F492647
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1292 | 395 | 2584 | 78 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_11003768|Ga0070658_110037682 |
| Length | 81 |
| Sequence | MINPRIDELLDQVDSRYALVIVAAKRARQINNYHHQLGEGTFDEFAPPLIQSRSKNYLTMALEEIAEGKIVYDYSKTGAPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 107 | 3300013062 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 123 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 126 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 211 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 213 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 214 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 215 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 242 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 243 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 245 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 246 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 247 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 248 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 249 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 250 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 251 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 252 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 253 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 254 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 255 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 258 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 259 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 260 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 261 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 262 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 263 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 264 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 265 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 326 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 327 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 328 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 329 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 330 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 331 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 332 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 395 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.75 |
| Metatranscriptomes | 3.25 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 9.52 |
| Rhizosphere | 89.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_11003768 | 3300005327 | Bacteria | 726 |
| 2 | JGI24737J22298_10192572 | 3300001990 | Bacteria | 602 |
| 3 | JGI24743J22301_10119710 | 3300001991 | Bacteria | 576 |
| 4 | Ga0058863_10058229 | 3300004799 | Bacteria | 510 |
| 5 | Ga0070658_10159250 | 3300005327 | Bacteria | 1893 |
| 6 | Ga0070658_10378361 | 3300005327 | Bacteria | 1214 |
| 7 | Ga0070658_11238415 | 3300005327 | Bacteria | 648 |
| 8 | Ga0070676_10121968 | 3300005328 | Bacteria | 1637 |
| 9 | Ga0070683_100004462 | 3300005329 | Bacteria | 11548 |
| 10 | Ga0070683_100065117 | 3300005329 | Bacteria | 3393 |
| 11 | Ga0070683_100160124 | 3300005329 | Bacteria | 2135 |
| 12 | Ga0070683_100196034 | 3300005329 | Bacteria | 1918 |
| 13 | Ga0070683_100414338 | 3300005329 | Bacteria | 1285 |
| 14 | Ga0070683_100444207 | 3300005329 | Bacteria | 1237 |
| 15 | Ga0070683_100445415 | 3300005329 | Bacteria | 1236 |
| 16 | Ga0070690_100071641 | 3300005330 | Bacteria | 2252 |
| 17 | Ga0070670_100343018 | 3300005331 | Bacteria | 1312 |
| 18 | Ga0070670_100429998 | 3300005331 | Bacteria | 1168 |
| 19 | Ga0068869_100060026 | 3300005334 | Bacteria | 2786 |
| 20 | Ga0068869_100070985 | 3300005334 | Bacteria | 2578 |
| 21 | Ga0068869_100140466 | 3300005334 | Bacteria | 1865 |
| 22 | Ga0070666_10158979 | 3300005335 | Bacteria | 1579 |
| 23 | Ga0070680_100060097 | 3300005336 | Bacteria | 3110 |
| 24 | Ga0070680_100112057 | 3300005336 | Bacteria | 2272 |
| 25 | Ga0070680_100139899 | 3300005336 | Bacteria | 2029 |
| 26 | Ga0070682_100014416 | 3300005337 | Bacteria | 4567 |
| 27 | Ga0070682_100137438 | 3300005337 | Bacteria | 1662 |
| 28 | Ga0070682_100684036 | 3300005337 | Bacteria | 821 |
| 29 | Ga0070682_100765564 | 3300005337 | Unclassified | 781 |
| 30 | Ga0068868_100076587 | 3300005338 | Bacteria | 2674 |
| 31 | Ga0068868_100087772 | 3300005338 | Bacteria | 2502 |
| 32 | Ga0068868_100099234 | 3300005338 | Bacteria | 2355 |
| 33 | Ga0068868_101384345 | 3300005338 | Bacteria | 656 |
| 34 | Ga0070660_100008187 | 3300005339 | Bacteria | 7307 |
| 35 | Ga0070660_100100458 | 3300005339 | Bacteria | 2291 |
| 36 | Ga0070660_100254230 | 3300005339 | Bacteria | 1433 |
| 37 | Ga0070660_101301863 | 3300005339 | Bacteria | 617 |
| 38 | Ga0070689_100072495 | 3300005340 | Bacteria | 2692 |
| 39 | Ga0070691_10118420 | 3300005341 | Bacteria | 1331 |
| 40 | Ga0070691_10996327 | 3300005341 | Unclassified | 523 |
| 41 | Ga0070687_100867805 | 3300005343 | Bacteria | 645 |
| 42 | Ga0070661_100006256 | 3300005344 | Bacteria | 8215 |
| 43 | Ga0070661_100006849 | 3300005344 | Bacteria | 7859 |
| 44 | Ga0070661_100309189 | 3300005344 | Bacteria | 1232 |
| 45 | Ga0070661_100537834 | 3300005344 | Bacteria | 939 |
| 46 | Ga0070661_100999972 | 3300005344 | Bacteria | 694 |
| 47 | Ga0070661_101595747 | 3300005344 | Bacteria | 551 |
| 48 | Ga0070692_10026063 | 3300005345 | Bacteria | 2887 |
| 49 | Ga0070692_10088380 | 3300005345 | Bacteria | 1681 |
| 50 | Ga0070692_10168062 | 3300005345 | Bacteria | 1262 |
| 51 | Ga0070668_100177452 | 3300005347 | Bacteria | 1738 |
| 52 | Ga0070668_100248601 | 3300005347 | Bacteria | 1475 |
| 53 | Ga0070668_100383945 | 3300005347 | Bacteria | 1196 |
| 54 | Ga0070675_102139345 | 3300005354 | Unclassified | 516 |
| 55 | Ga0070671_100366415 | 3300005355 | Bacteria | 1230 |
| 56 | Ga0070671_100372968 | 3300005355 | Bacteria | 1219 |
| 57 | Ga0070671_101450758 | 3300005355 | Bacteria | 607 |
| 58 | Ga0070674_100019333 | 3300005356 | Bacteria | 4325 |
| 59 | Ga0070674_100111213 | 3300005356 | Bacteria | 2011 |
| 60 | Ga0070674_100854502 | 3300005356 | Bacteria | 789 |
| 61 | Ga0070674_101824461 | 3300005356 | Bacteria | 552 |
| 62 | Ga0070673_100120177 | 3300005364 | Bacteria | 2191 |
| 63 | Ga0070688_100069583 | 3300005365 | Bacteria | 2248 |
| 64 | Ga0070688_100397045 | 3300005365 | Bacteria | 1020 |
| 65 | Ga0070659_100011282 | 3300005366 | Bacteria | 6603 |
| 66 | Ga0070659_100183843 | 3300005366 | Bacteria | 1716 |
| 67 | Ga0070659_102110098 | 3300005366 | Bacteria | 507 |
| 68 | Ga0070667_100011225 | 3300005367 | Bacteria | 7411 |
| 69 | Ga0070667_101041637 | 3300005367 | Bacteria | 764 |
| 70 | Ga0070703_10622931 | 3300005406 | Bacteria | 500 |
| 71 | Ga0070709_10049444 | 3300005434 | Bacteria | 2629 |
| 72 | Ga0070709_10451344 | 3300005434 | Bacteria | 969 |
| 73 | Ga0070709_10602919 | 3300005434 | Bacteria | 846 |
| 74 | Ga0070714_100042327 | 3300005435 | Bacteria | 3848 |
| 75 | Ga0070714_100089193 | 3300005435 | Bacteria | 2699 |
| 76 | Ga0070714_100177169 | 3300005435 | Bacteria | 1938 |
| 77 | Ga0070714_100187934 | 3300005435 | Bacteria | 1883 |
| 78 | Ga0070714_100605272 | 3300005435 | Bacteria | 1052 |
| 79 | Ga0070714_100954282 | 3300005435 | Bacteria | 834 |
| 80 | Ga0070714_102188542 | 3300005435 | Bacteria | 538 |
| 81 | Ga0070713_100170141 | 3300005436 | Bacteria | 1951 |
| 82 | Ga0070713_100465035 | 3300005436 | Bacteria | 1190 |
| 83 | Ga0070713_101248067 | 3300005436 | Bacteria | 720 |
| 84 | Ga0070713_101753198 | 3300005436 | Bacteria | 603 |
| 85 | Ga0070710_10265355 | 3300005437 | Bacteria | 1108 |
| 86 | Ga0070710_10291344 | 3300005437 | Bacteria | 1062 |
| 87 | Ga0070710_10664933 | 3300005437 | Bacteria | 732 |
| 88 | Ga0070701_10078474 | 3300005438 | Bacteria | 1782 |
| 89 | Ga0070701_10625996 | 3300005438 | Unclassified | 716 |
| 90 | Ga0070711_100023255 | 3300005439 | Bacteria | 4028 |
| 91 | Ga0070711_100324185 | 3300005439 | Bacteria | 1231 |
| 92 | Ga0070711_100573418 | 3300005439 | Bacteria | 939 |
| 93 | Ga0070705_100060215 | 3300005440 | Bacteria | 2251 |
| 94 | Ga0070705_100165974 | 3300005440 | Bacteria | 1481 |
| 95 | Ga0070705_100940423 | 3300005440 | Unclassified | 698 |
| 96 | Ga0070700_100014010 | 3300005441 | Bacteria | 4519 |
| 97 | Ga0070700_100139140 | 3300005441 | Bacteria | 1647 |
| 98 | Ga0070700_100226097 | 3300005441 | Bacteria | 1329 |
| 99 | Ga0070700_100511664 | 3300005441 | Bacteria | 926 |
| 100 | Ga0070700_100695566 | 3300005441 | Bacteria | 808 |
| 101 | Ga0070694_100187759 | 3300005444 | Bacteria | 1533 |
| 102 | Ga0070694_100251665 | 3300005444 | Bacteria | 1337 |
| 103 | Ga0070708_100404878 | 3300005445 | Bacteria | 1287 |
| 104 | Ga0070708_100448762 | 3300005445 | Unclassified | 1217 |
| 105 | Ga0070663_100950492 | 3300005455 | Bacteria | 745 |
| 106 | Ga0070678_100112177 | 3300005456 | Bacteria | 2135 |
| 107 | Ga0070678_100193775 | 3300005456 | Bacteria | 1673 |
| 108 | Ga0070678_102148742 | 3300005456 | Bacteria | 529 |
| 109 | Ga0070662_100025198 | 3300005457 | Bacteria | 4105 |
| 110 | Ga0070662_100214645 | 3300005457 | Bacteria | 1533 |
| 111 | Ga0070662_100589825 | 3300005457 | Bacteria | 934 |
| 112 | Ga0070681_10008490 | 3300005458 | Bacteria | 10055 |
| 113 | Ga0070681_10028181 | 3300005458 | Bacteria | 5647 |
| 114 | Ga0070681_10082635 | 3300005458 | Bacteria | 3167 |
| 115 | Ga0070681_10164785 | 3300005458 | Bacteria | 2139 |
| 116 | Ga0070681_10385188 | 3300005458 | Bacteria | 1313 |
| 117 | Ga0070681_10415779 | 3300005458 | Bacteria | 1256 |
| 118 | Ga0070681_10518753 | 3300005458 | Bacteria | 1105 |
| 119 | Ga0070681_10764746 | 3300005458 | Unclassified | 883 |
| 120 | Ga0070681_11218242 | 3300005458 | Bacteria | 675 |
| 121 | Ga0068867_100074108 | 3300005459 | Bacteria | 2550 |
| 122 | Ga0068867_100267918 | 3300005459 | Bacteria | 1395 |
| 123 | Ga0068867_100839017 | 3300005459 | Bacteria | 822 |
| 124 | Ga0068867_101833788 | 3300005459 | Unclassified | 571 |
| 125 | Ga0070685_10141590 | 3300005466 | Bacteria | 1515 |
| 126 | Ga0070685_10683379 | 3300005466 | Bacteria | 747 |
| 127 | Ga0070706_101818259 | 3300005467 | Bacteria | 554 |
| 128 | Ga0070707_100356451 | 3300005468 | Unclassified | 1421 |
| 129 | Ga0070707_100380634 | 3300005468 | Bacteria | 1371 |
| 130 | Ga0070707_100734394 | 3300005468 | Bacteria | 951 |
| 131 | Ga0070698_101264799 | 3300005471 | Bacteria | 688 |
| 132 | Ga0070698_101521464 | 3300005471 | Bacteria | 621 |
| 133 | Ga0070699_100076728 | 3300005518 | Bacteria | 2909 |
| 134 | Ga0070699_101842392 | 3300005518 | Bacteria | 554 |
| 135 | Ga0070679_100087848 | 3300005530 | Bacteria | 3096 |
| 136 | Ga0070679_100231236 | 3300005530 | Bacteria | 1808 |
| 137 | Ga0070679_100264560 | 3300005530 | Bacteria | 1675 |
| 138 | Ga0070679_100360245 | 3300005530 | Bacteria | 1402 |
| 139 | Ga0070679_100882778 | 3300005530 | Unclassified | 838 |
| 140 | Ga0070679_101104596 | 3300005530 | Bacteria | 738 |
| 141 | Ga0070679_101126090 | 3300005530 | Bacteria | 730 |
| 142 | Ga0070684_100002170 | 3300005535 | Bacteria | 14480 |
| 143 | Ga0070684_100021741 | 3300005535 | Bacteria | 5343 |
| 144 | Ga0070684_100078043 | 3300005535 | Bacteria | 2925 |
| 145 | Ga0070684_100079373 | 3300005535 | Bacteria | 2901 |
| 146 | Ga0070684_100081483 | 3300005535 | Bacteria | 2864 |
| 147 | Ga0070684_100164503 | 3300005535 | Bacteria | 2013 |
| 148 | Ga0070684_100210153 | 3300005535 | Bacteria | 1773 |
| 149 | Ga0070684_100662989 | 3300005535 | Bacteria | 972 |
| 150 | Ga0070684_100698363 | 3300005535 | Bacteria | 946 |
| 151 | Ga0070684_101067416 | 3300005535 | Bacteria | 759 |
| 152 | Ga0070697_100576121 | 3300005536 | Bacteria | 988 |
| 153 | Ga0068853_100153385 | 3300005539 | Bacteria | 2074 |
| 154 | Ga0068853_100916406 | 3300005539 | Bacteria | 842 |
| 155 | Ga0068853_101007999 | 3300005539 | Bacteria | 802 |
| 156 | Ga0068853_101870338 | 3300005539 | Bacteria | 582 |
| 157 | Ga0070672_100236932 | 3300005543 | Bacteria | 1534 |
| 158 | Ga0070672_100901697 | 3300005543 | Bacteria | 781 |
| 159 | Ga0070672_100932875 | 3300005543 | Unclassified | 768 |
| 160 | Ga0070672_102048240 | 3300005543 | Bacteria | 516 |
| 161 | Ga0070686_100189089 | 3300005544 | Bacteria | 1468 |
| 162 | Ga0070686_100239196 | 3300005544 | Bacteria | 1321 |
| 163 | Ga0070695_100086659 | 3300005545 | Bacteria | 2081 |
| 164 | Ga0070695_100902824 | 3300005545 | Unclassified | 714 |
| 165 | Ga0070696_100020757 | 3300005546 | Bacteria | 4450 |
| 166 | Ga0070696_100040965 | 3300005546 | Bacteria | 3199 |
| 167 | Ga0070696_101225514 | 3300005546 | Bacteria | 635 |
| 168 | Ga0070693_100271341 | 3300005547 | Bacteria | 1132 |
| 169 | Ga0070693_100358776 | 3300005547 | Bacteria | 1000 |
| 170 | Ga0070693_100579939 | 3300005547 | Bacteria | 807 |
| 171 | Ga0070665_100080403 | 3300005548 | Bacteria | 3264 |
| 172 | Ga0070665_100165863 | 3300005548 | Bacteria | 2211 |
| 173 | Ga0070665_100648382 | 3300005548 | Bacteria | 1069 |
| 174 | Ga0070665_100993107 | 3300005548 | Unclassified | 852 |
| 175 | Ga0070665_101930054 | 3300005548 | Bacteria | 596 |
| 176 | Ga0070704_100251462 | 3300005549 | Bacteria | 1452 |
| 177 | Ga0070704_100392047 | 3300005549 | Bacteria | 1183 |
| 178 | Ga0070704_100482764 | 3300005549 | Bacteria | 1072 |
| 179 | Ga0068855_100013130 | 3300005563 | Bacteria | 9991 |
| 180 | Ga0068855_100050398 | 3300005563 | Bacteria | 4906 |
| 181 | Ga0068855_100197764 | 3300005563 | Bacteria | 2264 |
| 182 | Ga0068855_100254597 | 3300005563 | Bacteria | 1957 |
| 183 | Ga0068855_100259944 | 3300005563 | Bacteria | 1934 |
| 184 | Ga0070664_100151734 | 3300005564 | Bacteria | 2046 |
| 185 | Ga0070664_100153355 | 3300005564 | Bacteria | 2035 |
| 186 | Ga0070664_100219932 | 3300005564 | Bacteria | 1699 |
| 187 | Ga0070664_100238562 | 3300005564 | Bacteria | 1632 |
| 188 | Ga0070664_100391494 | 3300005564 | Bacteria | 1270 |
| 189 | Ga0068857_100010678 | 3300005577 | Bacteria | 7988 |
| 190 | Ga0068857_100012513 | 3300005577 | Bacteria | 7388 |
| 191 | Ga0068857_100333895 | 3300005577 | Bacteria | 1401 |
| 192 | Ga0068854_100010961 | 3300005578 | Bacteria | 5882 |
| 193 | Ga0068854_100125699 | 3300005578 | Bacteria | 1953 |
| 194 | Ga0068854_100341720 | 3300005578 | Bacteria | 1223 |
| 195 | Ga0068854_100483893 | 3300005578 | Bacteria | 1039 |
| 196 | Ga0068854_101772660 | 3300005578 | Bacteria | 566 |
| 197 | Ga0068856_100004589 | 3300005614 | Bacteria | 13737 |
| 198 | Ga0068856_100095955 | 3300005614 | Bacteria | 2954 |
| 199 | Ga0068856_100112742 | 3300005614 | Bacteria | 2717 |
| 200 | Ga0068856_100114678 | 3300005614 | Bacteria | 2694 |
| 201 | Ga0068856_100123757 | 3300005614 | Bacteria | 2589 |
| 202 | Ga0068856_102634467 | 3300005614 | Bacteria | 509 |
| 203 | Ga0070702_100012351 | 3300005615 | Bacteria | 4276 |
| 204 | Ga0070702_100022944 | 3300005615 | Bacteria | 3309 |
| 205 | Ga0070702_100470994 | 3300005615 | Bacteria | 916 |
| 206 | Ga0068852_100154748 | 3300005616 | Bacteria | 2135 |
| 207 | Ga0068852_100929244 | 3300005616 | Bacteria | 887 |
| 208 | Ga0068852_100967286 | 3300005616 | Bacteria | 869 |
| 209 | Ga0068852_101087536 | 3300005616 | Bacteria | 820 |
| 210 | Ga0068859_100117675 | 3300005617 | Bacteria | 2723 |
| 211 | Ga0068859_102342801 | 3300005617 | Bacteria | 589 |
| 212 | Ga0068864_100952251 | 3300005618 | Bacteria | 850 |
| 213 | Ga0068864_101175673 | 3300005618 | Bacteria | 765 |
| 214 | Ga0068864_101648924 | 3300005618 | Bacteria | 646 |
| 215 | Ga0068866_10100930 | 3300005718 | Bacteria | 1592 |
| 216 | Ga0068866_11129362 | 3300005718 | Bacteria | 563 |
| 217 | Ga0068861_100122029 | 3300005719 | Bacteria | 2104 |
| 218 | Ga0068861_100238572 | 3300005719 | Bacteria | 1545 |
