F492635

General Info

Members Datasets Scaffolds Average Seq Length
1291 401 2582 236

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1059413|Ga0081540_10594132
Length 277
Sequence MIEVAGLTVRFGGVTSLDDMSVTFETGTCGLIGPNGAGKTTFFNVLSGFVRPVTGTVRAFGEDLLSMVHFRRARWGVRRTFQTEQAIEELSVFDNVAMVHEHARLSGASRRRDVLDAISFVGLGADPSARVGTLAAGERRLLEVARAVVGRPRLVLLDEPAAGLPDEETRHLGEVIRAIPGHTGALVILVDHDMSLVSACCETTAVLDFGKLIASGPTAGVLRDEQVIRAYLGTADVAWRGRRARRPARAWACAASPSSGAGAPWSATSRSRYRPGR

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
95 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
118 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
128 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
129 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
130 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
203 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
204 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
205 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
208 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
209 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
210 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
211 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
214 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
215 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
216 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
217 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
221 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
226 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
227 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
228 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
229 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
230 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
231 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
232 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
234 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
238 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
241 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
247 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
248 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
249 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
250 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
267 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
268 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
271 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
296 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
297 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
300 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
311 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
312 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
313 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
361 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
367 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
368 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
369 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
372 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
376 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
377 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
378 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
379 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
380 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
381 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
382 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
396 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
397 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
398 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
399 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
400 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
401 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.31
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0
Rhizoplane 8.99
Rhizosphere 85.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1059413 3300005983 Bacteria 1836
2 rootL2_10015499 3300003322 Bacteria 4981
3 JGI25404J52841_10000237 3300003659 Bacteria 6905
4 Ga0070658_10047099 3300005327 Bacteria 3489
5 Ga0070676_10276945 3300005328 Bacteria 1129
6 Ga0070683_100007611 3300005329 Bacteria 9160
7 Ga0070683_100014788 3300005329 Bacteria 6838
8 Ga0070683_100095658 3300005329 Bacteria 2793
9 Ga0070683_100272286 3300005329 Bacteria 1610
10 Ga0070683_100427548 3300005329 Bacteria 1264
11 Ga0070690_100039157 3300005330 Bacteria 2994
12 Ga0070670_100539439 3300005331 Bacteria 1040
13 Ga0068869_100160561 3300005334 Bacteria 1749
14 Ga0070680_100011226 3300005336 Bacteria 6929
15 Ga0070680_100046621 3300005336 Bacteria 3526
16 Ga0070680_100059338 3300005336 Bacteria 3129
17 Ga0070680_100235341 3300005336 Bacteria 1547
18 Ga0070680_100285299 3300005336 Bacteria 1399
19 Ga0070682_100012732 3300005337 Bacteria 4828
20 Ga0070682_100197546 3300005337 Bacteria 1417
21 Ga0070682_100227251 3300005337 Bacteria 1332
22 Ga0068868_100123465 3300005338 Bacteria 2113
23 Ga0068868_100311897 3300005338 Bacteria 1338
24 Ga0068868_100317352 3300005338 Bacteria 1327
25 Ga0070660_100013359 3300005339 Bacteria 5888
26 Ga0070689_100010689 3300005340 Bacteria 6551
27 Ga0070689_100237409 3300005340 Bacteria 1500
28 Ga0070687_100041658 3300005343 Bacteria 2322
29 Ga0070661_100021551 3300005344 Bacteria 4605
30 Ga0070661_100413636 3300005344 Bacteria 1068
31 Ga0070692_10003019 3300005345 Bacteria 6708
32 Ga0070668_100049423 3300005347 Bacteria 3236
33 Ga0070668_100271665 3300005347 Bacteria 1413
34 Ga0070669_100126274 3300005353 Bacteria 1958
35 Ga0070675_100006014 3300005354 Bacteria 9299
36 Ga0070671_100015038 3300005355 Bacteria 6250
37 Ga0070671_100261342 3300005355 Bacteria 1471
38 Ga0070674_100153889 3300005356 Bacteria 1738
39 Ga0070674_100322653 3300005356 Bacteria 1239
40 Ga0070673_100011696 3300005364 Bacteria 5998
41 Ga0070673_100039781 3300005364 Bacteria 3602
42 Ga0070673_100354941 3300005364 Bacteria 1302
43 Ga0070688_100005380 3300005365 Bacteria 6736
44 Ga0070659_100011096 3300005366 Bacteria 6655
45 Ga0070659_100127085 3300005366 Bacteria 2069
46 Ga0070659_100278023 3300005366 Bacteria 1392
47 Ga0070667_100086800 3300005367 Bacteria 2685
48 Ga0070709_10012185 3300005434 Bacteria 4808
49 Ga0070709_10021705 3300005434 Bacteria 3744
50 Ga0070709_10024809 3300005434 Bacteria 3534
51 Ga0070714_100014645 3300005435 Bacteria 6301
52 Ga0070714_100041916 3300005435 Bacteria 3865
53 Ga0070714_100079967 3300005435 Bacteria 2843
54 Ga0070714_100130485 3300005435 Bacteria 2246
55 Ga0070713_100023990 3300005436 Bacteria 4743
56 Ga0070713_100042357 3300005436 Bacteria 3715
57 Ga0070713_100061806 3300005436 Bacteria 3135
58 Ga0070713_100185993 3300005436 Bacteria 1869
59 Ga0070713_100241101 3300005436 Bacteria 1646
60 Ga0070713_100272504 3300005436 Bacteria 1550
61 Ga0070713_100277213 3300005436 Bacteria 1537
62 Ga0070710_10025738 3300005437 Bacteria 3119
63 Ga0070710_10054260 3300005437 Bacteria 2261
64 Ga0070710_10055742 3300005437 Bacteria 2235
65 Ga0070710_10369199 3300005437 Bacteria 954
66 Ga0070701_10001668 3300005438 Bacteria 8318
67 Ga0070711_100038623 3300005439 Bacteria 3211
68 Ga0070711_100143041 3300005439 Bacteria 1795
69 Ga0070711_100359425 3300005439 Bacteria 1172
70 Ga0070711_100375352 3300005439 Bacteria 1148
71 Ga0070711_100596988 3300005439 Bacteria 921
72 Ga0070705_100048810 3300005440 Bacteria 2454
73 Ga0070700_100025865 3300005441 Bacteria 3460
74 Ga0070694_100065947 3300005444 Bacteria 2482
75 Ga0070694_100253036 3300005444 Bacteria 1333
76 Ga0070708_100204879 3300005445 Bacteria 1848
77 Ga0070708_100268473 3300005445 Bacteria 1604
78 Ga0070708_100299806 3300005445 Bacteria 1513
79 Ga0070663_100015332 3300005455 Bacteria 4944
80 Ga0070663_100074075 3300005455 Bacteria 2485
81 Ga0070678_100005693 3300005456 Bacteria 7239
82 Ga0070678_100023233 3300005456 Bacteria 4128
83 Ga0070678_100025740 3300005456 Bacteria 3965
84 Ga0070678_100038354 3300005456 Bacteria 3372
85 Ga0070678_100039968 3300005456 Bacteria 3315
86 Ga0070678_100277132 3300005456 Bacteria 1417
87 Ga0070662_100119312 3300005457 Bacteria 2020
88 Ga0070681_10028584 3300005458 Bacteria 5606
89 Ga0070681_10082738 3300005458 Bacteria 3165
90 Ga0070681_10092886 3300005458 Bacteria 2966
91 Ga0070681_10363817 3300005458 Bacteria 1357
92 Ga0068867_100010705 3300005459 Bacteria 6468
93 Ga0070685_10001614 3300005466 Bacteria 11898
94 Ga0070706_100008251 3300005467 Bacteria 9715
95 Ga0070706_100062383 3300005467 Bacteria 3444
96 Ga0070706_100246344 3300005467 Bacteria 1669
97 Ga0070707_100040233 3300005468 Bacteria 4472
98 Ga0070707_100138119 3300005468 Bacteria 2371
99 Ga0070707_100750095 3300005468 Bacteria 939
100 Ga0070698_100002351 3300005471 Bacteria 20891
101 Ga0070698_100081412 3300005471 Bacteria 3232
102 Ga0070698_100145421 3300005471 Bacteria 2320
103 Ga0070698_100168502 3300005471 Bacteria 2132
104 Ga0070698_100222614 3300005471 Bacteria 1820
105 Ga0070698_100508347 3300005471 Bacteria 1143
106 Ga0070698_100806645 3300005471 Bacteria 883
107 Ga0070699_100024741 3300005518 Bacteria 5176
108 Ga0070699_100027183 3300005518 Bacteria 4935
109 Ga0070699_100081933 3300005518 Bacteria 2812
110 Ga0070679_100004020 3300005530 Bacteria 13550
111 Ga0070679_100011266 3300005530 Bacteria 8523
112 Ga0070679_100113962 3300005530 Bacteria 2689
113 Ga0070679_100150313 3300005530 Bacteria 2305
114 Ga0070679_100173548 3300005530 Bacteria 2128
115 Ga0070684_100039442 3300005535 Bacteria 4062
116 Ga0070684_100046268 3300005535 Bacteria 3770
117 Ga0070684_100061135 3300005535 Bacteria 3296
118 Ga0070684_100074379 3300005535 Bacteria 2995
119 Ga0070684_100089813 3300005535 Bacteria 2731
120 Ga0070684_100106927 3300005535 Bacteria 2505
121 Ga0070684_100359163 3300005535 Bacteria 1341
122 Ga0070697_100000480 3300005536 Bacteria 30343
123 Ga0068853_100058644 3300005539 Bacteria 3323
124 Ga0068853_100186807 3300005539 Bacteria 1881
125 Ga0070672_100060447 3300005543 Bacteria 2983
126 Ga0070686_100019541 3300005544 Bacteria 3994
127 Ga0070686_100124990 3300005544 Bacteria 1771
128 Ga0070695_100052160 3300005545 Bacteria 2627
129 Ga0070696_100049012 3300005546 Bacteria 2932
130 Ga0070696_100202441 3300005546 Bacteria 1483
131 Ga0070693_100005137 3300005547 Bacteria 6257
132 Ga0070693_100035325 3300005547 Bacteria 2771
133 Ga0070693_100165235 3300005547 Bacteria 1413
134 Ga0070665_100531107 3300005548 Bacteria 1188
135 Ga0070704_100025959 3300005549 Bacteria 3864
136 Ga0068855_100175852 3300005563 Bacteria 2422
137 Ga0070664_100014886 3300005564 Bacteria 6345
138 Ga0070664_100021859 3300005564 Bacteria 5274
139 Ga0070664_100160646 3300005564 Bacteria 1988
140 Ga0070664_100439364 3300005564 Bacteria 1197
141 Ga0068857_100011972 3300005577 Bacteria 7546
142 Ga0068857_100136882 3300005577 Bacteria 2212
143 Ga0068856_100036063 3300005614 Bacteria 4849
144 Ga0068856_100070781 3300005614 Bacteria 3451
145 Ga0068856_100071480 3300005614 Bacteria 3435
146 Ga0068856_100088638 3300005614 Bacteria 3077
147 Ga0068856_100328703 3300005614 Bacteria 1546
148 Ga0068856_100482604 3300005614 Bacteria 1260
149 Ga0068856_100761745 3300005614 Bacteria 988
150 Ga0070702_100014672 3300005615 Bacteria 3980
151 Ga0070702_100100814 3300005615 Bacteria 1770
152 Ga0070702_100219328 3300005615 Bacteria 1271
153 Ga0070702_100275043 3300005615 Bacteria 1153
154 Ga0068852_100211680 3300005616 Bacteria 1839
155 Ga0068859_100017374 3300005617 Bacteria 7227
156 Ga0068864_100010496 3300005618 Bacteria 7653
157 Ga0068864_100208733 3300005618 Bacteria 1797
158 Ga0068866_10004410 3300005718 Bacteria 5779
159 Ga0068866_10116933 3300005718 Bacteria 1496
160 Ga0068861_100010676 3300005719 Bacteria 6380
161 Ga0068851_10050125 3300005834 Bacteria 2119
162 Ga0068870_10067222 3300005840 Bacteria 1944
163 Ga0068870_10123105 3300005840 Bacteria 1496
164 Ga0068863_100208041 3300005841 Bacteria 1884
165 Ga0068863_100601631 3300005841 Bacteria 1088
166 Ga0068863_100819903 3300005841 Bacteria 928
167 Ga0068858_100012604 3300005842 Bacteria 7969
168 Ga0068858_100037424 3300005842 Bacteria 4500
169 Ga0068858_100249215 3300005842 Bacteria 1687
170 Ga0068860_100017643 3300005843 Bacteria 6955
171 Ga0068860_100065396 3300005843 Bacteria 3453
