F492635
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1291 | 401 | 2582 | 236 |
Family's Representative Sequence
| Representative Sequence | 3300005983|Ga0081540_1059413|Ga0081540_10594132 |
| Length | 277 |
| Sequence | MIEVAGLTVRFGGVTSLDDMSVTFETGTCGLIGPNGAGKTTFFNVLSGFVRPVTGTVRAFGEDLLSMVHFRRARWGVRRTFQTEQAIEELSVFDNVAMVHEHARLSGASRRRDVLDAISFVGLGADPSARVGTLAAGERRLLEVARAVVGRPRLVLLDEPAAGLPDEETRHLGEVIRAIPGHTGALVILVDHDMSLVSACCETTAVLDFGKLIASGPTAGVLRDEQVIRAYLGTADVAWRGRRARRPARAWACAASPSSGAGAPWSATSRSRYRPGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 118 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 128 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 206 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 213 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 215 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 216 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 220 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 221 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 227 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 229 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 232 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 235 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 236 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 241 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 248 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 249 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 250 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 267 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 268 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 271 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 377 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 378 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 379 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 380 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 381 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 382 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 393 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 400 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 401 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.61 |
| Metatranscriptomes | 0.31 |
| Isolates | 0.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.79 |
| Nodule | 0 |
| Rhizoplane | 8.99 |
| Rhizosphere | 85.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081540_1059413 | 3300005983 | Bacteria | 1836 |
| 2 | rootL2_10015499 | 3300003322 | Bacteria | 4981 |
| 3 | JGI25404J52841_10000237 | 3300003659 | Bacteria | 6905 |
| 4 | Ga0070658_10047099 | 3300005327 | Bacteria | 3489 |
| 5 | Ga0070676_10276945 | 3300005328 | Bacteria | 1129 |
| 6 | Ga0070683_100007611 | 3300005329 | Bacteria | 9160 |
| 7 | Ga0070683_100014788 | 3300005329 | Bacteria | 6838 |
| 8 | Ga0070683_100095658 | 3300005329 | Bacteria | 2793 |
| 9 | Ga0070683_100272286 | 3300005329 | Bacteria | 1610 |
| 10 | Ga0070683_100427548 | 3300005329 | Bacteria | 1264 |
| 11 | Ga0070690_100039157 | 3300005330 | Bacteria | 2994 |
| 12 | Ga0070670_100539439 | 3300005331 | Bacteria | 1040 |
| 13 | Ga0068869_100160561 | 3300005334 | Bacteria | 1749 |
| 14 | Ga0070680_100011226 | 3300005336 | Bacteria | 6929 |
| 15 | Ga0070680_100046621 | 3300005336 | Bacteria | 3526 |
| 16 | Ga0070680_100059338 | 3300005336 | Bacteria | 3129 |
| 17 | Ga0070680_100235341 | 3300005336 | Bacteria | 1547 |
| 18 | Ga0070680_100285299 | 3300005336 | Bacteria | 1399 |
| 19 | Ga0070682_100012732 | 3300005337 | Bacteria | 4828 |
| 20 | Ga0070682_100197546 | 3300005337 | Bacteria | 1417 |
| 21 | Ga0070682_100227251 | 3300005337 | Bacteria | 1332 |
| 22 | Ga0068868_100123465 | 3300005338 | Bacteria | 2113 |
| 23 | Ga0068868_100311897 | 3300005338 | Bacteria | 1338 |
| 24 | Ga0068868_100317352 | 3300005338 | Bacteria | 1327 |
| 25 | Ga0070660_100013359 | 3300005339 | Bacteria | 5888 |
| 26 | Ga0070689_100010689 | 3300005340 | Bacteria | 6551 |
| 27 | Ga0070689_100237409 | 3300005340 | Bacteria | 1500 |
| 28 | Ga0070687_100041658 | 3300005343 | Bacteria | 2322 |
| 29 | Ga0070661_100021551 | 3300005344 | Bacteria | 4605 |
| 30 | Ga0070661_100413636 | 3300005344 | Bacteria | 1068 |
| 31 | Ga0070692_10003019 | 3300005345 | Bacteria | 6708 |
| 32 | Ga0070668_100049423 | 3300005347 | Bacteria | 3236 |
| 33 | Ga0070668_100271665 | 3300005347 | Bacteria | 1413 |
| 34 | Ga0070669_100126274 | 3300005353 | Bacteria | 1958 |
| 35 | Ga0070675_100006014 | 3300005354 | Bacteria | 9299 |
| 36 | Ga0070671_100015038 | 3300005355 | Bacteria | 6250 |
| 37 | Ga0070671_100261342 | 3300005355 | Bacteria | 1471 |
| 38 | Ga0070674_100153889 | 3300005356 | Bacteria | 1738 |
| 39 | Ga0070674_100322653 | 3300005356 | Bacteria | 1239 |
| 40 | Ga0070673_100011696 | 3300005364 | Bacteria | 5998 |
| 41 | Ga0070673_100039781 | 3300005364 | Bacteria | 3602 |
| 42 | Ga0070673_100354941 | 3300005364 | Bacteria | 1302 |
| 43 | Ga0070688_100005380 | 3300005365 | Bacteria | 6736 |
| 44 | Ga0070659_100011096 | 3300005366 | Bacteria | 6655 |
| 45 | Ga0070659_100127085 | 3300005366 | Bacteria | 2069 |
| 46 | Ga0070659_100278023 | 3300005366 | Bacteria | 1392 |
| 47 | Ga0070667_100086800 | 3300005367 | Bacteria | 2685 |
| 48 | Ga0070709_10012185 | 3300005434 | Bacteria | 4808 |
| 49 | Ga0070709_10021705 | 3300005434 | Bacteria | 3744 |
| 50 | Ga0070709_10024809 | 3300005434 | Bacteria | 3534 |
| 51 | Ga0070714_100014645 | 3300005435 | Bacteria | 6301 |
| 52 | Ga0070714_100041916 | 3300005435 | Bacteria | 3865 |
| 53 | Ga0070714_100079967 | 3300005435 | Bacteria | 2843 |
| 54 | Ga0070714_100130485 | 3300005435 | Bacteria | 2246 |
| 55 | Ga0070713_100023990 | 3300005436 | Bacteria | 4743 |
| 56 | Ga0070713_100042357 | 3300005436 | Bacteria | 3715 |
| 57 | Ga0070713_100061806 | 3300005436 | Bacteria | 3135 |
| 58 | Ga0070713_100185993 | 3300005436 | Bacteria | 1869 |
| 59 | Ga0070713_100241101 | 3300005436 | Bacteria | 1646 |