| 219 | Ga0068861_100279508 | 3300005719 | Bacteria | 1437 |
| 220 | Ga0068851_10057190 | 3300005834 | Bacteria | 1991 |
| 221 | Ga0068851_10224728 | 3300005834 | Bacteria | 1056 |
| 222 | Ga0068851_10250658 | 3300005834 | Bacteria | 1004 |
| 223 | Ga0068870_10415491 | 3300005840 | Bacteria | 879 |
| 224 | Ga0068860_100446102 | 3300005843 | Bacteria | 1286 |
| 225 | Ga0068862_100205883 | 3300005844 | Bacteria | 1776 |
| 226 | Ga0068862_100447871 | 3300005844 | Bacteria | 1217 |
| 227 | Ga0081455_10066708 | 3300005937 | Bacteria | 3003 |
| 228 | Ga0081455_10189118 | 3300005937 | Bacteria | 1552 |
| 229 | Ga0081538_10000059 | 3300005981 | Bacteria | 101468 |
| 230 | Ga0081538_10000939 | 3300005981 | Bacteria | 31446 |
| 231 | Ga0081538_10077190 | 3300005981 | Bacteria | 1795 |
| 232 | Ga0081540_1026636 | 3300005983 | Bacteria | 3294 |
| 233 | Ga0081539_10379186 | 3300005985 | Bacteria | 590 |
| 234 | Ga0070717_10147548 | 3300006028 | Bacteria | 2033 |
| 235 | Ga0070717_10248460 | 3300006028 | Unclassified | 1571 |
| 236 | Ga0070717_11320423 | 3300006028 | Bacteria | 656 |
| 237 | Ga0070715_10055696 | 3300006163 | Bacteria | 1718 |
| 238 | Ga0070715_10132645 | 3300006163 | Bacteria | 1201 |
| 239 | Ga0070715_10729701 | 3300006163 | Bacteria | 595 |
| 240 | Ga0070715_10935378 | 3300006163 | Bacteria | 536 |
| 241 | Ga0070716_100199601 | 3300006173 | Unclassified | 1328 |
| 242 | Ga0070716_101527192 | 3300006173 | Bacteria | 547 |
| 243 | Ga0070712_100011180 | 3300006175 | Bacteria | 5682 |
| 244 | Ga0070712_100085921 | 3300006175 | Bacteria | 2291 |
| 245 | Ga0070712_100266530 | 3300006175 | Bacteria | 1374 |
| 246 | Ga0070712_100371263 | 3300006175 | Bacteria | 1176 |
| 247 | Ga0070712_100564039 | 3300006175 | Bacteria | 961 |
| 248 | Ga0070712_100577247 | 3300006175 | Bacteria | 950 |
| 249 | Ga0070712_100769640 | 3300006175 | Bacteria | 825 |
| 250 | Ga0070712_100986707 | 3300006175 | Bacteria | 728 |
| 251 | Ga0097621_100100370 | 3300006237 | Bacteria | 2435 |
| 252 | Ga0097621_100658093 | 3300006237 | Bacteria | 962 |
| 253 | Ga0097621_101094956 | 3300006237 | Bacteria | 748 |
| 254 | Ga0068871_100137505 | 3300006358 | Bacteria | 2075 |
| 255 | Ga0068871_100146961 | 3300006358 | Bacteria | 2008 |
| 256 | Ga0068871_101010560 | 3300006358 | Bacteria | 775 |
| 257 | Ga0068871_101862541 | 3300006358 | Bacteria | 572 |
| 258 | Ga0075428_101352357 | 3300006844 | Bacteria | 748 |
| 259 | Ga0075428_101525106 | 3300006844 | Bacteria | 700 |
| 260 | Ga0075428_101948730 | 3300006844 | Unclassified | 610 |
| 261 | Ga0075433_10096866 | 3300006852 | Bacteria | 2611 |
| 262 | Ga0075433_10139122 | 3300006852 | Bacteria | 2158 |
| 263 | Ga0075433_10384546 | 3300006852 | Bacteria | 1239 |
| 264 | Ga0075433_10823519 | 3300006852 | Bacteria | 811 |
| 265 | Ga0075434_100000288 | 3300006871 | Bacteria | 35846 |
| 266 | Ga0075434_100018510 | 3300006871 | Bacteria | 6731 |
| 267 | Ga0068865_100166347 | 3300006881 | Unclassified | 1687 |
| 268 | Ga0068865_100799563 | 3300006881 | Unclassified | 813 |
| 269 | Ga0068865_100973441 | 3300006881 | Bacteria | 742 |
| 270 | Ga0068865_102050855 | 3300006881 | Bacteria | 519 |
| 271 | Ga0075436_100371622 | 3300006914 | Bacteria | 1033 |
| 272 | Ga0075436_101159067 | 3300006914 | Bacteria | 583 |
| 273 | Ga0097620_100117671 | 3300006931 | Bacteria | 2723 |
| 274 | Ga0097620_102342873 | 3300006931 | Bacteria | 589 |
| 275 | Ga0075435_100009347 | 3300007076 | Bacteria | 7091 |
| 276 | Ga0075435_100154157 | 3300007076 | Bacteria | 1933 |
| 277 | Ga0075435_101557192 | 3300007076 | Bacteria | 580 |
| 278 | Ga0075435_101638165 | 3300007076 | Bacteria | 565 |
| 279 | Ga0105240_10168799 | 3300009093 | Bacteria | 2593 |
| 280 | Ga0105240_10201527 | 3300009093 | Bacteria | 2332 |
| 281 | Ga0105240_10523857 | 3300009093 | Bacteria | 1315 |
| 282 | Ga0105240_10793271 | 3300009093 | Bacteria | 1026 |
| 283 | Ga0105240_12592786 | 3300009093 | Bacteria | 524 |
| 284 | Ga0111539_10992705 | 3300009094 | Bacteria | 976 |
| 285 | Ga0111539_12491529 | 3300009094 | Bacteria | 600 |
| 286 | Ga0111539_12629029 | 3300009094 | Bacteria | 584 |
| 287 | Ga0105245_10010505 | 3300009098 | Bacteria | 8058 |
| 288 | Ga0105245_10020014 | 3300009098 | Bacteria | 5866 |
| 289 | Ga0105245_10066479 | 3300009098 | Bacteria | 3263 |
| 290 | Ga0105245_10143417 | 3300009098 | Bacteria | 2252 |
| 291 | Ga0105245_10191096 | 3300009098 | Bacteria | 1961 |
| 292 | Ga0105245_10379343 | 3300009098 | Bacteria | 1407 |
| 293 | Ga0105245_12258927 | 3300009098 | Bacteria | 598 |
| 294 | Ga0105247_10328782 | 3300009101 | Bacteria | 1069 |
| 295 | Ga0105247_11332197 | 3300009101 | Bacteria | 578 |
| 296 | Ga0114129_10034735 | 3300009147 | Bacteria | 7123 |
| 297 | Ga0114129_10938849 | 3300009147 | Unclassified | 1093 |
| 298 | Ga0105243_10063297 | 3300009148 | Bacteria | 2964 |
| 299 | Ga0105243_10129765 | 3300009148 | Bacteria | 2137 |
| 300 | Ga0105243_10145258 | 3300009148 | Bacteria | 2029 |
| 301 | Ga0105243_10157670 | 3300009148 | Bacteria | 1954 |
| 302 | Ga0105243_10207412 | 3300009148 | Bacteria | 1723 |
| 303 | Ga0105241_10232388 | 3300009174 | Bacteria | 1555 |
| 304 | Ga0105241_10261041 | 3300009174 | Bacteria | 1472 |
| 305 | Ga0105241_10288667 | 3300009174 | Bacteria | 1404 |
| 306 | Ga0105241_10851554 | 3300009174 | Bacteria | 843 |
| 307 | Ga0105242_10124875 | 3300009176 | Unclassified | 2214 |
| 308 | Ga0105242_10143075 | 3300009176 | Bacteria | 2078 |
| 309 | Ga0105242_10300165 | 3300009176 | Bacteria | 1466 |
| 310 | Ga0105242_10585861 | 3300009176 | Bacteria | 1075 |
| 311 | Ga0105242_11731854 | 3300009176 | Bacteria | 662 |
| 312 | Ga0105248_10153320 | 3300009177 | Bacteria | 2599 |
| 313 | Ga0105248_10386125 | 3300009177 | Bacteria | 1576 |
| 314 | Ga0105237_10065849 | 3300009545 | Bacteria | 3618 |
| 315 | Ga0105237_10275223 | 3300009545 | Bacteria | 1686 |
| 316 | Ga0105237_10913145 | 3300009545 | Bacteria | 885 |
| 317 | Ga0105238_10016816 | 3300009551 | Bacteria | 7417 |
| 318 | Ga0105238_10024093 | 3300009551 | Bacteria | 6205 |
| 319 | Ga0105238_10029238 | 3300009551 | Bacteria | 5615 |
| 320 | Ga0105238_12048181 | 3300009551 | Bacteria | 606 |
| 321 | Ga0105238_12769955 | 3300009551 | Bacteria | 527 |
| 322 | Ga0105249_10053640 | 3300009553 | Bacteria | 3685 |
| 323 | Ga0105249_10082731 | 3300009553 | Bacteria | 2987 |
| 324 | Ga0105249_10332080 | 3300009553 | Bacteria | 1534 |
| 325 | Ga0105239_10047172 | 3300010375 | Bacteria | 4721 |
| 326 | Ga0105239_10165256 | 3300010375 | Bacteria | 2474 |
| 327 | Ga0105239_10328527 | 3300010375 | Bacteria | 1725 |
| 328 | Ga0105239_10878736 | 3300010375 | Unclassified | 1028 |
| 329 | Ga0105239_12394770 | 3300010375 | Bacteria | 615 |
| 330 | Ga0105246_10229334 | 3300011119 | Bacteria | 1461 |
| 331 | Ga0105246_10235425 | 3300011119 | Bacteria | 1444 |
| 332 | Ga0157345_1045955 | 3300012498 | Bacteria | 541 |
| 333 | Ga0154010_111657 | 3300013062 | Bacteria | 543 |
| 334 | Ga0157373_10029236 | 3300013100 | Bacteria | 3972 |
| 335 | Ga0157373_10996037 | 3300013100 | Bacteria | 625 |
| 336 | Ga0157371_10996725 | 3300013102 | Bacteria | 639 |
| 337 | Ga0157370_10040599 | 3300013104 | Bacteria | 4492 |
| 338 | Ga0157370_10111956 | 3300013104 | Unclassified | 2551 |
| 339 | Ga0157370_10294487 | 3300013104 | Bacteria | 1499 |
| 340 | Ga0157370_10619521 | 3300013104 | Bacteria | 990 |
| 341 | Ga0157370_10982301 | 3300013104 | Bacteria | 765 |
| 342 | Ga0157370_11354339 | 3300013104 | Bacteria | 641 |
| 343 | Ga0157369_10006129 | 3300013105 | Bacteria | 13955 |
| 344 | Ga0157369_10017337 | 3300013105 | Bacteria | 8096 |
| 345 | Ga0157369_10018632 | 3300013105 | Bacteria | 7782 |
| 346 | Ga0157369_10037075 | 3300013105 | Bacteria | 5340 |
| 347 | Ga0157369_10059365 | 3300013105 | Bacteria | 4125 |
| 348 | Ga0157369_10103686 | 3300013105 | Bacteria | 3030 |
| 349 | Ga0157369_10267871 | 3300013105 | Bacteria | 1781 |
| 350 | Ga0157369_10438866 | 3300013105 | Bacteria | 1353 |
| 351 | Ga0157369_10771483 | 3300013105 | Bacteria | 988 |
| 352 | Ga0157369_12549769 | 3300013105 | Bacteria | 517 |
| 353 | Ga0157374_10043473 | 3300013296 | Bacteria | 4151 |
| 354 | Ga0157374_10244845 | 3300013296 | Bacteria | 1764 |
| 355 | Ga0157374_10478435 | 3300013296 | Bacteria | 1248 |
| 356 | Ga0157374_10492826 | 3300013296 | Bacteria | 1229 |
| 357 | Ga0157374_10647685 | 3300013296 | Bacteria | 1068 |
| 358 | Ga0157374_10834835 | 3300013296 | Bacteria | 938 |
| 359 | Ga0157374_11379835 | 3300013296 | Bacteria | 727 |
| 360 | Ga0157374_12521948 | 3300013296 | Bacteria | 542 |
| 361 | Ga0157378_10684821 | 3300013297 | Bacteria | 1043 |
| 362 | Ga0157378_11081783 | 3300013297 | Bacteria | 838 |
| 363 | Ga0157378_13054342 | 3300013297 | Bacteria | 519 |
| 364 | Ga0163162_10065811 | 3300013306 | Bacteria | 3673 |
| 365 | Ga0163162_10147565 | 3300013306 | Bacteria | 2469 |
| 366 | Ga0163162_10425474 | 3300013306 | Bacteria | 1460 |
| 367 | Ga0163162_10512933 | 3300013306 | Bacteria | 1329 |
| 368 | Ga0163162_11041298 | 3300013306 | Bacteria | 926 |
| 369 | Ga0157372_10016430 | 3300013307 | Bacteria | 7941 |
| 370 | Ga0157372_10067351 | 3300013307 | Bacteria | 4023 |
| 371 | Ga0157372_10069442 | 3300013307 | Bacteria | 3962 |
| 372 | Ga0157372_10102553 | 3300013307 | Bacteria | 3268 |
| 373 | Ga0157372_10301713 | 3300013307 | Bacteria | 1863 |
| 374 | Ga0157372_11849121 | 3300013307 | Bacteria | 694 |
| 375 | Ga0157372_12274164 | 3300013307 | Bacteria | 623 |
| 376 | Ga0157375_10394539 | 3300013308 | Bacteria | 1551 |
| 377 | Ga0157375_10523633 | 3300013308 | Bacteria | 1349 |
| 378 | Ga0157375_10686347 | 3300013308 | Bacteria | 1178 |
| 379 | Ga0163163_10005491 | 3300014325 | Bacteria | 10972 |
| 380 | Ga0163163_12209976 | 3300014325 | Bacteria | 609 |
| 381 | Ga0157380_10326743 | 3300014326 | Bacteria | 1424 |
| 382 | Ga0157380_10968685 | 3300014326 | Bacteria | 882 |
| 383 | Ga0157380_11716452 | 3300014326 | Unclassified | 686 |
| 384 | Ga0157377_10000811 | 3300014745 | Bacteria | 12922 |
| 385 | Ga0157377_10883623 | 3300014745 | Bacteria | 667 |
| 386 | Ga0157379_10119216 | 3300014968 | Bacteria | 2373 |
| 387 | Ga0157376_10012411 | 3300014969 | Bacteria | 6324 |
| 388 | Ga0157376_10109890 | 3300014969 | Unclassified | 2425 |
| 389 | Ga0157376_10216561 | 3300014969 | Bacteria | 1771 |
| 390 | Ga0157376_10439367 | 3300014969 | Bacteria | 1270 |
| 391 | Ga0157376_12627093 | 3300014969 | Bacteria | 543 |
| 392 | Ga0182006_1166591 | 3300015261 | Bacteria | 740 |
| 393 | Ga0197907_10272433 | 3300020069 | Bacteria | 650 |
| 394 | Ga0197907_10520340 | 3300020069 | Bacteria | 1053 |
| 395 | Ga0197907_10540602 | 3300020069 | Bacteria | 756 |
| 396 | Ga0206356_10002683 | 3300020070 | Bacteria | 1102 |
| 397 | Ga0206356_10142702 | 3300020070 | Bacteria | 1262 |
| 398 | Ga0206356_10915817 | 3300020070 | Bacteria | 870 |
| 399 | Ga0206356_11241351 | 3300020070 | Bacteria | 1384 |
| 400 | Ga0206356_11889777 | 3300020070 | Bacteria | 665 |
| 401 | Ga0206356_11906180 | 3300020070 | Bacteria | 2962 |
| 402 | Ga0206355_1150212 | 3300020076 | Bacteria | 754 |
| 403 | Ga0206352_10568934 | 3300020078 | Bacteria | 618 |
| 404 | Ga0206350_10432168 | 3300020080 | Unclassified | 1006 |
| 405 | Ga0206350_10517347 | 3300020080 | Bacteria | 1047 |
| 406 | Ga0206350_10827546 | 3300020080 | Bacteria | 539 |
| 407 | Ga0206350_11491362 | 3300020080 | Bacteria | 990 |
| 408 | Ga0206354_10323697 | 3300020081 | Bacteria | 553 |
| 409 | Ga0206353_10260902 | 3300020082 | Bacteria | 2037 |
| 410 | Ga0206353_10311011 | 3300020082 | Bacteria | 1242 |
| 411 | Ga0206353_11315790 | 3300020082 | Bacteria | 1329 |
| 412 | Ga0213873_10100442 | 3300021358 | Bacteria | 831 |
| 413 | Ga0224712_10046400 | 3300022467 | Bacteria | 1667 |
| 414 | Ga0224712_10125171 | 3300022467 | Bacteria | 1117 |
| 415 | Ga0224712_10141618 | 3300022467 | Bacteria | 1059 |
| 416 | Ga0224712_10178621 | 3300022467 | Bacteria | 955 |
| 417 | Ga0224712_10275539 | 3300022467 | Bacteria | 782 |
| 418 | Ga0224712_10336736 | 3300022467 | Bacteria | 711 |
| 419 | Ga0224712_10365394 | 3300022467 | Bacteria | 684 |
| 420 | Ga0207697_10265251 | 3300025315 | Bacteria | 760 |
| 421 | Ga0207656_10188603 | 3300025321 | Bacteria | 992 |
| 422 | Ga0207653_10388320 | 3300025885 | Bacteria | 547 |
| 423 | Ga0207692_10112452 | 3300025898 | Bacteria | 1512 |
| 424 | Ga0207692_10461573 | 3300025898 | Bacteria | 801 |
| 425 | Ga0207692_10628970 | 3300025898 | Bacteria | 692 |
| 426 | Ga0207692_11217474 | 3300025898 | Bacteria | 500 |
| 427 | Ga0207642_10019598 | 3300025899 | Bacteria | 2622 |
| 428 | Ga0207642_10051877 | 3300025899 | Bacteria | 1858 |
| 429 | Ga0207710_10149755 | 3300025900 | Bacteria | 1131 |
| 430 | Ga0207688_10039319 | 3300025901 | Bacteria | 2627 |
| 431 | Ga0207688_10089851 | 3300025901 | Bacteria | 1763 |
| 432 | Ga0207688_10101483 | 3300025901 | Bacteria | 1662 |
| 433 | Ga0207680_10034303 | 3300025903 | Bacteria | 2903 |
| 434 | Ga0207647_10137924 | 3300025904 | Bacteria | 1430 |
| 435 | Ga0207685_10102907 | 3300025905 | Bacteria | 1224 |
| 436 | Ga0207685_10524243 | 3300025905 | Bacteria | 627 |
| 437 | Ga0207685_10577360 | 3300025905 | Bacteria | 601 |
| 438 | Ga0207699_10016150 | 3300025906 | Bacteria | 3897 |
| 439 | Ga0207699_10222621 | 3300025906 | Bacteria | 1289 |
| 440 | Ga0207645_10387589 | 3300025907 | Bacteria | 939 |
| 441 | Ga0207645_10447812 | 3300025907 | Bacteria | 871 |
| 442 | Ga0207643_10124032 | 3300025908 | Bacteria | 1532 |
| 443 | Ga0207705_10045265 | 3300025909 | Bacteria | 3163 |
| 444 | Ga0207705_10049149 | 3300025909 | Bacteria | 3036 |
| 445 | Ga0207705_10169123 | 3300025909 | Unclassified | 1645 |
| 446 | Ga0207705_10657734 | 3300025909 | Bacteria | 815 |
| 447 | Ga0207684_11071152 | 3300025910 | Bacteria | 672 |
| 448 | Ga0207654_10126066 | 3300025911 | Bacteria | 1614 |
| 449 | Ga0207654_10280082 | 3300025911 | Bacteria | 1128 |
| 450 | Ga0207654_10494570 | 3300025911 | Bacteria | 863 |
| 451 | Ga0207654_10943099 | 3300025911 | Bacteria | 626 |
| 452 | Ga0207707_10002473 | 3300025912 | Bacteria | 16636 |
| 453 | Ga0207707_10023064 | 3300025912 | Bacteria | 5445 |
| 454 | Ga0207707_10094470 | 3300025912 | Bacteria | 2612 |
| 455 | Ga0207707_10128466 | 3300025912 | Bacteria | 2216 |
| 456 | Ga0207707_10176916 | 3300025912 | Bacteria | 1864 |
| 457 | Ga0207707_10184948 | 3300025912 | Bacteria | 1818 |
| 458 | Ga0207707_10306361 | 3300025912 | Bacteria | 1373 |
| 459 | Ga0207695_10276705 | 3300025913 | Bacteria | 1573 |
| 460 | Ga0207695_10510539 | 3300025913 | Unclassified | 1084 |
| 461 | Ga0207695_10708641 | 3300025913 | Bacteria | 887 |
| 462 | Ga0207671_10212941 | 3300025914 | Bacteria | 1512 |
| 463 | Ga0207671_10268542 | 3300025914 | Bacteria | 1344 |
| 464 | Ga0207671_10305684 | 3300025914 | Bacteria | 1257 |
| 465 | Ga0207693_10006129 | 3300025915 | Bacteria | 9966 |
| 466 | Ga0207693_10025865 | 3300025915 | Bacteria | 4648 |
| 467 | Ga0207693_10044783 | 3300025915 | Bacteria | 3477 |
| 468 | Ga0207693_10074077 | 3300025915 | Bacteria | 2666 |
| 469 | Ga0207693_10204051 | 3300025915 | Bacteria | 1554 |
| 470 | Ga0207693_10403358 | 3300025915 | Bacteria | 1069 |
| 471 | Ga0207693_10638075 | 3300025915 | Bacteria | 828 |
| 472 | Ga0207663_10025472 | 3300025916 | Bacteria | 3420 |
| 473 | Ga0207663_10287232 | 3300025916 | Bacteria | 1224 |
| 474 | Ga0207663_10345354 | 3300025916 | Bacteria | 1125 |
| 475 | Ga0207660_10008507 | 3300025917 | Bacteria | 6638 |
| 476 | Ga0207660_10075618 | 3300025917 | Bacteria | 2461 |
| 477 | Ga0207660_10098807 | 3300025917 | Bacteria | 2178 |
| 478 | Ga0207660_11126474 | 3300025917 | Unclassified | 639 |
| 479 | Ga0207662_10032222 | 3300025918 | Bacteria | 3049 |