172 Ga0068860_100088667 3300005843 Bacteria 2945
173 Ga0068862_100057713 3300005844 Bacteria 3330
174 Ga0081455_10003582 3300005937 Bacteria 17818
175 Ga0081455_10023662 3300005937 Bacteria 5710
176 Ga0081455_10032587 3300005937 Bacteria 4693
177 Ga0081455_10039497 3300005937 Bacteria 4170
178 Ga0081455_10084652 3300005937 Bacteria 2587
179 Ga0081538_10003610 3300005981 Bacteria 14536
180 Ga0081538_10012556 3300005981 Bacteria 6783
181 Ga0081538_10069513 3300005981 Bacteria 1950
182 Ga0081540_1000936 3300005983 Bacteria 26242
183 Ga0081540_1068089 3300005983 Bacteria 1660
184 Ga0081539_10005354 3300005985 Bacteria 13149
185 Ga0070717_10001324 3300006028 Bacteria 16967
186 Ga0070717_10006096 3300006028 Bacteria 8850
187 Ga0070717_10023163 3300006028 Bacteria 4916
188 Ga0070717_10041201 3300006028 Bacteria 3765
189 Ga0070717_10041740 3300006028 Bacteria 3740
190 Ga0070717_10046387 3300006028 Bacteria 3555
191 Ga0070717_10050868 3300006028 Bacteria 3408
192 Ga0070717_10061134 3300006028 Bacteria 3121
193 Ga0070717_10097157 3300006028 Bacteria 2495
194 Ga0075365_10000551 3300006038 Bacteria 14473
195 Ga0075365_10004769 3300006038 Bacteria 7233
196 Ga0075365_10313674 3300006038 Bacteria 1104
197 Ga0075368_10019378 3300006042 Bacteria 2568
198 Ga0075368_10044783 3300006042 Bacteria 1747
199 Ga0075368_10047394 3300006042 Bacteria 1701
200 Ga0075363_100005505 3300006048 Bacteria 5644
201 Ga0075363_100039755 3300006048 Bacteria 2477
202 Ga0075363_100075681 3300006048 Bacteria 1834
203 Ga0075363_100077460 3300006048 Bacteria 1814
204 Ga0075363_100252637 3300006048 Bacteria 1015
205 Ga0075364_10003741 3300006051 Bacteria 8686
206 Ga0075364_10016558 3300006051 Bacteria 4588
207 Ga0075364_10040075 3300006051 Bacteria 3038
208 Ga0075364_10243597 3300006051 Bacteria 1221
209 Ga0075432_10012318 3300006058 Bacteria 2905
210 Ga0075432_10014283 3300006058 Bacteria 2704
211 Ga0070715_10014288 3300006163 Bacteria 2937
212 Ga0070715_10118581 3300006163 Bacteria 1258
213 Ga0070715_10188865 3300006163 Bacteria 1039
214 Ga0070716_100265101 3300006173 Bacteria 1177
215 Ga0070712_100011634 3300006175 Bacteria 5588
216 Ga0070712_100022010 3300006175 Bacteria 4193
217 Ga0070712_100055945 3300006175 Bacteria 2765
218 Ga0070712_100087827 3300006175 Bacteria 2270
219 Ga0070712_100129460 3300006175 Bacteria 1911
220 Ga0070712_100212123 3300006175 Bacteria 1528
221 Ga0075362_10043341 3300006177 Bacteria 1992
222 Ga0075362_10156742 3300006177 Bacteria 1095
223 Ga0075367_10037625 3300006178 Bacteria 2813
224 Ga0075367_10048254 3300006178 Bacteria 2507
225 Ga0075367_10255811 3300006178 Bacteria 1098
226 Ga0097621_100014585 3300006237 Bacteria 5887
227 Ga0097621_100151140 3300006237 Bacteria 1991
228 Ga0075370_10061924 3300006353 Bacteria 2132
229 Ga0068871_100006269 3300006358 Bacteria 8391
230 Ga0068871_100206822 3300006358 Bacteria 1696
231 Ga0075428_100005147 3300006844 Bacteria 14540
232 Ga0075430_100636575 3300006846 Bacteria 879
233 Ga0075431_100181903 3300006847 Bacteria 2157
234 Ga0075431_100254561 3300006847 Bacteria 1783
235 Ga0075433_10060219 3300006852 Bacteria 3324
236 Ga0075433_10083867 3300006852 Bacteria 2813
237 Ga0075433_10093514 3300006852 Bacteria 2660
238 Ga0075433_10121916 3300006852 Bacteria 2315
239 Ga0075433_10159160 3300006852 Bacteria 2009
240 Ga0075434_100007864 3300006871 Bacteria 9879
241 Ga0075434_100173746 3300006871 Bacteria 2174
242 Ga0075434_100376501 3300006871 Bacteria 1441
243 Ga0075434_100558776 3300006871 Bacteria 1164
244 Ga0075429_100089560 3300006880 Bacteria 2682
245 Ga0075429_100168608 3300006880 Bacteria 1918
246 Ga0075429_100232361 3300006880 Bacteria 1615
247 Ga0068865_100047339 3300006881 Bacteria 2955
248 Ga0068865_100082886 3300006881 Bacteria 2307
249 Ga0075436_100041056 3300006914 Bacteria 3193
250 Ga0075436_100202302 3300006914 Bacteria 1407
251 Ga0097620_100017374 3300006931 Bacteria 7227
252 Ga0075435_100015622 3300007076 Bacteria 5711
253 Ga0075435_100018686 3300007076 Bacteria 5279
254 Ga0075435_100032377 3300007076 Bacteria 4128
255 Ga0075435_100178362 3300007076 Bacteria 1795
256 Ga0075435_100525068 3300007076 Bacteria 1024
257 Ga0075435_100655278 3300007076 Bacteria 911
258 Ga0099795_10022772 3300007788 Bacteria 2072
259 Ga0105240_10662366 3300009093 Bacteria 1143
260 Ga0111539_10022685 3300009094 Bacteria 7710
261 Ga0111539_10034085 3300009094 Bacteria 6177
262 Ga0111539_10096837 3300009094 Bacteria 3466
263 Ga0111539_10166545 3300009094 Bacteria 2576
264 Ga0105245_10026307 3300009098 Bacteria 5121
265 Ga0105245_10032395 3300009098 Bacteria 4626
266 Ga0105245_10055135 3300009098 Bacteria 3570
267 Ga0105245_10066233 3300009098 Bacteria 3269
268 Ga0105245_10094014 3300009098 Bacteria 2763
269 Ga0105245_10557600 3300009098 Bacteria 1168
270 Ga0105247_10018783 3300009101 Bacteria 4150
271 Ga0105247_10136238 3300009101 Bacteria 1604
272 Ga0114129_10000926 3300009147 Bacteria 38287
273 Ga0114129_10008895 3300009147 Bacteria 14316
274 Ga0114129_10041949 3300009147 Bacteria 6443
275 Ga0114129_11147598 3300009147 Bacteria 970
276 Ga0105243_10080721 3300009148 Bacteria 2653
277 Ga0105243_10151947 3300009148 Bacteria 1987
278 Ga0105243_10355355 3300009148 Bacteria 1347
279 Ga0105241_10076027 3300009174 Bacteria 2617
280 Ga0105241_10200801 3300009174 Bacteria 1665
281 Ga0105241_10704692 3300009174 Bacteria 922
282 Ga0105242_10007042 3300009176 Bacteria 8684
283 Ga0105242_10024097 3300009176 Bacteria 4804
284 Ga0105242_10283292 3300009176 Bacteria 1506
285 Ga0105248_10014103 3300009177 Bacteria 8795
286 Ga0105248_10026145 3300009177 Bacteria 6494
287 Ga0105248_10819917 3300009177 Bacteria 1050
288 Ga0105248_11127599 3300009177 Bacteria 887
289 Ga0105237_10129012 3300009545 Bacteria 2523
290 Ga0105237_10830945 3300009545 Bacteria 930
291 Ga0105238_10012955 3300009551 Bacteria 8418
292 Ga0105238_10593329 3300009551 Bacteria 1115
293 Ga0105249_10014381 3300009553 Bacteria 6997
294 Ga0105249_10101151 3300009553 Bacteria 2711
295 Ga0105249_11128727 3300009553 Bacteria 854
296 Ga0099796_10033381 3300010159 Bacteria 1693
297 Ga0099796_10121599 3300010159 Bacteria 1004
298 Ga0105239_10063118 3300010375 Bacteria 4067
299 Ga0105239_11109202 3300010375 Bacteria 911
300 Ga0105246_10024802 3300011119 Bacteria 3902
301 Ga0105246_10080496 3300011119 Bacteria 2319
302 Ga0105246_10240817 3300011119 Bacteria 1430
303 Ga0157340_1003493 3300012473 Bacteria 865
304 Ga0157338_1008935 3300012515 Bacteria 982
305 Ga0157373_10092233 3300013100 Bacteria 2133
306 Ga0157371_10105689 3300013102 Bacteria 1998
307 Ga0157369_10072595 3300013105 Bacteria 3694
308 Ga0157369_10077811 3300013105 Bacteria 3555
309 Ga0157369_10115357 3300013105 Bacteria 2852
310 Ga0157369_10851718 3300013105 Bacteria 936
311 Ga0157378_10549956 3300013297 Bacteria 1159
312 Ga0157378_10821570 3300013297 Bacteria 956
313 Ga0163162_10012158 3300013306 Bacteria 8404
314 Ga0163162_10415145 3300013306 Bacteria 1478
315 Ga0157375_10012051 3300013308 Bacteria 7657
316 Ga0157375_10191379 3300013308 Bacteria 2200
317 Ga0157375_10340894 3300013308 Bacteria 1664
318 Ga0163163_10115540 3300014325 Bacteria 2715
319 Ga0163163_10204952 3300014325 Bacteria 2020
320 Ga0157380_10006251 3300014326 Bacteria 8363
321 Ga0157380_10631838 3300014326 Bacteria 1065
322 Ga0182008_10296888 3300014497 Bacteria 844
323 Ga0157377_10061398 3300014745 Bacteria 2148
324 Ga0157377_10184817 3300014745 Bacteria 1313
325 Ga0157377_10197402 3300014745 Bacteria 1275
326 Ga0157377_10230537 3300014745 Bacteria 1190
327 Ga0157377_10311089 3300014745 Bacteria 1043
328 Ga0157377_10530120 3300014745 Bacteria 828
329 Ga0157379_10006395 3300014968 Bacteria 10150
330 Ga0157379_10017040 3300014968 Bacteria 6396
331 Ga0157376_10005806 3300014969 Bacteria 8651
332 Ga0157376_10035530 3300014969 Bacteria 4031
333 Ga0157376_10160601 3300014969 Bacteria 2037
334 Ga0157376_10679414 3300014969 Bacteria 1033
335 Ga0163161_10008515 3300017792 Bacteria 7100
336 Ga0163161_10021369 3300017792 Bacteria 4549
337 Ga0206356_10213329 3300020070 Bacteria 1110
338 Ga0206356_10978510 3300020070 Bacteria 2255
339 Ga0206353_11752886 3300020082 Bacteria 2177
340 Ga0213874_10001831 3300021377 Bacteria 4462
341 Ga0213874_10005759 3300021377 Bacteria 2903
342 Ga0213876_10015845 3300021384 Bacteria 3989
343 Ga0213876_10029848 3300021384 Bacteria 2874
344 Ga0213875_10000934 3300021388 Bacteria 20993
345 Ga0213875_10010235 3300021388 Bacteria 4706
346 Ga0213875_10018494 3300021388 Bacteria 3357
347 Ga0213875_10021540 3300021388 Bacteria 3086
348 Ga0213875_10179480 3300021388 Bacteria 994
349 Ga0207656_10035713 3300025321 Bacteria 2083
350 Ga0207656_10258600 3300025321 Bacteria 854
351 Ga0207653_10005149 3300025885 Bacteria 4088
352 Ga0207692_10017284 3300025898 Bacteria 3214
353 Ga0207692_10086879 3300025898 Bacteria 1686
354 Ga0207692_10107464 3300025898 Bacteria 1542
355 Ga0207692_10217705 3300025898 Bacteria 1130
356 Ga0207642_10003988 3300025899 Bacteria 4709
357 Ga0207710_10033540 3300025900 Bacteria 2252
358 Ga0207688_10015412 3300025901 Bacteria 4146
359 Ga0207688_10021594 3300025901 Bacteria 3519
360 Ga0207680_10124484 3300025903 Bacteria 1690
361 Ga0207685_10106308 3300025905 Bacteria 1209
362 Ga0207699_10006382 3300025906 Bacteria 5706
363 Ga0207699_10021386 3300025906 Bacteria 3485
364 Ga0207699_10033971 3300025906 Bacteria 2888
365 Ga0207699_10107677 3300025906 Bacteria 1781
366 Ga0207699_10113141 3300025906 Bacteria 1743
367 Ga0207699_10138005 3300025906 Bacteria 1599
368 Ga0207643_10003445 3300025908 Bacteria 8507
369 Ga0207643_10010851 3300025908 Bacteria 4914
370 Ga0207684_10007560 3300025910 Bacteria 9771
371 Ga0207684_10115814 3300025910 Bacteria 2296
372 Ga0207684_10263327 3300025910 Bacteria 1488
373 Ga0207684_10506724 3300025910 Bacteria 1034
374 Ga0207654_10241170 3300025911 Bacteria 1208
375 Ga0207707_10001584 3300025912 Bacteria 20963
376 Ga0207693_10014459 3300025915 Bacteria 6345
377 Ga0207693_10017499 3300025915 Bacteria 5716
378 Ga0207693_10021237 3300025915 Bacteria 5160
379 Ga0207693_10182188 3300025915 Bacteria 1653
380 Ga0207693_10192779 3300025915 Bacteria 1603
381 Ga0207693_10201492 3300025915 Bacteria 1565
382 Ga0207693_10236452 3300025915 Bacteria 1434
383 Ga0207693_10355262 3300025915 Bacteria 1146
384 Ga0207663_10030425 3300025916 Bacteria 3185
385 Ga0207663_10055624 3300025916 Bacteria 2484
386 Ga0207663_10068956 3300025916 Bacteria 2273
387 Ga0207660_10054585 3300025917 Bacteria 2852
388 Ga0207660_10083264 3300025917 Bacteria 2355
389 Ga0207660_10198304 3300025917 Bacteria 1567
390 Ga0207662_10005077 3300025918 Bacteria 6978
391 Ga0207657_10001843 3300025919 Bacteria 22910
392 Ga0207657_10062133 3300025919 Bacteria 3199
393 Ga0207649_10321784 3300025920 Bacteria 1137
394 Ga0207649_10608046 3300025920 Bacteria 841
395 Ga0207652_10033721 3300025921 Bacteria 4312
396 Ga0207652_10034319 3300025921 Bacteria 4275
397 Ga0207652_10070720 3300025921 Bacteria 3031
398 Ga0207652_10080065 3300025921 Bacteria 2855
399 Ga0207646_10010709 3300025922 Bacteria 8928
400 Ga0207646_10015301 3300025922 Bacteria 7249
401 Ga0207646_10287335 3300025922 Bacteria 1486
402 Ga0207681_10018267 3300025923 Bacteria 4417
403 Ga0207681_10166283 3300025923 Bacteria 1668
404 Ga0207694_10487920 3300025924 Bacteria 1031
405 Ga0207650_10044635 3300025925 Bacteria 3258
406 Ga0207650_10111015 3300025925 Bacteria 2123
407 Ga0207659_10056399 3300025926 Bacteria 2814
408 Ga0207659_10156145 3300025926 Bacteria 1787
409 Ga0207687_10036796 3300025927 Bacteria 3335
410 Ga0207687_10071637 3300025927 Bacteria 2477
411 Ga0207687_10189976 3300025927 Bacteria 1598
412 Ga0207687_10374964 3300025927 Bacteria 1164
413 Ga0207687_10436315 3300025927 Bacteria 1084
414 Ga0207700_10032985 3300025928 Bacteria 3701
415 Ga0207700_10068058 3300025928 Bacteria 2729
416 Ga0207700_10069439 3300025928 Bacteria 2704
417 Ga0207700_10087041 3300025928 Bacteria 2456
418 Ga0207700_10128919 3300025928 Bacteria 2062
419 Ga0207700_10154442 3300025928 Bacteria 1900
420 Ga0207700_10446945 3300025928 Bacteria 1139
421 Ga0207700_10456930 3300025928 Bacteria 1126
422 Ga0207664_10002425 3300025929 Bacteria 12335
423 Ga0207664_10005168 3300025929 Bacteria 8893
424 Ga0207664_10015898 3300025929 Bacteria 5479
425 Ga0207664_10020974 3300025929 Bacteria 4849