| 60 | Ga0070713_100272504 | 3300005436 | Bacteria | 1550 |
| 61 | Ga0070713_100277213 | 3300005436 | Bacteria | 1537 |
| 62 | Ga0070710_10025738 | 3300005437 | Bacteria | 3119 |
| 63 | Ga0070710_10054260 | 3300005437 | Bacteria | 2261 |
| 64 | Ga0070710_10055742 | 3300005437 | Bacteria | 2235 |
| 65 | Ga0070710_10369199 | 3300005437 | Bacteria | 954 |
| 66 | Ga0070701_10001668 | 3300005438 | Bacteria | 8318 |
| 67 | Ga0070711_100038623 | 3300005439 | Bacteria | 3211 |
| 68 | Ga0070711_100143041 | 3300005439 | Bacteria | 1795 |
| 69 | Ga0070711_100359425 | 3300005439 | Bacteria | 1172 |
| 70 | Ga0070711_100375352 | 3300005439 | Bacteria | 1148 |
| 71 | Ga0070711_100596988 | 3300005439 | Bacteria | 921 |
| 72 | Ga0070705_100048810 | 3300005440 | Bacteria | 2454 |
| 73 | Ga0070700_100025865 | 3300005441 | Bacteria | 3460 |
| 74 | Ga0070694_100065947 | 3300005444 | Bacteria | 2482 |
| 75 | Ga0070694_100253036 | 3300005444 | Bacteria | 1333 |
| 76 | Ga0070708_100204879 | 3300005445 | Bacteria | 1848 |
| 77 | Ga0070708_100268473 | 3300005445 | Bacteria | 1604 |
| 78 | Ga0070708_100299806 | 3300005445 | Bacteria | 1513 |
| 79 | Ga0070663_100015332 | 3300005455 | Bacteria | 4944 |
| 80 | Ga0070663_100074075 | 3300005455 | Bacteria | 2485 |
| 81 | Ga0070678_100005693 | 3300005456 | Bacteria | 7239 |
| 82 | Ga0070678_100023233 | 3300005456 | Bacteria | 4128 |
| 83 | Ga0070678_100025740 | 3300005456 | Bacteria | 3965 |
| 84 | Ga0070678_100038354 | 3300005456 | Bacteria | 3372 |
| 85 | Ga0070678_100039968 | 3300005456 | Bacteria | 3315 |
| 86 | Ga0070678_100277132 | 3300005456 | Bacteria | 1417 |
| 87 | Ga0070662_100119312 | 3300005457 | Bacteria | 2020 |
| 88 | Ga0070681_10028584 | 3300005458 | Bacteria | 5606 |
| 89 | Ga0070681_10082738 | 3300005458 | Bacteria | 3165 |
| 90 | Ga0070681_10092886 | 3300005458 | Bacteria | 2966 |
| 91 | Ga0070681_10363817 | 3300005458 | Bacteria | 1357 |
| 92 | Ga0068867_100010705 | 3300005459 | Bacteria | 6468 |
| 93 | Ga0070685_10001614 | 3300005466 | Bacteria | 11898 |
| 94 | Ga0070706_100008251 | 3300005467 | Bacteria | 9715 |
| 95 | Ga0070706_100062383 | 3300005467 | Bacteria | 3444 |
| 96 | Ga0070706_100246344 | 3300005467 | Bacteria | 1669 |
| 97 | Ga0070707_100040233 | 3300005468 | Bacteria | 4472 |
| 98 | Ga0070707_100138119 | 3300005468 | Bacteria | 2371 |
| 99 | Ga0070707_100750095 | 3300005468 | Bacteria | 939 |
| 100 | Ga0070698_100002351 | 3300005471 | Bacteria | 20891 |
| 101 | Ga0070698_100081412 | 3300005471 | Bacteria | 3232 |
| 102 | Ga0070698_100145421 | 3300005471 | Bacteria | 2320 |
| 103 | Ga0070698_100168502 | 3300005471 | Bacteria | 2132 |
| 104 | Ga0070698_100222614 | 3300005471 | Bacteria | 1820 |
| 105 | Ga0070698_100508347 | 3300005471 | Bacteria | 1143 |
| 106 | Ga0070698_100806645 | 3300005471 | Bacteria | 883 |
| 107 | Ga0070699_100024741 | 3300005518 | Bacteria | 5176 |
| 108 | Ga0070699_100027183 | 3300005518 | Bacteria | 4935 |
| 109 | Ga0070699_100081933 | 3300005518 | Bacteria | 2812 |
| 110 | Ga0070679_100004020 | 3300005530 | Bacteria | 13550 |
| 111 | Ga0070679_100011266 | 3300005530 | Bacteria | 8523 |
| 112 | Ga0070679_100113962 | 3300005530 | Bacteria | 2689 |
| 113 | Ga0070679_100150313 | 3300005530 | Bacteria | 2305 |
| 114 | Ga0070679_100173548 | 3300005530 | Bacteria | 2128 |
| 115 | Ga0070684_100039442 | 3300005535 | Bacteria | 4062 |
| 116 | Ga0070684_100046268 | 3300005535 | Bacteria | 3770 |
| 117 | Ga0070684_100061135 | 3300005535 | Bacteria | 3296 |
| 118 | Ga0070684_100074379 | 3300005535 | Bacteria | 2995 |
| 119 | Ga0070684_100089813 | 3300005535 | Bacteria | 2731 |
| 120 | Ga0070684_100106927 | 3300005535 | Bacteria | 2505 |
| 121 | Ga0070684_100359163 | 3300005535 | Bacteria | 1341 |
| 122 | Ga0070697_100000480 | 3300005536 | Bacteria | 30343 |
| 123 | Ga0068853_100058644 | 3300005539 | Bacteria | 3323 |
| 124 | Ga0068853_100186807 | 3300005539 | Bacteria | 1881 |
| 125 | Ga0070672_100060447 | 3300005543 | Bacteria | 2983 |
| 126 | Ga0070686_100019541 | 3300005544 | Bacteria | 3994 |
| 127 | Ga0070686_100124990 | 3300005544 | Bacteria | 1771 |
| 128 | Ga0070695_100052160 | 3300005545 | Bacteria | 2627 |
| 129 | Ga0070696_100049012 | 3300005546 | Bacteria | 2932 |
| 130 | Ga0070696_100202441 | 3300005546 | Bacteria | 1483 |
| 131 | Ga0070693_100005137 | 3300005547 | Bacteria | 6257 |
| 132 | Ga0070693_100035325 | 3300005547 | Bacteria | 2771 |
| 133 | Ga0070693_100165235 | 3300005547 | Bacteria | 1413 |
| 134 | Ga0070665_100531107 | 3300005548 | Bacteria | 1188 |
| 135 | Ga0070704_100025959 | 3300005549 | Bacteria | 3864 |
| 136 | Ga0068855_100175852 | 3300005563 | Bacteria | 2422 |
| 137 | Ga0070664_100014886 | 3300005564 | Bacteria | 6345 |
| 138 | Ga0070664_100021859 | 3300005564 | Bacteria | 5274 |
| 139 | Ga0070664_100160646 | 3300005564 | Bacteria | 1988 |
| 140 | Ga0070664_100439364 | 3300005564 | Bacteria | 1197 |
| 141 | Ga0068857_100011972 | 3300005577 | Bacteria | 7546 |
| 142 | Ga0068857_100136882 | 3300005577 | Bacteria | 2212 |
| 143 | Ga0068856_100036063 | 3300005614 | Bacteria | 4849 |
| 144 | Ga0068856_100070781 | 3300005614 | Bacteria | 3451 |
| 145 | Ga0068856_100071480 | 3300005614 | Bacteria | 3435 |
| 146 | Ga0068856_100088638 | 3300005614 | Bacteria | 3077 |
| 147 | Ga0068856_100328703 | 3300005614 | Bacteria | 1546 |
| 148 | Ga0068856_100482604 | 3300005614 | Bacteria | 1260 |
| 149 | Ga0068856_100761745 | 3300005614 | Bacteria | 988 |
| 150 | Ga0070702_100014672 | 3300005615 | Bacteria | 3980 |
| 151 | Ga0070702_100100814 | 3300005615 | Bacteria | 1770 |
| 152 | Ga0070702_100219328 | 3300005615 | Bacteria | 1271 |
| 153 | Ga0070702_100275043 | 3300005615 | Bacteria | 1153 |
| 154 | Ga0068852_100211680 | 3300005616 | Bacteria | 1839 |
| 155 | Ga0068859_100017374 | 3300005617 | Bacteria | 7227 |
| 156 | Ga0068864_100010496 | 3300005618 | Bacteria | 7653 |
| 157 | Ga0068864_100208733 | 3300005618 | Bacteria | 1797 |
| 158 | Ga0068866_10004410 | 3300005718 | Bacteria | 5779 |
