495624_0264618
2262 Ga0495624_0328108
2263 Ga0495624_0489836
2264 Ga0495624_0534403
2265 Ga0495600_0008198
2266 Ga0495600_0042616
2267 Ga0495600_0052274
2268 Ga0495600_0289085
2269 Ga0495600_0856731
2270 Ga0495600_0890680
2271 Ga0495581_0002043
2272 Ga0495581_0005670
2273 Ga0495581_0195302
2274 Ga0495581_0864114
2275 Ga0495604_0065911
2276 Ga0495604_0068890
2277 Ga0495604_0176181
2278 Ga0495604_0337720
2279 Ga0495604_0922598
2280 Ga0495674_0000944
2281 Ga0495674_0034090
2282 Ga0495674_0039755
2283 Ga0495674_0126250
2284 Ga0495674_0230014
2285 Ga0495674_0398048
2286 Ga0495674_0641062
2287 Ga0495676_0002172
2288 Ga0495676_0043365
2289 Ga0495676_0052135
2290 Ga0495676_0082881
2291 Ga0495680_0000491
2292 Ga0495680_0050186
2293 Ga0495680_0127060
2294 Ga0495680_0167091
2295 Ga0495680_0321908
2296 Ga0495680_0510562
2297 Ga0495680_0622641
2298 Ga0495675_0140167
2299 Ga0495675_0377835
2300 Ga0495684_0005173
2301 Ga0495593_0010191
2302 Ga0495593_0019130
2303 Ga0495593_0149968
2304 Ga0495602_0054170
2305 Ga0495602_0070809
2306 Ga0495602_0197369
2307 Ga0495602_0261909
2308 Ga0495614_0007391
2309 Ga0495614_0050939
2310 Ga0495614_0482077
2311 Ga0495614_0621487
2312 Ga0496100_0014411
2313 Ga0496100_0015773
2314 Ga0496100_0076332
2315 Ga0496100_0087868
2316 Ga0496100_0268500
2317 Ga0496101_0002875
2318 Ga0496101_0018591
2319 Ga0496101_0024995
2320 Ga0496101_0027032
2321 Ga0496101_0038693
2322 Ga0496101_0047663
2323 Ga0496101_0148534
2324 Ga0496101_0297997
2325 Ga0496101_0542756
2326 Ga0496101_0935578
2327 Ga0496101_1109941
2328 Ga0496102_0006393
2329 Ga0496102_0007158
2330 Ga0496102_0031961
2331 Ga0496102_0057760
2332 Ga0496102_0178118
2333 Ga0496102_0433599
2334 Ga0496102_0525950
2335 Ga0496102_0671417
2336 Ga0496102_0848720
2337 Ga0496102_1013955
2338 Ga0496102_1754552
2339 Ga0496103_0004333
2340 Ga0496103_0098308
2341 Ga0496103_0108037
2342 Ga0496103_0340335
2343 Ga0496103_0589067
2344 Ga0496103_1046432
2345 Ga0496103_1060481
2346 Ga0496104_0003577
2347 Ga0496104_0057348
2348 Ga0496104_0352908
2349 Ga0496104_0806886
2350 Ga0496104_1000512
2351 Ga0496104_1306538
2352 Ga0496104_1465912
2353 Ga0496104_1580963
2354 Ga0496105_0004361
2355 Ga0496105_0007507
2356 Ga0496105_0049383
2357 Ga0496105_0250894
2358 Ga0496105_0880567
2359 Ga0496105_0922002
2360 Ga0496105_1274609
2361 Ga0496106_0004788
2362 Ga0496106_0005708
2363 Ga0496106_0040068
2364 Ga0496106_0068056
2365 Ga0496106_0079533
2366 Ga0496106_0160808
2367 Ga0496106_0923661
2368 Ga0496107_0002187
2369 Ga0496107_0051696
2370 Ga0496107_0559746
2371 Ga0496107_0815262
2372 Ga0496107_0931149
2373 Ga0496107_0940025
2374 Ga0496107_0983477
2375 Ga0496107_1007004
2376 Ga0496108_0007095
2377 Ga0496108_0047504
2378 Ga0496108_0137749
2379 Ga0496108_0189520
2380 Ga0496108_0666423
2381 Ga0496108_0769616
2382 Ga0496108_1180842
2383 Ga0496109_0004651
2384 Ga0496109_0063728
2385 Ga0496109_0089321
2386 Ga0496109_0360994
2387 Ga0496109_0500717
2388 Ga0496109_0515177
2389 Ga0496109_0518376
2390 Ga0496109_0838467
2391 Ga0496110_0005481
2392 Ga0496110_0058749
2393 Ga0496110_1629292
2394 Ga0496111_0005981
2395 Ga0496111_0012824
2396 Ga0496111_0049942
2397 Ga0496111_0052158
2398 Ga0496111_0171945
2399 Ga0496111_0617552
2400 Ga0496111_0889356
2401 Ga0496112_0001450
2402 Ga0496112_0006292
2403 Ga0496112_0007087
2404 Ga0496112_0026743
2405 Ga0496112_0082764
2406 Ga0496112_0122322
2407 Ga0496112_0408848
2408 Ga0496112_0733917
2409 Ga0496112_1549161
2410 Ga0496113_0017566
2411 Ga0496113_0035844
2412 Ga0496113_0365991
2413 Ga0496113_0404147
2414 Ga0496113_0503207
2415 Ga0496113_0859966
2416 Ga0496113_0992950
2417 Ga0496114_0001055
2418 Ga0496114_0029665
2419 Ga0496114_0103450
2420 Ga0496114_0131618
2421 Ga0496114_0154317
2422 Ga0496114_0194861
2423 Ga0496114_0282339
2424 Ga0496114_0716559