426 Ga0207664_10032683 3300025929 Bacteria 3990
427 Ga0207664_10039208 3300025929 Bacteria 3677
428 Ga0207664_10052909 3300025929 Bacteria 3212
429 Ga0207664_10072900 3300025929 Bacteria 2770
430 Ga0207664_10460899 3300025929 Bacteria 1135
431 Ga0207644_10136573 3300025931 Bacteria 1883
432 Ga0207690_10011653 3300025932 Bacteria 5255
433 Ga0207690_10065424 3300025932 Bacteria 2486
434 Ga0207706_10008643 3300025933 Bacteria 9381
435 Ga0207686_10109239 3300025934 Bacteria 1862
436 Ga0207709_10011567 3300025935 Bacteria 4868
437 Ga0207709_10014406 3300025935 Bacteria 4366
438 Ga0207709_10253185 3300025935 Bacteria 1287
439 Ga0207670_10005858 3300025936 Bacteria 6785
440 Ga0207670_10256130 3300025936 Bacteria 1354
441 Ga0207669_10010843 3300025937 Bacteria 4405
442 Ga0207669_10128968 3300025937 Bacteria 1734
443 Ga0207704_10006943 3300025938 Bacteria 5313
444 Ga0207704_10037653 3300025938 Bacteria 2796
445 Ga0207665_10041688 3300025939 Bacteria 3067
446 Ga0207665_10044459 3300025939 Bacteria 2972
447 Ga0207665_10091095 3300025939 Bacteria 2114
448 Ga0207665_10185131 3300025939 Bacteria 1510
449 Ga0207691_10020083 3300025940 Bacteria 6319
450 Ga0207691_10058230 3300025940 Bacteria 3514
451 Ga0207711_10015219 3300025941 Bacteria 6386
452 Ga0207689_10009295 3300025942 Bacteria 8498
453 Ga0207689_10018914 3300025942 Bacteria 5810
454 Ga0207661_10006975 3300025944 Bacteria 8012
455 Ga0207661_10007758 3300025944 Bacteria 7642
456 Ga0207661_10046413 3300025944 Bacteria 3445
457 Ga0207661_10057842 3300025944 Bacteria 3119
458 Ga0207661_10059390 3300025944 Bacteria 3082
459 Ga0207661_10076878 3300025944 Bacteria 2743
460 Ga0207661_10537164 3300025944 Bacteria 1070
461 Ga0207679_10108982 3300025945 Bacteria 2182
462 Ga0207679_10145994 3300025945 Bacteria 1919
463 Ga0207679_10581139 3300025945 Bacteria 1008
464 Ga0207667_10924513 3300025949 Bacteria 863
465 Ga0207651_10049958 3300025960 Bacteria 2837
466 Ga0207651_10570524 3300025960 Bacteria 986
467 Ga0207712_10013444 3300025961 Bacteria 5246
468 Ga0207668_10006340 3300025972 Bacteria 6995
469 Ga0207668_10059741 3300025972 Bacteria 2673
470 Ga0207668_10303624 3300025972 Bacteria 1318
471 Ga0207668_10881028 3300025972 Bacteria 796
472 Ga0207703_10007760 3300026035 Bacteria 8493
473 Ga0207703_10120627 3300026035 Bacteria 2251
474 Ga0207639_10019887 3300026041 Bacteria 4797
475 Ga0207639_10057672 3300026041 Bacteria 2983
476 Ga0207678_10012485 3300026067 Bacteria 7459
477 Ga0207678_10049018 3300026067 Bacteria 3649
478 Ga0207678_10288416 3300026067 Bacteria 1409
479 Ga0207678_10924451 3300026067 Bacteria 771
480 Ga0207708_10010788 3300026075 Bacteria 6791
481 Ga0207708_10214371 3300026075 Bacteria 1540
482 Ga0207708_10880563 3300026075 Bacteria 774
483 Ga0207702_10024939 3300026078 Bacteria 4962
484 Ga0207702_10039177 3300026078 Bacteria 3970
485 Ga0207702_10412804 3300026078 Bacteria 1304
486 Ga0207702_10464120 3300026078 Bacteria 1230
487 Ga0207702_10567792 3300026078 Bacteria 1111
488 Ga0207702_10641501 3300026078 Bacteria 1044
489 Ga0207641_10478807 3300026088 Bacteria 1206
490 Ga0207641_10532009 3300026088 Bacteria 1144
491 Ga0207641_10559965 3300026088 Bacteria 1115
492 Ga0207648_10023769 3300026089 Bacteria 5483
493 Ga0207648_10043798 3300026089 Bacteria 3929
494 Ga0207648_10094750 3300026089 Bacteria 2611
495 Ga0207648_10138893 3300026089 Bacteria 2141
496 Ga0207676_10227097 3300026095 Bacteria 1666
497 Ga0207674_10009266 3300026116 Bacteria 11280
498 Ga0207674_10021925 3300026116 Bacteria 6869
499 Ga0207674_10278111 3300026116 Bacteria 1622
500 Ga0207674_10495346 3300026116 Bacteria 1181
501 Ga0207675_100009277 3300026118 Bacteria 9228
502 Ga0207675_100016831 3300026118 Bacteria 6831
503 Ga0207675_100098975 3300026118 Bacteria 2747
504 Ga0207675_100556275 3300026118 Bacteria 1147
505 Ga0207683_10006539 3300026121 Bacteria 9979
506 Ga0207683_10012640 3300026121 Bacteria 7200
507 Ga0207683_10085257 3300026121 Bacteria 2808
508 Ga0207683_10348115 3300026121 Bacteria 1360
509 Ga0207698_10391364 3300026142 Bacteria 1325
510 Ga0209813_10063302 3300027866 Bacteria 1186
511 Ga0207428_10016087 3300027907 Bacteria 6446
512 Ga0207428_10105603 3300027907 Bacteria 2172
513 Ga0268265_10066231 3300028380 Bacteria 2792
514 Ga0268265_11058065 3300028380 Bacteria 804
515 Ga0268264_10097244 3300028381 Bacteria 2551
516 Ga0265337_1000033 3300028556 Bacteria 60717
517 Ga0265337_1035722 3300028556 Bacteria 1454
518 Ga0265326_10001841 3300028558 Bacteria 7274
519 Ga0265319_1002186 3300028563 Bacteria 10895
520 Ga0265334_10006906 3300028573 Bacteria 4873
521 Ga0265334_10031619 3300028573 Bacteria 2114
522 Ga0265318_10002086 3300028577 Bacteria 10937
523 Ga0265318_10009588 3300028577 Bacteria 4250
524 Ga0265318_10011629 3300028577 Bacteria 3781
525 Ga0265318_10126186 3300028577 Bacteria 941
526 Ga0265323_10004662 3300028653 Bacteria 5884
527 Ga0265322_10003011 3300028654 Bacteria 5132
528 Ga0265322_10009522 3300028654 Bacteria 2821
529 Ga0265322_10051176 3300028654 Bacteria 1172
530 Ga0265336_10003443 3300028666 Bacteria 6201
531 Ga0265336_10041308 3300028666 Bacteria 1410
532 Ga0265338_10000059 3300028800 Bacteria 198047
533 Ga0265338_10002834 3300028800 Bacteria 25311
534 Ga0265338_10009051 3300028800 Bacteria 11977
535 Ga0265338_10026943 3300028800 Bacteria 5781
536 Ga0265338_10088243 3300028800 Bacteria 2574
537 Ga0265324_10000810 3300029957 Bacteria 20364
538 Ga0265330_10064966 3300031235 Bacteria 1584
539 Ga0265330_10066888 3300031235 Bacteria 1558
540 Ga0265332_10000315 3300031238 Bacteria 37028
541 Ga0265332_10112041 3300031238 Bacteria 1149
542 Ga0265320_10003479 3300031240 Bacteria 10556
543 Ga0265320_10013756 3300031240 Bacteria 4642
544 Ga0265320_10073655 3300031240 Bacteria 1604
545 Ga0265325_10062542 3300031241 Bacteria 1885
546 Ga0265325_10065324 3300031241 Bacteria 1838
547 Ga0265329_10049954 3300031242 Bacteria 1332
548 Ga0265340_10000168 3300031247 Bacteria 32907
549 Ga0265340_10041197 3300031247 Bacteria 2272
550 Ga0265340_10084773 3300031247 Bacteria 1487
551 Ga0265339_10015478 3300031249 Bacteria 4570
552 Ga0265339_10126140 3300031249 Bacteria 1312
553 Ga0265331_10054975 3300031250 Bacteria 1895
554 Ga0265331_10064200 3300031250 Bacteria 1729
555 Ga0265327_10072976 3300031251 Bacteria 1713
556 Ga0265327_10165307 3300031251 Bacteria 1019
557 Ga0265316_10007783 3300031344 Bacteria 10035
558 Ga0265316_10019343 3300031344 Bacteria 5827
559 Ga0307509_10168616 3300031507 Bacteria 2073
560 Ga0265313_10006538 3300031595 Bacteria 8224
561 Ga0265313_10026175 3300031595 Bacteria 3078
562 Ga0265313_10164033 3300031595 Bacteria 942
563 Ga0265314_10005746 3300031711 Bacteria 11128
564 Ga0265314_10014093 3300031711 Bacteria 6419
565 Ga0265314_10045899 3300031711 Bacteria 3086
566 Ga0265314_10132511 3300031711 Bacteria 1552
567 Ga0265342_10001322 3300031712 Bacteria 23238
568 Ga0265342_10040773 3300031712 Bacteria 2814
569 Ga0265342_10064181 3300031712 Bacteria 2156
570 Ga0307405_10375765 3300031731 Bacteria 1105
571 Ga0307416_100178966 3300032002 Bacteria 1985
572 Ga0307416_100501622 3300032002 Bacteria 1278
573 Ga0373948_0003612 3300034817 Bacteria 2391
574 Ga0373948_0061127 3300034817 Bacteria 827
575 Ga0373950_0051435 3300034818 Bacteria 810
576 Ga0373958_0012987 3300034819 Bacteria 1434
577 Ga0373958_0013501 3300034819 Bacteria 1416
578 Ga0373926_0056484 3300035083 Bacteria 1424
579 Ga0373929_0074714 3300035085 Bacteria 816
580 Ga0373934_0002258 3300035086 Bacteria 7083
581 Ga0373934_0011853 3300035086 Bacteria 3285
582 Ga0373934_0123875 3300035086 Bacteria 1052
583 Ga0373949_0002596 3300035090 Bacteria 4579
584 Ga0373949_0017890 3300035090 Bacteria 1601
585 Ga0373949_0027952 3300035090 Bacteria 1329
586 Ga0373923_0008085 3300035111 Bacteria 3733
587 Ga0373923_0149773 3300035111 Bacteria 1059
588 Ga0373932_0057276 3300035112 Bacteria 1175
589 Ga0373936_0011457 3300035113 Bacteria 3356
590 Ga0373936_0011809 3300035113 Bacteria 3312
591 Ga0373939_0052315 3300035114 Bacteria 1272
592 Ga0373945_0002605 3300035116 Bacteria 5650
593 Ga0373945_0070097 3300035116 Bacteria 1325
594 Ga0373953_0000386 3300035117 Bacteria 11969
595 Ga0373953_0002454 3300035117 Bacteria 5609
596 Ga0373953_0034216 3300035117 Bacteria 1991
597 Ga0373953_0069609 3300035117 Bacteria 1450
598 Ga0373953_0106760 3300035117 Bacteria 1182
599 Ga0373953_0129062 3300035117 Bacteria 1077
600 Ga0373954_0022705 3300035118 Bacteria 2849
601 Ga0373954_0050231 3300035118 Bacteria 1957
602 Ga0373954_0073094 3300035118 Bacteria 1631
603 Ga0373954_0132796 3300035118 Bacteria 1212
604 Ga0373956_0001244 3300035119 Bacteria 10544
605 Ga0373956_0008563 3300035119 Bacteria 4142
606 Ga0373956_0127642 3300035119 Bacteria 1189
607 Ga0373956_0155328 3300035119 Bacteria 1077
608 Ga0373957_0000246 3300035120 Bacteria 13558
609 Ga0373957_0054480 3300035120 Bacteria 1536
610 Ga0373957_0066495 3300035120 Bacteria 1404
611 Ga0373960_0049976 3300035121 Bacteria 1238
612 Ga0373943_0074747 3300035170 Bacteria 1724
613 Ga0373946_0115537 3300035171 Bacteria 1219
614 Ga0373955_0000228 3300035172 Bacteria 23478
615 Ga0373955_0013489 3300035172 Bacteria 3954
616 Ga0373955_0044965 3300035172 Bacteria 2381
617 Ga0373955_0082384 3300035172 Bacteria 1820
618 Ga0373955_0177833 3300035172 Bacteria 1262
619 Ga0373955_0226574 3300035172 Bacteria 1117
620 Ga0373955_0244728 3300035172 Bacteria 1074
621 Ga0373955_0348733 3300035172 Bacteria 896
622 Ga0373942_0005087 3300035207 Bacteria 3050
623 Ga0373942_0027404 3300035207 Bacteria 1482
624 Ga0373961_0016088 3300035241 Bacteria 1923
625 Ga0373961_0018101 3300035241 Bacteria 1836
626 Ga0373962_0023258 3300035242 Bacteria 1649
627 Ga0316574_0103985 3300035398 Bacteria 1818
628 Ga0373924_0002099 3300035410 Bacteria 6653
629 Ga0373924_0042617 3300035410 Bacteria 1862
630 Ga0373931_0008158 3300035691 Bacteria 4962
631 Ga0373931_0091615 3300035691 Bacteria 1694
632 Ga0373931_0092396 3300035691 Bacteria 1688
633 Ga0373931_0105452 3300035691 Bacteria 1592
634 Ga0373927_0009389 3300035695 Bacteria 6561
635 Ga0373927_0109158 3300035695 Bacteria 1802
636 Ga0373933_0000012 3300035724 Bacteria 108156
637 Ga0373933_0018359 3300035724 Bacteria 3931
638 Ga0373933_0022298 3300035724 Bacteria 3604
639 Ga0373933_0267120 3300035724 Bacteria 1104
640 Ga0373933_0294100 3300035724 Bacteria 1050
641 Ga0373933_0382669 3300035724 Bacteria 916
642 Ga0373947_0019792 3300035725 Bacteria 3884
643 Ga0373947_0048661 3300035725 Bacteria 2544
644 Ga0373947_0048860 3300035725 Bacteria 2539
645 Ga0373947_0052979 3300035725 Bacteria 2445
646 Ga0373947_0056510 3300035725 Bacteria 2372
647 Ga0373937_0000040 3300036401 Bacteria 108935
648 Ga0373937_0002649 3300036401 Bacteria 14915
649 Ga0373937_0003488 3300036401 Bacteria 13226
650 Ga0373937_0028479 3300036401 Bacteria 5055
651 Ga0373937_0052183 3300036401 Bacteria 3748
652 Ga0373937_0057123 3300036401 Bacteria 3584
653 Ga0373937_0200759 3300036401 Bacteria 1874
654 Ga0373937_0506048 3300036401 Bacteria 1147
655 Ga0372808_001465 3300036459 Bacteria 2462
656 Ga0373925_0000014 3300037068 Bacteria 180414
657 Ga0373925_0004085 3300037068 Bacteria 11078
658 Ga0373925_0010821 3300037068 Bacteria 6615
659 Ga0373925_0023001 3300037068 Bacteria 4548
660 Ga0373925_0077614 3300037068 Bacteria 2521
661 Ga0373925_0431063 3300037068 Bacteria 1078
662 Ga0395899_0277109 3300037312 Bacteria 1142
663 Ga0395900_0155133 3300037418 Bacteria 2339
664 Ga0395898_0082521 3300037466 Bacteria 3098
665 Ga0395898_0087463 3300037466 Bacteria 3002
666 Ga0395898_0736505 3300037466 Bacteria 927
667 Ga0436364_0296603 3300037853 Bacteria 1761
668 Ga0436364_0305992 3300037853 Bacteria 1457
669 Ga0436364_0330965 3300037853 Bacteria 247749
670 Ga0436364_0970657 3300037853 Bacteria 3769
671 Ga0436364_1003558 3300037853 Bacteria 13096
672 Ga0436364_1091382 3300037853 Bacteria 1767
673 Ga0436364_1207495 3300037853 Bacteria 11099
674 Ga0436364_1309732 3300037853 Bacteria 3300
675 Ga0436364_1515661 3300037853 Bacteria 6169
676 Ga0395901_0058914 3300038443 Bacteria 3995
677 Ga0395901_0105133 3300038443 Bacteria 2963
678 Ga0395901_0563324 3300038443 Bacteria 1153
679 Ga0395901_1056289 3300038443 Bacteria 785
680 Ga0400483_027790 3300039062 Bacteria 5551
681 Ga0400483_040279 3300039062 Bacteria 3026
682 Ga0400483_148576 3300039062 Bacteria 5166
683 Ga0436365_0122816 3300039437 Bacteria 3399