| 480 | Ga0207657_10019359 | 3300025919 | Bacteria | 6467 |
| 481 | Ga0207657_10033039 | 3300025919 | Bacteria | 4668 |
| 482 | Ga0207657_10105190 | 3300025919 | Bacteria | 2337 |
| 483 | Ga0207657_10216334 | 3300025919 | Bacteria | 1536 |
| 484 | Ga0207657_10415502 | 3300025919 | Bacteria | 1058 |
| 485 | Ga0207649_10177829 | 3300025920 | Bacteria | 1487 |
| 486 | Ga0207649_10284283 | 3300025920 | Bacteria | 1204 |
| 487 | Ga0207649_10397061 | 3300025920 | Bacteria | 1031 |
| 488 | Ga0207649_11615809 | 3300025920 | Bacteria | 513 |
| 489 | Ga0207652_10067465 | 3300025921 | Bacteria | 3102 |
| 490 | Ga0207652_10241497 | 3300025921 | Bacteria | 1628 |
| 491 | Ga0207652_10262084 | 3300025921 | Bacteria | 1559 |
| 492 | Ga0207652_10588360 | 3300025921 | Unclassified | 999 |
| 493 | Ga0207652_10914696 | 3300025921 | Bacteria | 774 |
| 494 | Ga0207646_10187358 | 3300025922 | Bacteria | 1869 |
| 495 | Ga0207646_10337993 | 3300025922 | Bacteria | 1360 |
| 496 | Ga0207646_10398279 | 3300025922 | Bacteria | 1243 |
| 497 | Ga0207646_10644175 | 3300025922 | Bacteria | 949 |
| 498 | Ga0207681_10191033 | 3300025923 | Bacteria | 1567 |
| 499 | Ga0207694_10102874 | 3300025924 | Bacteria | 2265 |
| 500 | Ga0207694_10124866 | 3300025924 | Bacteria | 2058 |
| 501 | Ga0207694_10198717 | 3300025924 | Bacteria | 1631 |
| 502 | Ga0207650_10524621 | 3300025925 | Bacteria | 991 |
| 503 | Ga0207650_10926864 | 3300025925 | Bacteria | 740 |
| 504 | Ga0207659_11646523 | 3300025926 | Bacteria | 547 |
| 505 | Ga0207687_10003687 | 3300025927 | Bacteria | 10313 |
| 506 | Ga0207687_10004292 | 3300025927 | Bacteria | 9522 |
| 507 | Ga0207687_10013761 | 3300025927 | Bacteria | 5284 |
| 508 | Ga0207687_10031947 | 3300025927 | Bacteria | 3562 |
| 509 | Ga0207687_10298609 | 3300025927 | Bacteria | 1297 |
| 510 | Ga0207700_10496362 | 3300025928 | Bacteria | 1080 |
| 511 | Ga0207700_11192616 | 3300025928 | Bacteria | 680 |
| 512 | Ga0207700_11276402 | 3300025928 | Bacteria | 655 |
| 513 | Ga0207700_11355393 | 3300025928 | Bacteria | 633 |
| 514 | Ga0207700_11464177 | 3300025928 | Bacteria | 606 |
| 515 | Ga0207664_10118764 | 3300025929 | Unclassified | 2209 |
| 516 | Ga0207664_10140364 | 3300025929 | Bacteria | 2043 |
| 517 | Ga0207664_10167829 | 3300025929 | Bacteria | 1876 |
| 518 | Ga0207664_10199711 | 3300025929 | Bacteria | 1725 |
| 519 | Ga0207664_10271932 | 3300025929 | Bacteria | 1485 |
| 520 | Ga0207664_10462616 | 3300025929 | Bacteria | 1133 |
| 521 | Ga0207664_11647957 | 3300025929 | Bacteria | 564 |
| 522 | Ga0207664_11794616 | 3300025929 | Unclassified | 536 |
| 523 | Ga0207644_10115487 | 3300025931 | Bacteria | 2036 |
| 524 | Ga0207644_10121456 | 3300025931 | Bacteria | 1989 |
| 525 | Ga0207644_11671426 | 3300025931 | Bacteria | 534 |
| 526 | Ga0207690_10012160 | 3300025932 | Bacteria | 5150 |
| 527 | Ga0207690_10050575 | 3300025932 | Bacteria | 2775 |
| 528 | Ga0207690_10070800 | 3300025932 | Bacteria | 2403 |
| 529 | Ga0207706_10194609 | 3300025933 | Bacteria | 1779 |
| 530 | Ga0207706_10345534 | 3300025933 | Bacteria | 1294 |
| 531 | Ga0207706_11516764 | 3300025933 | Unclassified | 546 |
| 532 | Ga0207709_10058973 | 3300025935 | Bacteria | 2387 |
| 533 | Ga0207709_10102752 | 3300025935 | Bacteria | 1893 |
| 534 | Ga0207709_10415859 | 3300025935 | Bacteria | 1032 |
| 535 | Ga0207709_10446687 | 3300025935 | Bacteria | 999 |
| 536 | Ga0207669_10010168 | 3300025937 | Bacteria | 4519 |
| 537 | Ga0207669_10145783 | 3300025937 | Bacteria | 1651 |
| 538 | Ga0207669_10421050 | 3300025937 | Bacteria | 1051 |
| 539 | Ga0207669_10472729 | 3300025937 | Unclassified | 998 |
| 540 | Ga0207704_10020469 | 3300025938 | Bacteria | 3501 |
| 541 | Ga0207704_10518636 | 3300025938 | Unclassified | 963 |
| 542 | Ga0207704_10817461 | 3300025938 | Bacteria | 779 |
| 543 | Ga0207704_11287902 | 3300025938 | Bacteria | 625 |
| 544 | Ga0207665_10213942 | 3300025939 | Bacteria | 1409 |
| 545 | Ga0207665_10915058 | 3300025939 | Bacteria | 696 |
| 546 | Ga0207691_10322435 | 3300025940 | Bacteria | 1324 |
| 547 | Ga0207691_10804414 | 3300025940 | Bacteria | 790 |
| 548 | Ga0207711_10369982 | 3300025941 | Bacteria | 1329 |
| 549 | Ga0207711_11673813 | 3300025941 | Unclassified | 580 |
| 550 | Ga0207689_10032246 | 3300025942 | Bacteria | 4359 |
| 551 | Ga0207689_10051166 | 3300025942 | Bacteria | 3405 |
| 552 | Ga0207661_10017694 | 3300025944 | Bacteria | 5281 |
| 553 | Ga0207661_10027657 | 3300025944 | Bacteria | 4334 |
| 554 | Ga0207661_10101307 | 3300025944 | Bacteria | 2419 |
| 555 | Ga0207661_10214956 | 3300025944 | Bacteria | 1696 |
| 556 | Ga0207661_10439909 | 3300025944 | Bacteria | 1186 |
| 557 | Ga0207661_10490526 | 3300025944 | Bacteria | 1122 |
| 558 | Ga0207661_10795976 | 3300025944 | Bacteria | 870 |
| 559 | Ga0207661_10811701 | 3300025944 | Bacteria | 861 |
| 560 | Ga0207661_10903207 | 3300025944 | Unclassified | 813 |
| 561 | Ga0207661_10991166 | 3300025944 | Bacteria | 774 |
| 562 | Ga0207661_11076974 | 3300025944 | Bacteria | 740 |
| 563 | Ga0207679_10191835 | 3300025945 | Bacteria | 1699 |
| 564 | Ga0207679_10259310 | 3300025945 | Bacteria | 1482 |
| 565 | Ga0207667_10024089 | 3300025949 | Bacteria | 6693 |
| 566 | Ga0207667_10063012 | 3300025949 | Bacteria | 3875 |
| 567 | Ga0207667_10078675 | 3300025949 | Bacteria | 3417 |
| 568 | Ga0207667_10080330 | 3300025949 | Bacteria | 3378 |
| 569 | Ga0207667_10613458 | 3300025949 | Unclassified | 1096 |
| 570 | Ga0207667_11039917 | 3300025949 | Bacteria | 805 |
| 571 | Ga0207667_11938835 | 3300025949 | Bacteria | 550 |
| 572 | Ga0207651_10152349 | 3300025960 | Bacteria | 1802 |
| 573 | Ga0207651_10596858 | 3300025960 | Bacteria | 965 |
| 574 | Ga0207712_10241330 | 3300025961 | Bacteria | 1456 |
| 575 | Ga0207712_10348099 | 3300025961 | Bacteria | 1231 |
| 576 | Ga0207668_10098892 | 3300025972 | Bacteria | 2163 |
| 577 | Ga0207640_10051928 | 3300025981 | Bacteria | 2667 |
| 578 | Ga0207640_10107500 | 3300025981 | Unclassified | 1970 |
| 579 | Ga0207640_10768400 | 3300025981 | Bacteria | 832 |
| 580 | Ga0207640_11380948 | 3300025981 | Bacteria | 631 |
| 581 | Ga0207640_11748610 | 3300025981 | Unclassified | 562 |
| 582 | Ga0207658_10003886 | 3300025986 | Bacteria | 10519 |
| 583 | Ga0207658_11297012 | 3300025986 | Bacteria | 666 |
| 584 | Ga0207658_11500641 | 3300025986 | Bacteria | 616 |
| 585 | Ga0207677_10010576 | 3300026023 | Bacteria | 5228 |
| 586 | Ga0207677_10432945 | 3300026023 | Bacteria | 1123 |
| 587 | Ga0207677_10457699 | 3300026023 | Bacteria | 1094 |
| 588 | Ga0207677_10635272 | 3300026023 | Bacteria | 941 |
| 589 | Ga0207677_11392620 | 3300026023 | Unclassified | 646 |
| 590 | Ga0207703_10052430 | 3300026035 | Bacteria | 3312 |
| 591 | Ga0207639_10108692 | 3300026041 | Bacteria | 2255 |
| 592 | Ga0207639_10141253 | 3300026041 | Unclassified | 2007 |
| 593 | Ga0207639_10278971 | 3300026041 | Bacteria | 1469 |
| 594 | Ga0207639_10925941 | 3300026041 | Bacteria | 815 |
| 595 | Ga0207639_11896082 | 3300026041 | Unclassified | 557 |
| 596 | Ga0207678_10154748 | 3300026067 | Bacteria | 1957 |
| 597 | Ga0207678_10195549 | 3300026067 | Bacteria | 1729 |
| 598 | Ga0207678_10831595 | 3300026067 | Unclassified | 816 |
| 599 | Ga0207678_11171405 | 3300026067 | Bacteria | 680 |
| 600 | Ga0207708_10004675 | 3300026075 | Bacteria | 10069 |
| 601 | Ga0207708_10045109 | 3300026075 | Bacteria | 3360 |
| 602 | Ga0207708_10859500 | 3300026075 | Bacteria | 783 |
| 603 | Ga0207708_11514145 | 3300026075 | Bacteria | 589 |
| 604 | Ga0207708_12003123 | 3300026075 | Bacteria | 507 |
| 605 | Ga0207702_10008420 | 3300026078 | Bacteria | 8701 |
| 606 | Ga0207702_10070367 | 3300026078 | Bacteria | 3009 |
| 607 | Ga0207702_10179603 | 3300026078 | Bacteria | 1948 |
| 608 | Ga0207702_10237286 | 3300026078 | Bacteria | 1707 |
| 609 | Ga0207702_10796681 | 3300026078 | Bacteria | 934 |
| 610 | Ga0207648_10036192 | 3300026089 | Bacteria | 4348 |
| 611 | Ga0207648_10069681 | 3300026089 | Bacteria | 3064 |
| 612 | Ga0207676_10431708 | 3300026095 | Bacteria | 1238 |
| 613 | Ga0207676_10941329 | 3300026095 | Bacteria | 849 |
| 614 | Ga0207676_11141198 | 3300026095 | Bacteria | 771 |
| 615 | Ga0207674_10004135 | 3300026116 | Bacteria | 17554 |
| 616 | Ga0207674_10009602 | 3300026116 | Bacteria | 11037 |
| 617 | Ga0207674_10024193 | 3300026116 | Bacteria | 6494 |
| 618 | Ga0207674_10072348 | 3300026116 | Bacteria | 3464 |
| 619 | Ga0207674_10084616 | 3300026116 | Bacteria | 3169 |
| 620 | Ga0207674_11079527 | 3300026116 | Bacteria | 772 |
| 621 | Ga0207675_100004546 | 3300026118 | Bacteria | 13386 |
| 622 | Ga0207675_100020968 | 3300026118 | Bacteria | 6094 |
| 623 | Ga0207675_100360851 | 3300026118 | Bacteria | 1425 |
| 624 | Ga0207683_10005639 | 3300026121 | Bacteria | 10734 |
| 625 | Ga0207683_10111906 | 3300026121 | Bacteria | 2445 |
| 626 | Ga0207683_10436745 | 3300026121 | Bacteria | 1206 |
| 627 | Ga0207683_11065943 | 3300026121 | Unclassified | 750 |
| 628 | Ga0207683_11329015 | 3300026121 | Bacteria | 665 |
| 629 | Ga0207698_10092693 | 3300026142 | Bacteria | 2477 |
| 630 | Ga0207698_10860151 | 3300026142 | Bacteria | 912 |
| 631 | Ga0207698_11204396 | 3300026142 | Bacteria | 771 |
| 632 | Ga0207698_11346523 | 3300026142 | Bacteria | 729 |
| 633 | Ga0209966_1052986 | 3300027695 | Unclassified | 866 |
| 634 | Ga0209974_10196561 | 3300027876 | Unclassified | 744 |
| 635 | Ga0207428_10386307 | 3300027907 | Bacteria | 1026 |
| 636 | Ga0268266_10093454 | 3300028379 | Bacteria | 2639 |
| 637 | Ga0268266_10632639 | 3300028379 | Bacteria | 1029 |
| 638 | Ga0268265_10212127 | 3300028380 | Bacteria | 1688 |
| 639 | Ga0268265_12038097 | 3300028380 | Unclassified | 581 |
| 640 | Ga0268265_12632724 | 3300028380 | Unclassified | 509 |
| 641 | Ga0268264_10458896 | 3300028381 | Bacteria | 1236 |
| 642 | Ga0268264_10605819 | 3300028381 | Bacteria | 1080 |
| 643 | Ga0268264_11630368 | 3300028381 | Bacteria | 656 |
| 644 | Ga0268264_11805915 | 3300028381 | Unclassified | 621 |
| 645 | Ga0265338_10053011 | 3300028800 | Bacteria | 3634 |
| 646 | Ga0265338_10081986 | 3300028800 | Bacteria | 2702 |
| 647 | Ga0265338_10360334 | 3300028800 | Bacteria | 1043 |
| 648 | Ga0265328_10046362 | 3300031239 | Bacteria | 1598 |
| 649 | Ga0265327_10005348 | 3300031251 | Bacteria | 10749 |
| 650 | Ga0265327_10025102 | 3300031251 | Bacteria | 3482 |
| 651 | Ga0265327_10043117 | 3300031251 | Bacteria | 2417 |
| 652 | Ga0307408_100731485 | 3300031548 | Bacteria | 892 |
| 653 | Ga0265313_10365476 | 3300031595 | Bacteria | 570 |
| 654 | Ga0307405_11409823 | 3300031731 | Bacteria | 609 |
| 655 | Ga0307412_10713555 | 3300031911 | Bacteria | 862 |
| 656 | Ga0307409_100428292 | 3300031995 | Bacteria | 1271 |
| 657 | Ga0307415_100980212 | 3300032126 | Bacteria | 784 |
| 658 | Ga0373948_0143803 | 3300034817 | Bacteria | 592 |
| 659 | Ga0373926_0033608 | 3300035083 | Bacteria | 1813 |
| 660 | Ga0373928_0112888 | 3300035084 | Bacteria | 721 |
| 661 | Ga0373934_0053026 | 3300035086 | Bacteria | 1609 |
| 662 | Ga0373944_0005822 | 3300035089 | Bacteria | 3260 |
| 663 | Ga0373944_0029250 | 3300035089 | Bacteria | 1646 |
| 664 | Ga0373944_0094392 | 3300035089 | Bacteria | 1003 |
| 665 | Ga0373944_0187308 | 3300035089 | Bacteria | 744 |
| 666 | Ga0373949_0026207 | 3300035090 | Bacteria | 1365 |
| 667 | Ga0373923_0027686 | 3300035111 | Bacteria | 2262 |
| 668 | Ga0373923_0126032 | 3300035111 | Bacteria | 1148 |
| 669 | Ga0373936_0004255 | 3300035113 | Bacteria | 5405 |
| 670 | Ga0373945_0005048 | 3300035116 | Bacteria | 4205 |
| 671 | Ga0373945_0005353 | 3300035116 | Bacteria | 4109 |
| 672 | Ga0373945_0124517 | 3300035116 | Bacteria | 1027 |
| 673 | Ga0373954_0274243 | 3300035118 | Bacteria | 831 |
| 674 | Ga0373943_0000948 | 3300035170 | Bacteria | 12836 |
| 675 | Ga0373943_0005005 | 3300035170 | Bacteria | 5977 |
| 676 | Ga0373943_0029909 | 3300035170 | Bacteria | 2575 |
| 677 | Ga0373943_0091068 | 3300035170 | Bacteria | 1579 |
| 678 | Ga0373943_0921681 | 3300035170 | Bacteria | 522 |
| 679 | Ga0373946_0028313 | 3300035171 | Bacteria | 2222 |
| 680 | Ga0373946_0034334 | 3300035171 | Bacteria | 2048 |
| 681 | Ga0373946_0049788 | 3300035171 | Bacteria | 1748 |
| 682 | Ga0373955_0081204 | 3300035172 | Bacteria | 1832 |
| 683 | Ga0373961_0407873 | 3300035241 | Bacteria | 523 |
| 684 | Ga0373962_0069989 | 3300035242 | Bacteria | 1047 |
| 685 | Ga0373924_0304370 | 3300035410 | Bacteria | 708 |
| 686 | Ga0373931_0851639 | 3300035691 | Bacteria | 610 |
| 687 | Ga0373931_1211222 | 3300035691 | Unclassified | 517 |
| 688 | Ga0373935_0020566 | 3300035692 | Bacteria | 4034 |
| 689 | Ga0373935_0039711 | 3300035692 | Bacteria | 2951 |
| 690 | Ga0373935_0092235 | 3300035692 | Bacteria | 1984 |
| 691 | Ga0373935_0133805 | 3300035692 | Bacteria | 1668 |
| 692 | Ga0373935_0703428 | 3300035692 | Bacteria | 743 |
| 693 | Ga0373927_0013935 | 3300035695 | Bacteria | 5334 |
| 694 | Ga0373927_0188986 | 3300035695 | Bacteria | 1351 |
| 695 | Ga0373927_0703717 | 3300035695 | Bacteria | 667 |
| 696 | Ga0373933_0053922 | 3300035724 | Bacteria | 2408 |
| 697 | Ga0373947_0003156 | 3300035725 | Bacteria | 9813 |
| 698 | Ga0373947_0011478 | 3300035725 | Bacteria | 5082 |
| 699 | Ga0373947_0020606 | 3300035725 | Bacteria | 3808 |
| 700 | Ga0373947_0032831 | 3300035725 | Bacteria | 3061 |
| 701 | Ga0373947_0629307 | 3300035725 | Bacteria | 731 |
| 702 | Ga0373937_0242408 | 3300036401 | Bacteria | 1698 |
| 703 | Ga0373937_0288184 | 3300036401 | Bacteria | 1551 |
| 704 | Ga0373937_0575187 | 3300036401 | Bacteria | 1070 |
| 705 | Ga0373925_0013684 | 3300037068 | Bacteria | 5875 |
| 706 | Ga0373925_0055953 | 3300037068 | Bacteria | 2954 |
| 707 | Ga0373925_0590428 | 3300037068 | Bacteria | 914 |
| 708 | Ga0373925_0709030 | 3300037068 | Bacteria | 829 |
| 709 | Ga0395899_0000857 | 3300037312 | Bacteria | 29102 |
| 710 | Ga0395899_0022381 | 3300037312 | Bacteria | 4793 |
| 711 | Ga0395899_0286300 | 3300037312 | Bacteria | 1119 |
| 712 | Ga0395899_0489570 | 3300037312 | Bacteria | 799 |
| 713 | Ga0395900_0006983 | 3300037418 | Bacteria | 11698 |
| 714 | Ga0395900_0008169 | 3300037418 | Bacteria | 10773 |
| 715 | Ga0395900_0026920 | 3300037418 | Bacteria | 5886 |
| 716 | Ga0395900_0052733 | 3300037418 | Bacteria | 4187 |
| 717 | Ga0395900_0120580 | 3300037418 | Bacteria | 2691 |
| 718 | Ga0395900_0146384 | 3300037418 | Bacteria | 2415 |
| 719 | Ga0395900_0176437 | 3300037418 | Bacteria | 2173 |
| 720 | Ga0395900_0232975 | 3300037418 | Unclassified | 1851 |
| 721 | Ga0395900_0258735 | 3300037418 | Bacteria | 1739 |
| 722 | Ga0395900_0284944 | 3300037418 | Bacteria | 1643 |
| 723 | Ga0395900_0343602 | 3300037418 | Bacteria | 1467 |
| 724 | Ga0395900_0568862 | 3300037418 | Bacteria | 1076 |
| 725 | Ga0395900_1874177 | 3300037418 | Bacteria | 510 |
| 726 | Ga0395898_0001107 | 3300037466 | Bacteria | 41584 |
| 727 | Ga0395898_0003086 | 3300037466 | Bacteria | 18838 |
| 728 | Ga0395898_0026599 | 3300037466 | Bacteria | 5819 |
| 729 | Ga0395898_0041591 | 3300037466 | Bacteria | 4539 |
| 730 | Ga0395898_0077048 | 3300037466 | Bacteria | 3219 |
| 731 | Ga0395898_0083596 | 3300037466 | Bacteria | 3077 |
| 732 | Ga0395898_0120968 | 3300037466 | Bacteria | 2508 |
| 733 | Ga0395898_0137249 | 3300037466 | Bacteria | 2342 |
| 734 | Ga0395898_1468889 | 3300037466 | Bacteria | 608 |
| 735 | Ga0395898_1623872 | 3300037466 | Bacteria | 570 |
| 736 | Ga0395905_0006650 | 3300037471 | Bacteria | 11593 |
| 737 | Ga0395905_0028323 | 3300037471 | Bacteria | 5280 |
| 738 | Ga0395905_0090864 | 3300037471 | Unclassified | 2863 |
| 739 | Ga0395905_0228732 | 3300037471 | Bacteria | 1739 |
| 740 | Ga0395905_0412021 | 3300037471 | Bacteria | 1247 |
| 741 | Ga0395905_0549727 | 3300037471 | Bacteria | 1056 |
| 742 | Ga0395905_0601511 | 3300037471 | Bacteria | 1001 |