| 159 | Ga0068866_10116933 | 3300005718 | Bacteria | 1496 |
| 160 | Ga0068861_100010676 | 3300005719 | Bacteria | 6380 |
| 161 | Ga0068851_10050125 | 3300005834 | Bacteria | 2119 |
| 162 | Ga0068870_10067222 | 3300005840 | Bacteria | 1944 |
| 163 | Ga0068870_10123105 | 3300005840 | Bacteria | 1496 |
| 164 | Ga0068863_100208041 | 3300005841 | Bacteria | 1884 |
| 165 | Ga0068863_100601631 | 3300005841 | Bacteria | 1088 |
| 166 | Ga0068863_100819903 | 3300005841 | Bacteria | 928 |
| 167 | Ga0068858_100012604 | 3300005842 | Bacteria | 7969 |
| 168 | Ga0068858_100037424 | 3300005842 | Bacteria | 4500 |
| 169 | Ga0068858_100249215 | 3300005842 | Bacteria | 1687 |
| 170 | Ga0068860_100017643 | 3300005843 | Bacteria | 6955 |
| 171 | Ga0068860_100065396 | 3300005843 | Bacteria | 3453 |
| 172 | Ga0068860_100088667 | 3300005843 | Bacteria | 2945 |
| 173 | Ga0068862_100057713 | 3300005844 | Bacteria | 3330 |
| 174 | Ga0081455_10003582 | 3300005937 | Bacteria | 17818 |
| 175 | Ga0081455_10023662 | 3300005937 | Bacteria | 5710 |
| 176 | Ga0081455_10032587 | 3300005937 | Bacteria | 4693 |
| 177 | Ga0081455_10039497 | 3300005937 | Bacteria | 4170 |
| 178 | Ga0081455_10084652 | 3300005937 | Bacteria | 2587 |
| 179 | Ga0081538_10003610 | 3300005981 | Bacteria | 14536 |
| 180 | Ga0081538_10012556 | 3300005981 | Bacteria | 6783 |
| 181 | Ga0081538_10069513 | 3300005981 | Bacteria | 1950 |
| 182 | Ga0081540_1000936 | 3300005983 | Bacteria | 26242 |
| 183 | Ga0081540_1068089 | 3300005983 | Bacteria | 1660 |
| 184 | Ga0081539_10005354 | 3300005985 | Bacteria | 13149 |
| 185 | Ga0070717_10001324 | 3300006028 | Bacteria | 16967 |
| 186 | Ga0070717_10006096 | 3300006028 | Bacteria | 8850 |
| 187 | Ga0070717_10023163 | 3300006028 | Bacteria | 4916 |
| 188 | Ga0070717_10041201 | 3300006028 | Bacteria | 3765 |
| 189 | Ga0070717_10041740 | 3300006028 | Bacteria | 3740 |
| 190 | Ga0070717_10046387 | 3300006028 | Bacteria | 3555 |
| 191 | Ga0070717_10050868 | 3300006028 | Bacteria | 3408 |
| 192 | Ga0070717_10061134 | 3300006028 | Bacteria | 3121 |
| 193 | Ga0070717_10097157 | 3300006028 | Bacteria | 2495 |
| 194 | Ga0075365_10000551 | 3300006038 | Bacteria | 14473 |
| 195 | Ga0075365_10004769 | 3300006038 | Bacteria | 7233 |
| 196 | Ga0075365_10313674 | 3300006038 | Bacteria | 1104 |
| 197 | Ga0075368_10019378 | 3300006042 | Bacteria | 2568 |
| 198 | Ga0075368_10044783 | 3300006042 | Bacteria | 1747 |
| 199 | Ga0075368_10047394 | 3300006042 | Bacteria | 1701 |
| 200 | Ga0075363_100005505 | 3300006048 | Bacteria | 5644 |
| 201 | Ga0075363_100039755 | 3300006048 | Bacteria | 2477 |
| 202 | Ga0075363_100075681 | 3300006048 | Bacteria | 1834 |
| 203 | Ga0075363_100077460 | 3300006048 | Bacteria | 1814 |
| 204 | Ga0075363_100252637 | 3300006048 | Bacteria | 1015 |
| 205 | Ga0075364_10003741 | 3300006051 | Bacteria | 8686 |
| 206 | Ga0075364_10016558 | 3300006051 | Bacteria | 4588 |
| 207 | Ga0075364_10040075 | 3300006051 | Bacteria | 3038 |
| 208 | Ga0075364_10243597 | 3300006051 | Bacteria | 1221 |
| 209 | Ga0075432_10012318 | 3300006058 | Bacteria | 2905 |
| 210 | Ga0075432_10014283 | 3300006058 | Bacteria | 2704 |
| 211 | Ga0070715_10014288 | 3300006163 | Bacteria | 2937 |
| 212 | Ga0070715_10118581 | 3300006163 | Bacteria | 1258 |
| 213 | Ga0070715_10188865 | 3300006163 | Bacteria | 1039 |
| 214 | Ga0070716_100265101 | 3300006173 | Bacteria | 1177 |
| 215 | Ga0070712_100011634 | 3300006175 | Bacteria | 5588 |
| 216 | Ga0070712_100022010 | 3300006175 | Bacteria | 4193 |
| 217 | Ga0070712_100055945 | 3300006175 | Bacteria | 2765 |
| 218 | Ga0070712_100087827 | 3300006175 | Bacteria | 2270 |
| 219 | Ga0070712_100129460 | 3300006175 | Bacteria | 1911 |
| 220 | Ga0070712_100212123 | 3300006175 | Bacteria | 1528 |
| 221 | Ga0075362_10043341 | 3300006177 | Bacteria | 1992 |
| 222 | Ga0075362_10156742 | 3300006177 | Bacteria | 1095 |
| 223 | Ga0075367_10037625 | 3300006178 | Bacteria | 2813 |
| 224 | Ga0075367_10048254 | 3300006178 | Bacteria | 2507 |
| 225 | Ga0075367_10255811 | 3300006178 | Bacteria | 1098 |
| 226 | Ga0097621_100014585 | 3300006237 | Bacteria | 5887 |
| 227 | Ga0097621_100151140 | 3300006237 | Bacteria | 1991 |
| 228 | Ga0075370_10061924 | 3300006353 | Bacteria | 2132 |
| 229 | Ga0068871_100006269 | 3300006358 | Bacteria | 8391 |
| 230 | Ga0068871_100206822 | 3300006358 | Bacteria | 1696 |
| 231 | Ga0075428_100005147 | 3300006844 | Bacteria | 14540 |
| 232 | Ga0075430_100636575 | 3300006846 | Bacteria | 879 |
| 233 | Ga0075431_100181903 | 3300006847 | Bacteria | 2157 |
| 234 | Ga0075431_100254561 | 3300006847 | Bacteria | 1783 |
| 235 | Ga0075433_10060219 | 3300006852 | Bacteria | 3324 |
| 236 | Ga0075433_10083867 | 3300006852 | Bacteria | 2813 |
| 237 | Ga0075433_10093514 | 3300006852 | Bacteria | 2660 |
| 238 | Ga0075433_10121916 | 3300006852 | Bacteria | 2315 |
| 239 | Ga0075433_10159160 | 3300006852 | Bacteria | 2009 |
| 240 | Ga0075434_100007864 | 3300006871 | Bacteria | 9879 |
| 241 | Ga0075434_100173746 | 3300006871 | Bacteria | 2174 |
| 242 | Ga0075434_100376501 | 3300006871 | Bacteria | 1441 |
| 243 | Ga0075434_100558776 | 3300006871 | Bacteria | 1164 |
| 244 | Ga0075429_100089560 | 3300006880 | Bacteria | 2682 |
| 245 | Ga0075429_100168608 | 3300006880 | Bacteria | 1918 |
| 246 | Ga0075429_100232361 | 3300006880 | Bacteria | 1615 |
| 247 | Ga0068865_100047339 | 3300006881 | Bacteria | 2955 |
| 248 | Ga0068865_100082886 | 3300006881 | Bacteria | 2307 |
| 249 | Ga0075436_100041056 | 3300006914 | Bacteria | 3193 |
| 250 | Ga0075436_100202302 | 3300006914 | Bacteria | 1407 |
| 251 | Ga0097620_100017374 | 3300006931 | Bacteria | 7227 |
| 252 | Ga0075435_100015622 | 3300007076 | Bacteria | 5711 |
| 253 | Ga0075435_100018686 | 3300007076 | Bacteria | 5279 |
| 254 | Ga0075435_100032377 | 3300007076 | Bacteria | 4128 |
| 255 | Ga0075435_100178362 | 3300007076 | Bacteria | 1795 |
| 256 | Ga0075435_100525068 | 3300007076 | Bacteria | 1024 |
| 257 | Ga0075435_100655278 | 3300007076 | Bacteria | 911 |