684 Ga0436365_0501329 3300039437 Bacteria 4187
685 Ga0436365_0722652 3300039437 Bacteria 1846
686 Ga0436365_0741127 3300039437 Bacteria 2129
687 Ga0436365_0772721 3300039437 Bacteria 3409
688 Ga0436365_1118937 3300039437 Bacteria 2875
689 Ga0436365_1384528 3300039437 Bacteria 14063
690 Ga0436365_1709192 3300039437 Bacteria 1987
691 Ga0436365_1928355 3300039437 Bacteria 7771
692 Ga0436361_0405093 3300039447 Bacteria 909
693 Ga0436363_0275177 3300039450 Bacteria 88978
694 Ga0436363_0440163 3300039450 Bacteria 3417
695 Ga0436363_0510149 3300039450 Bacteria 4096
696 Ga0436363_1273328 3300039450 Bacteria 2142
697 Ga0436363_1413520 3300039450 Bacteria 1855
698 Ga0436362_0833178 3300039453 Bacteria 1615
699 Ga0436362_0953937 3300039453 Bacteria 2048
700 Ga0450917_009097 3300042120 Bacteria 775
701 Ga0466965_0256018 3300044683 Bacteria 940
702 Ga0466966_0180031 3300044684 Bacteria 1283
703 Ga0466966_0473861 3300044684 Bacteria 753
704 Ga0466963_0001738 3300044694 Bacteria 11866
705 Ga0466963_0022259 3300044694 Bacteria 4012
706 Ga0466963_0139269 3300044694 Bacteria 1680
707 Ga0466963_0214943 3300044694 Bacteria 1346
708 Ga0466964_0069867 3300044706 Bacteria 1482
709 Ga0466971_0098857 3300044719 Bacteria 1340
710 Ga0466959_0037694 3300045049 Bacteria 3573
711 Ga0466959_0042235 3300045049 Bacteria 3363
712 Ga0466959_0050502 3300045049 Bacteria 3053
713 Ga0466959_0149684 3300045049 Bacteria 1646
714 Ga0466959_0232645 3300045049 Bacteria 1275
715 Ga0466958_0001703 3300045836 Bacteria 10606
716 Ga0466958_0266968 3300045836 Bacteria 1096
717 Ga0466958_0450580 3300045836 Bacteria 833
718 Ga0466967_0002363 3300045976 Bacteria 11678
719 Ga0466967_0003356 3300045976 Bacteria 10411
720 Ga0466967_0026541 3300045976 Bacteria 4800
721 Ga0466967_0070646 3300045976 Bacteria 3124
722 Ga0466967_0155534 3300045976 Bacteria 2141
723 Ga0466967_0249603 3300045976 Bacteria 1695
724 Ga0466967_0432380 3300045976 Bacteria 1284
725 Ga0466967_0688114 3300045976 Bacteria 1012
726 Ga0495592_0000311 3300046454 Bacteria 40958
727 Ga0495592_0000527 3300046454 Bacteria 27616
728 Ga0495592_0025649 3300046454 Bacteria 4473
729 Ga0495592_0034230 3300046454 Bacteria 3830
730 Ga0495592_0050225 3300046454 Bacteria 3099
731 Ga0495592_0110199 3300046454 Bacteria 1949
732 Ga0495592_0205353 3300046454 Bacteria 1327
733 Ga0495603_0208477 3300046455 Bacteria 1129
734 Ga0495603_0276899 3300046455 Bacteria 965
735 Ga0495629_0015038 3300046459 Bacteria 5562
736 Ga0495629_0033434 3300046459 Bacteria 3637
737 Ga0495629_0078458 3300046459 Bacteria 2305
738 Ga0495629_0161204 3300046459 Bacteria 1558
739 Ga0495629_0182369 3300046459 Bacteria 1455
740 Ga0495641_0007063 3300046461 Bacteria 7113
741 Ga0495641_0063175 3300046461 Bacteria 1669
742 Ga0495641_0064991 3300046461 Bacteria 1642
743 Ga0495651_0000040 3300046462 Bacteria 94890
744 Ga0495651_0000432 3300046462 Bacteria 32343
745 Ga0495651_0010333 3300046462 Bacteria 7172
746 Ga0495651_0012108 3300046462 Bacteria 6636
747 Ga0495651_0020217 3300046462 Bacteria 5167
748 Ga0495651_0040043 3300046462 Bacteria 3645
749 Ga0495651_0061895 3300046462 Bacteria 2864
750 Ga0495651_0080139 3300046462 Bacteria 2466
751 Ga0495651_0102253 3300046462 Bacteria 2131
752 Ga0495651_0131711 3300046462 Bacteria 1824
753 Ga0495651_0260350 3300046462 Bacteria 1180
754 Ga0495653_0001251 3300046463 Bacteria 19664
755 Ga0495653_0007460 3300046463 Bacteria 8947
756 Ga0495653_0010425 3300046463 Bacteria 7603
757 Ga0495653_0013540 3300046463 Bacteria 6648
758 Ga0495653_0023183 3300046463 Bacteria 5019
759 Ga0495653_0058167 3300046463 Bacteria 2939
760 Ga0495653_0070742 3300046463 Bacteria 2610
761 Ga0495653_0306885 3300046463 Bacteria 1033
762 Ga0495653_0373008 3300046463 Bacteria 913
763 Ga0495580_0068962 3300046472 Bacteria 2471
764 Ga0495582_0001113 3300046473 Bacteria 15100
765 Ga0495582_0074578 3300046473 Bacteria 1878
766 Ga0495582_0109258 3300046473 Bacteria 1553
767 Ga0495582_0164323 3300046473 Bacteria 1263
768 Ga0495639_0002135 3300046475 Bacteria 8718
769 Ga0495639_0084286 3300046475 Bacteria 1484
770 Ga0495639_0095221 3300046475 Bacteria 1401
771 Ga0495662_0031724 3300046476 Bacteria 2552
772 Ga0495662_0061205 3300046476 Bacteria 1819
773 Ga0495664_0005004 3300046477 Bacteria 7256
774 Ga0495664_0012500 3300046477 Bacteria 4808
775 Ga0495664_0047329 3300046477 Bacteria 2552
776 Ga0495664_0124224 3300046477 Bacteria 1561
777 Ga0495664_0143344 3300046477 Bacteria 1448
778 Ga0495664_0402642 3300046477 Bacteria 822
779 Ga0495594_0016153 3300046499 Bacteria 3930
780 Ga0495594_0119789 3300046499 Bacteria 1487
781 Ga0495594_0123368 3300046499 Bacteria 1465
782 Ga0495596_0036764 3300046500 Bacteria 1939
783 Ga0495608_0000044 3300046511 Bacteria 108171
784 Ga0495608_0003725 3300046511 Bacteria 10952
785 Ga0495608_0013028 3300046511 Bacteria 5769
786 Ga0495608_0041756 3300046511 Bacteria 3068
787 Ga0495608_0052083 3300046511 Bacteria 2710
788 Ga0495608_0063252 3300046511 Bacteria 2429
789 Ga0495608_0071915 3300046511 Bacteria 2256
790 Ga0495608_0113406 3300046511 Bacteria 1741
791 Ga0495608_0230472 3300046511 Bacteria 1160
792 Ga0495618_0008862 3300046514 Bacteria 6072
793 Ga0495618_0012673 3300046514 Bacteria 5123
794 Ga0495618_0074891 3300046514 Bacteria 2156
795 Ga0495618_0169551 3300046514 Bacteria 1389
796 Ga0495628_0000123 3300046516 Bacteria 64063
797 Ga0495628_0001019 3300046516 Bacteria 25587
798 Ga0495628_0015522 3300046516 Bacteria 6359
799 Ga0495628_0025365 3300046516 Bacteria 4843
800 Ga0495628_0064278 3300046516 Bacteria 2873
801 Ga0495628_0087795 3300046516 Bacteria 2411
802 Ga0495628_0098527 3300046516 Bacteria 2258
803 Ga0495630_0001285 3300046517 Bacteria 17291
804 Ga0495630_0017790 3300046517 Bacteria 5211
805 Ga0495630_0236059 3300046517 Bacteria 1397
806 Ga0495630_0337205 3300046517 Bacteria 1153
807 Ga0495630_0387584 3300046517 Bacteria 1070
808 Ga0495666_0050744 3300046526 Bacteria 1994
809 Ga0495666_0088624 3300046526 Bacteria 1461
810 Ga0495652_0000108 3300046529 Bacteria 89636
811 Ga0495652_0002108 3300046529 Bacteria 20955
812 Ga0495652_0047091 3300046529 Bacteria 3699
813 Ga0495652_0054033 3300046529 Bacteria 3421
814 Ga0495652_0122964 3300046529 Bacteria 2066
815 Ga0495652_0256085 3300046529 Bacteria 1294
816 Ga0495652_0300368 3300046529 Bacteria 1167
817 Ga0495665_0001114 3300046531 Bacteria 14219
818 Ga0495640_0000776 3300046533 Bacteria 24055
819 Ga0495640_0031026 3300046533 Bacteria 3819
820 Ga0495640_0357501 3300046533 Bacteria 901
821 Ga0495586_0028909 3300046535 Bacteria 2967
822 Ga0495586_0031543 3300046535 Bacteria 2839
823 Ga0495587_0000046 3300046536 Bacteria 108171
824 Ga0495587_0001714 3300046536 Bacteria 14640
825 Ga0495587_0009527 3300046536 Bacteria 6220
826 Ga0495587_0022981 3300046536 Bacteria 3834
827 Ga0495587_0023110 3300046536 Bacteria 3823
828 Ga0495587_0058683 3300046536 Bacteria 2260
829 Ga0495587_0103208 3300046536 Bacteria 1641
830 Ga0495587_0153456 3300046536 Bacteria 1312
831 Ga0495587_0217118 3300046536 Bacteria 1079
832 Ga0495609_0072602 3300046538 Bacteria 1511
833 Ga0495645_0001345 3300046543 Bacteria 16609
834 Ga0495645_0015292 3300046543 Bacteria 5456
835 Ga0495645_0032378 3300046543 Bacteria 3814
836 Ga0495645_0078708 3300046543 Bacteria 2369
837 Ga0495645_0084006 3300046543 Bacteria 2281
838 Ga0495645_0177101 3300046543 Bacteria 1464
839 Ga0495645_0229657 3300046543 Bacteria 1244
840 Ga0495645_0272482 3300046543 Bacteria 1116
841 Ga0495645_0309437 3300046543 Bacteria 1029
842 Ga0495667_0000066 3300046559 Bacteria 84361
843 Ga0495667_0000469 3300046559 Bacteria 25713
844 Ga0495667_0000828 3300046559 Bacteria 19968
845 Ga0495667_0009982 3300046559 Bacteria 6428
846 Ga0495667_0014660 3300046559 Bacteria 5296
847 Ga0495667_0033979 3300046559 Bacteria 3410
848 Ga0495667_0049490 3300046559 Bacteria 2775
849 Ga0495667_0123994 3300046559 Bacteria 1667
850 Ga0495667_0167185 3300046559 Bacteria 1414
851 Ga0495667_0168443 3300046559 Bacteria 1408
852 Ga0495667_0183342 3300046559 Bacteria 1342
853 Ga0495667_0311125 3300046559 Bacteria 997
854 Ga0495667_0434734 3300046559 Bacteria 825
855 Ga0495635_0001007 3300046663 Bacteria 18614
856 Ga0495635_0008192 3300046663 Bacteria 7300
857 Ga0495635_0020988 3300046663 Bacteria 4552
858 Ga0495635_0050191 3300046663 Bacteria 2876
859 Ga0495635_0075969 3300046663 Bacteria 2302
860 Ga0495635_0116471 3300046663 Bacteria 1824
861 Ga0495635_0125870 3300046663 Bacteria 1747
862 Ga0495659_0133478 3300046664 Bacteria 986
863 Ga0495661_0194526 3300046665 Bacteria 1066
864 Ga0495588_0094796 3300046674 Bacteria 1565
865 Ga0495588_0205190 3300046674 Bacteria 1041
866 Ga0495657_0001421 3300046675 Bacteria 20698
867 Ga0495657_0002047 3300046675 Bacteria 17180
868 Ga0495657_0009366 3300046675 Bacteria 7428
869 Ga0495657_0010865 3300046675 Bacteria 6834
870 Ga0495657_0012482 3300046675 Bacteria 6311
871 Ga0495657_0027401 3300046675 Bacteria 4021
872 Ga0495657_0066536 3300046675 Bacteria 2367
873 Ga0495657_0074526 3300046675 Bacteria 2208
874 Ga0495657_0080349 3300046675 Bacteria 2110
875 Ga0495599_0000052 3300046678 Bacteria 80904
876 Ga0495599_0000263 3300046678 Bacteria 33149
877 Ga0495599_0036098 3300046678 Bacteria 3103
878 Ga0495599_0039707 3300046678 Bacteria 2957
879 Ga0495599_0243119 3300046678 Bacteria 1097
880 Ga0495623_0000798 3300046679 Bacteria 21190
881 Ga0495623_0005605 3300046679 Bacteria 8195
882 Ga0495623_0020411 3300046679 Bacteria 4282
883 Ga0495623_0046126 3300046679 Bacteria 2767
884 Ga0495623_0072707 3300046679 Bacteria 2138
885 Ga0495623_0093873 3300046679 Bacteria 1836
886 Ga0495646_0000483 3300046680 Bacteria 21207
887 Ga0495646_0002352 3300046680 Bacteria 11579
888 Ga0495646_0014166 3300046680 Bacteria 5069
889 Ga0495646_0043510 3300046680 Bacteria 2749
890 Ga0495647_0009226 3300046681 Bacteria 3335
891 Ga0495658_0024122 3300046683 Bacteria 3236
892 Ga0495658_0119828 3300046683 Bacteria 1590
893 Ga0495658_0125229 3300046683 Bacteria 1558
894 Ga0495613_0030148 3300046689 Bacteria 4029
895 Ga0495613_0080268 3300046689 Bacteria 2371
896 Ga0495613_0118503 3300046689 Bacteria 1903
897 Ga0495613_0336763 3300046689 Bacteria 1039
898 Ga0495649_0226596 3300046694 Bacteria 966
899 Ga0495589_0105353 3300046794 Bacteria 1363
900 Ga0495600_0000363 3300046809 Bacteria 23755
901 Ga0495600_0021707 3300046809 Bacteria 4116
902 Ga0495600_0037041 3300046809 Bacteria 3170
903 Ga0495600_0037705 3300046809 Bacteria 3143
904 Ga0495600_0259053 3300046809 Bacteria 1105
905 Ga0495581_0012735 3300047315 Bacteria 4871
906 Ga0495581_0012822 3300047315 Bacteria 4854
907 Ga0495581_0080938 3300047315 Bacteria 1880
908 Ga0495604_0000049 3300047317 Bacteria 108620
909 Ga0495604_0000825 3300047317 Bacteria 25886
910 Ga0495604_0019323 3300047317 Bacteria 5453
911 Ga0495604_0044702 3300047317 Bacteria 3458
912 Ga0495604_0046769 3300047317 Bacteria 3373
913 Ga0495604_0077899 3300047317 Bacteria 2489
914 Ga0495604_0172570 3300047317 Bacteria 1519
915 Ga0495604_0457968 3300047317 Bacteria 832
916 Ga0495674_0000509 3300047319 Bacteria 35677
917 Ga0495674_0001040 3300047319 Bacteria 26667
918 Ga0495674_0008480 3300047319 Bacteria 9791
919 Ga0495674_0013623 3300047319 Bacteria 7639
920 Ga0495674_0112862 3300047319 Bacteria 2302
921 Ga0495674_0246133 3300047319 Bacteria 1472
922 Ga0495674_0288562 3300047319 Bacteria 1342
923 Ga0495674_0449266 3300047319 Bacteria 1036
924 Ga0495676_0004008 3300047321 Bacteria 13401
925 Ga0495676_0095986 3300047321 Bacteria 2205
926 Ga0495680_0000915 3300047322 Bacteria 32763
927 Ga0495680_0001981 3300047322 Bacteria 21515
928 Ga0495680_0002008 3300047322 Bacteria 21353
929 Ga0495680_0008614 3300047322 Bacteria 9259
930 Ga0495680_0011345 3300047322 Bacteria 7895
931 Ga0495680_0019480 3300047322 Bacteria 5724
932 Ga0495680_0040654 3300047322 Bacteria 3703
933 Ga0495680_0049169 3300047322 Bacteria 3304
934 Ga0495680_0220013 3300047322 Bacteria 1356
935 Ga0495680_0278034 3300047322 Bacteria 1180
936 Ga0495675_0000684 3300047444 Bacteria 21297
937 Ga0495675_0015403 3300047444 Bacteria 4836
938 Ga0495675_0041410 3300047444 Bacteria 2936
939 Ga0495675_0074908 3300047444 Bacteria 2133
940 Ga0495675_0146438 3300047444 Bacteria 1461
941 Ga0495684_0001813 3300047471 Bacteria 17172
942 Ga0495684_0009204 3300047471 Bacteria 7624
943 Ga0495684_0018650 3300047471 Bacteria 5346