| 743 | Ga0395905_1476474 | 3300037471 | Bacteria | 584 |
| 744 | Ga0395901_0009580 | 3300038443 | Bacteria | 9830 |
| 745 | Ga0395901_0010735 | 3300038443 | Bacteria | 9286 |
| 746 | Ga0395901_0014827 | 3300038443 | Bacteria | 7918 |
| 747 | Ga0395901_0032782 | 3300038443 | Bacteria | 5359 |
| 748 | Ga0395901_0033026 | 3300038443 | Bacteria | 5340 |
| 749 | Ga0395901_0057261 | 3300038443 | Bacteria | 4054 |
| 750 | Ga0395901_0081453 | 3300038443 | Bacteria | 3381 |
| 751 | Ga0395901_0190919 | 3300038443 | Unclassified | 2148 |
| 752 | Ga0395901_0587348 | 3300038443 | Bacteria | 1125 |
| 753 | Ga0395901_0618580 | 3300038443 | Bacteria | 1090 |
| 754 | Ga0395901_0622690 | 3300038443 | Bacteria | 1086 |
| 755 | Ga0395901_0722601 | 3300038443 | Bacteria | 991 |
| 756 | Ga0395901_0818168 | 3300038443 | Bacteria | 919 |
| 757 | Ga0395901_1612657 | 3300038443 | Bacteria | 602 |
| 758 | Ga0436365_0081418 | 3300039437 | Bacteria | 596 |
| 759 | Ga0436361_0951993 | 3300039447 | Bacteria | 672 |
| 760 | Ga0436363_1216359 | 3300039450 | Bacteria | 577 |
| 761 | Ga0436363_1436042 | 3300039450 | Bacteria | 568 |
| 762 | Ga0436362_0307992 | 3300039453 | Bacteria | 849 |
| 763 | Ga0436362_0511863 | 3300039453 | Bacteria | 3044 |
| 764 | Ga0451789_0948195 | 3300041443 | Bacteria | 792 |
| 765 | Ga0451835_0360775 | 3300041492 | Bacteria | 583 |
| 766 | Ga0451837_0243006 | 3300041494 | Bacteria | 586 |
| 767 | Ga0451839_0578465 | 3300041496 | Bacteria | 553 |
| 768 | Ga0451839_0601551 | 3300041496 | Bacteria | 507 |
| 769 | Ga0451853_2386811 | 3300041512 | Bacteria | 611 |
| 770 | Ga0451853_2929055 | 3300041512 | Bacteria | 925 |
| 771 | Ga0451853_4020500 | 3300041512 | Unclassified | 889 |
| 772 | Ga0439448_0079382 | 3300042005 | Bacteria | 1100 |
| 773 | Ga0439450_142461 | 3300042008 | Bacteria | 626 |
| 774 | Ga0439456_124799 | 3300042013 | Bacteria | 592 |
| 775 | Ga0439462_0039407 | 3300042015 | Bacteria | 1260 |
| 776 | Ga0450907_024247 | 3300042146 | Bacteria | 1025 |
| 777 | Ga0439458_0185125 | 3300042157 | Bacteria | 566 |
| 778 | Ga0439440_0180680 | 3300042993 | Bacteria | 618 |
| 779 | Ga0466969_0347538 | 3300044656 | Bacteria | 671 |
| 780 | Ga0466965_0232828 | 3300044683 | Bacteria | 984 |
| 781 | Ga0466966_0021194 | 3300044684 | Bacteria | 4268 |
| 782 | Ga0466966_0026087 | 3300044684 | Bacteria | 3815 |
| 783 | Ga0466966_0053244 | 3300044684 | Bacteria | 2568 |
| 784 | Ga0466966_0195067 | 3300044684 | Bacteria | 1226 |
| 785 | Ga0466961_0020291 | 3300044693 | Bacteria | 4275 |
| 786 | Ga0466961_0140784 | 3300044693 | Bacteria | 1510 |
| 787 | Ga0466961_0262862 | 3300044693 | Bacteria | 1058 |
| 788 | Ga0466961_0323221 | 3300044693 | Bacteria | 941 |
| 789 | Ga0466963_0016292 | 3300044694 | Bacteria | 4620 |
| 790 | Ga0466963_0017022 | 3300044694 | Bacteria | 4528 |
| 791 | Ga0466963_0037220 | 3300044694 | Bacteria | 3176 |
| 792 | Ga0466963_0084841 | 3300044694 | Bacteria | 2149 |
| 793 | Ga0466963_0154898 | 3300044694 | Bacteria | 1592 |
| 794 | Ga0466963_0221103 | 3300044694 | Bacteria | 1326 |
| 795 | Ga0466963_0381511 | 3300044694 | Bacteria | 993 |
| 796 | Ga0466963_0430999 | 3300044694 | Bacteria | 930 |
| 797 | Ga0466963_0566640 | 3300044694 | Bacteria | 802 |
| 798 | Ga0466963_1273424 | 3300044694 | Bacteria | 516 |
| 799 | Ga0466964_0004892 | 3300044706 | Bacteria | 4951 |
| 800 | Ga0466964_0008108 | 3300044706 | Bacteria | 3940 |
| 801 | Ga0466964_0054372 | 3300044706 | Unclassified | 1650 |
| 802 | Ga0466964_0825009 | 3300044706 | Bacteria | 526 |
| 803 | Ga0466971_0103752 | 3300044719 | Bacteria | 1308 |
| 804 | Ga0466971_0479954 | 3300044719 | Unclassified | 612 |
| 805 | Ga0466968_0005563 | 3300044735 | Bacteria | 4720 |
| 806 | Ga0466968_0120121 | 3300044735 | Bacteria | 1188 |
| 807 | Ga0466968_0373812 | 3300044735 | Bacteria | 695 |
| 808 | Ga0466970_0024022 | 3300044765 | Bacteria | 3187 |
| 809 | Ga0466957_0216887 | 3300044842 | Bacteria | 1262 |
| 810 | Ga0466957_0670521 | 3300044842 | Bacteria | 730 |
| 811 | Ga0466957_1126591 | 3300044842 | Bacteria | 566 |
| 812 | Ga0466960_0251774 | 3300044901 | Bacteria | 981 |
| 813 | Ga0466959_0014461 | 3300045049 | Bacteria | 5735 |
| 814 | Ga0466959_0084559 | 3300045049 | Bacteria | 2284 |
| 815 | Ga0466959_0629943 | 3300045049 | Bacteria | 720 |
| 816 | Ga0451576_0143068 | 3300045051 | Bacteria | 2494 |
| 817 | Ga0451576_1644379 | 3300045051 | Bacteria | 666 |
| 818 | Ga0451576_2157330 | 3300045051 | Bacteria | 572 |
| 819 | Ga0466958_0016073 | 3300045836 | Bacteria | 4304 |
| 820 | Ga0466958_0021158 | 3300045836 | Bacteria | 3797 |
| 821 | Ga0466958_0125161 | 3300045836 | Bacteria | 1611 |
| 822 | Ga0466958_0157298 | 3300045836 | Bacteria | 1435 |
| 823 | Ga0466958_0223615 | 3300045836 | Bacteria | 1201 |
| 824 | Ga0466958_0794382 | 3300045836 | Bacteria | 617 |
| 825 | Ga0466967_0002964 | 3300045976 | Bacteria | 10850 |
| 826 | Ga0466967_0003721 | 3300045976 | Bacteria | 10050 |
| 827 | Ga0466967_0018586 | 3300045976 | Bacteria | 5560 |
| 828 | Ga0466967_0021070 | 3300045976 | Bacteria | 5282 |
| 829 | Ga0466967_0024277 | 3300045976 | Bacteria | 4982 |
| 830 | Ga0466967_0080388 | 3300045976 | Bacteria | 2941 |
| 831 | Ga0466967_0120948 | 3300045976 | Bacteria | 2419 |
| 832 | Ga0466967_0132870 | 3300045976 | Bacteria | 2312 |
| 833 | Ga0466967_0151283 | 3300045976 | Bacteria | 2169 |
| 834 | Ga0466967_0203962 | 3300045976 | Bacteria | 1873 |
| 835 | Ga0466967_0355216 | 3300045976 | Bacteria | 1419 |
| 836 | Ga0466967_0361058 | 3300045976 | Bacteria | 1407 |
| 837 | Ga0466967_0703727 | 3300045976 | Bacteria | 1001 |
| 838 | Ga0466967_2593790 | 3300045976 | Bacteria | 501 |
| 839 | Ga0495592_0081801 | 3300046454 | Bacteria | 2335 |
| 840 | Ga0495592_0227232 | 3300046454 | Bacteria | 1244 |
| 841 | Ga0495592_0279435 | 3300046454 | Bacteria | 1092 |
| 842 | Ga0495603_0017920 | 3300046455 | Bacteria | 4286 |
| 843 | Ga0495603_0140061 | 3300046455 | Bacteria | 1407 |
| 844 | Ga0495603_0370571 | 3300046455 | Bacteria | 821 |
| 845 | Ga0495629_0009258 | 3300046459 | Bacteria | 7205 |
| 846 | Ga0495629_0020903 | 3300046459 | Bacteria | 4672 |
| 847 | Ga0495629_0052145 | 3300046459 | Bacteria | 2863 |
| 848 | Ga0495629_0100124 | 3300046459 | Bacteria | 2022 |
| 849 | Ga0495629_0171740 | 3300046459 | Bacteria | 1504 |
| 850 | Ga0495629_0264958 | 3300046459 | Bacteria | 1181 |
| 851 | Ga0495629_0410323 | 3300046459 | Bacteria | 920 |
| 852 | Ga0495629_1030761 | 3300046459 | Bacteria | 534 |
| 853 | Ga0495641_0000793 | 3300046461 | Bacteria | 26791 |
| 854 | Ga0495641_0013263 | 3300046461 | Bacteria | 4541 |
| 855 | Ga0495641_0017097 | 3300046461 | Bacteria | 3792 |
| 856 | Ga0495641_0041713 | 3300046461 | Bacteria | 2131 |
| 857 | Ga0495641_0082519 | 3300046461 | Bacteria | 1439 |
| 858 | Ga0495641_0227177 | 3300046461 | Bacteria | 837 |
| 859 | Ga0495651_0023372 | 3300046462 | Bacteria | 4806 |
| 860 | Ga0495651_0039755 | 3300046462 | Bacteria | 3660 |
| 861 | Ga0495651_0113961 | 3300046462 | Bacteria | 1995 |
| 862 | Ga0495651_0620115 | 3300046462 | Bacteria | 681 |
| 863 | Ga0495651_0774996 | 3300046462 | Bacteria | 593 |
| 864 | Ga0495653_0056093 | 3300046463 | Bacteria | 3004 |
| 865 | Ga0495653_0383379 | 3300046463 | Bacteria | 897 |
| 866 | Ga0495653_0520910 | 3300046463 | Bacteria | 739 |
| 867 | Ga0495580_0026424 | 3300046472 | Bacteria | 4232 |
| 868 | Ga0495580_0101146 | 3300046472 | Bacteria | 2005 |
| 869 | Ga0495580_0985033 | 3300046472 | Bacteria | 538 |
| 870 | Ga0495582_0003686 | 3300046473 | Bacteria | 8633 |
| 871 | Ga0495582_0004168 | 3300046473 | Bacteria | 8126 |
| 872 | Ga0495582_0033145 | 3300046473 | Bacteria | 2839 |
| 873 | Ga0495582_0055842 | 3300046473 | Bacteria | 2177 |
| 874 | Ga0495582_0093913 | 3300046473 | Bacteria | 1674 |
| 875 | Ga0495639_0002486 | 3300046475 | Bacteria | 8042 |
| 876 | Ga0495639_0019251 | 3300046475 | Bacteria | 2978 |
| 877 | Ga0495639_0095558 | 3300046475 | Bacteria | 1398 |
| 878 | Ga0495662_0003248 | 3300046476 | Bacteria | 8215 |
| 879 | Ga0495662_0005102 | 3300046476 | Bacteria | 6577 |
| 880 | Ga0495662_0061974 | 3300046476 | Bacteria | 1807 |
| 881 | Ga0495662_0272122 | 3300046476 | Bacteria | 834 |
| 882 | Ga0495664_0018878 | 3300046477 | Bacteria | 3958 |
| 883 | Ga0495664_0067639 | 3300046477 | Bacteria | 2131 |
| 884 | Ga0495594_0017126 | 3300046499 | Bacteria | 3825 |
| 885 | Ga0495594_0281453 | 3300046499 | Bacteria | 948 |
| 886 | Ga0495594_0466104 | 3300046499 | Bacteria | 718 |
| 887 | Ga0495596_0407787 | 3300046500 | Bacteria | 530 |
| 888 | Ga0495608_0010163 | 3300046511 | Bacteria | 6568 |
| 889 | Ga0495608_0021288 | 3300046511 | Bacteria | 4451 |
| 890 | Ga0495608_0316661 | 3300046511 | Bacteria | 964 |
| 891 | Ga0495618_0210702 | 3300046514 | Bacteria | 1228 |
| 892 | Ga0495618_0463724 | 3300046514 | Bacteria | 767 |
| 893 | Ga0495618_0624252 | 3300046514 | Bacteria | 639 |
| 894 | Ga0495618_0765979 | 3300046514 | Bacteria | 564 |
| 895 | Ga0495628_0387188 | 3300046516 | Bacteria | 1023 |
| 896 | Ga0495628_1061886 | 3300046516 | Bacteria | 555 |
| 897 | Ga0495630_0003748 | 3300046517 | Bacteria | 10605 |
| 898 | Ga0495630_0089179 | 3300046517 | Bacteria | 2329 |
| 899 | Ga0495630_0166820 | 3300046517 | Bacteria | 1676 |
| 900 | Ga0495630_0271651 | 3300046517 | Bacteria | 1295 |
| 901 | Ga0495630_0769723 | 3300046517 | Bacteria | 735 |
| 902 | Ga0495630_0769790 | 3300046517 | Bacteria | 735 |
| 903 | Ga0495630_1115974 | 3300046517 | Bacteria | 598 |
| 904 | Ga0495630_1126812 | 3300046517 | Bacteria | 594 |
| 905 | Ga0495666_0009556 | 3300046526 | Bacteria | 4846 |
| 906 | Ga0495666_0032459 | 3300046526 | Bacteria | 2555 |
| 907 | Ga0495652_0043940 | 3300046529 | Bacteria | 3849 |
| 908 | Ga0495652_0169334 | 3300046529 | Bacteria | 1687 |
| 909 | Ga0495652_0238105 | 3300046529 | Bacteria | 1356 |
| 910 | Ga0495652_0596574 | 3300046529 | Bacteria | 754 |
| 911 | Ga0495652_0969412 | 3300046529 | Bacteria | 558 |
| 912 | Ga0495665_0001332 | 3300046531 | Bacteria | 13180 |
| 913 | Ga0495665_0004084 | 3300046531 | Bacteria | 7873 |
| 914 | Ga0495665_0201757 | 3300046531 | Bacteria | 1031 |
| 915 | Ga0495665_0367695 | 3300046531 | Bacteria | 731 |
| 916 | Ga0495640_0027400 | 3300046533 | Bacteria | 4110 |
| 917 | Ga0495640_0063043 | 3300046533 | Bacteria | 2512 |
| 918 | Ga0495640_0320308 | 3300046533 | Bacteria | 960 |
| 919 | Ga0495586_0086592 | 3300046535 | Bacteria | 1727 |
| 920 | Ga0495586_0202095 | 3300046535 | Bacteria | 1126 |
| 921 | Ga0495586_0801874 | 3300046535 | Bacteria | 543 |
| 922 | Ga0495587_0033023 | 3300046536 | Bacteria | 3125 |
| 923 | Ga0495587_0834915 | 3300046536 | Bacteria | 503 |
| 924 | Ga0495645_0029351 | 3300046543 | Bacteria | 4000 |
| 925 | Ga0495645_0115284 | 3300046543 | Bacteria | 1898 |
| 926 | Ga0495645_0435634 | 3300046543 | Bacteria | 829 |
| 927 | Ga0495667_0006114 | 3300046559 | Bacteria | 8151 |
| 928 | Ga0495667_0013391 | 3300046559 | Bacteria | 5552 |
| 929 | Ga0495667_0025494 | 3300046559 | Bacteria | 3983 |
| 930 | Ga0495667_0072648 | 3300046559 | Bacteria | 2242 |
| 931 | Ga0495634_0028676 | 3300046642 | Bacteria | 3861 |
| 932 | Ga0495634_0034982 | 3300046642 | Bacteria | 3443 |
| 933 | Ga0495634_0056253 | 3300046642 | Bacteria | 2629 |
| 934 | Ga0495634_0445671 | 3300046642 | Unclassified | 764 |
| 935 | Ga0495634_0771572 | 3300046642 | Bacteria | 549 |
| 936 | Ga0495635_0011984 | 3300046663 | Bacteria | 6074 |
| 937 | Ga0495635_0045493 | 3300046663 | Bacteria | 3029 |
| 938 | Ga0495635_0301828 | 3300046663 | Bacteria | 1074 |
| 939 | Ga0495588_0017324 | 3300046674 | Bacteria | 3495 |
| 940 | Ga0495588_0494800 | 3300046674 | Bacteria | 641 |
| 941 | Ga0495588_0508335 | 3300046674 | Bacteria | 631 |
| 942 | Ga0495657_0012099 | 3300046675 | Bacteria | 6420 |
| 943 | Ga0495657_0064273 | 3300046675 | Bacteria | 2418 |
| 944 | Ga0495657_0392136 | 3300046675 | Bacteria | 818 |
| 945 | Ga0495657_0601870 | 3300046675 | Bacteria | 636 |
| 946 | Ga0495599_0130705 | 3300046678 | Bacteria | 1559 |
| 947 | Ga0495599_0820827 | 3300046678 | Bacteria | 530 |
| 948 | Ga0495599_0895370 | 3300046678 | Bacteria | 503 |
| 949 | Ga0495646_0080992 | 3300046680 | Bacteria | 1893 |
| 950 | Ga0495646_0276236 | 3300046680 | Bacteria | 894 |
| 951 | Ga0495647_0002012 | 3300046681 | Bacteria | 6349 |
| 952 | Ga0495647_0003805 | 3300046681 | Bacteria | 4855 |
| 953 | Ga0495647_0254878 | 3300046681 | Bacteria | 782 |
| 954 | Ga0495658_0000379 | 3300046683 | Bacteria | 24931 |
| 955 | Ga0495658_0011720 | 3300046683 | Bacteria | 4418 |
| 956 | Ga0495658_0024560 | 3300046683 | Bacteria | 3211 |
| 957 | Ga0495658_0088213 | 3300046683 | Bacteria | 1833 |
| 958 | Ga0495658_0555003 | 3300046683 | Bacteria | 735 |
| 959 | Ga0495658_1088822 | 3300046683 | Bacteria | 509 |
| 960 | Ga0495613_0001753 | 3300046689 | Bacteria | 16515 |
| 961 | Ga0495613_0013003 | 3300046689 | Bacteria | 6184 |
| 962 | Ga0495613_0403886 | 3300046689 | Bacteria | 931 |
| 963 | Ga0495613_0603580 | 3300046689 | Bacteria | 730 |
| 964 | Ga0495613_0724424 | 3300046689 | Bacteria | 653 |
| 965 | Ga0495613_0736660 | 3300046689 | Bacteria | 647 |
| 966 | Ga0495613_1049164 | 3300046689 | Bacteria | 522 |
| 967 | Ga0495624_0015742 | 3300046690 | Bacteria | 5099 |
| 968 | Ga0495624_0205909 | 3300046690 | Bacteria | 1194 |
| 969 | Ga0495624_0264618 | 3300046690 | Bacteria | 1039 |
| 970 | Ga0495624_0328108 | 3300046690 | Unclassified | 921 |
| 971 | Ga0495624_0489836 | 3300046690 | Bacteria | 736 |
| 972 | Ga0495624_0534403 | 3300046690 | Bacteria | 700 |
| 973 | Ga0495600_0008198 | 3300046809 | Bacteria | 6415 |
| 974 | Ga0495600_0042616 | 3300046809 | Bacteria | 2959 |
| 975 | Ga0495600_0052274 | 3300046809 | Bacteria | 2668 |
| 976 | Ga0495600_0289085 | 3300046809 | Bacteria | 1036 |
| 977 | Ga0495600_0856731 | 3300046809 | Bacteria | 538 |
| 978 | Ga0495600_0890680 | 3300046809 | Unclassified | 526 |
| 979 | Ga0495581_0002043 | 3300047315 | Bacteria | 11350 |
| 980 | Ga0495581_0005670 | 3300047315 | Bacteria | 7241 |
| 981 | Ga0495581_0195302 | 3300047315 | Bacteria | 1184 |
| 982 | Ga0495581_0864114 | 3300047315 | Bacteria | 517 |
| 983 | Ga0495604_0065911 | 3300047317 | Bacteria | 2756 |
| 984 | Ga0495604_0068890 | 3300047317 | Bacteria | 2683 |
| 985 | Ga0495604_0176181 | 3300047317 | Bacteria | 1499 |
| 986 | Ga0495604_0337720 | 3300047317 | Bacteria | 1003 |
| 987 | Ga0495604_0922598 | 3300047317 | Bacteria | 544 |
| 988 | Ga0495674_0000944 | 3300047319 | Bacteria | 27747 |
| 989 | Ga0495674_0034090 | 3300047319 | Bacteria | 4606 |
| 990 | Ga0495674_0039755 | 3300047319 | Bacteria | 4213 |
| 991 | Ga0495674_0126250 | 3300047319 | Bacteria | 2158 |
| 992 | Ga0495674_0230014 | 3300047319 | Bacteria | 1530 |
| 993 | Ga0495674_0398048 | 3300047319 | Bacteria | 1112 |
| 994 | Ga0495674_0641062 | 3300047319 | Bacteria | 838 |
| 995 | Ga0495676_0002172 | 3300047321 | Bacteria | 17365 |
| 996 | Ga0495676_0043365 | 3300047321 | Bacteria | 3682 |
| 997 | Ga0495676_0052135 | 3300047321 | Bacteria | 3268 |
| 998 | Ga0495676_0082881 | 3300047321 | Bacteria | 2425 |
| 999 | Ga0495680_0000491 | 3300047322 | Bacteria | 44586 |
| 1000 | Ga0495680_0050186 | 3300047322 | Bacteria | 3263 |
| 1001 | Ga0495680_0127060 | 3300047322 | Bacteria | 1876 |
| 1002 | Ga0495680_0167091 | 3300047322 | Bacteria | 1594 |
| 1003 | Ga0495680_0321908 | 3300047322 | Bacteria | 1082 |
| 1004 | Ga0495680_0510562 | 3300047322 | Bacteria | 815 |
| 1005 | Ga0495680_0622641 | 3300047322 | Bacteria | 720 |
| 1006 | Ga0495675_0140167 | 3300047444 | Bacteria | 1499 |
| 1007 | Ga0495675_0377835 | 3300047444 | Bacteria | 829 |
| 1008 | Ga0495684_0005173 | 3300047471 | Bacteria | 10166 |