| 258 | Ga0099795_10022772 | 3300007788 | Bacteria | 2072 |
| 259 | Ga0105240_10662366 | 3300009093 | Bacteria | 1143 |
| 260 | Ga0111539_10022685 | 3300009094 | Bacteria | 7710 |
| 261 | Ga0111539_10034085 | 3300009094 | Bacteria | 6177 |
| 262 | Ga0111539_10096837 | 3300009094 | Bacteria | 3466 |
| 263 | Ga0111539_10166545 | 3300009094 | Bacteria | 2576 |
| 264 | Ga0105245_10026307 | 3300009098 | Bacteria | 5121 |
| 265 | Ga0105245_10032395 | 3300009098 | Bacteria | 4626 |
| 266 | Ga0105245_10055135 | 3300009098 | Bacteria | 3570 |
| 267 | Ga0105245_10066233 | 3300009098 | Bacteria | 3269 |
| 268 | Ga0105245_10094014 | 3300009098 | Bacteria | 2763 |
| 269 | Ga0105245_10557600 | 3300009098 | Bacteria | 1168 |
| 270 | Ga0105247_10018783 | 3300009101 | Bacteria | 4150 |
| 271 | Ga0105247_10136238 | 3300009101 | Bacteria | 1604 |
| 272 | Ga0114129_10000926 | 3300009147 | Bacteria | 38287 |
| 273 | Ga0114129_10008895 | 3300009147 | Bacteria | 14316 |
| 274 | Ga0114129_10041949 | 3300009147 | Bacteria | 6443 |
| 275 | Ga0114129_11147598 | 3300009147 | Bacteria | 970 |
| 276 | Ga0105243_10080721 | 3300009148 | Bacteria | 2653 |
| 277 | Ga0105243_10151947 | 3300009148 | Bacteria | 1987 |
| 278 | Ga0105243_10355355 | 3300009148 | Bacteria | 1347 |
| 279 | Ga0105241_10076027 | 3300009174 | Bacteria | 2617 |
| 280 | Ga0105241_10200801 | 3300009174 | Bacteria | 1665 |
| 281 | Ga0105241_10704692 | 3300009174 | Bacteria | 922 |
| 282 | Ga0105242_10007042 | 3300009176 | Bacteria | 8684 |
| 283 | Ga0105242_10024097 | 3300009176 | Bacteria | 4804 |
| 284 | Ga0105242_10283292 | 3300009176 | Bacteria | 1506 |
| 285 | Ga0105248_10014103 | 3300009177 | Bacteria | 8795 |
| 286 | Ga0105248_10026145 | 3300009177 | Bacteria | 6494 |
| 287 | Ga0105248_10819917 | 3300009177 | Bacteria | 1050 |
| 288 | Ga0105248_11127599 | 3300009177 | Bacteria | 887 |
| 289 | Ga0105237_10129012 | 3300009545 | Bacteria | 2523 |
| 290 | Ga0105237_10830945 | 3300009545 | Bacteria | 930 |
| 291 | Ga0105238_10012955 | 3300009551 | Bacteria | 8418 |
| 292 | Ga0105238_10593329 | 3300009551 | Bacteria | 1115 |
| 293 | Ga0105249_10014381 | 3300009553 | Bacteria | 6997 |
| 294 | Ga0105249_10101151 | 3300009553 | Bacteria | 2711 |
| 295 | Ga0105249_11128727 | 3300009553 | Bacteria | 854 |
| 296 | Ga0099796_10033381 | 3300010159 | Bacteria | 1693 |
| 297 | Ga0099796_10121599 | 3300010159 | Bacteria | 1004 |
| 298 | Ga0105239_10063118 | 3300010375 | Bacteria | 4067 |
| 299 | Ga0105239_11109202 | 3300010375 | Bacteria | 911 |
| 300 | Ga0105246_10024802 | 3300011119 | Bacteria | 3902 |
| 301 | Ga0105246_10080496 | 3300011119 | Bacteria | 2319 |
| 302 | Ga0105246_10240817 | 3300011119 | Bacteria | 1430 |
| 303 | Ga0157340_1003493 | 3300012473 | Bacteria | 865 |
| 304 | Ga0157338_1008935 | 3300012515 | Bacteria | 982 |
| 305 | Ga0157373_10092233 | 3300013100 | Bacteria | 2133 |
| 306 | Ga0157371_10105689 | 3300013102 | Bacteria | 1998 |
| 307 | Ga0157369_10072595 | 3300013105 | Bacteria | 3694 |
| 308 | Ga0157369_10077811 | 3300013105 | Bacteria | 3555 |
| 309 | Ga0157369_10115357 | 3300013105 | Bacteria | 2852 |
| 310 | Ga0157369_10851718 | 3300013105 | Bacteria | 936 |
| 311 | Ga0157378_10549956 | 3300013297 | Bacteria | 1159 |
| 312 | Ga0157378_10821570 | 3300013297 | Bacteria | 956 |
| 313 | Ga0163162_10012158 | 3300013306 | Bacteria | 8404 |
| 314 | Ga0163162_10415145 | 3300013306 | Bacteria | 1478 |
| 315 | Ga0157375_10012051 | 3300013308 | Bacteria | 7657 |
| 316 | Ga0157375_10191379 | 3300013308 | Bacteria | 2200 |
| 317 | Ga0157375_10340894 | 3300013308 | Bacteria | 1664 |
| 318 | Ga0163163_10115540 | 3300014325 | Bacteria | 2715 |
| 319 | Ga0163163_10204952 | 3300014325 | Bacteria | 2020 |
| 320 | Ga0157380_10006251 | 3300014326 | Bacteria | 8363 |
| 321 | Ga0157380_10631838 | 3300014326 | Bacteria | 1065 |
| 322 | Ga0182008_10296888 | 3300014497 | Bacteria | 844 |
| 323 | Ga0157377_10061398 | 3300014745 | Bacteria | 2148 |
| 324 | Ga0157377_10184817 | 3300014745 | Bacteria | 1313 |
| 325 | Ga0157377_10197402 | 3300014745 | Bacteria | 1275 |
| 326 | Ga0157377_10230537 | 3300014745 | Bacteria | 1190 |
| 327 | Ga0157377_10311089 | 3300014745 | Bacteria | 1043 |
| 328 | Ga0157377_10530120 | 3300014745 | Bacteria | 828 |
| 329 | Ga0157379_10006395 | 3300014968 | Bacteria | 10150 |
| 330 | Ga0157379_10017040 | 3300014968 | Bacteria | 6396 |
| 331 | Ga0157376_10005806 | 3300014969 | Bacteria | 8651 |
| 332 | Ga0157376_10035530 | 3300014969 | Bacteria | 4031 |
| 333 | Ga0157376_10160601 | 3300014969 | Bacteria | 2037 |
| 334 | Ga0157376_10679414 | 3300014969 | Bacteria | 1033 |
| 335 | Ga0163161_10008515 | 3300017792 | Bacteria | 7100 |
| 336 | Ga0163161_10021369 | 3300017792 | Bacteria | 4549 |
| 337 | Ga0206356_10213329 | 3300020070 | Bacteria | 1110 |
| 338 | Ga0206356_10978510 | 3300020070 | Bacteria | 2255 |
| 339 | Ga0206353_11752886 | 3300020082 | Bacteria | 2177 |
| 340 | Ga0213874_10001831 | 3300021377 | Bacteria | 4462 |
| 341 | Ga0213874_10005759 | 3300021377 | Bacteria | 2903 |
| 342 | Ga0213876_10015845 | 3300021384 | Bacteria | 3989 |
| 343 | Ga0213876_10029848 | 3300021384 | Bacteria | 2874 |
| 344 | Ga0213875_10000934 | 3300021388 | Bacteria | 20993 |
| 345 | Ga0213875_10010235 | 3300021388 | Bacteria | 4706 |
| 346 | Ga0213875_10018494 | 3300021388 | Bacteria | 3357 |
| 347 | Ga0213875_10021540 | 3300021388 | Bacteria | 3086 |
| 348 | Ga0213875_10179480 | 3300021388 | Bacteria | 994 |
| 349 | Ga0207656_10035713 | 3300025321 | Bacteria | 2083 |
| 350 | Ga0207656_10258600 | 3300025321 | Bacteria | 854 |
| 351 | Ga0207653_10005149 | 3300025885 | Bacteria | 4088 |
| 352 | Ga0207692_10017284 | 3300025898 | Bacteria | 3214 |
| 353 | Ga0207692_10086879 | 3300025898 | Bacteria | 1686 |
| 354 | Ga0207692_10107464 | 3300025898 | Bacteria | 1542 |
| 355 | Ga0207692_10217705 | 3300025898 | Bacteria | 1130 |
| 356 | Ga0207642_10003988 | 3300025899 | Bacteria | 4709 |
| 357 | Ga0207710_10033540 | 3300025900 | Bacteria | 2252 |