944 Ga0495684_0105690 3300047471 Bacteria 2127
945 Ga0495684_0123412 3300047471 Bacteria 1949
946 Ga0495684_0197743 3300047471 Bacteria 1483
947 Ga0495593_0009273 3300047673 Bacteria 5709
948 Ga0495593_0014329 3300047673 Bacteria 4507
949 Ga0495593_0074512 3300047673 Bacteria 1760
950 Ga0495593_0173797 3300047673 Bacteria 1085
951 Ga0495602_0001642 3300048088 Bacteria 22253
952 Ga0495602_0002204 3300048088 Bacteria 19673
953 Ga0495602_0020733 3300048088 Bacteria 6490
954 Ga0495602_0027368 3300048088 Bacteria 5478
955 Ga0495602_0062190 3300048088 Bacteria 3240
956 Ga0495602_0079517 3300048088 Bacteria 2765
957 Ga0495602_0109412 3300048088 Bacteria 2248
958 Ga0495602_0247131 3300048088 Bacteria 1331
959 Ga0495602_0496751 3300048088 Bacteria 853
960 Ga0495614_0074477 3300048089 Bacteria 1466
961 Ga0496100_0004806 3300048903 Bacteria 7216
962 Ga0496100_0011762 3300048903 Bacteria 4992
963 Ga0496100_0049972 3300048903 Bacteria 2707
964 Ga0496100_0058398 3300048903 Bacteria 2531
965 Ga0496100_0518683 3300048903 Bacteria 919
966 Ga0496101_0002482 3300048904 Bacteria 11324
967 Ga0496101_0024549 3300048904 Bacteria 4172
968 Ga0496101_0040092 3300048904 Bacteria 3335
969 Ga0496101_0046218 3300048904 Bacteria 3121
970 Ga0496101_0171689 3300048904 Bacteria 1667
971 Ga0496101_0217063 3300048904 Bacteria 1483
972 Ga0496102_0008128 3300048905 Bacteria 8978
973 Ga0496102_0034483 3300048905 Bacteria 4552
974 Ga0496102_0054604 3300048905 Bacteria 3643
975 Ga0496102_0101511 3300048905 Bacteria 2673
976 Ga0496102_0105239 3300048905 Bacteria 2625
977 Ga0496102_0158274 3300048905 Bacteria 2130
978 Ga0496102_0161595 3300048905 Bacteria 2107
979 Ga0496102_0226605 3300048905 Bacteria 1762
980 Ga0496102_0626775 3300048905 Bacteria 998
981 Ga0496103_0013448 3300048906 Bacteria 4854
982 Ga0496103_0015143 3300048906 Bacteria 4585
983 Ga0496103_0082878 3300048906 Bacteria 2019
984 Ga0496104_0000254 3300048907 Bacteria 47479
985 Ga0496104_0005355 3300048907 Bacteria 11230
986 Ga0496104_0044635 3300048907 Bacteria 4164
987 Ga0496104_0088201 3300048907 Bacteria 2963
988 Ga0496104_0091180 3300048907 Bacteria 2913
989 Ga0496104_0345648 3300048907 Bacteria 1400
990 Ga0496105_0000055 3300048908 Bacteria 88389
991 Ga0496105_0010310 3300048908 Bacteria 7345
992 Ga0496105_0019105 3300048908 Bacteria 5523
993 Ga0496105_0027732 3300048908 Bacteria 4629
994 Ga0496105_0057708 3300048908 Bacteria 3205
995 Ga0496105_0165916 3300048908 Bacteria 1812
996 Ga0496105_0368167 3300048908 Bacteria 1145
997 Ga0496106_0011555 3300048909 Bacteria 6527
998 Ga0496106_0022778 3300048909 Bacteria 4653
999 Ga0496106_0072293 3300048909 Bacteria 2637
1000 Ga0496106_0133446 3300048909 Bacteria 1948
1001 Ga0496106_0164377 3300048909 Bacteria 1756
1002 Ga0496106_0222863 3300048909 Bacteria 1504
1003 Ga0496107_0012905 3300048910 Bacteria 5840
1004 Ga0496107_0014053 3300048910 Bacteria 5604
1005 Ga0496107_0028240 3300048910 Bacteria 3986
1006 Ga0496107_0105210 3300048910 Bacteria 2071
1007 Ga0496107_0147581 3300048910 Bacteria 1739
1008 Ga0496108_0001045 3300048911 Bacteria 21549
1009 Ga0496108_0006864 3300048911 Bacteria 9213
1010 Ga0496108_0022625 3300048911 Bacteria 5169
1011 Ga0496108_0024614 3300048911 Bacteria 4957
1012 Ga0496108_0030222 3300048911 Bacteria 4490
1013 Ga0496108_0065294 3300048911 Bacteria 3068
1014 Ga0496108_0136924 3300048911 Bacteria 2108
1015 Ga0496108_0151036 3300048911 Bacteria 2004
1016 Ga0496108_0154859 3300048911 Bacteria 1979
1017 Ga0496108_0201227 3300048911 Bacteria 1728
1018 Ga0496109_0001932 3300048912 Bacteria 17223
1019 Ga0496109_0027051 3300048912 Bacteria 5118
1020 Ga0496109_0034509 3300048912 Bacteria 4557
1021 Ga0496109_0087898 3300048912 Bacteria 2871
1022 Ga0496109_0285301 3300048912 Bacteria 1556
1023 Ga0496109_0287768 3300048912 Bacteria 1549
1024 Ga0496109_0317383 3300048912 Bacteria 1470
1025 Ga0496109_0337535 3300048912 Bacteria 1423
1026 Ga0496109_0344197 3300048912 Bacteria 1408
1027 Ga0496109_0376488 3300048912 Bacteria 1341
1028 Ga0496109_0397230 3300048912 Bacteria 1302
1029 Ga0496109_0627552 3300048912 Bacteria 1011
1030 Ga0496110_0001472 3300048913 Bacteria 17050
1031 Ga0496110_0015265 3300048913 Bacteria 6388
1032 Ga0496110_0024503 3300048913 Bacteria 5142
1033 Ga0496110_0039557 3300048913 Bacteria 4106
1034 Ga0496110_0060635 3300048913 Bacteria 3337
1035 Ga0496110_0078534 3300048913 Bacteria 2938
1036 Ga0496110_0080758 3300048913 Bacteria 2898
1037 Ga0496110_0202524 3300048913 Bacteria 1803
1038 Ga0496110_0533108 3300048913 Bacteria 1068
1039 Ga0496111_0000582 3300048914 Bacteria 19124
1040 Ga0496111_0006467 3300048914 Bacteria 7613
1041 Ga0496111_0010734 3300048914 Bacteria 6160
1042 Ga0496111_0010771 3300048914 Bacteria 6146
1043 Ga0496111_0020021 3300048914 Bacteria 4655
1044 Ga0496111_0059459 3300048914 Bacteria 2769
1045 Ga0496111_0105585 3300048914 Bacteria 2073
1046 Ga0496111_0118417 3300048914 Bacteria 1955
1047 Ga0496111_0125298 3300048914 Bacteria 1898
1048 Ga0496112_0035013 3300048915 Bacteria 4887
1049 Ga0496112_0144166 3300048915 Bacteria 2350
1050 Ga0496112_0246516 3300048915 Bacteria 1738
1051 Ga0496113_0032179 3300048916 Bacteria 3810
1052 Ga0496113_0037996 3300048916 Bacteria 3537
1053 Ga0496113_0080207 3300048916 Bacteria 2499
1054 Ga0496113_0269416 3300048916 Bacteria 1361
1055 Ga0496114_0000256 3300048917 Bacteria 38442
1056 Ga0496114_0002055 3300048917 Bacteria 15319
1057 Ga0496114_0008450 3300048917 Bacteria 8158
1058 Ga0496114_0023237 3300048917 Bacteria 5058
1059 Ga0496114_0039944 3300048917 Bacteria 3883
1060 Ga0496114_0069098 3300048917 Bacteria 2966
1061 Ga0496114_0077619 3300048917 Bacteria 2800
1062 Ga0496114_0095689 3300048917 Bacteria 2527
1063 Ga0496114_0180586 3300048917 Bacteria 1843
1064 Ga0496114_0212649 3300048917 Bacteria 1696
1065 Ga0496114_0227410 3300048917 Bacteria 1638
1066 Ga0496114_0264213 3300048917 Bacteria 1516
1067 Ga0496114_0329684 3300048917 Bacteria 1349
1068 Ga0496114_0440618 3300048917 Bacteria 1154
1069 Ga0496115_0004783 3300048918 Bacteria 9828
1070 Ga0496115_0061389 3300048918 Bacteria 3030
1071 Ga0496115_0107103 3300048918 Bacteria 2295
1072 Ga0496115_0128386 3300048918 Bacteria 2089
1073 Ga0496115_0147106 3300048918 Bacteria 1945
1074 Ga0496115_0344185 3300048918 Bacteria 1216
1075 Ga0496115_0387211 3300048918 Bacteria 1136
1076 Ga0496115_0521682 3300048918 Bacteria 952
1077 Ga0496126_0105857 3300048929 Bacteria 2455
1078 Ga0501031_0015677 3300049568 Bacteria 4919
1079 Ga0501031_0038100 3300049568 Bacteria 3138
1080 Ga0501031_0416810 3300049568 Bacteria 868
1081 Ga0501032_0002084 3300049569 Bacteria 15788
1082 Ga0501032_0005781 3300049569 Bacteria 9149
1083 Ga0501033_0006304 3300049570 Bacteria 9293
1084 Ga0501034_0068193 3300049571 Bacteria 3568
1085 Ga0501034_0123205 3300049571 Bacteria 2578
1086 Ga0501036_0000591 3300049572 Bacteria 26291
1087 Ga0501036_0039371 3300049572 Bacteria 4000
1088 Ga0501036_0124304 3300049572 Bacteria 2179
1089 Ga0501036_0370608 3300049572 Bacteria 1195
1090 Ga0501037_0006728 3300049573 Bacteria 8410
1091 Ga0501037_0047819 3300049573 Bacteria 3135
1092 Ga0501037_0292336 3300049573 Bacteria 1133
1093 Ga0501038_0012788 3300049574 Bacteria 7665
1094 Ga0501038_0063219 3300049574 Bacteria 3160
1095 Ga0501039_0011789 3300049575 Bacteria 6657
1096 Ga0501039_0090639 3300049575 Bacteria 2383
1097 Ga0501039_0097604 3300049575 Bacteria 2291
1098 Ga0501039_0125388 3300049575 Bacteria 2014
1099 Ga0501039_0288507 3300049575 Bacteria 1290
1100 Ga0501039_0522005 3300049575 Bacteria 932
1101 Ga0501040_0002817 3300049576 Bacteria 11219
1102 Ga0501040_0008241 3300049576 Bacteria 6778
1103 Ga0501040_0023563 3300049576 Bacteria 4128
1104 Ga0501040_0040508 3300049576 Bacteria 3170
1105 Ga0501040_0094030 3300049576 Bacteria 2085
1106 Ga0501040_0134093 3300049576 Bacteria 1742
1107 Ga0501041_0003917 3300049577 Bacteria 8581
1108 Ga0501041_0027722 3300049577 Bacteria 3415
1109 Ga0501041_0039956 3300049577 Bacteria 2847
1110 Ga0501041_0251157 3300049577 Bacteria 1112
1111 Ga0501042_0009634 3300049578 Bacteria 6449
1112 Ga0501042_0019215 3300049578 Bacteria 4741
1113 Ga0501042_0066304 3300049578 Bacteria 2580
1114 Ga0501042_0088999 3300049578 Bacteria 2215
1115 Ga0501042_0275267 3300049578 Bacteria 1215
1116 Ga0501042_0541380 3300049578 Bacteria 846
1117 Ga0501043_0006662 3300049579 Bacteria 9241
1118 Ga0501043_0090816 3300049579 Bacteria 2402
1119 Ga0501046_0009111 3300049580 Bacteria 8596
1120 Ga0501047_0030083 3300049581 Bacteria 5236
1121 Ga0501048_0003882 3300049582 Bacteria 11373
1122 Ga0501048_0012586 3300049582 Bacteria 6293
1123 Ga0501048_0020300 3300049582 Bacteria 4869
1124 Ga0501048_0095022 3300049582 Bacteria 2102
1125 Ga0501067_0003977 3300049583 Bacteria 8159
1126 Ga0501068_0001816 3300049584 Bacteria 11334
1127 Ga0501068_0008703 3300049584 Bacteria 5658
1128 Ga0501068_0031657 3300049584 Bacteria 3142
1129 Ga0501068_0157342 3300049584 Bacteria 1431
1130 Ga0501069_0205306 3300049585 Bacteria 1142
1131 Ga0501070_0001737 3300049586 Bacteria 19258
1132 Ga0501070_0004106 3300049586 Bacteria 12518
1133 Ga0501070_0045415 3300049586 Bacteria 3654
1134 Ga0501071_0005038 3300049587 Bacteria 8450
1135 Ga0501071_0048965 3300049587 Bacteria 3041
1136 Ga0501071_0067283 3300049587 Bacteria 2605
1137 Ga0501071_0146763 3300049587 Bacteria 1758
1138 Ga0501071_0370971 3300049587 Bacteria 1091
1139 Ga0501071_0382872 3300049587 Bacteria 1073
1140 Ga0501071_0424293 3300049587 Bacteria 1016
1141 Ga0501072_0006718 3300049588 Bacteria 8743
1142 Ga0501072_0007195 3300049588 Bacteria 8443
1143 Ga0501072_0013631 3300049588 Bacteria 6223
1144 Ga0501072_0023338 3300049588 Bacteria 4804
1145 Ga0501072_0065511 3300049588 Bacteria 2865
1146 Ga0501072_0162491 3300049588 Bacteria 1781
1147 Ga0501072_0163134 3300049588 Bacteria 1778
1148 Ga0501072_0222542 3300049588 Bacteria 1504
1149 Ga0501072_0581108 3300049588 Bacteria 884
1150 Ga0501072_0768227 3300049588 Bacteria 755
1151 Ga0501073_0004004 3300049589 Bacteria 11066
1152 Ga0501073_0044173 3300049589 Bacteria 3140
1153 Ga0501074_0013566 3300049590 Bacteria 5923
1154 Ga0501074_0015334 3300049590 Bacteria 5570
1155 Ga0501074_0130070 3300049590 Bacteria 1801
1156 Ga0501074_0288955 3300049590 Bacteria 1165
1157 Ga0501075_0002914 3300049591 Bacteria 11482
1158 Ga0501075_0006299 3300049591 Bacteria 8152
1159 Ga0501075_0016462 3300049591 Bacteria 5326
1160 Ga0501075_0047506 3300049591 Bacteria 3225
1161 Ga0501075_0065586 3300049591 Bacteria 2740
1162 Ga0501075_0110102 3300049591 Bacteria 2094
1163 Ga0501075_0176780 3300049591 Bacteria 1629
1164 Ga0501075_0217638 3300049591 Bacteria 1457
1165 Ga0501075_0267434 3300049591 Bacteria 1303
1166 Ga0501076_0003476 3300049592 Bacteria 11062
1167 Ga0501076_0008871 3300049592 Bacteria 7395
1168 Ga0501076_0032100 3300049592 Bacteria 4097
1169 Ga0501076_0036340 3300049592 Bacteria 3860
1170 Ga0501076_0058198 3300049592 Bacteria 3071
1171 Ga0501076_0138735 3300049592 Bacteria 1975
1172 Ga0501076_0366192 3300049592 Bacteria 1184
1173 Ga0501077_0001647 3300049593 Bacteria 13415
1174 Ga0501077_0002374 3300049593 Bacteria 11305
1175 Ga0501077_0004791 3300049593 Bacteria 8224
1176 Ga0501077_0025032 3300049593 Bacteria 3790
1177 Ga0501077_0045344 3300049593 Bacteria 2793
1178 Ga0501077_0089929 3300049593 Bacteria 1946
1179 Ga0501077_0139551 3300049593 Bacteria 1537
1180 Ga0501079_0016897 3300049741 Bacteria 5573
1181 Ga0501079_0024063 3300049741 Bacteria 4672
1182 Ga0501079_0047864 3300049741 Bacteria 3300
1183 Ga0501079_0048947 3300049741 Bacteria 3262
1184 Ga0501079_0064271 3300049741 Bacteria 2830
1185 Ga0501079_0079306 3300049741 Bacteria 2539
1186 Ga0501079_0154482 3300049741 Bacteria 1789
1187 Ga0501079_0336647 3300049741 Bacteria 1182
1188 Ga0501080_0008162 3300049742 Bacteria 9485
1189 Ga0501080_0011073 3300049742 Bacteria 8252
1190 Ga0501080_0393001 3300049742 Bacteria 1248
1191 Ga0501081_0024191 3300049743 Bacteria 4077
1192 Ga0501081_0026153 3300049743 Bacteria 3932
1193 Ga0501081_0045233 3300049743 Bacteria 3022
1194 Ga0501081_0106530 3300049743 Bacteria 1987
1195 Ga0501083_0008832 3300049744 Bacteria 7112
1196 Ga0501083_0012205 3300049744 Bacteria 6012
1197 Ga0501083_0068855 3300049744 Bacteria 2355
1198 Ga0501083_0101284 3300049744 Bacteria 1899
1199 Ga0501035_0003688 3300049822 Bacteria 14596