| 1009 | Ga0495593_0010191 | 3300047673 | Bacteria | 5432 |
| 1010 | Ga0495593_0019130 | 3300047673 | Bacteria | 3843 |
| 1011 | Ga0495593_0149968 | 3300047673 | Bacteria | 1179 |
| 1012 | Ga0495602_0054170 | 3300048088 | Bacteria | 3544 |
| 1013 | Ga0495602_0070809 | 3300048088 | Bacteria | 2981 |
| 1014 | Ga0495602_0197369 | 3300048088 | Bacteria | 1538 |
| 1015 | Ga0495602_0261909 | 3300048088 | Bacteria | 1282 |
| 1016 | Ga0495614_0007391 | 3300048089 | Bacteria | 4893 |
| 1017 | Ga0495614_0050939 | 3300048089 | Bacteria | 1774 |
| 1018 | Ga0495614_0482077 | 3300048089 | Bacteria | 589 |
| 1019 | Ga0495614_0621487 | 3300048089 | Bacteria | 520 |
| 1020 | Ga0496100_0014411 | 3300048903 | Bacteria | 4590 |
| 1021 | Ga0496100_0015773 | 3300048903 | Bacteria | 4418 |
| 1022 | Ga0496100_0076332 | 3300048903 | Bacteria | 2250 |
| 1023 | Ga0496100_0087868 | 3300048903 | Bacteria | 2114 |
| 1024 | Ga0496100_0268500 | 3300048903 | Bacteria | 1268 |
| 1025 | Ga0496101_0002875 | 3300048904 | Bacteria | 10590 |
| 1026 | Ga0496101_0018591 | 3300048904 | Bacteria | 4728 |
| 1027 | Ga0496101_0024995 | 3300048904 | Bacteria | 4140 |
| 1028 | Ga0496101_0027032 | 3300048904 | Bacteria | 3992 |
| 1029 | Ga0496101_0038693 | 3300048904 | Bacteria | 3388 |
| 1030 | Ga0496101_0047663 | 3300048904 | Bacteria | 3077 |
| 1031 | Ga0496101_0148534 | 3300048904 | Bacteria | 1791 |
| 1032 | Ga0496101_0297997 | 3300048904 | Bacteria | 1263 |
| 1033 | Ga0496101_0542756 | 3300048904 | Bacteria | 919 |
| 1034 | Ga0496101_0935578 | 3300048904 | Bacteria | 682 |
| 1035 | Ga0496101_1109941 | 3300048904 | Bacteria | 621 |
| 1036 | Ga0496102_0006393 | 3300048905 | Bacteria | 10043 |
| 1037 | Ga0496102_0007158 | 3300048905 | Bacteria | 9524 |
| 1038 | Ga0496102_0031961 | 3300048905 | Bacteria | 4726 |
| 1039 | Ga0496102_0057760 | 3300048905 | Bacteria | 3544 |
| 1040 | Ga0496102_0178118 | 3300048905 | Bacteria | 2002 |
| 1041 | Ga0496102_0433599 | 3300048905 | Unclassified | 1234 |
| 1042 | Ga0496102_0525950 | 3300048905 | Bacteria | 1105 |
| 1043 | Ga0496102_0671417 | 3300048905 | Bacteria | 959 |
| 1044 | Ga0496102_0848720 | 3300048905 | Unclassified | 835 |
| 1045 | Ga0496102_1013955 | 3300048905 | Bacteria | 751 |
| 1046 | Ga0496102_1754552 | 3300048905 | Bacteria | 538 |
| 1047 | Ga0496103_0004333 | 3300048906 | Bacteria | 8618 |
| 1048 | Ga0496103_0098308 | 3300048906 | Bacteria | 1851 |
| 1049 | Ga0496103_0108037 | 3300048906 | Bacteria | 1765 |
| 1050 | Ga0496103_0340335 | 3300048906 | Bacteria | 965 |
| 1051 | Ga0496103_0589067 | 3300048906 | Bacteria | 709 |
| 1052 | Ga0496103_1046432 | 3300048906 | Bacteria | 507 |
| 1053 | Ga0496103_1060481 | 3300048906 | Bacteria | 503 |
| 1054 | Ga0496104_0003577 | 3300048907 | Bacteria | 13415 |
| 1055 | Ga0496104_0057348 | 3300048907 | Bacteria | 3685 |
| 1056 | Ga0496104_0352908 | 3300048907 | Bacteria | 1383 |
| 1057 | Ga0496104_0806886 | 3300048907 | Bacteria | 844 |
| 1058 | Ga0496104_1000512 | 3300048907 | Bacteria | 740 |
| 1059 | Ga0496104_1306538 | 3300048907 | Bacteria | 628 |
| 1060 | Ga0496104_1465912 | 3300048907 | Bacteria | 585 |
| 1061 | Ga0496104_1580963 | 3300048907 | Bacteria | 558 |
| 1062 | Ga0496105_0004361 | 3300048908 | Bacteria | 10651 |
| 1063 | Ga0496105_0007507 | 3300048908 | Bacteria | 8447 |
| 1064 | Ga0496105_0049383 | 3300048908 | Bacteria | 3473 |
| 1065 | Ga0496105_0250894 | 3300048908 | Bacteria | 1434 |
| 1066 | Ga0496105_0880567 | 3300048908 | Bacteria | 676 |
| 1067 | Ga0496105_0922002 | 3300048908 | Bacteria | 657 |
| 1068 | Ga0496105_1274609 | 3300048908 | Bacteria | 538 |
| 1069 | Ga0496106_0004788 | 3300048909 | Bacteria | 10010 |
| 1070 | Ga0496106_0005708 | 3300048909 | Bacteria | 9207 |
| 1071 | Ga0496106_0040068 | 3300048909 | Bacteria | 3507 |
| 1072 | Ga0496106_0068056 | 3300048909 | Bacteria | 2716 |
| 1073 | Ga0496106_0079533 | 3300048909 | Bacteria | 2517 |
| 1074 | Ga0496106_0160808 | 3300048909 | Bacteria | 1776 |
| 1075 | Ga0496106_0923661 | 3300048909 | Bacteria | 688 |
| 1076 | Ga0496107_0002187 | 3300048910 | Bacteria | 12564 |
| 1077 | Ga0496107_0051696 | 3300048910 | Bacteria | 2964 |
| 1078 | Ga0496107_0559746 | 3300048910 | Bacteria | 846 |
| 1079 | Ga0496107_0815262 | 3300048910 | Bacteria | 683 |
| 1080 | Ga0496107_0931149 | 3300048910 | Bacteria | 632 |
| 1081 | Ga0496107_0940025 | 3300048910 | Unclassified | 629 |
| 1082 | Ga0496107_0983477 | 3300048910 | Bacteria | 613 |
| 1083 | Ga0496107_1007004 | 3300048910 | Bacteria | 604 |
| 1084 | Ga0496108_0007095 | 3300048911 | Bacteria | 9073 |
| 1085 | Ga0496108_0047504 | 3300048911 | Bacteria | 3588 |
| 1086 | Ga0496108_0137749 | 3300048911 | Bacteria | 2101 |
| 1087 | Ga0496108_0189520 | 3300048911 | Bacteria | 1782 |
| 1088 | Ga0496108_0666423 | 3300048911 | Bacteria | 904 |
| 1089 | Ga0496108_0769616 | 3300048911 | Bacteria | 832 |
| 1090 | Ga0496108_1180842 | 3300048911 | Bacteria | 648 |
| 1091 | Ga0496109_0004651 | 3300048912 | Bacteria | 11458 |
| 1092 | Ga0496109_0063728 | 3300048912 | Bacteria | 3372 |
| 1093 | Ga0496109_0089321 | 3300048912 | Bacteria | 2848 |
| 1094 | Ga0496109_0360994 | 3300048912 | Bacteria | 1372 |
| 1095 | Ga0496109_0500717 | 3300048912 | Bacteria | 1147 |
| 1096 | Ga0496109_0515177 | 3300048912 | Bacteria | 1129 |
| 1097 | Ga0496109_0518376 | 3300048912 | Bacteria | 1125 |
| 1098 | Ga0496109_0838467 | 3300048912 | Bacteria | 857 |
| 1099 | Ga0496110_0005481 | 3300048913 | Bacteria | 9950 |
| 1100 | Ga0496110_0058749 | 3300048913 | Bacteria | 3387 |
| 1101 | Ga0496110_1629292 | 3300048913 | Bacteria | 555 |
| 1102 | Ga0496111_0005981 | 3300048914 | Bacteria | 7855 |
| 1103 | Ga0496111_0012824 | 3300048914 | Bacteria | 5687 |
| 1104 | Ga0496111_0049942 | 3300048914 | Bacteria | 3016 |
| 1105 | Ga0496111_0052158 | 3300048914 | Bacteria | 2953 |
| 1106 | Ga0496111_0171945 | 3300048914 | Bacteria | 1610 |
| 1107 | Ga0496111_0617552 | 3300048914 | Bacteria | 793 |
| 1108 | Ga0496111_0889356 | 3300048914 | Bacteria | 642 |
| 1109 | Ga0496112_0001450 | 3300048915 | Bacteria | 18215 |
| 1110 | Ga0496112_0006292 | 3300048915 | Bacteria | 10415 |
| 1111 | Ga0496112_0007087 | 3300048915 | Bacteria | 9908 |
| 1112 | Ga0496112_0026743 | 3300048915 | Bacteria | 5558 |
| 1113 | Ga0496112_0082764 | 3300048915 | Bacteria | 3174 |
| 1114 | Ga0496112_0122322 | 3300048915 | Bacteria | 2573 |
| 1115 | Ga0496112_0408848 | 3300048915 | Bacteria | 1296 |
| 1116 | Ga0496112_0733917 | 3300048915 | Bacteria | 914 |
| 1117 | Ga0496112_1549161 | 3300048915 | Bacteria | 576 |
| 1118 | Ga0496113_0017566 | 3300048916 | Bacteria | 4968 |
| 1119 | Ga0496113_0035844 | 3300048916 | Bacteria | 3631 |
| 1120 | Ga0496113_0365991 | 3300048916 | Bacteria | 1157 |
| 1121 | Ga0496113_0404147 | 3300048916 | Bacteria | 1097 |
| 1122 | Ga0496113_0503207 | 3300048916 | Bacteria | 973 |
| 1123 | Ga0496113_0859966 | 3300048916 | Bacteria | 719 |
| 1124 | Ga0496113_0992950 | 3300048916 | Bacteria | 661 |
| 1125 | Ga0496114_0001055 | 3300048917 | Bacteria | 20710 |
| 1126 | Ga0496114_0029665 | 3300048917 | Bacteria | 4498 |
| 1127 | Ga0496114_0103450 | 3300048917 | Bacteria | 2434 |
| 1128 | Ga0496114_0131618 | 3300048917 | Bacteria | 2160 |
| 1129 | Ga0496114_0154317 | 3300048917 | Bacteria | 1993 |
| 1130 | Ga0496114_0194861 | 3300048917 | Bacteria | 1773 |
| 1131 | Ga0496114_0282339 | 3300048917 | Bacteria | 1464 |
| 1132 | Ga0496114_0716559 | 3300048917 | Bacteria | 876 |
| 1133 | Ga0496114_1479363 | 3300048917 | Bacteria | 567 |
| 1134 | Ga0496115_0001930 | 3300048918 | Bacteria | 14798 |
| 1135 | Ga0496115_0004249 | 3300048918 | Bacteria | 10358 |
| 1136 | Ga0496115_0006019 | 3300048918 | Bacteria | 8856 |
| 1137 | Ga0496115_0010743 | 3300048918 | Bacteria | 6848 |
| 1138 | Ga0496115_0338373 | 3300048918 | Bacteria | 1228 |
| 1139 | Ga0496115_0403600 | 3300048918 | Bacteria | 1109 |
| 1140 | Ga0496115_0566482 | 3300048918 | Bacteria | 906 |
| 1141 | Ga0496115_0889896 | 3300048918 | Bacteria | 687 |
| 1142 | Ga0501031_0050828 | 3300049568 | Bacteria | 2699 |
| 1143 | Ga0501031_0806611 | 3300049568 | Bacteria | 602 |
| 1144 | Ga0501032_0123521 | 3300049569 | Bacteria | 1710 |
| 1145 | Ga0501033_0008059 | 3300049570 | Bacteria | 8161 |
| 1146 | Ga0501034_0003184 | 3300049571 | Bacteria | 18882 |
| 1147 | Ga0501034_0165777 | 3300049571 | Bacteria | 2178 |
| 1148 | Ga0501034_1570177 | 3300049571 | Bacteria | 531 |
| 1149 | Ga0501036_0087038 | 3300049572 | Bacteria | 2640 |
| 1150 | Ga0501036_0474920 | 3300049572 | Bacteria | 1041 |
| 1151 | Ga0501037_0112532 | 3300049573 | Bacteria | 1960 |
| 1152 | Ga0501038_0025721 | 3300049574 | Bacteria | 5243 |
| 1153 | Ga0501039_0078300 | 3300049575 | Bacteria | 2571 |
| 1154 | Ga0501040_0001135 | 3300049576 | Bacteria | 16892 |
| 1155 | Ga0501040_0082946 | 3300049576 | Bacteria | 2223 |
| 1156 | Ga0501041_0001531 | 3300049577 | Bacteria | 12843 |
| 1157 | Ga0501041_0508786 | 3300049577 | Bacteria | 766 |
| 1158 | Ga0501042_0000272 | 3300049578 | Bacteria | 25276 |
| 1159 | Ga0501042_0280580 | 3300049578 | Bacteria | 1203 |
| 1160 | Ga0501042_0427750 | 3300049578 | Bacteria | 960 |
| 1161 | Ga0501043_0009705 | 3300049579 | Bacteria | 7542 |
| 1162 | Ga0501046_0000332 | 3300049580 | Bacteria | 47567 |
| 1163 | Ga0501046_0262668 | 3300049580 | Bacteria | 1268 |
| 1164 | Ga0501047_0056333 | 3300049581 | Bacteria | 3801 |
| 1165 | Ga0501047_0142073 | 3300049581 | Bacteria | 2278 |
| 1166 | Ga0501047_0144410 | 3300049581 | Bacteria | 2257 |
| 1167 | Ga0501048_0002707 | 3300049582 | Bacteria | 13520 |
| 1168 | Ga0501048_0687661 | 3300049582 | Bacteria | 734 |
| 1169 | Ga0501048_1338667 | 3300049582 | Bacteria | 515 |
| 1170 | Ga0501067_0003649 | 3300049583 | Bacteria | 8482 |
| 1171 | Ga0501067_0019581 | 3300049583 | Bacteria | 3747 |
| 1172 | Ga0501067_0079231 | 3300049583 | Bacteria | 1820 |
| 1173 | Ga0501067_0126918 | 3300049583 | Bacteria | 1419 |
| 1174 | Ga0501067_0285938 | 3300049583 | Bacteria | 918 |
| 1175 | Ga0501067_0339722 | 3300049583 | Bacteria | 837 |
| 1176 | Ga0501067_0444786 | 3300049583 | Unclassified | 724 |
| 1177 | Ga0501068_0012786 | 3300049584 | Bacteria | 4765 |
| 1178 | Ga0501068_0031718 | 3300049584 | Bacteria | 3139 |
| 1179 | Ga0501068_0054832 | 3300049584 | Bacteria | 2415 |
| 1180 | Ga0501068_0147597 | 3300049584 | Bacteria | 1477 |
| 1181 | Ga0501068_0241486 | 3300049584 | Bacteria | 1150 |
| 1182 | Ga0501069_0001571 | 3300049585 | Bacteria | 11282 |
| 1183 | Ga0501069_0005861 | 3300049585 | Bacteria | 6400 |
| 1184 | Ga0501069_0292651 | 3300049585 | Bacteria | 954 |
| 1185 | Ga0501069_0506863 | 3300049585 | Bacteria | 720 |
| 1186 | Ga0501070_0003206 | 3300049586 | Bacteria | 14226 |
| 1187 | Ga0501070_0026105 | 3300049586 | Bacteria | 4901 |
| 1188 | Ga0501070_0130801 | 3300049586 | Bacteria | 2073 |
| 1189 | Ga0501070_0646376 | 3300049586 | Bacteria | 840 |
| 1190 | Ga0501070_0652662 | 3300049586 | Bacteria | 835 |
| 1191 | Ga0501070_1234740 | 3300049586 | Bacteria | 572 |
| 1192 | Ga0501071_0021673 | 3300049587 | Bacteria | 4477 |
| 1193 | Ga0501072_0015423 | 3300049588 | Bacteria | 5857 |
| 1194 | Ga0501072_1248360 | 3300049588 | Unclassified | 577 |
| 1195 | Ga0501073_0029751 | 3300049589 | Bacteria | 3903 |
| 1196 | Ga0501073_0641869 | 3300049589 | Bacteria | 733 |
| 1197 | Ga0501073_0722196 | 3300049589 | Bacteria | 687 |
| 1198 | Ga0501074_0020747 | 3300049590 | Bacteria | 4772 |
| 1199 | Ga0501074_0118067 | 3300049590 | Bacteria | 1897 |
| 1200 | Ga0501074_0144407 | 3300049590 | Bacteria | 1702 |
| 1201 | Ga0501074_0278737 | 3300049590 | Bacteria | 1189 |
| 1202 | Ga0501075_0000659 | 3300049591 | Bacteria | 21228 |
| 1203 | Ga0501075_0359962 | 3300049591 | Bacteria | 1109 |
| 1204 | Ga0501075_0596221 | 3300049591 | Bacteria | 843 |
| 1205 | Ga0501076_0021198 | 3300049592 | Bacteria | 4982 |
| 1206 | Ga0501077_0001904 | 3300049593 | Bacteria | 12632 |
| 1207 | Ga0501077_0015838 | 3300049593 | Bacteria | 4748 |
| 1208 | Ga0501077_0625336 | 3300049593 | Bacteria | 692 |
| 1209 | Ga0501077_0902230 | 3300049593 | Bacteria | 569 |
| 1210 | Ga0501079_0000155 | 3300049741 | Bacteria | 37452 |
| 1211 | Ga0501079_0189066 | 3300049741 | Bacteria | 1607 |
| 1212 | Ga0501079_0271555 | 3300049741 | Bacteria | 1325 |
| 1213 | Ga0501079_0322998 | 3300049741 | Bacteria | 1208 |
| 1214 | Ga0501079_1174093 | 3300049741 | Bacteria | 605 |
| 1215 | Ga0501079_1410411 | 3300049741 | Bacteria | 548 |
| 1216 | Ga0501080_0108130 | 3300049742 | Bacteria | 2577 |
| 1217 | Ga0501080_0251007 | 3300049742 | Bacteria | 1613 |
| 1218 | Ga0501080_0316989 | 3300049742 | Bacteria | 1412 |
| 1219 | Ga0501080_0410527 | 3300049742 | Bacteria | 1217 |
| 1220 | Ga0501080_0479998 | 3300049742 | Bacteria | 1112 |
| 1221 | Ga0501081_0001472 | 3300049743 | Bacteria | 14434 |
| 1222 | Ga0501081_0671814 | 3300049743 | Bacteria | 777 |
| 1223 | Ga0501083_0011793 | 3300049744 | Bacteria | 6124 |
| 1224 | Ga0501083_0339079 | 3300049744 | Bacteria | 977 |
| 1225 | Ga0501035_0118007 | 3300049822 | Bacteria | 2321 |
| 1226 | Ga0501035_0181960 | 3300049822 | Bacteria | 1811 |
| 1227 | Ga0501044_0044757 | 3300049823 | Bacteria | 4590 |
| 1228 | Ga0501044_0161865 | 3300049823 | Bacteria | 2214 |
| 1229 | Ga0501044_0507847 | 3300049823 | Bacteria | 1106 |
| 1230 | Ga0501044_1541266 | 3300049823 | Bacteria | 529 |
| 1231 | Ga0501045_0007803 | 3300049824 | Bacteria | 7443 |
| 1232 | Ga0501045_0637527 | 3300049824 | Bacteria | 788 |
| 1233 | nmdc:mga05p37_1620566_c1 | 3300050507 | Bacteria | 636 |
| 1234 | nmdc:mga05p37_477167_c1 | 3300050507 | Bacteria | 1437 |
| 1235 | nmdc:mga05p37_733747_c1 | 3300050507 | Bacteria | 1092 |
| 1236 | nmdc:mga09592_500346_c1 | 3300050508 | Bacteria | 1046 |
| 1237 | nmdc:mga06r32_1312490_c1 | 3300050510 | Bacteria | 667 |
| 1238 | nmdc:mga08y16_1681672_c1 | 3300050511 | Bacteria | 590 |
| 1239 | nmdc:mga08y16_1881800_c1 | 3300050511 | Bacteria | 550 |
| 1240 | nmdc:mga0n895_4747_c1 | 3300050512 | Bacteria | 11229 |
| 1241 | nmdc:mga0n895_66521_c1 | 3300050512 | Bacteria | 3569 |
| 1242 | nmdc:mga0n895_668399_c1 | 3300050512 | Bacteria | 1036 |
| 1243 | nmdc:mga0rr50_1643075_c1 | 3300050513 | Bacteria | 542 |
| 1244 | nmdc:mga0rr50_726841_c1 | 3300050513 | Bacteria | 847 |
| 1245 | nmdc:mga0rr50_8707_c1 | 3300050513 | Bacteria | 6328 |
| 1246 | nmdc:mga08x19_396731_c1 | 3300050514 | Bacteria | 967 |
| 1247 | nmdc:mga08x19_649826_c1 | 3300050514 | Bacteria | 748 |
| 1248 | Ga0495601_0042101 | 3300053077 | Bacteria | 2864 |
| 1249 | Ga0495601_0215016 | 3300053077 | Bacteria | 1255 |
| 1250 | Ga0495601_0417007 | 3300053077 | Unclassified | 870 |
| 1251 | Ga0495601_0543994 | 3300053077 | Unclassified | 747 |
| 1252 | Ga0495601_0754697 | 3300053077 | Bacteria | 619 |
| 1253 | Ga0495612_0267715 | 3300053078 | Bacteria | 762 |
| 1254 | Ga0495612_0276073 | 3300053078 | Bacteria | 750 |
| 1255 | Ga0495655_0243725 | 3300053083 | Bacteria | 602 |
| 1256 | Ga0495595_0024188 | 3300053084 | Bacteria | 2681 |
| 1257 | Ga0495595_0030992 | 3300053084 | Bacteria | 2401 |
| 1258 | Ga0495595_0075809 | 3300053084 | Bacteria | 1596 |
| 1259 | Ga0495595_0180356 | 3300053084 | Unclassified | 1047 |
| 1260 | Ga0495595_0499210 | 3300053084 | Bacteria | 620 |
| 1261 | Ga0495619_0010424 | 3300053085 | Bacteria | 5848 |
| 1262 | Ga0495619_0039047 | 3300053085 | Bacteria | 3098 |
| 1263 | Ga0495619_0050697 | 3300053085 | Bacteria | 2741 |
| 1264 | Ga0495619_0057461 | 3300053085 | Bacteria | 2582 |
| 1265 | Ga0495619_0266138 | 3300053085 | Bacteria | 1188 |
| 1266 | Ga0501084_0006129 | 3300054114 | Bacteria | 9883 |
| 1267 | Ga0501084_0166479 | 3300054114 | Bacteria | 1860 |
| 1268 | Ga0501084_1726385 | 3300054114 | Bacteria | 523 |
| 1269 | Ga0590074_018569 | 3300059423 | Bacteria | 1190 |