| 358 | Ga0207688_10015412 | 3300025901 | Bacteria | 4146 |
| 359 | Ga0207688_10021594 | 3300025901 | Bacteria | 3519 |
| 360 | Ga0207680_10124484 | 3300025903 | Bacteria | 1690 |
| 361 | Ga0207685_10106308 | 3300025905 | Bacteria | 1209 |
| 362 | Ga0207699_10006382 | 3300025906 | Bacteria | 5706 |
| 363 | Ga0207699_10021386 | 3300025906 | Bacteria | 3485 |
| 364 | Ga0207699_10033971 | 3300025906 | Bacteria | 2888 |
| 365 | Ga0207699_10107677 | 3300025906 | Bacteria | 1781 |
| 366 | Ga0207699_10113141 | 3300025906 | Bacteria | 1743 |
| 367 | Ga0207699_10138005 | 3300025906 | Bacteria | 1599 |
| 368 | Ga0207643_10003445 | 3300025908 | Bacteria | 8507 |
| 369 | Ga0207643_10010851 | 3300025908 | Bacteria | 4914 |
| 370 | Ga0207684_10007560 | 3300025910 | Bacteria | 9771 |
| 371 | Ga0207684_10115814 | 3300025910 | Bacteria | 2296 |
| 372 | Ga0207684_10263327 | 3300025910 | Bacteria | 1488 |
| 373 | Ga0207684_10506724 | 3300025910 | Bacteria | 1034 |
| 374 | Ga0207654_10241170 | 3300025911 | Bacteria | 1208 |
| 375 | Ga0207707_10001584 | 3300025912 | Bacteria | 20963 |
| 376 | Ga0207693_10014459 | 3300025915 | Bacteria | 6345 |
| 377 | Ga0207693_10017499 | 3300025915 | Bacteria | 5716 |
| 378 | Ga0207693_10021237 | 3300025915 | Bacteria | 5160 |
| 379 | Ga0207693_10182188 | 3300025915 | Bacteria | 1653 |
| 380 | Ga0207693_10192779 | 3300025915 | Bacteria | 1603 |
| 381 | Ga0207693_10201492 | 3300025915 | Bacteria | 1565 |
| 382 | Ga0207693_10236452 | 3300025915 | Bacteria | 1434 |
| 383 | Ga0207693_10355262 | 3300025915 | Bacteria | 1146 |
| 384 | Ga0207663_10030425 | 3300025916 | Bacteria | 3185 |
| 385 | Ga0207663_10055624 | 3300025916 | Bacteria | 2484 |
| 386 | Ga0207663_10068956 | 3300025916 | Bacteria | 2273 |
| 387 | Ga0207660_10054585 | 3300025917 | Bacteria | 2852 |
| 388 | Ga0207660_10083264 | 3300025917 | Bacteria | 2355 |
| 389 | Ga0207660_10198304 | 3300025917 | Bacteria | 1567 |
| 390 | Ga0207662_10005077 | 3300025918 | Bacteria | 6978 |
| 391 | Ga0207657_10001843 | 3300025919 | Bacteria | 22910 |
| 392 | Ga0207657_10062133 | 3300025919 | Bacteria | 3199 |
| 393 | Ga0207649_10321784 | 3300025920 | Bacteria | 1137 |
| 394 | Ga0207649_10608046 | 3300025920 | Bacteria | 841 |
| 395 | Ga0207652_10033721 | 3300025921 | Bacteria | 4312 |
| 396 | Ga0207652_10034319 | 3300025921 | Bacteria | 4275 |
| 397 | Ga0207652_10070720 | 3300025921 | Bacteria | 3031 |
| 398 | Ga0207652_10080065 | 3300025921 | Bacteria | 2855 |
| 399 | Ga0207646_10010709 | 3300025922 | Bacteria | 8928 |
| 400 | Ga0207646_10015301 | 3300025922 | Bacteria | 7249 |
| 401 | Ga0207646_10287335 | 3300025922 | Bacteria | 1486 |
| 402 | Ga0207681_10018267 | 3300025923 | Bacteria | 4417 |
| 403 | Ga0207681_10166283 | 3300025923 | Bacteria | 1668 |
| 404 | Ga0207694_10487920 | 3300025924 | Bacteria | 1031 |
| 405 | Ga0207650_10044635 | 3300025925 | Bacteria | 3258 |
| 406 | Ga0207650_10111015 | 3300025925 | Bacteria | 2123 |
| 407 | Ga0207659_10056399 | 3300025926 | Bacteria | 2814 |
| 408 | Ga0207659_10156145 | 3300025926 | Bacteria | 1787 |
| 409 | Ga0207687_10036796 | 3300025927 | Bacteria | 3335 |
| 410 | Ga0207687_10071637 | 3300025927 | Bacteria | 2477 |
| 411 | Ga0207687_10189976 | 3300025927 | Bacteria | 1598 |
| 412 | Ga0207687_10374964 | 3300025927 | Bacteria | 1164 |
| 413 | Ga0207687_10436315 | 3300025927 | Bacteria | 1084 |
| 414 | Ga0207700_10032985 | 3300025928 | Bacteria | 3701 |
| 415 | Ga0207700_10068058 | 3300025928 | Bacteria | 2729 |
| 416 | Ga0207700_10069439 | 3300025928 | Bacteria | 2704 |
| 417 | Ga0207700_10087041 | 3300025928 | Bacteria | 2456 |
| 418 | Ga0207700_10128919 | 3300025928 | Bacteria | 2062 |
| 419 | Ga0207700_10154442 | 3300025928 | Bacteria | 1900 |
| 420 | Ga0207700_10446945 | 3300025928 | Bacteria | 1139 |
| 421 | Ga0207700_10456930 | 3300025928 | Bacteria | 1126 |
| 422 | Ga0207664_10002425 | 3300025929 | Bacteria | 12335 |
| 423 | Ga0207664_10005168 | 3300025929 | Bacteria | 8893 |
| 424 | Ga0207664_10015898 | 3300025929 | Bacteria | 5479 |
| 425 | Ga0207664_10020974 | 3300025929 | Bacteria | 4849 |
| 426 | Ga0207664_10032683 | 3300025929 | Bacteria | 3990 |
| 427 | Ga0207664_10039208 | 3300025929 | Bacteria | 3677 |
| 428 | Ga0207664_10052909 | 3300025929 | Bacteria | 3212 |
| 429 | Ga0207664_10072900 | 3300025929 | Bacteria | 2770 |
| 430 | Ga0207664_10460899 | 3300025929 | Bacteria | 1135 |
| 431 | Ga0207644_10136573 | 3300025931 | Bacteria | 1883 |
| 432 | Ga0207690_10011653 | 3300025932 | Bacteria | 5255 |
| 433 | Ga0207690_10065424 | 3300025932 | Bacteria | 2486 |
| 434 | Ga0207706_10008643 | 3300025933 | Bacteria | 9381 |
| 435 | Ga0207686_10109239 | 3300025934 | Bacteria | 1862 |
| 436 | Ga0207709_10011567 | 3300025935 | Bacteria | 4868 |
| 437 | Ga0207709_10014406 | 3300025935 | Bacteria | 4366 |
| 438 | Ga0207709_10253185 | 3300025935 | Bacteria | 1287 |
| 439 | Ga0207670_10005858 | 3300025936 | Bacteria | 6785 |
| 440 | Ga0207670_10256130 | 3300025936 | Bacteria | 1354 |
| 441 | Ga0207669_10010843 | 3300025937 | Bacteria | 4405 |
| 442 | Ga0207669_10128968 | 3300025937 | Bacteria | 1734 |
| 443 | Ga0207704_10006943 | 3300025938 | Bacteria | 5313 |
| 444 | Ga0207704_10037653 | 3300025938 | Bacteria | 2796 |
| 445 | Ga0207665_10041688 | 3300025939 | Bacteria | 3067 |
| 446 | Ga0207665_10044459 | 3300025939 | Bacteria | 2972 |
| 447 | Ga0207665_10091095 | 3300025939 | Bacteria | 2114 |
| 448 | Ga0207665_10185131 | 3300025939 | Bacteria | 1510 |
| 449 | Ga0207691_10020083 | 3300025940 | Bacteria | 6319 |
| 450 | Ga0207691_10058230 | 3300025940 | Bacteria | 3514 |
| 451 | Ga0207711_10015219 | 3300025941 | Bacteria | 6386 |
| 452 | Ga0207689_10009295 | 3300025942 | Bacteria | 8498 |
| 453 | Ga0207689_10018914 | 3300025942 | Bacteria | 5810 |
| 454 | Ga0207661_10006975 | 3300025944 | Bacteria | 8012 |
| 455 | Ga0207661_10007758 | 3300025944 | Bacteria | 7642 |
| 456 | Ga0207661_10046413 | 3300025944 | Bacteria | 3445 |