1200 Ga0501035_0221003 3300049822 Bacteria 1617
1201 Ga0501035_0257749 3300049822 Bacteria 1479
1202 Ga0501044_0013073 3300049823 Bacteria 8983
1203 Ga0501045_0013916 3300049824 Bacteria 5691
1204 Ga0501045_0017443 3300049824 Bacteria 5097
1205 Ga0501045_0057401 3300049824 Bacteria 2848
1206 Ga0501045_0081790 3300049824 Bacteria 2381
1207 Ga0501045_0199650 3300049824 Bacteria 1490
1208 nmdc:mga03683_9500_c1 3300050489 Bacteria 3462
1209 nmdc:mga03n38_30305_c1 3300050490 Bacteria 2273
1210 nmdc:mga03n38_78687_c1 3300050490 Bacteria 1544
1211 nmdc:mga00v17_13011_c1 3300050491 Bacteria 4610
1212 nmdc:mga00v17_141723_c1 3300050491 Bacteria 1542
1213 nmdc:mga00v17_25280_c1 3300050491 Bacteria 3451
1214 nmdc:mga0yw44_1038_c1 3300050492 Bacteria 10662
1215 nmdc:mga0yw44_185170_c1 3300050492 Bacteria 1372
1216 nmdc:mga0yw44_86706_c1 3300050492 Bacteria 1972
1217 nmdc:mga06z11_71297_c1 3300050494 Bacteria 1839
1218 nmdc:mga04h51_14713_c1 3300050495 Bacteria 2241
1219 nmdc:mga04h51_23717_c1 3300050495 Bacteria 1871
1220 nmdc:mga07m45_71199_c1 3300050496 Bacteria 1978
1221 nmdc:mga05p37_13498_c1 3300050507 Bacteria 9790
1222 nmdc:mga05p37_16833_c1 3300050507 Bacteria 8814
1223 nmdc:mga05p37_361180_c2 3300050507 Bacteria 1080
1224 nmdc:mga05p37_72339_c1 3300050507 Bacteria 4243
1225 nmdc:mga05p37_81894_c1 3300050507 Bacteria 3976
1226 nmdc:mga09592_98003_c1 3300050508 Bacteria 2509
1227 nmdc:mga0qj67_20834_c1 3300050509 Bacteria 3341
1228 nmdc:mga06r32_105647_c1 3300050510 Bacteria 2766
1229 nmdc:mga06r32_16822_c1 3300050510 Bacteria 6669
1230 nmdc:mga08y16_26370_c1 3300050511 Bacteria 6128
1231 nmdc:mga08y16_27729_c1 3300050511 Bacteria 5968
1232 nmdc:mga08y16_37172_c1 3300050511 Bacteria 5114
1233 nmdc:mga08y16_470051_c1 3300050511 Bacteria 1280
1234 nmdc:mga08y16_70851_c1 3300050511 Bacteria 3633
1235 nmdc:mga08y16_71864_c1 3300050511 Bacteria 3605
1236 nmdc:mga0n895_161179_c1 3300050512 Bacteria 2275
1237 nmdc:mga0n895_245084_c1 3300050512 Bacteria 1819
1238 nmdc:mga0n895_366073_c1 3300050512 Bacteria 1460
1239 nmdc:mga0n895_39038_c1 3300050512 Bacteria 4603
1240 nmdc:mga0n895_50222_c1 3300050512 Bacteria 4088
1241 nmdc:mga0n895_838543_c1 3300050512 Bacteria 908
1242 nmdc:mga0rr50_11223_c1 3300050513 Bacteria 5721
1243 nmdc:mga0rr50_295431_c1 3300050513 Bacteria 1354
1244 nmdc:mga08x19_180488_c1 3300050514 Bacteria 1441
1245 nmdc:mga08x19_62858_c1 3300050514 Bacteria 2408
1246 nmdc:mga0a205_115469_c1 3300050515 Bacteria 2583
1247 nmdc:mga0a205_137707_c1 3300050515 Bacteria 2342
1248 nmdc:mga0a205_159635_c1 3300050515 Bacteria 2152
1249 nmdc:mga0a205_197968_c1 3300050515 Bacteria 1900
1250 nmdc:mga0a205_25714_c1 3300050515 Bacteria 5610
1251 nmdc:mga0a205_89620_c1 3300050515 Bacteria 2973
1252 nmdc:mga0sz30_18724_c1 3300050516 Bacteria 2773
1253 Ga0495601_0020423 3300053077 Bacteria 4046
1254 Ga0495601_0021938 3300053077 Bacteria 3916
1255 Ga0495601_0041459 3300053077 Bacteria 2886
1256 Ga0495601_0077649 3300053077 Bacteria 2127
1257 Ga0495601_0098688 3300053077 Bacteria 1885
1258 Ga0495601_0147676 3300053077 Bacteria 1534
1259 Ga0495612_0002621 3300053078 Bacteria 7414
1260 Ga0495612_0090587 3300053078 Bacteria 1294
1261 Ga0495595_0005279 3300053084 Bacteria 5224
1262 Ga0495595_0035215 3300053084 Bacteria 2268
1263 Ga0495595_0042766 3300053084 Bacteria 2076
1264 Ga0495595_0183883 3300053084 Bacteria 1037
1265 Ga0495619_0004394 3300053085 Bacteria 8990
1266 Ga0495619_0013127 3300053085 Bacteria 5220
1267 Ga0495619_0017477 3300053085 Bacteria 4540
1268 Ga0495619_0082854 3300053085 Bacteria 2162
1269 Ga0495619_0087413 3300053085 Bacteria 2107
1270 Ga0495619_0175685 3300053085 Bacteria 1481
1271 Ga0495619_0234006 3300053085 Bacteria 1273
1272 Ga0495619_0347781 3300053085 Bacteria 1026
1273 Ga0501084_0005328 3300054114 Bacteria 10531
1274 Ga0501084_0110156 3300054114 Bacteria 2313
1275 Ga0501084_0136837 3300054114 Bacteria 2062
1276 Ga0501084_0164692 3300054114 Bacteria 1871
1277 Ga0501084_0191748 3300054114 Bacteria 1724
1278 Ga0501084_0331625 3300054114 Bacteria 1285
1279 Ga0501082_0006774 3300060353 Bacteria 9902
1280 Ga0501082_0012448 3300060353 Bacteria 7309
1281 Ga0501082_0034537 3300060353 Bacteria 4358
1282 Ga0501082_0061051 3300060353 Bacteria 3245
1283 Ga0501082_0324933 3300060353 Bacteria 1340
1284 Ga0501082_0449104 3300060353 Bacteria 1126
1285 Ga0466962_0018395 3300061719 Bacteria 3361
1286 Ga0530510_0001773 3300061734 Bacteria 14719
1287 Ga0530510_0021207 3300061734 Bacteria 4621
1288 Ga0530510_0029823 3300061734 Bacteria 3916
1289 Ga0530510_0071060 3300061734 Bacteria 2526
1290 Ga0530510_0168454 3300061734 Bacteria 1622
1291 2753267114 2751185782 Bacteria 11227053
1292 Ga0081540_1059413
1293 rootL2_10015499
1294 JGI25404J52841_10000237
1295 Ga0070658_10047099
1296 Ga0070676_10276945
1297 Ga0070683_100007611
1298 Ga0070683_100014788
1299 Ga0070683_100095658
1300 Ga0070683_100272286
1301 Ga0070683_100427548
1302 Ga0070690_100039157
1303 Ga0070670_100539439
1304 Ga0068869_100160561
1305 Ga0070680_100011226
1306 Ga0070680_100046621
1307 Ga0070680_100059338
1308 Ga0070680_100235341
1309 Ga0070680_100285299
1310 Ga0070682_100012732
1311 Ga0070682_100197546
1312 Ga0070682_100227251
1313 Ga0068868_100123465
1314 Ga0068868_100311897
1315 Ga0068868_100317352
1316 Ga0070660_100013359
1317 Ga0070689_100010689
1318 Ga0070689_100237409
1319 Ga0070687_100041658
1320 Ga0070661_100021551
1321 Ga0070661_100413636
1322 Ga0070692_10003019
1323 Ga0070668_100049423
1324 Ga0070668_100271665
1325 Ga0070669_100126274
1326 Ga0070675_100006014
1327 Ga0070671_100015038
1328 Ga0070671_100261342
1329 Ga0070674_100153889
1330 Ga0070674_100322653
1331 Ga0070673_100011696
1332 Ga0070673_100039781
1333 Ga0070673_100354941
1334 Ga0070688_100005380
1335 Ga0070659_100011096
1336 Ga0070659_100127085
1337 Ga0070659_100278023
1338 Ga0070667_100086800
1339 Ga0070709_10012185
1340 Ga0070709_10021705
1341 Ga0070709_10024809
1342 Ga0070714_100014645
1343 Ga0070714_100041916
1344 Ga0070714_100079967
1345 Ga0070714_100130485
1346 Ga0070713_100023990
1347 Ga0070713_100042357
1348 Ga0070713_100061806
1349 Ga0070713_100185993
1350 Ga0070713_100241101
1351 Ga0070713_100272504
1352 Ga0070713_100277213
1353 Ga0070710_10025738
1354 Ga0070710_10054260
1355 Ga0070710_10055742
1356 Ga0070710_10369199
1357 Ga0070701_10001668
1358 Ga0070711_100038623
1359 Ga0070711_100143041
1360 Ga0070711_100359425
1361 Ga0070711_100375352
1362 Ga0070711_100596988
1363 Ga0070705_100048810
1364 Ga0070700_100025865
1365 Ga0070694_100065947
1366 Ga0070694_100253036
1367 Ga0070708_100204879
1368 Ga0070708_100268473
1369 Ga0070708_100299806
1370 Ga0070663_100015332
1371 Ga0070663_100074075
1372 Ga0070678_100005693
1373 Ga0070678_100023233
1374 Ga0070678_100025740
1375 Ga0070678_100038354
1376 Ga0070678_100039968
1377 Ga0070678_100277132
1378 Ga0070662_100119312
1379 Ga0070681_10028584
1380 Ga0070681_10082738
1381 Ga0070681_10092886
1382 Ga0070681_10363817
1383 Ga0068867_100010705
1384 Ga0070685_10001614
1385 Ga0070706_100008251
1386 Ga0070706_100062383
1387 Ga0070706_100246344
1388 Ga0070707_100040233
1389 Ga0070707_100138119
1390 Ga0070707_100750095
1391 Ga0070698_100002351
1392 Ga0070698_100081412
1393 Ga0070698_100145421
1394 Ga0070698_100168502
1395 Ga0070698_100222614
1396 Ga0070698_100508347
1397 Ga0070698_100806645
1398 Ga0070699_100024741
1399 Ga0070699_100027183
1400 Ga0070699_100081933
1401 Ga0070679_100004020
1402 Ga0070679_100011266
1403 Ga0070679_100113962
1404 Ga0070679_100150313
1405 Ga0070679_100173548
1406 Ga0070684_100039442
1407 Ga0070684_100046268
1408 Ga0070684_100061135
1409 Ga0070684_100074379
1410 Ga0070684_100089813
1411 Ga0070684_100106927
1412 Ga0070684_100359163
1413 Ga0070697_100000480
1414 Ga0068853_100058644
1415 Ga0068853_100186807
1416 Ga0070672_100060447
1417 Ga0070686_100019541
1418 Ga0070686_100124990
1419 Ga0070695_100052160
1420 Ga0070696_100049012
1421 Ga0070696_100202441
1422 Ga0070693_100005137
1423 Ga0070693_100035325
1424 Ga0070693_100165235
1425 Ga0070665_100531107
1426 Ga0070704_100025959
1427 Ga0068855_100175852
1428 Ga0070664_100014886
1429 Ga0070664_100021859
1430 Ga0070664_100160646
1431 Ga0070664_100439364
1432 Ga0068857_100011972
1433 Ga0068857_100136882
1434 Ga0068856_100036063
1435 Ga0068856_100070781
1436 Ga0068856_100071480
1437 Ga0068856_100088638
1438 Ga0068856_100328703
1439 Ga0068856_100482604
1440 Ga0068856_100761745
1441 Ga0070702_100014672
1442 Ga0070702_100100814
1443 Ga0070702_100219328
1444 Ga0070702_100275043
1445 Ga0068852_100211680
1446 Ga0068859_100017374
1447 Ga0068864_100010496
1448 Ga0068864_100208733
1449 Ga0068866_10004410
1450 Ga0068866_10116933
1451 Ga0068861_100010676
1452 Ga0068851_10050125
1453 Ga0068870_10067222
1454 Ga0068870_10123105
1455 Ga0068863_100208041
1456 Ga0068863_100601631
1457 Ga0068863_100819903
1458 Ga0068858_100012604
1459 Ga0068858_100037424
1460 Ga0068858_100249215
1461 Ga0068860_100017643
1462 Ga0068860_100065396
1463 Ga0068860_100088667
1464 Ga0068862_100057713
1465 Ga0081455_10003582
1466 Ga0081455_10023662
1467 Ga0081455_10032587
1468 Ga0081455_10039497
1469 Ga0081455_10084652
1470 Ga0081538_10003610
1471 Ga0081538_10012556
1472 Ga0081538_10069513
1473 Ga0081540_1000936
1474 Ga0081540_1068089
1475 Ga0081539_10005354
1476 Ga0070717_10001324
1477 Ga0070717_10006096
1478 Ga0070717_10023163
1479 Ga0070717_10041201
1480 Ga0070717_10041740
1481 Ga0070717_10046387
1482 Ga0070717_10050868
1483 Ga0070717_10061134
1484 Ga0070717_10097157
1485 Ga0075365_10000551
1486 Ga0075365_10004769
1487 Ga0075365_10313674
1488 Ga0075368_10019378
1489 Ga0075368_10044783
1490 Ga0075368_10047394
1491 Ga0075363_100005505
1492 Ga0075363_100039755
1493 Ga0075363_100075681
1494 Ga0075363_100077460
1495 Ga0075363_100252637
1496 Ga0075364_10003741
1497 Ga0075364_10016558
1498 Ga0075364_10040075
1499 Ga0075364_10243597
1500 Ga0075432_10012318
1501 Ga0075432_10014283
1502 Ga0070715_10014288
1503 Ga0070715_10118581
1504 Ga0070715_10188865
1505 Ga0070716_100265101
1506 Ga0070712_100011634
1507 Ga0070712_100022010
1508 Ga0070712_100055945
1509 Ga0070712_100087827
1510 Ga0070712_100129460
1511 Ga0070712_100212123
1512 Ga0075362_10043341
1513 Ga0075362_10156742
1514 Ga0075367_10037625
1515 Ga0075367_10048254
1516 Ga0075367_10255811
1517 Ga0097621_100014585
1518 Ga0097621_100151140
1519 Ga0075370_10061924
1520 Ga0068871_100006269
1521 Ga0068871_100206822
1522 Ga0075428_100005147
1523 Ga0075430_100636575
1524 Ga0075431_100181903
1525 Ga0075431_100254561
1526 Ga0075433_10060219
1527 Ga0075433_10083867
1528 Ga0075433_10093514
1529 Ga0075433_10121916
1530 Ga0075433_10159160
1531 Ga0075434_100007864
1532 Ga0075434_100173746
1533 Ga0075434_100376501
1534 Ga0075434_100558776
1535 Ga0075429_100089560
1536 Ga0075429_100168608
1537 Ga0075429_100232361
1538 Ga0068865_100047339
1539 Ga0068865_100082886
1540 Ga0075436_100041056
1541 Ga0075436_100202302
1542 Ga0097620_100017374
1543 Ga0075435_100015622
1544 Ga0075435_100018686
1545 Ga0075435_100032377
1546 Ga0075435_100178362
1547 Ga0075435_100525068
1548 Ga0075435_100655278
1549 Ga0099795_10022772
1550 Ga0105240_10662366
1551 Ga0111539_10022685
1552 Ga0111539_10034085
1553 Ga0111539_10096837
1554 Ga0111539_10166545
1555 Ga0105245_10026307
1556 Ga0105245_10032395
1557 Ga0105245_10055135
1558 Ga0105245_10066233
1559 Ga0105245_10094014
1560 Ga0105245_10557600
1561 Ga0105247_10018783
1562 Ga0105247_10136238
1563 Ga0114129_10000926
1564 Ga0114129_10008895
1565 Ga0114129_10041949
1566 Ga0114129_11147598
1567 Ga0105243_10080721
1568 Ga0105243_10151947
1569 Ga0105243_10355355
1570 Ga0105241_10076027
1571 Ga0105241_10200801
1572 Ga0105241_10704692
1573 Ga0105242_10007042
1574 Ga0105242_10024097
1575 Ga0105242_10283292
1576 Ga0105248_10014103
1577 Ga0105248_10026145
1578 Ga0105248_10819917
1579 Ga0105248_11127599
1580 Ga0105237_10129012
1581 Ga0105237_10830945
1582 Ga0105238_10012955
1583 Ga0105238_10593329
1584 Ga0105249_10014381
1585 Ga0105249_10101151
1586 Ga0105249_11128727
1587 Ga0099796_10033381
1588 Ga0099796_10121599
1589 Ga0105239_10063118
1590 Ga0105239_11109202
1591 Ga0105246_10024802
1592 Ga0105246_10080496
1593 Ga0105246_10240817
1594 Ga0157340_1003493
1595 Ga0157338_1008935
1596 Ga0157373_10092233
1597 Ga0157371_10105689
1598 Ga0157369_10072595
1599 Ga0157369_10077811
1600 Ga0157369_10115357