| 1270 | Ga0590075_042453 | 3300059424 | Bacteria | 1163 |
| 1271 | Ga0590077_053736 | 3300059426 | Bacteria | 907 |
| 1272 | Ga0587066_097148 | 3300059490 | Bacteria | 664 |
| 1273 | Ga0587066_135608 | 3300059490 | Bacteria | 596 |
| 1274 | Ga0587070_114187 | 3300059491 | Bacteria | 638 |
| 1275 | Ga0587080_151380 | 3300059503 | Bacteria | 538 |
| 1276 | Ga0587083_0196014 | 3300059505 | Bacteria | 574 |
| 1277 | Ga0587083_0283845 | 3300059505 | Bacteria | 505 |
| 1278 | Ga0587089_052123 | 3300059509 | Bacteria | 659 |
| 1279 | Ga0587091_123006 | 3300059511 | Bacteria | 632 |
| 1280 | Ga0587098_034432 | 3300059604 | Bacteria | 712 |
| 1281 | Ga0587106_083877 | 3300059605 | Bacteria | 625 |
| 1282 | Ga0587115_111974 | 3300059626 | Bacteria | 517 |
| 1283 | Ga0587067_095615 | 3300059640 | Bacteria | 680 |
| 1284 | Ga0587114_080424 | 3300059655 | Bacteria | 605 |
| 1285 | Ga0587111_0160298 | 3300060346 | Bacteria | 611 |
| 1286 | Ga0501082_0000480 | 3300060353 | Bacteria | 35259 |
| 1287 | Ga0501082_0524157 | 3300060353 | Unclassified | 1036 |
| 1288 | Ga0501082_0619069 | 3300060353 | Bacteria | 947 |
| 1289 | Ga0466962_0488780 | 3300061719 | Bacteria | 622 |
| 1290 | Ga0530510_0000230 | 3300061734 | Bacteria | 34995 |
| 1291 | Ga0530510_0073196 | 3300061734 | Bacteria | 2487 |
| 1292 | Ga0530510_0116202 | 3300061734 | Bacteria | 1961 |
| 1293 | Ga0070658_11003768 | |||
| 1294 | JGI24737J22298_10192572 | |||
| 1295 | JGI24743J22301_10119710 | |||
| 1296 | Ga0058863_10058229 | |||
| 1297 | Ga0070658_10159250 | |||
| 1298 | Ga0070658_10378361 | |||
| 1299 | Ga0070658_11238415 | |||
| 1300 | Ga0070676_10121968 | |||
| 1301 | Ga0070683_100004462 | |||
| 1302 | Ga0070683_100065117 | |||
| 1303 | Ga0070683_100160124 | |||
| 1304 | Ga0070683_100196034 | |||
| 1305 | Ga0070683_100414338 | |||
| 1306 | Ga0070683_100444207 | |||
| 1307 | Ga0070683_100445415 | |||
| 1308 | Ga0070690_100071641 | |||
| 1309 | Ga0070670_100343018 | |||
| 1310 | Ga0070670_100429998 | |||
| 1311 | Ga0068869_100060026 | |||
| 1312 | Ga0068869_100070985 | |||
| 1313 | Ga0068869_100140466 | |||
| 1314 | Ga0070666_10158979 | |||
| 1315 | Ga0070680_100060097 | |||
| 1316 | Ga0070680_100112057 | |||
| 1317 | Ga0070680_100139899 | |||
| 1318 | Ga0070682_100014416 | |||
| 1319 | Ga0070682_100137438 | |||
| 1320 | Ga0070682_100684036 | |||
| 1321 | Ga0070682_100765564 | |||
| 1322 | Ga0068868_100076587 | |||
| 1323 | Ga0068868_100087772 | |||
| 1324 | Ga0068868_100099234 | |||
| 1325 | Ga0068868_101384345 | |||
| 1326 | Ga0070660_100008187 | |||
| 1327 | Ga0070660_100100458 | |||
| 1328 | Ga0070660_100254230 | |||
| 1329 | Ga0070660_101301863 | |||
| 1330 | Ga0070689_100072495 | |||
| 1331 | Ga0070691_10118420 | |||
| 1332 | Ga0070691_10996327 | |||
| 1333 | Ga0070687_100867805 | |||
| 1334 | Ga0070661_100006256 | |||
| 1335 | Ga0070661_100006849 | |||
| 1336 | Ga0070661_100309189 | |||
| 1337 | Ga0070661_100537834 | |||
| 1338 | Ga0070661_100999972 | |||
| 1339 | Ga0070661_101595747 | |||
| 1340 | Ga0070692_10026063 | |||
| 1341 | Ga0070692_10088380 | |||
| 1342 | Ga0070692_10168062 | |||
| 1343 | Ga0070668_100177452 | |||
| 1344 | Ga0070668_100248601 | |||
| 1345 | Ga0070668_100383945 | |||
| 1346 | Ga0070675_102139345 | |||
| 1347 | Ga0070671_100366415 | |||
| 1348 | Ga0070671_100372968 | |||
| 1349 | Ga0070671_101450758 | |||
| 1350 | Ga0070674_100019333 | |||
| 1351 | Ga0070674_100111213 | |||
| 1352 | Ga0070674_100854502 | |||
| 1353 | Ga0070674_101824461 | |||
| 1354 | Ga0070673_100120177 | |||
| 1355 | Ga0070688_100069583 | |||
| 1356 | Ga0070688_100397045 | |||
| 1357 | Ga0070659_100011282 | |||
| 1358 | Ga0070659_100183843 | |||
| 1359 | Ga0070659_102110098 | |||
| 1360 | Ga0070667_100011225 | |||
| 1361 | Ga0070667_101041637 | |||
| 1362 | Ga0070703_10622931 | |||
| 1363 | Ga0070709_10049444 | |||
| 1364 | Ga0070709_10451344 | |||
| 1365 | Ga0070709_10602919 | |||
| 1366 | Ga0070714_100042327 | |||
| 1367 | Ga0070714_100089193 | |||
| 1368 | Ga0070714_100177169 | |||
| 1369 | Ga0070714_100187934 | |||
| 1370 | Ga0070714_100605272 | |||
| 1371 | Ga0070714_100954282 | |||
| 1372 | Ga0070714_102188542 | |||
| 1373 | Ga0070713_100170141 | |||
| 1374 | Ga0070713_100465035 | |||
| 1375 | Ga0070713_101248067 | |||
| 1376 | Ga0070713_101753198 | |||
| 1377 | Ga0070710_10265355 | |||
| 1378 | Ga0070710_10291344 | |||
| 1379 | Ga0070710_10664933 | |||
| 1380 | Ga0070701_10078474 | |||
| 1381 | Ga0070701_10625996 | |||
| 1382 | Ga0070711_100023255 | |||
| 1383 | Ga0070711_100324185 | |||
| 1384 | Ga0070711_100573418 | |||
| 1385 | Ga0070705_100060215 | |||
| 1386 | Ga0070705_100165974 | |||
| 1387 | Ga0070705_100940423 | |||
| 1388 | Ga0070700_100014010 | |||
| 1389 | Ga0070700_100139140 | |||
| 1390 | Ga0070700_100226097 | |||
| 1391 | Ga0070700_100511664 | |||
| 1392 | Ga0070700_100695566 | |||
| 1393 | Ga0070694_100187759 | |||
| 1394 | Ga0070694_100251665 | |||
| 1395 | Ga0070708_100404878 | |||
| 1396 | Ga0070708_100448762 | |||
| 1397 | Ga0070663_100950492 | |||
| 1398 | Ga0070678_100112177 | |||
| 1399 | Ga0070678_100193775 | |||
| 1400 | Ga0070678_102148742 | |||
| 1401 | Ga0070662_100025198 | |||
| 1402 | Ga0070662_100214645 | |||
| 1403 | Ga0070662_100589825 | |||
| 1404 | Ga0070681_10008490 | |||
| 1405 | Ga0070681_10028181 | |||
| 1406 | Ga0070681_10082635 | |||
| 1407 | Ga0070681_10164785 | |||
| 1408 | Ga0070681_10385188 | |||
| 1409 | Ga0070681_10415779 | |||
| 1410 | Ga0070681_10518753 | |||
| 1411 | Ga0070681_10764746 | |||
| 1412 | Ga0070681_11218242 | |||
| 1413 | Ga0068867_100074108 | |||
| 1414 | Ga0068867_100267918 | |||
| 1415 | Ga0068867_100839017 | |||
| 1416 | Ga0068867_101833788 | |||
| 1417 | Ga0070685_10141590 | |||
| 1418 | Ga0070685_10683379 | |||
| 1419 | Ga0070706_101818259 | |||
| 1420 | Ga0070707_100356451 | |||
| 1421 | Ga0070707_100380634 | |||
| 1422 | Ga0070707_100734394 | |||
| 1423 | Ga0070698_101264799 | |||
| 1424 | Ga0070698_101521464 | |||
| 1425 | Ga0070699_100076728 | |||
| 1426 | Ga0070699_101842392 | |||
| 1427 | Ga0070679_100087848 | |||
| 1428 | Ga0070679_100231236 | |||
| 1429 | Ga0070679_100264560 | |||
| 1430 | Ga0070679_100360245 | |||
| 1431 | Ga0070679_100882778 | |||
| 1432 | Ga0070679_101104596 | |||
| 1433 | Ga0070679_101126090 | |||
| 1434 | Ga0070684_100002170 | |||
| 1435 | Ga0070684_100021741 | |||
| 1436 | Ga0070684_100078043 | |||
| 1437 | Ga0070684_100079373 | |||
| 1438 | Ga0070684_100081483 | |||
| 1439 | Ga0070684_100164503 | |||
| 1440 | Ga0070684_100210153 | |||
| 1441 | Ga0070684_100662989 | |||
| 1442 | Ga0070684_100698363 | |||
| 1443 | Ga0070684_101067416 | |||
| 1444 | Ga0070697_100576121 | |||
| 1445 | Ga0068853_100153385 | |||
| 1446 | Ga0068853_100916406 | |||
| 1447 | Ga0068853_101007999 | |||
| 1448 | Ga0068853_101870338 | |||
| 1449 | Ga0070672_100236932 | |||
| 1450 | Ga0070672_100901697 | |||
| 1451 | Ga0070672_100932875 | |||
| 1452 | Ga0070672_102048240 | |||
| 1453 | Ga0070686_100189089 | |||
| 1454 | Ga0070686_100239196 | |||
| 1455 | Ga0070695_100086659 | |||
| 1456 | Ga0070695_100902824 | |||
| 1457 | Ga0070696_100020757 | |||
| 1458 | Ga0070696_100040965 | |||
| 1459 | Ga0070696_101225514 | |||
| 1460 | Ga0070693_100271341 | |||
| 1461 | Ga0070693_100358776 | |||
| 1462 | Ga0070693_100579939 | |||
| 1463 | Ga0070665_100080403 | |||
| 1464 | Ga0070665_100165863 | |||
| 1465 | Ga0070665_100648382 | |||
| 1466 | Ga0070665_100993107 | |||
| 1467 | Ga0070665_101930054 | |||
| 1468 | Ga0070704_100251462 | |||
| 1469 | Ga0070704_100392047 | |||
| 1470 | Ga0070704_100482764 | |||
| 1471 | Ga0068855_100013130 | |||
| 1472 | Ga0068855_100050398 | |||
| 1473 | Ga0068855_100197764 | |||
| 1474 | Ga0068855_100254597 | |||
| 1475 | Ga0068855_100259944 | |||
| 1476 | Ga0070664_100151734 | |||
| 1477 | Ga0070664_100153355 | |||
| 1478 | Ga0070664_100219932 | |||
| 1479 | Ga0070664_100238562 | |||
| 1480 | Ga0070664_100391494 | |||
| 1481 | Ga0068857_100010678 | |||
| 1482 | Ga0068857_100012513 | |||
| 1483 | Ga0068857_100333895 | |||
| 1484 | Ga0068854_100010961 | |||
| 1485 | Ga0068854_100125699 | |||
| 1486 | Ga0068854_100341720 | |||
| 1487 | Ga0068854_100483893 | |||
| 1488 | Ga0068854_101772660 | |||
| 1489 | Ga0068856_100004589 | |||
| 1490 | Ga0068856_100095955 | |||
| 1491 | Ga0068856_100112742 | |||
| 1492 | Ga0068856_100114678 | |||
| 1493 | Ga0068856_100123757 | |||
| 1494 | Ga0068856_102634467 | |||
| 1495 | Ga0070702_100012351 | |||
| 1496 | Ga0070702_100022944 | |||
| 1497 | Ga0070702_100470994 | |||
| 1498 | Ga0068852_100154748 | |||
| 1499 | Ga0068852_100929244 | |||
| 1500 | Ga0068852_100967286 | |||
| 1501 | Ga0068852_101087536 | |||
| 1502 | Ga0068859_100117675 | |||
| 1503 | Ga0068859_102342801 | |||
| 1504 | Ga0068864_100952251 | |||
| 1505 | Ga0068864_101175673 | |||
| 1506 | Ga0068864_101648924 | |||
| 1507 | Ga0068866_10100930 | |||
| 1508 | Ga0068866_11129362 | |||
| 1509 | Ga0068861_100122029 | |||
| 1510 | Ga0068861_100238572 | |||
| 1511 | Ga0068861_100279508 | |||
| 1512 | Ga0068851_10057190 | |||
| 1513 | Ga0068851_10224728 | |||
| 1514 | Ga0068851_10250658 | |||
| 1515 | Ga0068870_10415491 | |||
| 1516 | Ga0068860_100446102 | |||
| 1517 | Ga0068862_100205883 | |||
| 1518 | Ga0068862_100447871 | |||
| 1519 | Ga0081455_10066708 | |||
| 1520 | Ga0081455_10189118 | |||
| 1521 | Ga0081538_10000059 | |||
| 1522 | Ga0081538_10000939 | |||
| 1523 | Ga0081538_10077190 | |||
| 1524 | Ga0081540_1026636 | |||
| 1525 | Ga0081539_10379186 | |||
| 1526 | Ga0070717_10147548 | |||
| 1527 | Ga0070717_10248460 | |||
| 1528 | Ga0070717_11320423 | |||
| 1529 | Ga0070715_10055696 | |||
| 1530 | Ga0070715_10132645 | |||
| 1531 | Ga0070715_10729701 | |||
| 1532 | Ga0070715_10935378 | |||
| 1533 | Ga0070716_100199601 | |||
| 1534 | Ga0070716_101527192 | |||
| 1535 | Ga0070712_100011180 | |||
| 1536 | Ga0070712_100085921 | |||
| 1537 | Ga0070712_100266530 | |||
| 1538 | Ga0070712_100371263 | |||
| 1539 | Ga0070712_100564039 | |||
| 1540 | Ga0070712_100577247 | |||
| 1541 | Ga0070712_100769640 | |||
| 1542 | Ga0070712_100986707 | |||
| 1543 | Ga0097621_100100370 | |||
| 1544 | Ga0097621_100658093 | |||
| 1545 | Ga0097621_101094956 | |||
| 1546 | Ga0068871_100137505 | |||
| 1547 | Ga0068871_100146961 | |||
| 1548 | Ga0068871_101010560 | |||
| 1549 | Ga0068871_101862541 | |||
| 1550 | Ga0075428_101352357 | |||
| 1551 | Ga0075428_101525106 | |||
| 1552 | Ga0075428_101948730 | |||
| 1553 | Ga0075433_10096866 | |||
| 1554 | Ga0075433_10139122 | |||
| 1555 | Ga0075433_10384546 | |||
| 1556 | Ga0075433_10823519 | |||
| 1557 | Ga0075434_100000288 | |||
| 1558 | Ga0075434_100018510 | |||
| 1559 | Ga0068865_100166347 | |||
| 1560 | Ga0068865_100799563 | |||
| 1561 | Ga0068865_100973441 | |||
| 1562 | Ga0068865_102050855 | |||
| 1563 | Ga0075436_100371622 | |||
| 1564 | Ga0075436_101159067 | |||
| 1565 | Ga0097620_100117671 | |||
| 1566 | Ga0097620_102342873 | |||
| 1567 | Ga0075435_100009347 | |||
| 1568 | Ga0075435_100154157 | |||
| 1569 | Ga0075435_101557192 | |||
| 1570 | Ga0075435_101638165 | |||
| 1571 | Ga0105240_10168799 | |||
| 1572 | Ga0105240_10201527 | |||
| 1573 | Ga0105240_10523857 | |||
| 1574 | Ga0105240_10793271 | |||
| 1575 | Ga0105240_12592786 | |||
| 1576 | Ga0111539_10992705 | |||
| 1577 | Ga0111539_12491529 | |||
| 1578 | Ga0111539_12629029 | |||
| 1579 | Ga0105245_10010505 | |||
| 1580 | Ga0105245_10020014 | |||
| 1581 | Ga0105245_10066479 | |||
| 1582 | Ga0105245_10143417 | |||
| 1583 | Ga0105245_10191096 | |||
| 1584 | Ga0105245_10379343 | |||
| 1585 | Ga0105245_12258927 | |||
| 1586 | Ga0105247_10328782 | |||
| 1587 | Ga0105247_11332197 | |||
| 1588 | Ga0114129_10034735 | |||
| 1589 | Ga0114129_10938849 | |||
| 1590 | Ga0105243_10063297 | |||
| 1591 | Ga0105243_10129765 | |||
| 1592 | Ga0105243_10145258 | |||
| 1593 | Ga0105243_10157670 | |||
| 1594 | Ga0105243_10207412 | |||
| 1595 | Ga0105241_10232388 | |||
| 1596 | Ga0105241_10261041 | |||
| 1597 | Ga0105241_10288667 | |||
| 1598 | Ga0105241_10851554 | |||
| 1599 | Ga0105242_10124875 | |||
| 1600 | Ga0105242_10143075 | |||
| 1601 | Ga0105242_10300165 | |||
| 1602 | Ga0105242_10585861 | |||
| 1603 | Ga0105242_11731854 | |||
| 1604 | Ga0105248_10153320 | |||
| 1605 | Ga0105248_10386125 | |||
| 1606 | Ga0105237_10065849 | |||
| 1607 | Ga0105237_10275223 | |||
| 1608 | Ga0105237_10913145 | |||
| 1609 | Ga0105238_10016816 | |||
| 1610 | Ga0105238_10024093 | |||
| 1611 | Ga0105238_10029238 | |||
| 1612 | Ga0105238_12048181 | |||
| 1613 | Ga0105238_12769955 | |||
| 1614 | Ga0105249_10053640 | |||
| 1615 | Ga0105249_10082731 | |||
| 1616 | Ga0105249_10332080 | |||
| 1617 | Ga0105239_10047172 | |||
| 1618 | Ga0105239_10165256 | |||
| 1619 | Ga0105239_10328527 | |||
| 1620 | Ga0105239_10878736 | |||
| 1621 | Ga0105239_12394770 | |||
| 1622 | Ga0105246_10229334 | |||
| 1623 | Ga0105246_10235425 | |||
| 1624 | Ga0157345_1045955 | |||
| 1625 | Ga0154010_111657 | |||
| 1626 | Ga0157373_10029236 | |||
| 1627 | Ga0157373_10996037 | |||
| 1628 | Ga0157371_10996725 | |||
| 1629 | Ga0157370_10040599 | |||
| 1630 | Ga0157370_10111956 | |||
| 1631 | Ga0157370_10294487 | |||
| 1632 | Ga0157370_10619521 | |||
| 1633 | Ga0157370_10982301 | |||
| 1634 | Ga0157370_11354339 | |||
| 1635 | Ga0157369_10006129 | |||
| 1636 | Ga0157369_10017337 | |||
| 1637 | Ga0157369_10018632 | |||
| 1638 | Ga0157369_10037075 | |||
| 1639 | Ga0157369_10059365 | |||
| 1640 | Ga0157369_10103686 | |||
| 1641 | Ga0157369_10267871 | |||
| 1642 | Ga0157369_10438866 | |||
| 1643 | Ga0157369_10771483 | |||
| 1644 | Ga0157369_12549769 | |||
| 1645 | Ga0157374_10043473 | |||
| 1646 | Ga0157374_10244845 | |||
| 1647 | Ga0157374_10478435 | |||
| 1648 | Ga0157374_10492826 | |||
| 1649 | Ga0157374_10647685 | |||
| 1650 | Ga0157374_10834835 | |||
| 1651 | Ga0157374_11379835 | |||
| 1652 | Ga0157374_12521948 | |||
| 1653 | Ga0157378_10684821 | |||
| 1654 | Ga0157378_11081783 | |||
| 1655 | Ga0157378_13054342 | |||
| 1656 | Ga0163162_10065811 | |||
| 1657 | Ga0163162_10147565 | |||
| 1658 | Ga0163162_10425474 | |||
| 1659 | Ga0163162_10512933 | |||
| 1660 | Ga0163162_11041298 | |||
| 1661 | Ga0157372_10016430 | |||
| 1662 | Ga0157372_10067351 | |||
| 1663 | Ga0157372_10069442 | |||
| 1664 | Ga0157372_10102553 | |||
| 1665 | Ga0157372_10301713 | |||
| 1666 | Ga0157372_11849121 | |||
| 1667 | Ga0157372_12274164 | |||
| 1668 | Ga0157375_10394539 | |||
| 1669 | Ga0157375_10523633 | |||
| 1670 | Ga0157375_10686347 | |||
| 1671 | Ga0163163_10005491 | |||
| 1672 | Ga0163163_12209976 | |||
| 1673 | Ga0157380_10326743 | |||
| 1674 | Ga0157380_10968685 | |||
| 1675 | Ga0157380_11716452 | |||
| 1676 | Ga0157377_10000811 | |||
| 1677 | Ga0157377_10883623 | |||
| 1678 | Ga0157379_10119216 | |||
| 1679 | Ga0157376_10012411 | |||
| 1680 | Ga0157376_10109890 | |||
| 1681 | Ga0157376_10216561 | |||
| 1682 | Ga0157376_10439367 | |||
| 1683 | Ga0157376_12627093 | |||
| 1684 | Ga0182006_1166591 | |||
| 1685 | Ga0197907_10272433 | |||
| 1686 | Ga0197907_10520340 | |||
| 1687 | Ga0197907_10540602 | |||
| 1688 | Ga0206356_10002683 | |||
| 1689 | Ga0206356_10142702 | |||
| 1690 | Ga0206356_10915817 | |||
| 1691 | Ga0206356_11241351 | |||
| 1692 | Ga0206356_11889777 | |||
| 1693 | Ga0206356_11906180 | |||
| 1694 | Ga0206355_1150212 | |||
| 1695 | Ga0206352_10568934 | |||
| 1696 | Ga0206350_10432168 | |||
| 1697 | Ga0206350_10517347 | |||
| 1698 | Ga0206350_10827546 | |||
| 1699 | Ga0206350_11491362 | |||
| 1700 | Ga0206354_10323697 | |||
| 1701 | Ga0206353_10260902 | |||
| 1702 | Ga0206353_10311011 | |||
| 1703 | Ga0206353_11315790 | |||
| 1704 | Ga0213873_10100442 | |||
| 1705 | Ga0224712_10046400 | |||
| 1706 | Ga0224712_10125171 | |||
| 1707 | Ga0224712_10141618 | |||