| 457 | Ga0207661_10057842 | 3300025944 | Bacteria | 3119 |
| 458 | Ga0207661_10059390 | 3300025944 | Bacteria | 3082 |
| 459 | Ga0207661_10076878 | 3300025944 | Bacteria | 2743 |
| 460 | Ga0207661_10537164 | 3300025944 | Bacteria | 1070 |
| 461 | Ga0207679_10108982 | 3300025945 | Bacteria | 2182 |
| 462 | Ga0207679_10145994 | 3300025945 | Bacteria | 1919 |
| 463 | Ga0207679_10581139 | 3300025945 | Bacteria | 1008 |
| 464 | Ga0207667_10924513 | 3300025949 | Bacteria | 863 |
| 465 | Ga0207651_10049958 | 3300025960 | Bacteria | 2837 |
| 466 | Ga0207651_10570524 | 3300025960 | Bacteria | 986 |
| 467 | Ga0207712_10013444 | 3300025961 | Bacteria | 5246 |
| 468 | Ga0207668_10006340 | 3300025972 | Bacteria | 6995 |
| 469 | Ga0207668_10059741 | 3300025972 | Bacteria | 2673 |
| 470 | Ga0207668_10303624 | 3300025972 | Bacteria | 1318 |
| 471 | Ga0207668_10881028 | 3300025972 | Bacteria | 796 |
| 472 | Ga0207703_10007760 | 3300026035 | Bacteria | 8493 |
| 473 | Ga0207703_10120627 | 3300026035 | Bacteria | 2251 |
| 474 | Ga0207639_10019887 | 3300026041 | Bacteria | 4797 |
| 475 | Ga0207639_10057672 | 3300026041 | Bacteria | 2983 |
| 476 | Ga0207678_10012485 | 3300026067 | Bacteria | 7459 |
| 477 | Ga0207678_10049018 | 3300026067 | Bacteria | 3649 |
| 478 | Ga0207678_10288416 | 3300026067 | Bacteria | 1409 |
| 479 | Ga0207678_10924451 | 3300026067 | Bacteria | 771 |
| 480 | Ga0207708_10010788 | 3300026075 | Bacteria | 6791 |
| 481 | Ga0207708_10214371 | 3300026075 | Bacteria | 1540 |
| 482 | Ga0207708_10880563 | 3300026075 | Bacteria | 774 |
| 483 | Ga0207702_10024939 | 3300026078 | Bacteria | 4962 |
| 484 | Ga0207702_10039177 | 3300026078 | Bacteria | 3970 |
| 485 | Ga0207702_10412804 | 3300026078 | Bacteria | 1304 |
| 486 | Ga0207702_10464120 | 3300026078 | Bacteria | 1230 |
| 487 | Ga0207702_10567792 | 3300026078 | Bacteria | 1111 |
| 488 | Ga0207702_10641501 | 3300026078 | Bacteria | 1044 |
| 489 | Ga0207641_10478807 | 3300026088 | Bacteria | 1206 |
| 490 | Ga0207641_10532009 | 3300026088 | Bacteria | 1144 |
| 491 | Ga0207641_10559965 | 3300026088 | Bacteria | 1115 |
| 492 | Ga0207648_10023769 | 3300026089 | Bacteria | 5483 |
| 493 | Ga0207648_10043798 | 3300026089 | Bacteria | 3929 |
| 494 | Ga0207648_10094750 | 3300026089 | Bacteria | 2611 |
| 495 | Ga0207648_10138893 | 3300026089 | Bacteria | 2141 |
| 496 | Ga0207676_10227097 | 3300026095 | Bacteria | 1666 |
| 497 | Ga0207674_10009266 | 3300026116 | Bacteria | 11280 |
| 498 | Ga0207674_10021925 | 3300026116 | Bacteria | 6869 |
| 499 | Ga0207674_10278111 | 3300026116 | Bacteria | 1622 |
| 500 | Ga0207674_10495346 | 3300026116 | Bacteria | 1181 |
| 501 | Ga0207675_100009277 | 3300026118 | Bacteria | 9228 |
| 502 | Ga0207675_100016831 | 3300026118 | Bacteria | 6831 |
| 503 | Ga0207675_100098975 | 3300026118 | Bacteria | 2747 |
| 504 | Ga0207675_100556275 | 3300026118 | Bacteria | 1147 |
| 505 | Ga0207683_10006539 | 3300026121 | Bacteria | 9979 |
| 506 | Ga0207683_10012640 | 3300026121 | Bacteria | 7200 |
| 507 | Ga0207683_10085257 | 3300026121 | Bacteria | 2808 |
| 508 | Ga0207683_10348115 | 3300026121 | Bacteria | 1360 |
| 509 | Ga0207698_10391364 | 3300026142 | Bacteria | 1325 |
| 510 | Ga0209813_10063302 | 3300027866 | Bacteria | 1186 |
| 511 | Ga0207428_10016087 | 3300027907 | Bacteria | 6446 |
| 512 | Ga0207428_10105603 | 3300027907 | Bacteria | 2172 |
| 513 | Ga0268265_10066231 | 3300028380 | Bacteria | 2792 |
| 514 | Ga0268265_11058065 | 3300028380 | Bacteria | 804 |
| 515 | Ga0268264_10097244 | 3300028381 | Bacteria | 2551 |
| 516 | Ga0265337_1000033 | 3300028556 | Bacteria | 60717 |
| 517 | Ga0265337_1035722 | 3300028556 | Bacteria | 1454 |
| 518 | Ga0265326_10001841 | 3300028558 | Bacteria | 7274 |
| 519 | Ga0265319_1002186 | 3300028563 | Bacteria | 10895 |
| 520 | Ga0265334_10006906 | 3300028573 | Bacteria | 4873 |
| 521 | Ga0265334_10031619 | 3300028573 | Bacteria | 2114 |
| 522 | Ga0265318_10002086 | 3300028577 | Bacteria | 10937 |
| 523 | Ga0265318_10009588 | 3300028577 | Bacteria | 4250 |
| 524 | Ga0265318_10011629 | 3300028577 | Bacteria | 3781 |
| 525 | Ga0265318_10126186 | 3300028577 | Bacteria | 941 |
| 526 | Ga0265323_10004662 | 3300028653 | Bacteria | 5884 |
| 527 | Ga0265322_10003011 | 3300028654 | Bacteria | 5132 |
| 528 | Ga0265322_10009522 | 3300028654 | Bacteria | 2821 |
| 529 | Ga0265322_10051176 | 3300028654 | Bacteria | 1172 |
| 530 | Ga0265336_10003443 | 3300028666 | Bacteria | 6201 |
| 531 | Ga0265336_10041308 | 3300028666 | Bacteria | 1410 |
| 532 | Ga0265338_10000059 | 3300028800 | Bacteria | 198047 |
| 533 | Ga0265338_10002834 | 3300028800 | Bacteria | 25311 |
| 534 | Ga0265338_10009051 | 3300028800 | Bacteria | 11977 |
| 535 | Ga0265338_10026943 | 3300028800 | Bacteria | 5781 |
| 536 | Ga0265338_10088243 | 3300028800 | Bacteria | 2574 |
| 537 | Ga0265324_10000810 | 3300029957 | Bacteria | 20364 |
| 538 | Ga0265330_10064966 | 3300031235 | Bacteria | 1584 |
| 539 | Ga0265330_10066888 | 3300031235 | Bacteria | 1558 |
| 540 | Ga0265332_10000315 | 3300031238 | Bacteria | 37028 |
| 541 | Ga0265332_10112041 | 3300031238 | Bacteria | 1149 |
| 542 | Ga0265320_10003479 | 3300031240 | Bacteria | 10556 |
| 543 | Ga0265320_10013756 | 3300031240 | Bacteria | 4642 |
| 544 | Ga0265320_10073655 | 3300031240 | Bacteria | 1604 |
| 545 | Ga0265325_10062542 | 3300031241 | Bacteria | 1885 |
| 546 | Ga0265325_10065324 | 3300031241 | Bacteria | 1838 |
| 547 | Ga0265329_10049954 | 3300031242 | Bacteria | 1332 |
| 548 | Ga0265340_10000168 | 3300031247 | Bacteria | 32907 |
| 549 | Ga0265340_10041197 | 3300031247 | Bacteria | 2272 |
| 550 | Ga0265340_10084773 | 3300031247 | Bacteria | 1487 |
| 551 | Ga0265339_10015478 | 3300031249 | Bacteria | 4570 |
| 552 | Ga0265339_10126140 | 3300031249 | Bacteria | 1312 |
| 553 | Ga0265331_10054975 | 3300031250 | Bacteria | 1895 |
| 554 | Ga0265331_10064200 | 3300031250 | Bacteria | 1729 |
| 555 | Ga0265327_10072976 | 3300031251 | Bacteria | 1713 |
| 556 | Ga0265327_10165307 | 3300031251 | Bacteria | 1019 |