2425 Ga0496114_1479363
2426 Ga0496115_0001930
2427 Ga0496115_0004249
2428 Ga0496115_0006019
2429 Ga0496115_0010743
2430 Ga0496115_0338373
2431 Ga0496115_0403600
2432 Ga0496115_0566482
2433 Ga0496115_0889896
2434 Ga0501031_0050828
2435 Ga0501031_0806611
2436 Ga0501032_0123521
2437 Ga0501033_0008059
2438 Ga0501034_0003184
2439 Ga0501034_0165777
2440 Ga0501034_1570177
2441 Ga0501036_0087038
2442 Ga0501036_0474920
2443 Ga0501037_0112532
2444 Ga0501038_0025721
2445 Ga0501039_0078300
2446 Ga0501040_0001135
2447 Ga0501040_0082946
2448 Ga0501041_0001531
2449 Ga0501041_0508786
2450 Ga0501042_0000272
2451 Ga0501042_0280580
2452 Ga0501042_0427750
2453 Ga0501043_0009705
2454 Ga0501046_0000332
2455 Ga0501046_0262668
2456 Ga0501047_0056333
2457 Ga0501047_0142073
2458 Ga0501047_0144410
2459 Ga0501048_0002707
2460 Ga0501048_0687661
2461 Ga0501048_1338667
2462 Ga0501067_0003649
2463 Ga0501067_0019581
2464 Ga0501067_0079231
2465 Ga0501067_0126918
2466 Ga0501067_0285938
2467 Ga0501067_0339722
2468 Ga0501067_0444786
2469 Ga0501068_0012786
2470 Ga0501068_0031718
2471 Ga0501068_0054832
2472 Ga0501068_0147597
2473 Ga0501068_0241486
2474 Ga0501069_0001571
2475 Ga0501069_0005861
2476 Ga0501069_0292651
2477 Ga0501069_0506863
2478 Ga0501070_0003206
2479 Ga0501070_0026105
2480 Ga0501070_0130801
2481 Ga0501070_0646376
2482 Ga0501070_0652662
2483 Ga0501070_1234740
2484 Ga0501071_0021673
2485 Ga0501072_0015423
2486 Ga0501072_1248360
2487 Ga0501073_0029751
2488 Ga0501073_0641869
2489 Ga0501073_0722196
2490 Ga0501074_0020747
2491 Ga0501074_0118067
2492 Ga0501074_0144407
2493 Ga0501074_0278737
2494 Ga0501075_0000659
2495 Ga0501075_0359962
2496 Ga0501075_0596221
2497 Ga0501076_0021198
2498 Ga0501077_0001904
2499 Ga0501077_0015838
2500 Ga0501077_0625336
2501 Ga0501077_0902230
2502 Ga0501079_0000155
2503 Ga0501079_0189066
2504 Ga0501079_0271555
2505 Ga0501079_0322998
2506 Ga0501079_1174093
2507 Ga0501079_1410411
2508 Ga0501080_0108130
2509 Ga0501080_0251007
2510 Ga0501080_0316989
2511 Ga0501080_0410527
2512 Ga0501080_0479998
2513 Ga0501081_0001472
2514 Ga0501081_0671814
2515 Ga0501083_0011793
2516 Ga0501083_0339079
2517 Ga0501035_0118007
2518 Ga0501035_0181960
2519 Ga0501044_0044757
2520 Ga0501044_0161865
2521 Ga0501044_0507847
2522 Ga0501044_1541266
2523 Ga0501045_0007803
2524 Ga0501045_0637527
2525 nmdc:mga05p37_1620566_c1
2526 nmdc:mga05p37_477167_c1
2527 nmdc:mga05p37_733747_c1
2528 nmdc:mga09592_500346_c1
2529 nmdc:mga06r32_1312490_c1
2530 nmdc:mga08y16_1681672_c1
2531 nmdc:mga08y16_1881800_c1
2532 nmdc:mga0n895_4747_c1
2533 nmdc:mga0n895_66521_c1
2534 nmdc:mga0n895_668399_c1
2535 nmdc:mga0rr50_1643075_c1
2536 nmdc:mga0rr50_726841_c1
2537 nmdc:mga0rr50_8707_c1
2538 nmdc:mga08x19_396731_c1
2539 nmdc:mga08x19_649826_c1
2540 Ga0495601_0042101
2541 Ga0495601_0215016
2542 Ga0495601_0417007
2543 Ga0495601_0543994
2544 Ga0495601_0754697
2545 Ga0495612_0267715
2546 Ga0495612_0276073
2547 Ga0495655_0243725
2548 Ga0495595_0024188
2549 Ga0495595_0030992
2550 Ga0495595_0075809
2551 Ga0495595_0180356
2552 Ga0495595_0499210
2553 Ga0495619_0010424
2554 Ga0495619_0039047
2555 Ga0495619_0050697
2556 Ga0495619_0057461
2557 Ga0495619_0266138
2558 Ga0501084_0006129
2559 Ga0501084_0166479
2560 Ga0501084_1726385
2561 Ga0590074_018569
2562 Ga0590075_042453
2563 Ga0590077_053736
2564 Ga0587066_097148
2565 Ga0587066_135608
2566 Ga0587070_114187
2567 Ga0587080_151380
2568 Ga0587083_0196014
2569 Ga0587083_0283845
2570 Ga0587089_052123
2571 Ga0587091_123006
2572 Ga0587098_034432
2573 Ga0587106_083877
2574 Ga0587115_111974
2575 Ga0587067_095615
2576 Ga0587114_080424
2577 Ga0587111_0160298
2578 Ga0501082_0000480
2579 Ga0501082_0524157
2580 Ga0501082_0619069
2581 Ga0466962_0488780
2582 Ga0530510_0000230
2583 Ga0530510_0073196
2584 Ga0530510_0116202