| 1708 | Ga0224712_10178621 | |||
| 1709 | Ga0224712_10275539 | |||
| 1710 | Ga0224712_10336736 | |||
| 1711 | Ga0224712_10365394 | |||
| 1712 | Ga0207697_10265251 | |||
| 1713 | Ga0207656_10188603 | |||
| 1714 | Ga0207653_10388320 | |||
| 1715 | Ga0207692_10112452 | |||
| 1716 | Ga0207692_10461573 | |||
| 1717 | Ga0207692_10628970 | |||
| 1718 | Ga0207692_11217474 | |||
| 1719 | Ga0207642_10019598 | |||
| 1720 | Ga0207642_10051877 | |||
| 1721 | Ga0207710_10149755 | |||
| 1722 | Ga0207688_10039319 | |||
| 1723 | Ga0207688_10089851 | |||
| 1724 | Ga0207688_10101483 | |||
| 1725 | Ga0207680_10034303 | |||
| 1726 | Ga0207647_10137924 | |||
| 1727 | Ga0207685_10102907 | |||
| 1728 | Ga0207685_10524243 | |||
| 1729 | Ga0207685_10577360 | |||
| 1730 | Ga0207699_10016150 | |||
| 1731 | Ga0207699_10222621 | |||
| 1732 | Ga0207645_10387589 | |||
| 1733 | Ga0207645_10447812 | |||
| 1734 | Ga0207643_10124032 | |||
| 1735 | Ga0207705_10045265 | |||
| 1736 | Ga0207705_10049149 | |||
| 1737 | Ga0207705_10169123 | |||
| 1738 | Ga0207705_10657734 | |||
| 1739 | Ga0207684_11071152 | |||
| 1740 | Ga0207654_10126066 | |||
| 1741 | Ga0207654_10280082 | |||
| 1742 | Ga0207654_10494570 | |||
| 1743 | Ga0207654_10943099 | |||
| 1744 | Ga0207707_10002473 | |||
| 1745 | Ga0207707_10023064 | |||
| 1746 | Ga0207707_10094470 | |||
| 1747 | Ga0207707_10128466 | |||
| 1748 | Ga0207707_10176916 | |||
| 1749 | Ga0207707_10184948 | |||
| 1750 | Ga0207707_10306361 | |||
| 1751 | Ga0207695_10276705 | |||
| 1752 | Ga0207695_10510539 | |||
| 1753 | Ga0207695_10708641 | |||
| 1754 | Ga0207671_10212941 | |||
| 1755 | Ga0207671_10268542 | |||
| 1756 | Ga0207671_10305684 | |||
| 1757 | Ga0207693_10006129 | |||
| 1758 | Ga0207693_10025865 | |||
| 1759 | Ga0207693_10044783 | |||
| 1760 | Ga0207693_10074077 | |||
| 1761 | Ga0207693_10204051 | |||
| 1762 | Ga0207693_10403358 | |||
| 1763 | Ga0207693_10638075 | |||
| 1764 | Ga0207663_10025472 | |||
| 1765 | Ga0207663_10287232 | |||
| 1766 | Ga0207663_10345354 | |||
| 1767 | Ga0207660_10008507 | |||
| 1768 | Ga0207660_10075618 | |||
| 1769 | Ga0207660_10098807 | |||
| 1770 | Ga0207660_11126474 | |||
| 1771 | Ga0207662_10032222 | |||
| 1772 | Ga0207657_10019359 | |||
| 1773 | Ga0207657_10033039 | |||
| 1774 | Ga0207657_10105190 | |||
| 1775 | Ga0207657_10216334 | |||
| 1776 | Ga0207657_10415502 | |||
| 1777 | Ga0207649_10177829 | |||
| 1778 | Ga0207649_10284283 | |||
| 1779 | Ga0207649_10397061 | |||
| 1780 | Ga0207649_11615809 | |||
| 1781 | Ga0207652_10067465 | |||
| 1782 | Ga0207652_10241497 | |||
| 1783 | Ga0207652_10262084 | |||
| 1784 | Ga0207652_10588360 | |||
| 1785 | Ga0207652_10914696 | |||
| 1786 | Ga0207646_10187358 | |||
| 1787 | Ga0207646_10337993 | |||
| 1788 | Ga0207646_10398279 | |||
| 1789 | Ga0207646_10644175 | |||
| 1790 | Ga0207681_10191033 | |||
| 1791 | Ga0207694_10102874 | |||
| 1792 | Ga0207694_10124866 | |||
| 1793 | Ga0207694_10198717 | |||
| 1794 | Ga0207650_10524621 | |||
| 1795 | Ga0207650_10926864 | |||
| 1796 | Ga0207659_11646523 | |||
| 1797 | Ga0207687_10003687 | |||
| 1798 | Ga0207687_10004292 | |||
| 1799 | Ga0207687_10013761 | |||
| 1800 | Ga0207687_10031947 | |||
| 1801 | Ga0207687_10298609 | |||
| 1802 | Ga0207700_10496362 | |||
| 1803 | Ga0207700_11192616 | |||
| 1804 | Ga0207700_11276402 | |||
| 1805 | Ga0207700_11355393 | |||
| 1806 | Ga0207700_11464177 | |||
| 1807 | Ga0207664_10118764 | |||
| 1808 | Ga0207664_10140364 | |||
| 1809 | Ga0207664_10167829 | |||
| 1810 | Ga0207664_10199711 | |||
| 1811 | Ga0207664_10271932 | |||
| 1812 | Ga0207664_10462616 | |||
| 1813 | Ga0207664_11647957 | |||
| 1814 | Ga0207664_11794616 | |||
| 1815 | Ga0207644_10115487 | |||
| 1816 | Ga0207644_10121456 | |||
| 1817 | Ga0207644_11671426 | |||
| 1818 | Ga0207690_10012160 | |||
| 1819 | Ga0207690_10050575 | |||
| 1820 | Ga0207690_10070800 | |||
| 1821 | Ga0207706_10194609 | |||
| 1822 | Ga0207706_10345534 | |||
| 1823 | Ga0207706_11516764 | |||
| 1824 | Ga0207709_10058973 | |||
| 1825 | Ga0207709_10102752 | |||
| 1826 | Ga0207709_10415859 | |||
| 1827 | Ga0207709_10446687 | |||
| 1828 | Ga0207669_10010168 | |||
| 1829 | Ga0207669_10145783 | |||
| 1830 | Ga0207669_10421050 | |||
| 1831 | Ga0207669_10472729 | |||
| 1832 | Ga0207704_10020469 | |||
| 1833 | Ga0207704_10518636 | |||
| 1834 | Ga0207704_10817461 | |||
| 1835 | Ga0207704_11287902 | |||
| 1836 | Ga0207665_10213942 | |||
| 1837 | Ga0207665_10915058 | |||
| 1838 | Ga0207691_10322435 | |||
| 1839 | Ga0207691_10804414 | |||
| 1840 | Ga0207711_10369982 | |||
| 1841 | Ga0207711_11673813 | |||
| 1842 | Ga0207689_10032246 | |||
| 1843 | Ga0207689_10051166 | |||
| 1844 | Ga0207661_10017694 | |||
| 1845 | Ga0207661_10027657 | |||
| 1846 | Ga0207661_10101307 | |||
| 1847 | Ga0207661_10214956 | |||
| 1848 | Ga0207661_10439909 | |||
| 1849 | Ga0207661_10490526 | |||
| 1850 | Ga0207661_10795976 | |||
| 1851 | Ga0207661_10811701 | |||
| 1852 | Ga0207661_10903207 | |||
| 1853 | Ga0207661_10991166 | |||
| 1854 | Ga0207661_11076974 | |||
| 1855 | Ga0207679_10191835 | |||
| 1856 | Ga0207679_10259310 | |||
| 1857 | Ga0207667_10024089 | |||
| 1858 | Ga0207667_10063012 | |||
| 1859 | Ga0207667_10078675 | |||
| 1860 | Ga0207667_10080330 | |||
| 1861 | Ga0207667_10613458 | |||
| 1862 | Ga0207667_11039917 | |||
| 1863 | Ga0207667_11938835 | |||
| 1864 | Ga0207651_10152349 | |||
| 1865 | Ga0207651_10596858 | |||
| 1866 | Ga0207712_10241330 | |||
| 1867 | Ga0207712_10348099 | |||
| 1868 | Ga0207668_10098892 | |||
| 1869 | Ga0207640_10051928 | |||
| 1870 | Ga0207640_10107500 | |||
| 1871 | Ga0207640_10768400 | |||
| 1872 | Ga0207640_11380948 | |||
| 1873 | Ga0207640_11748610 | |||
| 1874 | Ga0207658_10003886 | |||
| 1875 | Ga0207658_11297012 | |||
| 1876 | Ga0207658_11500641 | |||
| 1877 | Ga0207677_10010576 | |||
| 1878 | Ga0207677_10432945 | |||
| 1879 | Ga0207677_10457699 | |||
| 1880 | Ga0207677_10635272 | |||
| 1881 | Ga0207677_11392620 | |||
| 1882 | Ga0207703_10052430 | |||
| 1883 | Ga0207639_10108692 | |||
| 1884 | Ga0207639_10141253 | |||
| 1885 | Ga0207639_10278971 | |||
| 1886 | Ga0207639_10925941 | |||
| 1887 | Ga0207639_11896082 | |||
| 1888 | Ga0207678_10154748 | |||
| 1889 | Ga0207678_10195549 | |||
| 1890 | Ga0207678_10831595 | |||
| 1891 | Ga0207678_11171405 | |||
| 1892 | Ga0207708_10004675 | |||
| 1893 | Ga0207708_10045109 | |||
| 1894 | Ga0207708_10859500 | |||
| 1895 | Ga0207708_11514145 | |||
| 1896 | Ga0207708_12003123 | |||
| 1897 | Ga0207702_10008420 | |||
| 1898 | Ga0207702_10070367 | |||
| 1899 | Ga0207702_10179603 | |||
| 1900 | Ga0207702_10237286 | |||
| 1901 | Ga0207702_10796681 | |||
| 1902 | Ga0207648_10036192 | |||
| 1903 | Ga0207648_10069681 | |||
| 1904 | Ga0207676_10431708 | |||
| 1905 | Ga0207676_10941329 | |||
| 1906 | Ga0207676_11141198 | |||
| 1907 | Ga0207674_10004135 | |||
| 1908 | Ga0207674_10009602 | |||
| 1909 | Ga0207674_10024193 | |||
| 1910 | Ga0207674_10072348 | |||
| 1911 | Ga0207674_10084616 | |||
| 1912 | Ga0207674_11079527 | |||
| 1913 | Ga0207675_100004546 | |||
| 1914 | Ga0207675_100020968 | |||
| 1915 | Ga0207675_100360851 | |||
| 1916 | Ga0207683_10005639 | |||
| 1917 | Ga0207683_10111906 | |||
| 1918 | Ga0207683_10436745 | |||
| 1919 | Ga0207683_11065943 | |||
| 1920 | Ga0207683_11329015 | |||
| 1921 | Ga0207698_10092693 | |||
| 1922 | Ga0207698_10860151 | |||
| 1923 | Ga0207698_11204396 | |||
| 1924 | Ga0207698_11346523 | |||
| 1925 | Ga0209966_1052986 | |||
| 1926 | Ga0209974_10196561 | |||
| 1927 | Ga0207428_10386307 | |||
| 1928 | Ga0268266_10093454 | |||
| 1929 | Ga0268266_10632639 | |||
| 1930 | Ga0268265_10212127 | |||
| 1931 | Ga0268265_12038097 | |||
| 1932 | Ga0268265_12632724 | |||
| 1933 | Ga0268264_10458896 | |||
| 1934 | Ga0268264_10605819 | |||
| 1935 | Ga0268264_11630368 | |||
| 1936 | Ga0268264_11805915 | |||
| 1937 | Ga0265338_10053011 | |||
| 1938 | Ga0265338_10081986 | |||
| 1939 | Ga0265338_10360334 | |||
| 1940 | Ga0265328_10046362 | |||
| 1941 | Ga0265327_10005348 | |||
| 1942 | Ga0265327_10025102 | |||
| 1943 | Ga0265327_10043117 | |||
| 1944 | Ga0307408_100731485 | |||
| 1945 | Ga0265313_10365476 | |||
| 1946 | Ga0307405_11409823 | |||
| 1947 | Ga0307412_10713555 | |||
| 1948 | Ga0307409_100428292 | |||
| 1949 | Ga0307415_100980212 | |||
| 1950 | Ga0373948_0143803 | |||
| 1951 | Ga0373926_0033608 | |||
| 1952 | Ga0373928_0112888 | |||
| 1953 | Ga0373934_0053026 | |||
| 1954 | Ga0373944_0005822 | |||
| 1955 | Ga0373944_0029250 | |||
| 1956 | Ga0373944_0094392 | |||
| 1957 | Ga0373944_0187308 | |||
| 1958 | Ga0373949_0026207 | |||
| 1959 | Ga0373923_0027686 | |||
| 1960 | Ga0373923_0126032 | |||
| 1961 | Ga0373936_0004255 | |||
| 1962 | Ga0373945_0005048 | |||
| 1963 | Ga0373945_0005353 | |||
| 1964 | Ga0373945_0124517 | |||
| 1965 | Ga0373954_0274243 | |||
| 1966 | Ga0373943_0000948 | |||
| 1967 | Ga0373943_0005005 | |||
| 1968 | Ga0373943_0029909 | |||
| 1969 | Ga0373943_0091068 | |||
| 1970 | Ga0373943_0921681 | |||
| 1971 | Ga0373946_0028313 | |||
| 1972 | Ga0373946_0034334 | |||
| 1973 | Ga0373946_0049788 | |||
| 1974 | Ga0373955_0081204 | |||
| 1975 | Ga0373961_0407873 | |||
| 1976 | Ga0373962_0069989 | |||
| 1977 | Ga0373924_0304370 | |||
| 1978 | Ga0373931_0851639 | |||
| 1979 | Ga0373931_1211222 | |||
| 1980 | Ga0373935_0020566 | |||
| 1981 | Ga0373935_0039711 | |||
| 1982 | Ga0373935_0092235 | |||
| 1983 | Ga0373935_0133805 | |||
| 1984 | Ga0373935_0703428 | |||
| 1985 | Ga0373927_0013935 | |||
| 1986 | Ga0373927_0188986 | |||
| 1987 | Ga0373927_0703717 | |||
| 1988 | Ga0373933_0053922 | |||
| 1989 | Ga0373947_0003156 | |||
| 1990 | Ga0373947_0011478 | |||
| 1991 | Ga0373947_0020606 | |||
| 1992 | Ga0373947_0032831 | |||
| 1993 | Ga0373947_0629307 | |||
| 1994 | Ga0373937_0242408 | |||
| 1995 | Ga0373937_0288184 | |||
| 1996 | Ga0373937_0575187 | |||
| 1997 | Ga0373925_0013684 | |||
| 1998 | Ga0373925_0055953 | |||
| 1999 | Ga0373925_0590428 | |||
| 2000 | Ga0373925_0709030 | |||
| 2001 | Ga0395899_0000857 | |||
| 2002 | Ga0395899_0022381 | |||
| 2003 | Ga0395899_0286300 | |||
| 2004 | Ga0395899_0489570 | |||
| 2005 | Ga0395900_0006983 | |||
| 2006 | Ga0395900_0008169 | |||
| 2007 | Ga0395900_0026920 | |||
| 2008 | Ga0395900_0052733 | |||
| 2009 | Ga0395900_0120580 | |||
| 2010 | Ga0395900_0146384 | |||
| 2011 | Ga0395900_0176437 | |||
| 2012 | Ga0395900_0232975 | |||
| 2013 | Ga0395900_0258735 | |||
| 2014 | Ga0395900_0284944 | |||
| 2015 | Ga0395900_0343602 | |||
| 2016 | Ga0395900_0568862 | |||
| 2017 | Ga0395900_1874177 | |||
| 2018 | Ga0395898_0001107 | |||
| 2019 | Ga0395898_0003086 | |||
| 2020 | Ga0395898_0026599 | |||
| 2021 | Ga0395898_0041591 | |||
| 2022 | Ga0395898_0077048 | |||
| 2023 | Ga0395898_0083596 | |||
| 2024 | Ga0395898_0120968 | |||
| 2025 | Ga0395898_0137249 | |||
| 2026 | Ga0395898_1468889 | |||
| 2027 | Ga0395898_1623872 | |||
| 2028 | Ga0395905_0006650 | |||
| 2029 | Ga0395905_0028323 | |||
| 2030 | Ga0395905_0090864 | |||
| 2031 | Ga0395905_0228732 | |||
| 2032 | Ga0395905_0412021 | |||
| 2033 | Ga0395905_0549727 | |||
| 2034 | Ga0395905_0601511 | |||
| 2035 | Ga0395905_1476474 | |||
| 2036 | Ga0395901_0009580 | |||
| 2037 | Ga0395901_0010735 | |||
| 2038 | Ga0395901_0014827 | |||
| 2039 | Ga0395901_0032782 | |||
| 2040 | Ga0395901_0033026 | |||
| 2041 | Ga0395901_0057261 | |||
| 2042 | Ga0395901_0081453 | |||
| 2043 | Ga0395901_0190919 | |||
| 2044 | Ga0395901_0587348 | |||
| 2045 | Ga0395901_0618580 | |||
| 2046 | Ga0395901_0622690 | |||
| 2047 | Ga0395901_0722601 | |||
| 2048 | Ga0395901_0818168 | |||
| 2049 | Ga0395901_1612657 | |||
| 2050 | Ga0436365_0081418 | |||
| 2051 | Ga0436361_0951993 | |||
| 2052 | Ga0436363_1216359 | |||
| 2053 | Ga0436363_1436042 | |||
| 2054 | Ga0436362_0307992 | |||
| 2055 | Ga0436362_0511863 | |||
| 2056 | Ga0451789_0948195 | |||
| 2057 | Ga0451835_0360775 | |||
| 2058 | Ga0451837_0243006 | |||
| 2059 | Ga0451839_0578465 | |||
| 2060 | Ga0451839_0601551 | |||
| 2061 | Ga0451853_2386811 | |||
| 2062 | Ga0451853_2929055 | |||
| 2063 | Ga0451853_4020500 | |||
| 2064 | Ga0439448_0079382 | |||
| 2065 | Ga0439450_142461 | |||
| 2066 | Ga0439456_124799 | |||
| 2067 | Ga0439462_0039407 | |||
| 2068 | Ga0450907_024247 | |||
| 2069 | Ga0439458_0185125 | |||
| 2070 | Ga0439440_0180680 | |||
| 2071 | Ga0466969_0347538 | |||
| 2072 | Ga0466965_0232828 | |||
| 2073 | Ga0466966_0021194 | |||
| 2074 | Ga0466966_0026087 | |||
| 2075 | Ga0466966_0053244 | |||
| 2076 | Ga0466966_0195067 | |||
| 2077 | Ga0466961_0020291 | |||
| 2078 | Ga0466961_0140784 | |||
| 2079 | Ga0466961_0262862 | |||
| 2080 | Ga0466961_0323221 | |||
| 2081 | Ga0466963_0016292 | |||
| 2082 | Ga0466963_0017022 | |||
| 2083 | Ga0466963_0037220 | |||
| 2084 | Ga0466963_0084841 | |||
| 2085 | Ga0466963_0154898 | |||
| 2086 | Ga0466963_0221103 | |||
| 2087 | Ga0466963_0381511 | |||
| 2088 | Ga0466963_0430999 | |||
| 2089 | Ga0466963_0566640 | |||
| 2090 | Ga0466963_1273424 | |||
| 2091 | Ga0466964_0004892 | |||
| 2092 | Ga0466964_0008108 | |||
| 2093 | Ga0466964_0054372 | |||
| 2094 | Ga0466964_0825009 | |||
| 2095 | Ga0466971_0103752 | |||
| 2096 | Ga0466971_0479954 | |||
| 2097 | Ga0466968_0005563 | |||
| 2098 | Ga0466968_0120121 | |||
| 2099 | Ga0466968_0373812 | |||
| 2100 | Ga0466970_0024022 | |||
| 2101 | Ga0466957_0216887 | |||
| 2102 | Ga0466957_0670521 | |||
| 2103 | Ga0466957_1126591 | |||
| 2104 | Ga0466960_0251774 | |||
| 2105 | Ga0466959_0014461 | |||
| 2106 | Ga0466959_0084559 | |||
| 2107 | Ga0466959_0629943 | |||
| 2108 | Ga0451576_0143068 | |||
| 2109 | Ga0451576_1644379 | |||
| 2110 | Ga0451576_2157330 | |||
| 2111 | Ga0466958_0016073 | |||
| 2112 | Ga0466958_0021158 | |||
| 2113 | Ga0466958_0125161 | |||
| 2114 | Ga0466958_0157298 | |||
| 2115 | Ga0466958_0223615 | |||
| 2116 | Ga0466958_0794382 | |||
| 2117 | Ga0466967_0002964 | |||
| 2118 | Ga0466967_0003721 | |||
| 2119 | Ga0466967_0018586 | |||
| 2120 | Ga0466967_0021070 | |||
| 2121 | Ga0466967_0024277 | |||
| 2122 | Ga0466967_0080388 | |||
| 2123 | Ga0466967_0120948 | |||
| 2124 | Ga0466967_0132870 | |||
| 2125 | Ga0466967_0151283 | |||
| 2126 | Ga0466967_0203962 | |||
| 2127 | Ga0466967_0355216 | |||
| 2128 | Ga0466967_0361058 | |||
| 2129 | Ga0466967_0703727 | |||
| 2130 | Ga0466967_2593790 | |||
| 2131 | Ga0495592_0081801 | |||
| 2132 | Ga0495592_0227232 | |||
| 2133 | Ga0495592_0279435 | |||
| 2134 | Ga0495603_0017920 | |||
| 2135 | Ga0495603_0140061 | |||
| 2136 | Ga0495603_0370571 | |||
| 2137 | Ga0495629_0009258 | |||
| 2138 | Ga0495629_0020903 | |||
| 2139 | Ga0495629_0052145 | |||
| 2140 | Ga0495629_0100124 | |||
| 2141 | Ga0495629_0171740 | |||
| 2142 | Ga0495629_0264958 | |||
| 2143 | Ga0495629_0410323 | |||
| 2144 | Ga0495629_1030761 | |||
| 2145 | Ga0495641_0000793 | |||
| 2146 | Ga0495641_0013263 | |||
| 2147 | Ga0495641_0017097 | |||
| 2148 | Ga0495641_0041713 | |||
| 2149 | Ga0495641_0082519 | |||
| 2150 | Ga0495641_0227177 | |||
| 2151 | Ga0495651_0023372 | |||
| 2152 | Ga0495651_0039755 | |||
| 2153 | Ga0495651_0113961 | |||
| 2154 | Ga0495651_0620115 | |||
| 2155 | Ga0495651_0774996 | |||
| 2156 | Ga0495653_0056093 | |||
| 2157 | Ga0495653_0383379 | |||
| 2158 | Ga0495653_0520910 | |||
| 2159 | Ga0495580_0026424 | |||
| 2160 | Ga0495580_0101146 | |||
| 2161 | Ga0495580_0985033 | |||
| 2162 | Ga0495582_0003686 | |||
| 2163 | Ga0495582_0004168 | |||
| 2164 | Ga0495582_0033145 | |||
| 2165 | Ga0495582_0055842 | |||
| 2166 | Ga0495582_0093913 | |||
| 2167 | Ga0495639_0002486 | |||
| 2168 | Ga0495639_0019251 | |||
| 2169 | Ga0495639_0095558 | |||
| 2170 | Ga0495662_0003248 | |||
| 2171 | Ga0495662_0005102 | |||
| 2172 | Ga0495662_0061974 | |||
| 2173 | Ga0495662_0272122 | |||
| 2174 | Ga0495664_0018878 | |||
| 2175 | Ga0495664_0067639 | |||
| 2176 | Ga0495594_0017126 | |||