| 557 | Ga0265316_10007783 | 3300031344 | Bacteria | 10035 |
| 558 | Ga0265316_10019343 | 3300031344 | Bacteria | 5827 |
| 559 | Ga0307509_10168616 | 3300031507 | Bacteria | 2073 |
| 560 | Ga0265313_10006538 | 3300031595 | Bacteria | 8224 |
| 561 | Ga0265313_10026175 | 3300031595 | Bacteria | 3078 |
| 562 | Ga0265313_10164033 | 3300031595 | Bacteria | 942 |
| 563 | Ga0265314_10005746 | 3300031711 | Bacteria | 11128 |
| 564 | Ga0265314_10014093 | 3300031711 | Bacteria | 6419 |
| 565 | Ga0265314_10045899 | 3300031711 | Bacteria | 3086 |
| 566 | Ga0265314_10132511 | 3300031711 | Bacteria | 1552 |
| 567 | Ga0265342_10001322 | 3300031712 | Bacteria | 23238 |
| 568 | Ga0265342_10040773 | 3300031712 | Bacteria | 2814 |
| 569 | Ga0265342_10064181 | 3300031712 | Bacteria | 2156 |
| 570 | Ga0307405_10375765 | 3300031731 | Bacteria | 1105 |
| 571 | Ga0307416_100178966 | 3300032002 | Bacteria | 1985 |
| 572 | Ga0307416_100501622 | 3300032002 | Bacteria | 1278 |
| 573 | Ga0373948_0003612 | 3300034817 | Bacteria | 2391 |
| 574 | Ga0373948_0061127 | 3300034817 | Bacteria | 827 |
| 575 | Ga0373950_0051435 | 3300034818 | Bacteria | 810 |
| 576 | Ga0373958_0012987 | 3300034819 | Bacteria | 1434 |
| 577 | Ga0373958_0013501 | 3300034819 | Bacteria | 1416 |
| 578 | Ga0373926_0056484 | 3300035083 | Bacteria | 1424 |
| 579 | Ga0373929_0074714 | 3300035085 | Bacteria | 816 |
| 580 | Ga0373934_0002258 | 3300035086 | Bacteria | 7083 |
| 581 | Ga0373934_0011853 | 3300035086 | Bacteria | 3285 |
| 582 | Ga0373934_0123875 | 3300035086 | Bacteria | 1052 |
| 583 | Ga0373949_0002596 | 3300035090 | Bacteria | 4579 |
| 584 | Ga0373949_0017890 | 3300035090 | Bacteria | 1601 |
| 585 | Ga0373949_0027952 | 3300035090 | Bacteria | 1329 |
| 586 | Ga0373923_0008085 | 3300035111 | Bacteria | 3733 |
| 587 | Ga0373923_0149773 | 3300035111 | Bacteria | 1059 |
| 588 | Ga0373932_0057276 | 3300035112 | Bacteria | 1175 |
| 589 | Ga0373936_0011457 | 3300035113 | Bacteria | 3356 |
| 590 | Ga0373936_0011809 | 3300035113 | Bacteria | 3312 |
| 591 | Ga0373939_0052315 | 3300035114 | Bacteria | 1272 |
| 592 | Ga0373945_0002605 | 3300035116 | Bacteria | 5650 |
| 593 | Ga0373945_0070097 | 3300035116 | Bacteria | 1325 |
| 594 | Ga0373953_0000386 | 3300035117 | Bacteria | 11969 |
| 595 | Ga0373953_0002454 | 3300035117 | Bacteria | 5609 |
| 596 | Ga0373953_0034216 | 3300035117 | Bacteria | 1991 |
| 597 | Ga0373953_0069609 | 3300035117 | Bacteria | 1450 |
| 598 | Ga0373953_0106760 | 3300035117 | Bacteria | 1182 |
| 599 | Ga0373953_0129062 | 3300035117 | Bacteria | 1077 |
| 600 | Ga0373954_0022705 | 3300035118 | Bacteria | 2849 |
| 601 | Ga0373954_0050231 | 3300035118 | Bacteria | 1957 |
| 602 | Ga0373954_0073094 | 3300035118 | Bacteria | 1631 |
| 603 | Ga0373954_0132796 | 3300035118 | Bacteria | 1212 |
| 604 | Ga0373956_0001244 | 3300035119 | Bacteria | 10544 |
| 605 | Ga0373956_0008563 | 3300035119 | Bacteria | 4142 |
| 606 | Ga0373956_0127642 | 3300035119 | Bacteria | 1189 |
| 607 | Ga0373956_0155328 | 3300035119 | Bacteria | 1077 |
| 608 | Ga0373957_0000246 | 3300035120 | Bacteria | 13558 |
| 609 | Ga0373957_0054480 | 3300035120 | Bacteria | 1536 |
| 610 | Ga0373957_0066495 | 3300035120 | Bacteria | 1404 |
| 611 | Ga0373960_0049976 | 3300035121 | Bacteria | 1238 |
| 612 | Ga0373943_0074747 | 3300035170 | Bacteria | 1724 |
| 613 | Ga0373946_0115537 | 3300035171 | Bacteria | 1219 |
| 614 | Ga0373955_0000228 | 3300035172 | Bacteria | 23478 |
| 615 | Ga0373955_0013489 | 3300035172 | Bacteria | 3954 |
| 616 | Ga0373955_0044965 | 3300035172 | Bacteria | 2381 |
| 617 | Ga0373955_0082384 | 3300035172 | Bacteria | 1820 |
| 618 | Ga0373955_0177833 | 3300035172 | Bacteria | 1262 |
| 619 | Ga0373955_0226574 | 3300035172 | Bacteria | 1117 |
| 620 | Ga0373955_0244728 | 3300035172 | Bacteria | 1074 |
| 621 | Ga0373955_0348733 | 3300035172 | Bacteria | 896 |
| 622 | Ga0373942_0005087 | 3300035207 | Bacteria | 3050 |
| 623 | Ga0373942_0027404 | 3300035207 | Bacteria | 1482 |
| 624 | Ga0373961_0016088 | 3300035241 | Bacteria | 1923 |
| 625 | Ga0373961_0018101 | 3300035241 | Bacteria | 1836 |
| 626 | Ga0373962_0023258 | 3300035242 | Bacteria | 1649 |
| 627 | Ga0316574_0103985 | 3300035398 | Bacteria | 1818 |
| 628 | Ga0373924_0002099 | 3300035410 | Bacteria | 6653 |
| 629 | Ga0373924_0042617 | 3300035410 | Bacteria | 1862 |
| 630 | Ga0373931_0008158 | 3300035691 | Bacteria | 4962 |
| 631 | Ga0373931_0091615 | 3300035691 | Bacteria | 1694 |
| 632 | Ga0373931_0092396 | 3300035691 | Bacteria | 1688 |
| 633 | Ga0373931_0105452 | 3300035691 | Bacteria | 1592 |
| 634 | Ga0373927_0009389 | 3300035695 | Bacteria | 6561 |
| 635 | Ga0373927_0109158 | 3300035695 | Bacteria | 1802 |
| 636 | Ga0373933_0000012 | 3300035724 | Bacteria | 108156 |
| 637 | Ga0373933_0018359 | 3300035724 | Bacteria | 3931 |
| 638 | Ga0373933_0022298 | 3300035724 | Bacteria | 3604 |
| 639 | Ga0373933_0267120 | 3300035724 | Bacteria | 1104 |
| 640 | Ga0373933_0294100 | 3300035724 | Bacteria | 1050 |
| 641 | Ga0373933_0382669 | 3300035724 | Bacteria | 916 |
| 642 | Ga0373947_0019792 | 3300035725 | Bacteria | 3884 |
| 643 | Ga0373947_0048661 | 3300035725 | Bacteria | 2544 |
| 644 | Ga0373947_0048860 | 3300035725 | Bacteria | 2539 |
| 645 | Ga0373947_0052979 | 3300035725 | Bacteria | 2445 |
| 646 | Ga0373947_0056510 | 3300035725 | Bacteria | 2372 |
| 647 | Ga0373937_0000040 | 3300036401 | Bacteria | 108935 |
| 648 | Ga0373937_0002649 | 3300036401 | Bacteria | 14915 |
| 649 | Ga0373937_0003488 | 3300036401 | Bacteria | 13226 |
| 650 | Ga0373937_0028479 | 3300036401 | Bacteria | 5055 |
| 651 | Ga0373937_0052183 | 3300036401 | Bacteria | 3748 |
| 652 | Ga0373937_0057123 | 3300036401 | Bacteria | 3584 |
| 653 | Ga0373937_0200759 | 3300036401 | Bacteria | 1874 |
| 654 | Ga0373937_0506048 | 3300036401 | Bacteria | 1147 |
| 655 | Ga0372808_001465 | 3300036459 | Bacteria | 2462 |
| 656 | Ga0373925_0000014 | 3300037068 | Bacteria | 180414 |