1601 Ga0157369_10851718
1602 Ga0157378_10549956
1603 Ga0157378_10821570
1604 Ga0163162_10012158
1605 Ga0163162_10415145
1606 Ga0157375_10012051
1607 Ga0157375_10191379
1608 Ga0157375_10340894
1609 Ga0163163_10115540
1610 Ga0163163_10204952
1611 Ga0157380_10006251
1612 Ga0157380_10631838
1613 Ga0182008_10296888
1614 Ga0157377_10061398
1615 Ga0157377_10184817
1616 Ga0157377_10197402
1617 Ga0157377_10230537
1618 Ga0157377_10311089
1619 Ga0157377_10530120
1620 Ga0157379_10006395
1621 Ga0157379_10017040
1622 Ga0157376_10005806
1623 Ga0157376_10035530
1624 Ga0157376_10160601
1625 Ga0157376_10679414
1626 Ga0163161_10008515
1627 Ga0163161_10021369
1628 Ga0206356_10213329
1629 Ga0206356_10978510
1630 Ga0206353_11752886
1631 Ga0213874_10001831
1632 Ga0213874_10005759
1633 Ga0213876_10015845
1634 Ga0213876_10029848
1635 Ga0213875_10000934
1636 Ga0213875_10010235
1637 Ga0213875_10018494
1638 Ga0213875_10021540
1639 Ga0213875_10179480
1640 Ga0207656_10035713
1641 Ga0207656_10258600
1642 Ga0207653_10005149
1643 Ga0207692_10017284
1644 Ga0207692_10086879
1645 Ga0207692_10107464
1646 Ga0207692_10217705
1647 Ga0207642_10003988
1648 Ga0207710_10033540
1649 Ga0207688_10015412
1650 Ga0207688_10021594
1651 Ga0207680_10124484
1652 Ga0207685_10106308
1653 Ga0207699_10006382
1654 Ga0207699_10021386
1655 Ga0207699_10033971
1656 Ga0207699_10107677
1657 Ga0207699_10113141
1658 Ga0207699_10138005
1659 Ga0207643_10003445
1660 Ga0207643_10010851
1661 Ga0207684_10007560
1662 Ga0207684_10115814
1663 Ga0207684_10263327
1664 Ga0207684_10506724
1665 Ga0207654_10241170
1666 Ga0207707_10001584
1667 Ga0207693_10014459
1668 Ga0207693_10017499
1669 Ga0207693_10021237
1670 Ga0207693_10182188
1671 Ga0207693_10192779
1672 Ga0207693_10201492
1673 Ga0207693_10236452
1674 Ga0207693_10355262
1675 Ga0207663_10030425
1676 Ga0207663_10055624
1677 Ga0207663_10068956
1678 Ga0207660_10054585
1679 Ga0207660_10083264
1680 Ga0207660_10198304
1681 Ga0207662_10005077
1682 Ga0207657_10001843
1683 Ga0207657_10062133
1684 Ga0207649_10321784
1685 Ga0207649_10608046
1686 Ga0207652_10033721
1687 Ga0207652_10034319
1688 Ga0207652_10070720
1689 Ga0207652_10080065
1690 Ga0207646_10010709
1691 Ga0207646_10015301
1692 Ga0207646_10287335
1693 Ga0207681_10018267
1694 Ga0207681_10166283
1695 Ga0207694_10487920
1696 Ga0207650_10044635
1697 Ga0207650_10111015
1698 Ga0207659_10056399
1699 Ga0207659_10156145
1700 Ga0207687_10036796
1701 Ga0207687_10071637
1702 Ga0207687_10189976
1703 Ga0207687_10374964
1704 Ga0207687_10436315
1705 Ga0207700_10032985
1706 Ga0207700_10068058
1707 Ga0207700_10069439
1708 Ga0207700_10087041
1709 Ga0207700_10128919
1710 Ga0207700_10154442
1711 Ga0207700_10446945
1712 Ga0207700_10456930
1713 Ga0207664_10002425
1714 Ga0207664_10005168
1715 Ga0207664_10015898
1716 Ga0207664_10020974
1717 Ga0207664_10032683
1718 Ga0207664_10039208
1719 Ga0207664_10052909
1720 Ga0207664_10072900
1721 Ga0207664_10460899
1722 Ga0207644_10136573
1723 Ga0207690_10011653
1724 Ga0207690_10065424
1725 Ga0207706_10008643
1726 Ga0207686_10109239
1727 Ga0207709_10011567
1728 Ga0207709_10014406
1729 Ga0207709_10253185
1730 Ga0207670_10005858
1731 Ga0207670_10256130
1732 Ga0207669_10010843
1733 Ga0207669_10128968
1734 Ga0207704_10006943
1735 Ga0207704_10037653
1736 Ga0207665_10041688
1737 Ga0207665_10044459
1738 Ga0207665_10091095
1739 Ga0207665_10185131
1740 Ga0207691_10020083
1741 Ga0207691_10058230
1742 Ga0207711_10015219
1743 Ga0207689_10009295
1744 Ga0207689_10018914
1745 Ga0207661_10006975
1746 Ga0207661_10007758
1747 Ga0207661_10046413
1748 Ga0207661_10057842
1749 Ga0207661_10059390
1750 Ga0207661_10076878
1751 Ga0207661_10537164
1752 Ga0207679_10108982
1753 Ga0207679_10145994
1754 Ga0207679_10581139
1755 Ga0207667_10924513
1756 Ga0207651_10049958
1757 Ga0207651_10570524
1758 Ga0207712_10013444
1759 Ga0207668_10006340
1760 Ga0207668_10059741
1761 Ga0207668_10303624
1762 Ga0207668_10881028
1763 Ga0207703_10007760
1764 Ga0207703_10120627
1765 Ga0207639_10019887
1766 Ga0207639_10057672
1767 Ga0207678_10012485
1768 Ga0207678_10049018
1769 Ga0207678_10288416
1770 Ga0207678_10924451
1771 Ga0207708_10010788
1772 Ga0207708_10214371
1773 Ga0207708_10880563
1774 Ga0207702_10024939
1775 Ga0207702_10039177
1776 Ga0207702_10412804
1777 Ga0207702_10464120
1778 Ga0207702_10567792
1779 Ga0207702_10641501
1780 Ga0207641_10478807
1781 Ga0207641_10532009
1782 Ga0207641_10559965
1783 Ga0207648_10023769
1784 Ga0207648_10043798
1785 Ga0207648_10094750
1786 Ga0207648_10138893
1787 Ga0207676_10227097
1788 Ga0207674_10009266
1789 Ga0207674_10021925
1790 Ga0207674_10278111
1791 Ga0207674_10495346
1792 Ga0207675_100009277
1793 Ga0207675_100016831
1794 Ga0207675_100098975
1795 Ga0207675_100556275
1796 Ga0207683_10006539
1797 Ga0207683_10012640
1798 Ga0207683_10085257
1799 Ga0207683_10348115
1800 Ga0207698_10391364
1801 Ga0209813_10063302
1802 Ga0207428_10016087
1803 Ga0207428_10105603
1804 Ga0268265_10066231
1805 Ga0268265_11058065
1806 Ga0268264_10097244
1807 Ga0265337_1000033
1808 Ga0265337_1035722
1809 Ga0265326_10001841
1810 Ga0265319_1002186
1811 Ga0265334_10006906
1812 Ga0265334_10031619
1813 Ga0265318_10002086
1814 Ga0265318_10009588
1815 Ga0265318_10011629
1816 Ga0265318_10126186
1817 Ga0265323_10004662
1818 Ga0265322_10003011
1819 Ga0265322_10009522
1820 Ga0265322_10051176
1821 Ga0265336_10003443
1822 Ga0265336_10041308
1823 Ga0265338_10000059
1824 Ga0265338_10002834
1825 Ga0265338_10009051
1826 Ga0265338_10026943
1827 Ga0265338_10088243
1828 Ga0265324_10000810
1829 Ga0265330_10064966
1830 Ga0265330_10066888
1831 Ga0265332_10000315
1832 Ga0265332_10112041
1833 Ga0265320_10003479
1834 Ga0265320_10013756
1835 Ga0265320_10073655
1836 Ga0265325_10062542
1837 Ga0265325_10065324
1838 Ga0265329_10049954
1839 Ga0265340_10000168
1840 Ga0265340_10041197
1841 Ga0265340_10084773
1842 Ga0265339_10015478
1843 Ga0265339_10126140
1844 Ga0265331_10054975
1845 Ga0265331_10064200
1846 Ga0265327_10072976
1847 Ga0265327_10165307
1848 Ga0265316_10007783
1849 Ga0265316_10019343
1850 Ga0307509_10168616
1851 Ga0265313_10006538
1852 Ga0265313_10026175
1853 Ga0265313_10164033
1854 Ga0265314_10005746
1855 Ga0265314_10014093
1856 Ga0265314_10045899
1857 Ga0265314_10132511
1858 Ga0265342_10001322
1859 Ga0265342_10040773
1860 Ga0265342_10064181
1861 Ga0307405_10375765
1862 Ga0307416_100178966
1863 Ga0307416_100501622
1864 Ga0373948_0003612
1865 Ga0373948_0061127
1866 Ga0373950_0051435
1867 Ga0373958_0012987
1868 Ga0373958_0013501
1869 Ga0373926_0056484
1870 Ga0373929_0074714
1871 Ga0373934_0002258
1872 Ga0373934_0011853
1873 Ga0373934_0123875
1874 Ga0373949_0002596
1875 Ga0373949_0017890
1876 Ga0373949_0027952
1877 Ga0373923_0008085
1878 Ga0373923_0149773
1879 Ga0373932_0057276
1880 Ga0373936_0011457
1881 Ga0373936_0011809
1882 Ga0373939_0052315
1883 Ga0373945_0002605
1884 Ga0373945_0070097
1885 Ga0373953_0000386
1886 Ga0373953_0002454
1887 Ga0373953_0034216
1888 Ga0373953_0069609
1889 Ga0373953_0106760
1890 Ga0373953_0129062
1891 Ga0373954_0022705
1892 Ga0373954_0050231
1893 Ga0373954_0073094
1894 Ga0373954_0132796
1895 Ga0373956_0001244
1896 Ga0373956_0008563
1897 Ga0373956_0127642
1898 Ga0373956_0155328
1899 Ga0373957_0000246
1900 Ga0373957_0054480
1901 Ga0373957_0066495
1902 Ga0373960_0049976
1903 Ga0373943_0074747
1904 Ga0373946_0115537
1905 Ga0373955_0000228
1906 Ga0373955_0013489
1907 Ga0373955_0044965
1908 Ga0373955_0082384
1909 Ga0373955_0177833
1910 Ga0373955_0226574
1911 Ga0373955_0244728
1912 Ga0373955_0348733
1913 Ga0373942_0005087
1914 Ga0373942_0027404
1915 Ga0373961_0016088
1916 Ga0373961_0018101
1917 Ga0373962_0023258
1918 Ga0316574_0103985
1919 Ga0373924_0002099
1920 Ga0373924_0042617
1921 Ga0373931_0008158
1922 Ga0373931_0091615
1923 Ga0373931_0092396
1924 Ga0373931_0105452
1925 Ga0373927_0009389
1926 Ga0373927_0109158
1927 Ga0373933_0000012
1928 Ga0373933_0018359
1929 Ga0373933_0022298
1930 Ga0373933_0267120
1931 Ga0373933_0294100
1932 Ga0373933_0382669
1933 Ga0373947_0019792
1934 Ga0373947_0048661
1935 Ga0373947_0048860
1936 Ga0373947_0052979
1937 Ga0373947_0056510
1938 Ga0373937_0000040
1939 Ga0373937_0002649
1940 Ga0373937_0003488
1941 Ga0373937_0028479
1942 Ga0373937_0052183
1943 Ga0373937_0057123
1944 Ga0373937_0200759
1945 Ga0373937_0506048
1946 Ga0372808_001465
1947 Ga0373925_0000014
1948 Ga0373925_0004085
1949 Ga0373925_0010821
1950 Ga0373925_0023001
1951 Ga0373925_0077614
1952 Ga0373925_0431063
1953 Ga0395899_0277109
1954 Ga0395900_0155133
1955 Ga0395898_0082521
1956 Ga0395898_0087463
1957 Ga0395898_0736505
1958 Ga0436364_0296603
1959 Ga0436364_0305992
1960 Ga0436364_0330965
1961 Ga0436364_0970657
1962 Ga0436364_1003558
1963 Ga0436364_1091382
1964 Ga0436364_1207495
1965 Ga0436364_1309732
1966 Ga0436364_1515661
1967 Ga0395901_0058914
1968 Ga0395901_0105133
1969 Ga0395901_0563324
1970 Ga0395901_1056289
1971 Ga0400483_027790
1972 Ga0400483_040279
1973 Ga0400483_148576
1974 Ga0436365_0122816
1975 Ga0436365_0501329
1976 Ga0436365_0722652
1977 Ga0436365_0741127
1978 Ga0436365_0772721
1979 Ga0436365_1118937
1980 Ga0436365_1384528
1981 Ga0436365_1709192
1982 Ga0436365_1928355
1983 Ga0436361_0405093
1984 Ga0436363_0275177
1985 Ga0436363_0440163
1986 Ga0436363_0510149
1987 Ga0436363_1273328
1988 Ga0436363_1413520
1989 Ga0436362_0833178
1990 Ga0436362_0953937
1991 Ga0450917_009097
1992 Ga0466965_0256018
1993 Ga0466966_0180031
1994 Ga0466966_0473861
1995 Ga0466963_0001738
1996 Ga0466963_0022259
1997 Ga0466963_0139269
1998 Ga0466963_0214943
1999 Ga0466964_0069867
2000 Ga0466971_0098857
2001 Ga0466959_0037694
2002 Ga0466959_0042235
2003 Ga0466959_0050502
2004 Ga0466959_0149684
2005 Ga0466959_0232645
2006 Ga0466958_0001703
2007 Ga0466958_0266968
2008 Ga0466958_0450580
2009 Ga0466967_0002363
2010 Ga0466967_0003356
2011 Ga0466967_0026541
2012 Ga0466967_0070646
2013 Ga0466967_0155534
2014 Ga0466967_0249603
2015 Ga0466967_0432380
2016 Ga0466967_0688114
2017 Ga0495592_0000311
2018 Ga0495592_0000527
2019 Ga0495592_0025649
2020 Ga0495592_0034230
2021 Ga0495592_0050225
2022 Ga0495592_0110199
2023 Ga0495592_0205353
2024 Ga0495603_0208477
2025 Ga0495603_0276899
2026 Ga0495629_0015038
2027 Ga0495629_0033434
2028 Ga0495629_0078458
2029 Ga0495629_0161204
2030 Ga0495629_0182369
2031 Ga0495641_0007063
2032 Ga0495641_0063175
2033 Ga0495641_0064991
2034 Ga0495651_0000040
2035 Ga0495651_0000432
2036 Ga0495651_0010333
2037 Ga0495651_0012108
2038 Ga0495651_0020217
2039 Ga0495651_0040043
2040 Ga0495651_0061895
2041 Ga0495651_0080139
2042 Ga0495651_0102253
2043 Ga0495651_0131711
2044 Ga0495651_0260350
2045 Ga0495653_0001251
2046 Ga0495653_0007460
2047 Ga0495653_0010425
2048 Ga0495653_0013540
2049 Ga0495653_0023183
2050 Ga0495653_0058167
2051 Ga0495653_0070742
2052 Ga0495653_0306885
2053 Ga0495653_0373008
2054 Ga0495580_0068962
2055 Ga0495582_0001113
2056 Ga0495582_0074578
2057 Ga0495582_0109258
2058 Ga0495582_0164323
2059 Ga0495639_0002135
2060 Ga0495639_0084286
2061 Ga0495639_0095221
2062 Ga0495662_0031724
2063 Ga0495662_0061205
2064 Ga0495664_0005004
2065 Ga0495664_0012500
2066 Ga0495664_0047329
2067 Ga0495664_0124224
2068 Ga0495664_0143344
2069 Ga0495664_0402642
2070 Ga0495594_0016153
2071 Ga0495594_0119789
2072 Ga0495594_0123368
2073 Ga0495596_0036764
2074 Ga0495608_0000044
2075 Ga0495608_0003725
2076 Ga0495608_0013028
2077 Ga0495608_0041756
2078 Ga0495608_0052083
2079 Ga0495608_0063252
2080 Ga0495608_0071915
2081 Ga0495608_0113406
2082 Ga0495608_0230472
2083 Ga0495618_0008862
2084 Ga0495618_0012673
2085 Ga0495618_0074891
2086 Ga0495618_0169551
2087 Ga0495628_0000123
2088 Ga0495628_0001019
2089 Ga0495628_0015522
2090 Ga0495628_0025365
2091 Ga0495628_0064278
2092 Ga0495628_0087795
2093 Ga0495628_0098527
2094 Ga0495630_0001285
2095 Ga0495630_0017790
2096 Ga0495630_0236059
2097 Ga0495630_0337205
2098 Ga0495630_0387584
2099 Ga0495666_0050744
2100 Ga0495666_0088624
2101 Ga0495652_0000108
2102 Ga0495652_0002108
2103 Ga0495652_0047091
2104 Ga0495652_0054033
2105 Ga0495652_0122964
2106 Ga0495652_0256085
2107 Ga0495652_0300368
2108 Ga0495665_0001114
2109 Ga0495640_0000776
2110 Ga0495640_0031026
2111 Ga0495640_0357501
2112 Ga0495586_0028909
2113 Ga0495586_0031543
2114 Ga0495587_0000046
2115 Ga0495587_0001714
2116 Ga0495587_0009527
2117 Ga0495587_0022981
2118 Ga0495587_0023110
2119 Ga0495587_0058683
2120 Ga0495587_0103208
2121 Ga0495587_0153456