| 2177 | Ga0495594_0281453 | |||
| 2178 | Ga0495594_0466104 | |||
| 2179 | Ga0495596_0407787 | |||
| 2180 | Ga0495608_0010163 | |||
| 2181 | Ga0495608_0021288 | |||
| 2182 | Ga0495608_0316661 | |||
| 2183 | Ga0495618_0210702 | |||
| 2184 | Ga0495618_0463724 | |||
| 2185 | Ga0495618_0624252 | |||
| 2186 | Ga0495618_0765979 | |||
| 2187 | Ga0495628_0387188 | |||
| 2188 | Ga0495628_1061886 | |||
| 2189 | Ga0495630_0003748 | |||
| 2190 | Ga0495630_0089179 | |||
| 2191 | Ga0495630_0166820 | |||
| 2192 | Ga0495630_0271651 | |||
| 2193 | Ga0495630_0769723 | |||
| 2194 | Ga0495630_0769790 | |||
| 2195 | Ga0495630_1115974 | |||
| 2196 | Ga0495630_1126812 | |||
| 2197 | Ga0495666_0009556 | |||
| 2198 | Ga0495666_0032459 | |||
| 2199 | Ga0495652_0043940 | |||
| 2200 | Ga0495652_0169334 | |||
| 2201 | Ga0495652_0238105 | |||
| 2202 | Ga0495652_0596574 | |||
| 2203 | Ga0495652_0969412 | |||
| 2204 | Ga0495665_0001332 | |||
| 2205 | Ga0495665_0004084 | |||
| 2206 | Ga0495665_0201757 | |||
| 2207 | Ga0495665_0367695 | |||
| 2208 | Ga0495640_0027400 | |||
| 2209 | Ga0495640_0063043 | |||
| 2210 | Ga0495640_0320308 | |||
| 2211 | Ga0495586_0086592 | |||
| 2212 | Ga0495586_0202095 | |||
| 2213 | Ga0495586_0801874 | |||
| 2214 | Ga0495587_0033023 | |||
| 2215 | Ga0495587_0834915 | |||
| 2216 | Ga0495645_0029351 | |||
| 2217 | Ga0495645_0115284 | |||
| 2218 | Ga0495645_0435634 | |||
| 2219 | Ga0495667_0006114 | |||
| 2220 | Ga0495667_0013391 | |||
| 2221 | Ga0495667_0025494 | |||
| 2222 | Ga0495667_0072648 | |||
| 2223 | Ga0495634_0028676 | |||
| 2224 | Ga0495634_0034982 | |||
| 2225 | Ga0495634_0056253 | |||
| 2226 | Ga0495634_0445671 | |||
| 2227 | Ga0495634_0771572 | |||
| 2228 | Ga0495635_0011984 | |||
| 2229 | Ga0495635_0045493 | |||
| 2230 | Ga0495635_0301828 | |||
| 2231 | Ga0495588_0017324 | |||
| 2232 | Ga0495588_0494800 | |||
| 2233 | Ga0495588_0508335 | |||
| 2234 | Ga0495657_0012099 | |||
| 2235 | Ga0495657_0064273 | |||
| 2236 | Ga0495657_0392136 | |||
| 2237 | Ga0495657_0601870 | |||
| 2238 | Ga0495599_0130705 | |||
| 2239 | Ga0495599_0820827 | |||
| 2240 | Ga0495599_0895370 | |||
| 2241 | Ga0495646_0080992 | |||
| 2242 | Ga0495646_0276236 | |||
| 2243 | Ga0495647_0002012 | |||
| 2244 | Ga0495647_0003805 | |||
| 2245 | Ga0495647_0254878 | |||
| 2246 | Ga0495658_0000379 | |||
| 2247 | Ga0495658_0011720 | |||
| 2248 | Ga0495658_0024560 | |||
| 2249 | Ga0495658_0088213 | |||
| 2250 | Ga0495658_0555003 | |||
| 2251 | Ga0495658_1088822 | |||
| 2252 | Ga0495613_0001753 | |||
| 2253 | Ga0495613_0013003 | |||
| 2254 | Ga0495613_0403886 | |||
| 2255 | Ga0495613_0603580 | |||
| 2256 | Ga0495613_0724424 | |||
| 2257 | Ga0495613_0736660 | |||
| 2258 | Ga0495613_1049164 | |||
| 2259 | Ga0495624_0015742 | |||
| 2260 | Ga0495624_0205909 | |||
| 2261 | Ga0495624_0264618 | |||
| 2262 | Ga0495624_0328108 | |||
| 2263 | Ga0495624_0489836 | |||
| 2264 | Ga0495624_0534403 | |||
| 2265 | Ga0495600_0008198 | |||
| 2266 | Ga0495600_0042616 | |||
| 2267 | Ga0495600_0052274 | |||
| 2268 | Ga0495600_0289085 | |||
| 2269 | Ga0495600_0856731 | |||
| 2270 | Ga0495600_0890680 | |||
| 2271 | Ga0495581_0002043 | |||
| 2272 | Ga0495581_0005670 | |||
| 2273 | Ga0495581_0195302 | |||
| 2274 | Ga0495581_0864114 | |||
| 2275 | Ga0495604_0065911 | |||
| 2276 | Ga0495604_0068890 | |||
| 2277 | Ga0495604_0176181 | |||
| 2278 | Ga0495604_0337720 | |||
| 2279 | Ga0495604_0922598 | |||
| 2280 | Ga0495674_0000944 | |||
| 2281 | Ga0495674_0034090 | |||
| 2282 | Ga0495674_0039755 | |||
| 2283 | Ga0495674_0126250 | |||
| 2284 | Ga0495674_0230014 | |||
| 2285 | Ga0495674_0398048 | |||
| 2286 | Ga0495674_0641062 | |||
| 2287 | Ga0495676_0002172 | |||
| 2288 | Ga0495676_0043365 | |||
| 2289 | Ga0495676_0052135 | |||
| 2290 | Ga0495676_0082881 | |||
| 2291 | Ga0495680_0000491 | |||
| 2292 | Ga0495680_0050186 | |||
| 2293 | Ga0495680_0127060 | |||
| 2294 | Ga0495680_0167091 | |||
| 2295 | Ga0495680_0321908 | |||
| 2296 | Ga0495680_0510562 | |||
| 2297 | Ga0495680_0622641 | |||
| 2298 | Ga0495675_0140167 | |||
| 2299 | Ga0495675_0377835 | |||
| 2300 | Ga0495684_0005173 | |||
| 2301 | Ga0495593_0010191 | |||
| 2302 | Ga0495593_0019130 | |||
| 2303 | Ga0495593_0149968 | |||
| 2304 | Ga0495602_0054170 | |||
| 2305 | Ga0495602_0070809 | |||
| 2306 | Ga0495602_0197369 | |||
| 2307 | Ga0495602_0261909 | |||
| 2308 | Ga0495614_0007391 | |||
| 2309 | Ga0495614_0050939 | |||
| 2310 | Ga0495614_0482077 | |||
| 2311 | Ga0495614_0621487 | |||
| 2312 | Ga0496100_0014411 | |||
| 2313 | Ga0496100_0015773 | |||
| 2314 | Ga0496100_0076332 | |||
| 2315 | Ga0496100_0087868 | |||
| 2316 | Ga0496100_0268500 | |||
| 2317 | Ga0496101_0002875 | |||
| 2318 | Ga0496101_0018591 | |||
| 2319 | Ga0496101_0024995 | |||
| 2320 | Ga0496101_0027032 | |||
| 2321 | Ga0496101_0038693 | |||
| 2322 | Ga0496101_0047663 | |||
| 2323 | Ga0496101_0148534 | |||
| 2324 | Ga0496101_0297997 | |||
| 2325 | Ga0496101_0542756 | |||
| 2326 | Ga0496101_0935578 | |||
| 2327 | Ga0496101_1109941 | |||
| 2328 | Ga0496102_0006393 | |||
| 2329 | Ga0496102_0007158 | |||
| 2330 | Ga0496102_0031961 | |||
| 2331 | Ga0496102_0057760 | |||
| 2332 | Ga0496102_0178118 | |||
| 2333 | Ga0496102_0433599 | |||
| 2334 | Ga0496102_0525950 | |||
| 2335 | Ga0496102_0671417 | |||
| 2336 | Ga0496102_0848720 | |||
| 2337 | Ga0496102_1013955 | |||
| 2338 | Ga0496102_1754552 | |||
| 2339 | Ga0496103_0004333 | |||
| 2340 | Ga0496103_0098308 | |||
| 2341 | Ga0496103_0108037 | |||
| 2342 | Ga0496103_0340335 | |||
| 2343 | Ga0496103_0589067 | |||
| 2344 | Ga0496103_1046432 | |||
| 2345 | Ga0496103_1060481 | |||
| 2346 | Ga0496104_0003577 | |||
| 2347 | Ga0496104_0057348 | |||
| 2348 | Ga0496104_0352908 | |||
| 2349 | Ga0496104_0806886 | |||
| 2350 | Ga0496104_1000512 | |||
| 2351 | Ga0496104_1306538 | |||
| 2352 | Ga0496104_1465912 | |||
| 2353 | Ga0496104_1580963 | |||
| 2354 | Ga0496105_0004361 | |||
| 2355 | Ga0496105_0007507 | |||
| 2356 | Ga0496105_0049383 | |||
| 2357 | Ga0496105_0250894 | |||
| 2358 | Ga0496105_0880567 | |||
| 2359 | Ga0496105_0922002 | |||
| 2360 | Ga0496105_1274609 | |||
| 2361 | Ga0496106_0004788 | |||
| 2362 | Ga0496106_0005708 | |||
| 2363 | Ga0496106_0040068 | |||
| 2364 | Ga0496106_0068056 | |||
| 2365 | Ga0496106_0079533 | |||
| 2366 | Ga0496106_0160808 | |||
| 2367 | Ga0496106_0923661 | |||
| 2368 | Ga0496107_0002187 | |||
| 2369 | Ga0496107_0051696 | |||
| 2370 | Ga0496107_0559746 | |||
| 2371 | Ga0496107_0815262 | |||
| 2372 | Ga0496107_0931149 | |||
| 2373 | Ga0496107_0940025 | |||
| 2374 | Ga0496107_0983477 | |||
| 2375 | Ga0496107_1007004 | |||
| 2376 | Ga0496108_0007095 | |||
| 2377 | Ga0496108_0047504 | |||
| 2378 | Ga0496108_0137749 | |||
| 2379 | Ga0496108_0189520 | |||
| 2380 | Ga0496108_0666423 | |||
| 2381 | Ga0496108_0769616 | |||
| 2382 | Ga0496108_1180842 | |||
| 2383 | Ga0496109_0004651 | |||
| 2384 | Ga0496109_0063728 | |||
| 2385 | Ga0496109_0089321 | |||
| 2386 | Ga0496109_0360994 | |||
| 2387 | Ga0496109_0500717 | |||
| 2388 | Ga0496109_0515177 | |||
| 2389 | Ga0496109_0518376 | |||
| 2390 | Ga0496109_0838467 | |||
| 2391 | Ga0496110_0005481 | |||
| 2392 | Ga0496110_0058749 | |||
| 2393 | Ga0496110_1629292 | |||
| 2394 | Ga0496111_0005981 | |||
| 2395 | Ga0496111_0012824 | |||
| 2396 | Ga0496111_0049942 | |||
| 2397 | Ga0496111_0052158 | |||
| 2398 | Ga0496111_0171945 | |||
| 2399 | Ga0496111_0617552 | |||
| 2400 | Ga0496111_0889356 | |||
| 2401 | Ga0496112_0001450 | |||
| 2402 | Ga0496112_0006292 | |||
| 2403 | Ga0496112_0007087 | |||
| 2404 | Ga0496112_0026743 | |||
| 2405 | Ga0496112_0082764 | |||
| 2406 | Ga0496112_0122322 | |||
| 2407 | Ga0496112_0408848 | |||
| 2408 | Ga0496112_0733917 | |||
| 2409 | Ga0496112_1549161 | |||
| 2410 | Ga0496113_0017566 | |||
| 2411 | Ga0496113_0035844 | |||
| 2412 | Ga0496113_0365991 | |||
| 2413 | Ga0496113_0404147 | |||
| 2414 | Ga0496113_0503207 | |||
| 2415 | Ga0496113_0859966 | |||
| 2416 | Ga0496113_0992950 | |||
| 2417 | Ga0496114_0001055 | |||
| 2418 | Ga0496114_0029665 | |||
| 2419 | Ga0496114_0103450 | |||
| 2420 | Ga0496114_0131618 | |||
| 2421 | Ga0496114_0154317 | |||
| 2422 | Ga0496114_0194861 | |||
| 2423 | Ga0496114_0282339 | |||
| 2424 | Ga0496114_0716559 | |||
| 2425 | Ga0496114_1479363 | |||
| 2426 | Ga0496115_0001930 | |||
| 2427 | Ga0496115_0004249 | |||
| 2428 | Ga0496115_0006019 | |||
| 2429 | Ga0496115_0010743 | |||
| 2430 | Ga0496115_0338373 | |||
| 2431 | Ga0496115_0403600 | |||
| 2432 | Ga0496115_0566482 | |||
| 2433 | Ga0496115_0889896 | |||
| 2434 | Ga0501031_0050828 | |||
| 2435 | Ga0501031_0806611 | |||
| 2436 | Ga0501032_0123521 | |||
| 2437 | Ga0501033_0008059 | |||
| 2438 | Ga0501034_0003184 | |||
| 2439 | Ga0501034_0165777 | |||
| 2440 | Ga0501034_1570177 | |||
| 2441 | Ga0501036_0087038 | |||
| 2442 | Ga0501036_0474920 | |||
| 2443 | Ga0501037_0112532 | |||
| 2444 | Ga0501038_0025721 | |||
| 2445 | Ga0501039_0078300 | |||
| 2446 | Ga0501040_0001135 | |||
| 2447 | Ga0501040_0082946 | |||
| 2448 | Ga0501041_0001531 | |||
| 2449 | Ga0501041_0508786 | |||
| 2450 | Ga0501042_0000272 | |||
| 2451 | Ga0501042_0280580 | |||
| 2452 | Ga0501042_0427750 | |||
| 2453 | Ga0501043_0009705 | |||
| 2454 | Ga0501046_0000332 | |||
| 2455 | Ga0501046_0262668 | |||
| 2456 | Ga0501047_0056333 | |||
| 2457 | Ga0501047_0142073 | |||
| 2458 | Ga0501047_0144410 | |||
| 2459 | Ga0501048_0002707 | |||
| 2460 | Ga0501048_0687661 | |||
| 2461 | Ga0501048_1338667 | |||
| 2462 | Ga0501067_0003649 | |||
| 2463 | Ga0501067_0019581 | |||
| 2464 | Ga0501067_0079231 | |||
| 2465 | Ga0501067_0126918 | |||
| 2466 | Ga0501067_0285938 | |||
| 2467 | Ga0501067_0339722 | |||
| 2468 | Ga0501067_0444786 | |||
| 2469 | Ga0501068_0012786 | |||
| 2470 | Ga0501068_0031718 | |||
| 2471 | Ga0501068_0054832 | |||
| 2472 | Ga0501068_0147597 | |||
| 2473 | Ga0501068_0241486 | |||
| 2474 | Ga0501069_0001571 | |||
| 2475 | Ga0501069_0005861 | |||
| 2476 | Ga0501069_0292651 | |||
| 2477 | Ga0501069_0506863 | |||
| 2478 | Ga0501070_0003206 | |||
| 2479 | Ga0501070_0026105 | |||
| 2480 | Ga0501070_0130801 | |||
| 2481 | Ga0501070_0646376 | |||
| 2482 | Ga0501070_0652662 | |||
| 2483 | Ga0501070_1234740 | |||
| 2484 | Ga0501071_0021673 | |||
| 2485 | Ga0501072_0015423 | |||
| 2486 | Ga0501072_1248360 | |||
| 2487 | Ga0501073_0029751 | |||
| 2488 | Ga0501073_0641869 | |||
| 2489 | Ga0501073_0722196 | |||
| 2490 | Ga0501074_0020747 | |||
| 2491 | Ga0501074_0118067 | |||
| 2492 | Ga0501074_0144407 | |||
| 2493 | Ga0501074_0278737 | |||
| 2494 | Ga0501075_0000659 | |||
| 2495 | Ga0501075_0359962 | |||
| 2496 | Ga0501075_0596221 | |||
| 2497 | Ga0501076_0021198 | |||
| 2498 | Ga0501077_0001904 | |||
| 2499 | Ga0501077_0015838 | |||
| 2500 | Ga0501077_0625336 | |||
| 2501 | Ga0501077_0902230 | |||
| 2502 | Ga0501079_0000155 | |||
| 2503 | Ga0501079_0189066 | |||
| 2504 | Ga0501079_0271555 | |||
| 2505 | Ga0501079_0322998 | |||
| 2506 | Ga0501079_1174093 | |||
| 2507 | Ga0501079_1410411 | |||
| 2508 | Ga0501080_0108130 | |||
| 2509 | Ga0501080_0251007 | |||
| 2510 | Ga0501080_0316989 | |||
| 2511 | Ga0501080_0410527 | |||
| 2512 | Ga0501080_0479998 | |||
| 2513 | Ga0501081_0001472 | |||
| 2514 | Ga0501081_0671814 | |||
| 2515 | Ga0501083_0011793 | |||
| 2516 | Ga0501083_0339079 | |||
| 2517 | Ga0501035_0118007 | |||
| 2518 | Ga0501035_0181960 | |||
| 2519 | Ga0501044_0044757 | |||
| 2520 | Ga0501044_0161865 | |||
| 2521 | Ga0501044_0507847 | |||
| 2522 | Ga0501044_1541266 | |||
| 2523 | Ga0501045_0007803 | |||
| 2524 | Ga0501045_0637527 | |||
| 2525 | nmdc:mga05p37_1620566_c1 | |||
| 2526 | nmdc:mga05p37_477167_c1 | |||
| 2527 | nmdc:mga05p37_733747_c1 | |||
| 2528 | nmdc:mga09592_500346_c1 | |||
| 2529 | nmdc:mga06r32_1312490_c1 | |||
| 2530 | nmdc:mga08y16_1681672_c1 | |||
| 2531 | nmdc:mga08y16_1881800_c1 | |||
| 2532 | nmdc:mga0n895_4747_c1 | |||
| 2533 | nmdc:mga0n895_66521_c1 | |||
| 2534 | nmdc:mga0n895_668399_c1 | |||
| 2535 | nmdc:mga0rr50_1643075_c1 | |||
| 2536 | nmdc:mga0rr50_726841_c1 | |||
| 2537 | nmdc:mga0rr50_8707_c1 | |||
| 2538 | nmdc:mga08x19_396731_c1 | |||
| 2539 | nmdc:mga08x19_649826_c1 | |||
| 2540 | Ga0495601_0042101 | |||
| 2541 | Ga0495601_0215016 | |||
| 2542 | Ga0495601_0417007 | |||
| 2543 | Ga0495601_0543994 | |||
| 2544 | Ga0495601_0754697 | |||
| 2545 | Ga0495612_0267715 | |||
| 2546 | Ga0495612_0276073 | |||
| 2547 | Ga0495655_0243725 | |||
| 2548 | Ga0495595_0024188 | |||
| 2549 | Ga0495595_0030992 | |||
| 2550 | Ga0495595_0075809 | |||
| 2551 | Ga0495595_0180356 | |||
| 2552 | Ga0495595_0499210 | |||
| 2553 | Ga0495619_0010424 | |||
| 2554 | Ga0495619_0039047 | |||
| 2555 | Ga0495619_0050697 | |||
| 2556 | Ga0495619_0057461 | |||
| 2557 | Ga0495619_0266138 | |||
| 2558 | Ga0501084_0006129 | |||
| 2559 | Ga0501084_0166479 | |||
| 2560 | Ga0501084_1726385 | |||
| 2561 | Ga0590074_018569 | |||
| 2562 | Ga0590075_042453 | |||
| 2563 | Ga0590077_053736 | |||
| 2564 | Ga0587066_097148 | |||
| 2565 | Ga0587066_135608 | |||
| 2566 | Ga0587070_114187 | |||
| 2567 | Ga0587080_151380 | |||
| 2568 | Ga0587083_0196014 | |||
| 2569 | Ga0587083_0283845 | |||
| 2570 | Ga0587089_052123 | |||
| 2571 | Ga0587091_123006 | |||
| 2572 | Ga0587098_034432 | |||
| 2573 | Ga0587106_083877 | |||
| 2574 | Ga0587115_111974 | |||
| 2575 | Ga0587067_095615 | |||
| 2576 | Ga0587114_080424 | |||
| 2577 | Ga0587111_0160298 | |||
| 2578 | Ga0501082_0000480 | |||
| 2579 | Ga0501082_0524157 | |||
| 2580 | Ga0501082_0619069 | |||
| 2581 | Ga0466962_0488780 | |||
| 2582 | Ga0530510_0000230 | |||
| 2583 | Ga0530510_0073196 | |||
| 2584 | Ga0530510_0116202 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5iy9-assembly1.cif.gz_F | human holo-pic in the initial transcribing state (no iis) | 0.8147 | 16 | 70 |
| 6xre-assembly1.cif.gz_F | structure of the p53/rna polymerase ii assembly | 0.8127 | 17 | 70 |
| 4a3c-assembly1.cif.gz_F | rna polymerase ii initial transcribing complex with a 5nt dna-rna hybrid | 0.8067 | 17 | 70 |
| 5w64-assembly1.cif.gz_F | rna polymerase i initial transcribing complex state 1 | 0.8048 | 17 | 70 |
| 5iyc-assembly1.cif.gz_F | human core-pic in the initial transcribing state | 0.793 | 16 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5iycF00 | Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega | 0.793 | 16 | 70 | 3.90.940.10 |
| 1sfoF00 | Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega | 0.7912 | 16 | 70 | 3.90.940.10 |
| 4mexK00 | Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega | 0.7541 | 17 | 70 | 3.90.940.10 |
| 4c2mF00 | Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega | 0.6719 | 12 | 70 | 3.90.940.10 |
| 4meyE00 | Alpha Beta;Alpha-Beta Complex;Eukaryotic RPB6 RNA polymerase subunit;RNA polymerase subunit, RPB6/omega | 0.6712 | 6 | 72 | 3.90.940.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537YEG2-F1-model_v4 | DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) | 0.8453 | 16 | 74 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001066 GO:0003677 |
| AF-A0A538A1D8-F1-model_v4 | DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) | 0.8258 | 20 | 76 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001066 GO:0003677 |
| AF-A0A537ZEJ4-F1-model_v4 | DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) | 0.8225 | 7 | 76 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001066 GO:0003677 |
| AF-A0A2W5XUM9-F1-model_v4 | DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) | 0.8224 | 17 | 75 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001066 GO:0003677 |
| AF-A0A2N3F2C0-F1-model_v4 | DNA-directed RNA polymerase subunit omega (EC 2.7.7.6) (Transcriptase subunit omega) | 0.811 | 17 | 75 |
GO:0000428
GO:0001054 GO:0001055 GO:0001056 GO:0001057 GO:0001058 GO:0001066 GO:0003677 |