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

8

72

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iy9-assembly1.cif.gz_F human holo-pic in the initial transcribing state (no iis) 0.8147 16 70
6xre-assembly1.cif.gz_F structure of the p53/rna polymerase ii assembly 0.8127 17 70
4a3c-assembly1.cif.gz_F rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid 0.8067 17 70
5w64-assembly1.cif.gz_F rna polymerase i initial transcribing complex state 1 0.8048 17 70
5iyc-assembly1.cif.gz_F human core-pic in the initial transcribing state 0.793 16 70
ID Description Score Start End Superfamily
5iycF00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.793 16 70 3.90.940.10
1sfoF00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.7912 16 70 3.90.940.10
4mexK00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.7541 17 70 3.90.940.10
4c2mF00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.6719 12 70 3.90.940.10
4meyE00 Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega 0.6712 6 72 3.90.940.10
ID Description Score Start End GO Terms
AF-A0A537YEG2-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.8453 16 74 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A538A1D8-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.8258 20 76 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A537ZEJ4-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.8225 7 76 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A2W5XUM9-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.8224 17 75 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677
AF-A0A2N3F2C0-F1-model_v4 DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) 0.811 17 75 GO:0000428
GO:0001054
GO:0001055
GO:0001056
GO:0001057
GO:0001058
GO:0001066
GO:0003677

Map