2122 Ga0495587_0217118
2123 Ga0495609_0072602
2124 Ga0495645_0001345
2125 Ga0495645_0015292
2126 Ga0495645_0032378
2127 Ga0495645_0078708
2128 Ga0495645_0084006
2129 Ga0495645_0177101
2130 Ga0495645_0229657
2131 Ga0495645_0272482
2132 Ga0495645_0309437
2133 Ga0495667_0000066
2134 Ga0495667_0000469
2135 Ga0495667_0000828
2136 Ga0495667_0009982
2137 Ga0495667_0014660
2138 Ga0495667_0033979
2139 Ga0495667_0049490
2140 Ga0495667_0123994
2141 Ga0495667_0167185
2142 Ga0495667_0168443
2143 Ga0495667_0183342
2144 Ga0495667_0311125
2145 Ga0495667_0434734
2146 Ga0495635_0001007
2147 Ga0495635_0008192
2148 Ga0495635_0020988
2149 Ga0495635_0050191
2150 Ga0495635_0075969
2151 Ga0495635_0116471
2152 Ga0495635_0125870
2153 Ga0495659_0133478
2154 Ga0495661_0194526
2155 Ga0495588_0094796
2156 Ga0495588_0205190
2157 Ga0495657_0001421
2158 Ga0495657_0002047
2159 Ga0495657_0009366
2160 Ga0495657_0010865
2161 Ga0495657_0012482
2162 Ga0495657_0027401
2163 Ga0495657_0066536
2164 Ga0495657_0074526
2165 Ga0495657_0080349
2166 Ga0495599_0000052
2167 Ga0495599_0000263
2168 Ga0495599_0036098
2169 Ga0495599_0039707
2170 Ga0495599_0243119
2171 Ga0495623_0000798
2172 Ga0495623_0005605
2173 Ga0495623_0020411
2174 Ga0495623_0046126
2175 Ga0495623_0072707
2176 Ga0495623_0093873
2177 Ga0495646_0000483
2178 Ga0495646_0002352
2179 Ga0495646_0014166
2180 Ga0495646_0043510
2181 Ga0495647_0009226
2182 Ga0495658_0024122
2183 Ga0495658_0119828
2184 Ga0495658_0125229
2185 Ga0495613_0030148
2186 Ga0495613_0080268
2187 Ga0495613_0118503
2188 Ga0495613_0336763
2189 Ga0495649_0226596
2190 Ga0495589_0105353
2191 Ga0495600_0000363
2192 Ga0495600_0021707
2193 Ga0495600_0037041
2194 Ga0495600_0037705
2195 Ga0495600_0259053
2196 Ga0495581_0012735
2197 Ga0495581_0012822
2198 Ga0495581_0080938
2199 Ga0495604_0000049
2200 Ga0495604_0000825
2201 Ga0495604_0019323
2202 Ga0495604_0044702
2203 Ga0495604_0046769
2204 Ga0495604_0077899
2205 Ga0495604_0172570
2206 Ga0495604_0457968
2207 Ga0495674_0000509
2208 Ga0495674_0001040
2209 Ga0495674_0008480
2210 Ga0495674_0013623
2211 Ga0495674_0112862
2212 Ga0495674_0246133
2213 Ga0495674_0288562
2214 Ga0495674_0449266
2215 Ga0495676_0004008
2216 Ga0495676_0095986
2217 Ga0495680_0000915
2218 Ga0495680_0001981
2219 Ga0495680_0002008
2220 Ga0495680_0008614
2221 Ga0495680_0011345
2222 Ga0495680_0019480
2223 Ga0495680_0040654
2224 Ga0495680_0049169
2225 Ga0495680_0220013
2226 Ga0495680_0278034
2227 Ga0495675_0000684
2228 Ga0495675_0015403
2229 Ga0495675_0041410
2230 Ga0495675_0074908
2231 Ga0495675_0146438
2232 Ga0495684_0001813
2233 Ga0495684_0009204
2234 Ga0495684_0018650
2235 Ga0495684_0105690
2236 Ga0495684_0123412
2237 Ga0495684_0197743
2238 Ga0495593_0009273
2239 Ga0495593_0014329
2240 Ga0495593_0074512
2241 Ga0495593_0173797
2242 Ga0495602_0001642
2243 Ga0495602_0002204
2244 Ga0495602_0020733
2245 Ga0495602_0027368
2246 Ga0495602_0062190
2247 Ga0495602_0079517
2248 Ga0495602_0109412
2249 Ga0495602_0247131
2250 Ga0495602_0496751
2251 Ga0495614_0074477
2252 Ga0496100_0004806
2253 Ga0496100_0011762
2254 Ga0496100_0049972
2255 Ga0496100_0058398
2256 Ga0496100_0518683
2257 Ga0496101_0002482
2258 Ga0496101_0024549
2259 Ga0496101_0040092
2260 Ga0496101_0046218
2261 Ga0496101_0171689
2262 Ga0496101_0217063
2263 Ga0496102_0008128
2264 Ga0496102_0034483
2265 Ga0496102_0054604
2266 Ga0496102_0101511
2267 Ga0496102_0105239
2268 Ga0496102_0158274
2269 Ga0496102_0161595
2270 Ga0496102_0226605
2271 Ga0496102_0626775
2272 Ga0496103_0013448
2273 Ga0496103_0015143
2274 Ga0496103_0082878
2275 Ga0496104_0000254
2276 Ga0496104_0005355
2277 Ga0496104_0044635
2278 Ga0496104_0088201
2279 Ga0496104_0091180
2280 Ga0496104_0345648
2281 Ga0496105_0000055
2282 Ga0496105_0010310
2283 Ga0496105_0019105
2284 Ga0496105_0027732
2285 Ga0496105_0057708
2286 Ga0496105_0165916
2287 Ga0496105_0368167
2288 Ga0496106_0011555
2289 Ga0496106_0022778
2290 Ga0496106_0072293
2291 Ga0496106_0133446
2292 Ga0496106_0164377
2293 Ga0496106_0222863
2294 Ga0496107_0012905
2295 Ga0496107_0014053
2296 Ga0496107_0028240
2297 Ga0496107_0105210
2298 Ga0496107_0147581
2299 Ga0496108_0001045
2300 Ga0496108_0006864
2301 Ga0496108_0022625
2302 Ga0496108_0024614
2303 Ga0496108_0030222
2304 Ga0496108_0065294
2305 Ga0496108_0136924
2306 Ga0496108_0151036
2307 Ga0496108_0154859
2308 Ga0496108_0201227
2309 Ga0496109_0001932
2310 Ga0496109_0027051
2311 Ga0496109_0034509
2312 Ga0496109_0087898
2313 Ga0496109_0285301
2314 Ga0496109_0287768
2315 Ga0496109_0317383
2316 Ga0496109_0337535
2317 Ga0496109_0344197
2318 Ga0496109_0376488
2319 Ga0496109_0397230
2320 Ga0496109_0627552
2321 Ga0496110_0001472
2322 Ga0496110_0015265
2323 Ga0496110_0024503
2324 Ga0496110_0039557
2325 Ga0496110_0060635
2326 Ga0496110_0078534
2327 Ga0496110_0080758
2328 Ga0496110_0202524
2329 Ga0496110_0533108
2330 Ga0496111_0000582
2331 Ga0496111_0006467
2332 Ga0496111_0010734
2333 Ga0496111_0010771
2334 Ga0496111_0020021
2335 Ga0496111_0059459
2336 Ga0496111_0105585
2337 Ga0496111_0118417
2338 Ga0496111_0125298
2339 Ga0496112_0035013
2340 Ga0496112_0144166
2341 Ga0496112_0246516
2342 Ga0496113_0032179
2343 Ga0496113_0037996
2344 Ga0496113_0080207
2345 Ga0496113_0269416
2346 Ga0496114_0000256
2347 Ga0496114_0002055
2348 Ga0496114_0008450
2349 Ga0496114_0023237
2350 Ga0496114_0039944
2351 Ga0496114_0069098
2352 Ga0496114_0077619
2353 Ga0496114_0095689
2354 Ga0496114_0180586
2355 Ga0496114_0212649
2356 Ga0496114_0227410
2357 Ga0496114_0264213
2358 Ga0496114_0329684
2359 Ga0496114_0440618
2360 Ga0496115_0004783
2361 Ga0496115_0061389
2362 Ga0496115_0107103
2363 Ga0496115_0128386
2364 Ga0496115_0147106
2365 Ga0496115_0344185
2366 Ga0496115_0387211
2367 Ga0496115_0521682
2368 Ga0496126_0105857
2369 Ga0501031_0015677
2370 Ga0501031_0038100
2371 Ga0501031_0416810
2372 Ga0501032_0002084
2373 Ga0501032_0005781
2374 Ga0501033_0006304
2375 Ga0501034_0068193
2376 Ga0501034_0123205
2377 Ga0501036_0000591
2378 Ga0501036_0039371
2379 Ga0501036_0124304
2380 Ga0501036_0370608
2381 Ga0501037_0006728
2382 Ga0501037_0047819
2383 Ga0501037_0292336
2384 Ga0501038_0012788
2385 Ga0501038_0063219
2386 Ga0501039_0011789
2387 Ga0501039_0090639
2388 Ga0501039_0097604
2389 Ga0501039_0125388
2390 Ga0501039_0288507
2391 Ga0501039_0522005
2392 Ga0501040_0002817
2393 Ga0501040_0008241
2394 Ga0501040_0023563
2395 Ga0501040_0040508
2396 Ga0501040_0094030
2397 Ga0501040_0134093
2398 Ga0501041_0003917
2399 Ga0501041_0027722
2400 Ga0501041_0039956
2401 Ga0501041_0251157
2402 Ga0501042_0009634
2403 Ga0501042_0019215
2404 Ga0501042_0066304
2405 Ga0501042_0088999
2406 Ga0501042_0275267
2407 Ga0501042_0541380
2408 Ga0501043_0006662
2409 Ga0501043_0090816
2410 Ga0501046_0009111
2411 Ga0501047_0030083
2412 Ga0501048_0003882
2413 Ga0501048_0012586
2414 Ga0501048_0020300
2415 Ga0501048_0095022
2416 Ga0501067_0003977
2417 Ga0501068_0001816
2418 Ga0501068_0008703
2419 Ga0501068_0031657
2420 Ga0501068_0157342
2421 Ga0501069_0205306
2422 Ga0501070_0001737
2423 Ga0501070_0004106
2424 Ga0501070_0045415
2425 Ga0501071_0005038
2426 Ga0501071_0048965
2427 Ga0501071_0067283
2428 Ga0501071_0146763
2429 Ga0501071_0370971
2430 Ga0501071_0382872
2431 Ga0501071_0424293
2432 Ga0501072_0006718
2433 Ga0501072_0007195
2434 Ga0501072_0013631
2435 Ga0501072_0023338
2436 Ga0501072_0065511
2437 Ga0501072_0162491
2438 Ga0501072_0163134
2439 Ga0501072_0222542
2440 Ga0501072_0581108
2441 Ga0501072_0768227
2442 Ga0501073_0004004
2443 Ga0501073_0044173
2444 Ga0501074_0013566
2445 Ga0501074_0015334
2446 Ga0501074_0130070
2447 Ga0501074_0288955
2448 Ga0501075_0002914
2449 Ga0501075_0006299
2450 Ga0501075_0016462
2451 Ga0501075_0047506
2452 Ga0501075_0065586
2453 Ga0501075_0110102
2454 Ga0501075_0176780
2455 Ga0501075_0217638
2456 Ga0501075_0267434
2457 Ga0501076_0003476
2458 Ga0501076_0008871
2459 Ga0501076_0032100
2460 Ga0501076_0036340
2461 Ga0501076_0058198
2462 Ga0501076_0138735
2463 Ga0501076_0366192
2464 Ga0501077_0001647
2465 Ga0501077_0002374
2466 Ga0501077_0004791
2467 Ga0501077_0025032
2468 Ga0501077_0045344
2469 Ga0501077_0089929
2470 Ga0501077_0139551
2471 Ga0501079_0016897
2472 Ga0501079_0024063
2473 Ga0501079_0047864
2474 Ga0501079_0048947
2475 Ga0501079_0064271
2476 Ga0501079_0079306
2477 Ga0501079_0154482
2478 Ga0501079_0336647
2479 Ga0501080_0008162
2480 Ga0501080_0011073
2481 Ga0501080_0393001
2482 Ga0501081_0024191
2483 Ga0501081_0026153
2484 Ga0501081_0045233
2485 Ga0501081_0106530
2486 Ga0501083_0008832
2487 Ga0501083_0012205
2488 Ga0501083_0068855
2489 Ga0501083_0101284
2490 Ga0501035_0003688
2491 Ga0501035_0221003
2492 Ga0501035_0257749
2493 Ga0501044_0013073
2494 Ga0501045_0013916
2495 Ga0501045_0017443
2496 Ga0501045_0057401
2497 Ga0501045_0081790
2498 Ga0501045_0199650
2499 nmdc:mga03683_9500_c1
2500 nmdc:mga03n38_30305_c1
2501 nmdc:mga03n38_78687_c1
2502 nmdc:mga00v17_13011_c1
2503 nmdc:mga00v17_141723_c1
2504 nmdc:mga00v17_25280_c1
2505 nmdc:mga0yw44_1038_c1
2506 nmdc:mga0yw44_185170_c1
2507 nmdc:mga0yw44_86706_c1
2508 nmdc:mga06z11_71297_c1
2509 nmdc:mga04h51_14713_c1
2510 nmdc:mga04h51_23717_c1
2511 nmdc:mga07m45_71199_c1
2512 nmdc:mga05p37_13498_c1
2513 nmdc:mga05p37_16833_c1
2514 nmdc:mga05p37_361180_c2
2515 nmdc:mga05p37_72339_c1
2516 nmdc:mga05p37_81894_c1
2517 nmdc:mga09592_98003_c1
2518 nmdc:mga0qj67_20834_c1
2519 nmdc:mga06r32_105647_c1
2520 nmdc:mga06r32_16822_c1
2521 nmdc:mga08y16_26370_c1
2522 nmdc:mga08y16_27729_c1
2523 nmdc:mga08y16_37172_c1
2524 nmdc:mga08y16_470051_c1
2525 nmdc:mga08y16_70851_c1
2526 nmdc:mga08y16_71864_c1
2527 nmdc:mga0n895_161179_c1
2528 nmdc:mga0n895_245084_c1
2529 nmdc:mga0n895_366073_c1
2530 nmdc:mga0n895_39038_c1
2531 nmdc:mga0n895_50222_c1
2532 nmdc:mga0n895_838543_c1
2533 nmdc:mga0rr50_11223_c1
2534 nmdc:mga0rr50_295431_c1
2535 nmdc:mga08x19_180488_c1
2536 nmdc:mga08x19_62858_c1
2537 nmdc:mga0a205_115469_c1
2538 nmdc:mga0a205_137707_c1
2539 nmdc:mga0a205_159635_c1
2540 nmdc:mga0a205_197968_c1
2541 nmdc:mga0a205_25714_c1
2542 nmdc:mga0a205_89620_c1
2543 nmdc:mga0sz30_18724_c1
2544 Ga0495601_0020423
2545 Ga0495601_0021938
2546 Ga0495601_0041459
2547 Ga0495601_0077649
2548 Ga0495601_0098688
2549 Ga0495601_0147676
2550 Ga0495612_0002621
2551 Ga0495612_0090587
2552 Ga0495595_0005279
2553 Ga0495595_0035215
2554 Ga0495595_0042766
2555 Ga0495595_0183883
2556 Ga0495619_0004394
2557 Ga0495619_0013127
2558 Ga0495619_0017477
2559 Ga0495619_0082854
2560 Ga0495619_0087413
2561 Ga0495619_0175685
2562 Ga0495619_0234006
2563 Ga0495619_0347781
2564 Ga0501084_0005328
2565 Ga0501084_0110156
2566 Ga0501084_0136837
2567 Ga0501084_0164692
2568 Ga0501084_0191748
2569 Ga0501084_0331625
2570 Ga0501082_0006774
2571 Ga0501082_0012448
2572 Ga0501082_0034537
2573 Ga0501082_0061051
2574 Ga0501082_0324933
2575 Ga0501082_0449104
2576 Ga0466962_0018395
2577 Ga0530510_0001773
2578 Ga0530510_0021207
2579 Ga0530510_0029823
2580 Ga0530510_0071060
2581 Ga0530510_0168454
2582 2753267114

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

211

237

0.95

PF00005

ABC_tran

ABC transporter

17

162

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_D mycobacterium smegmatis sugabc complex 0.925 2 221
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9237 2 218
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9231 1 221
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9178 2 230
2it1-assembly1.cif.gz_B structure of ph0203 protein from pyrococcus horikoshii 0.9175 2 221
ID Description Score Start End Superfamily
af_Q8T6J0_514_774_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9344 2 221 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.931 2 233 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9304 2 218 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9284 2 217 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.927 2 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7C4S8X1-F1-model_v4 ABC transporter ATP-binding protein 0.9605 2 233 GO:0005524
GO:0005886
GO:0016887
AF-A0A512DTK1-F1-model_v4 ABC transporter ATP-binding protein 0.9577 2 236 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A2R4M201-F1-model_v4 ABC transporter ATP-binding protein 0.9562 2 233 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A0S8CEG3-F1-model_v4 ABC transporter 0.9512 1 233 GO:0005524
GO:0005886
GO:0016887
AF-A0A5P9GIF8-F1-model_v4 deleted 0.9471 1 221

Map