| 657 | Ga0373925_0004085 | 3300037068 | Bacteria | 11078 |
| 658 | Ga0373925_0010821 | 3300037068 | Bacteria | 6615 |
| 659 | Ga0373925_0023001 | 3300037068 | Bacteria | 4548 |
| 660 | Ga0373925_0077614 | 3300037068 | Bacteria | 2521 |
| 661 | Ga0373925_0431063 | 3300037068 | Bacteria | 1078 |
| 662 | Ga0395899_0277109 | 3300037312 | Bacteria | 1142 |
| 663 | Ga0395900_0155133 | 3300037418 | Bacteria | 2339 |
| 664 | Ga0395898_0082521 | 3300037466 | Bacteria | 3098 |
| 665 | Ga0395898_0087463 | 3300037466 | Bacteria | 3002 |
| 666 | Ga0395898_0736505 | 3300037466 | Bacteria | 927 |
| 667 | Ga0436364_0296603 | 3300037853 | Bacteria | 1761 |
| 668 | Ga0436364_0305992 | 3300037853 | Bacteria | 1457 |
| 669 | Ga0436364_0330965 | 3300037853 | Bacteria | 247749 |
| 670 | Ga0436364_0970657 | 3300037853 | Bacteria | 3769 |
| 671 | Ga0436364_1003558 | 3300037853 | Bacteria | 13096 |
| 672 | Ga0436364_1091382 | 3300037853 | Bacteria | 1767 |
| 673 | Ga0436364_1207495 | 3300037853 | Bacteria | 11099 |
| 674 | Ga0436364_1309732 | 3300037853 | Bacteria | 3300 |
| 675 | Ga0436364_1515661 | 3300037853 | Bacteria | 6169 |
| 676 | Ga0395901_0058914 | 3300038443 | Bacteria | 3995 |
| 677 | Ga0395901_0105133 | 3300038443 | Bacteria | 2963 |
| 678 | Ga0395901_0563324 | 3300038443 | Bacteria | 1153 |
| 679 | Ga0395901_1056289 | 3300038443 | Bacteria | 785 |
| 680 | Ga0400483_027790 | 3300039062 | Bacteria | 5551 |
| 681 | Ga0400483_040279 | 3300039062 | Bacteria | 3026 |
| 682 | Ga0400483_148576 | 3300039062 | Bacteria | 5166 |
| 683 | Ga0436365_0122816 | 3300039437 | Bacteria | 3399 |
| 684 | Ga0436365_0501329 | 3300039437 | Bacteria | 4187 |
| 685 | Ga0436365_0722652 | 3300039437 | Bacteria | 1846 |
| 686 | Ga0436365_0741127 | 3300039437 | Bacteria | 2129 |
| 687 | Ga0436365_0772721 | 3300039437 | Bacteria | 3409 |
| 688 | Ga0436365_1118937 | 3300039437 | Bacteria | 2875 |
| 689 | Ga0436365_1384528 | 3300039437 | Bacteria | 14063 |
| 690 | Ga0436365_1709192 | 3300039437 | Bacteria | 1987 |
| 691 | Ga0436365_1928355 | 3300039437 | Bacteria | 7771 |
| 692 | Ga0436361_0405093 | 3300039447 | Bacteria | 909 |
| 693 | Ga0436363_0275177 | 3300039450 | Bacteria | 88978 |
| 694 | Ga0436363_0440163 | 3300039450 | Bacteria | 3417 |
| 695 | Ga0436363_0510149 | 3300039450 | Bacteria | 4096 |
| 696 | Ga0436363_1273328 | 3300039450 | Bacteria | 2142 |
| 697 | Ga0436363_1413520 | 3300039450 | Bacteria | 1855 |
| 698 | Ga0436362_0833178 | 3300039453 | Bacteria | 1615 |
| 699 | Ga0436362_0953937 | 3300039453 | Bacteria | 2048 |
| 700 | Ga0450917_009097 | 3300042120 | Bacteria | 775 |
| 701 | Ga0466965_0256018 | 3300044683 | Bacteria | 940 |
| 702 | Ga0466966_0180031 | 3300044684 | Bacteria | 1283 |
| 703 | Ga0466966_0473861 | 3300044684 | Bacteria | 753 |
| 704 | Ga0466963_0001738 | 3300044694 | Bacteria | 11866 |
| 705 | Ga0466963_0022259 | 3300044694 | Bacteria | 4012 |
| 706 | Ga0466963_0139269 | 3300044694 | Bacteria | 1680 |
| 707 | Ga0466963_0214943 | 3300044694 | Bacteria | 1346 |
| 708 | Ga0466964_0069867 | 3300044706 | Bacteria | 1482 |
| 709 | Ga0466971_0098857 | 3300044719 | Bacteria | 1340 |
| 710 | Ga0466959_0037694 | 3300045049 | Bacteria | 3573 |
| 711 | Ga0466959_0042235 | 3300045049 | Bacteria | 3363 |
| 712 | Ga0466959_0050502 | 3300045049 | Bacteria | 3053 |
| 713 | Ga0466959_0149684 | 3300045049 | Bacteria | 1646 |
| 714 | Ga0466959_0232645 | 3300045049 | Bacteria | 1275 |
| 715 | Ga0466958_0001703 | 3300045836 | Bacteria | 10606 |
| 716 | Ga0466958_0266968 | 3300045836 | Bacteria | 1096 |
| 717 | Ga0466958_0450580 | 3300045836 | Bacteria | 833 |
| 718 | Ga0466967_0002363 | 3300045976 | Bacteria | 11678 |
| 719 | Ga0466967_0003356 | 3300045976 | Bacteria | 10411 |
| 720 | Ga0466967_0026541 | 3300045976 | Bacteria | 4800 |
| 721 | Ga0466967_0070646 | 3300045976 | Bacteria | 3124 |
| 722 | Ga0466967_0155534 | 3300045976 | Bacteria | 2141 |
| 723 | Ga0466967_0249603 | 3300045976 | Bacteria | 1695 |
| 724 | Ga0466967_0432380 | 3300045976 | Bacteria | 1284 |
| 725 | Ga0466967_0688114 | 3300045976 | Bacteria | 1012 |
| 726 | Ga0495592_0000311 | 3300046454 | Bacteria | 40958 |
| 727 | Ga0495592_0000527 | 3300046454 | Bacteria | 27616 |
| 728 | Ga0495592_0025649 | 3300046454 | Bacteria | 4473 |
| 729 | Ga0495592_0034230 | 3300046454 | Bacteria | 3830 |
| 730 | Ga0495592_0050225 | 3300046454 | Bacteria | 3099 |
| 731 | Ga0495592_0110199 | 3300046454 | Bacteria | 1949 |
| 732 | Ga0495592_0205353 | 3300046454 | Bacteria | 1327 |
| 733 | Ga0495603_0208477 | 3300046455 | Bacteria | 1129 |
| 734 | Ga0495603_0276899 | 3300046455 | Bacteria | 965 |
| 735 | Ga0495629_0015038 | 3300046459 | Bacteria | 5562 |
| 736 | Ga0495629_0033434 | 3300046459 | Bacteria | 3637 |
| 737 | Ga0495629_0078458 | 3300046459 | Bacteria | 2305 |
| 738 | Ga0495629_0161204 | 3300046459 | Bacteria | 1558 |
| 739 | Ga0495629_0182369 | 3300046459 | Bacteria | 1455 |
| 740 | Ga0495641_0007063 | 3300046461 | Bacteria | 7113 |
| 741 | Ga0495641_0063175 | 3300046461 | Bacteria | 1669 |
| 742 | Ga0495641_0064991 | 3300046461 | Bacteria | 1642 |
| 743 | Ga0495651_0000040 | 3300046462 | Bacteria | 94890 |
| 744 | Ga0495651_0000432 | 3300046462 | Bacteria | 32343 |
| 745 | Ga0495651_0010333 | 3300046462 | Bacteria | 7172 |
| 746 | Ga0495651_0012108 | 3300046462 | Bacteria | 6636 |
| 747 | Ga0495651_0020217 | 3300046462 | Bacteria | 5167 |
| 748 | Ga0495651_0040043 | 3300046462 | Bacteria | 3645 |
| 749 | Ga0495651_0061895 | 3300046462 | Bacteria | 2864 |
| 750 | Ga0495651_0080139 | 3300046462 | Bacteria | 2466 |
| 751 | Ga0495651_0102253 | 3300046462 | Bacteria | 2131 |
| 752 | Ga0495651_0131711 | 3300046462 | Bacteria | 1824 |
| 753 | Ga0495651_0260350 | 3300046462 | Bacteria | 1180 |
| 754 | Ga0495653_0001251 | 3300046463 | Bacteria | 19664 |
| 755 | Ga0495653_0007460 | 3300046463 | Bacteria | 8947 |
| 756 | Ga0495653_0010425 | 3300046463 | Bacteria | 7603 |
| 757 | Ga0495653_0013540 | 3300046463 | Bacteria | 6648 |
| 758 | Ga0495653_0023183 | 3300046463 | Bacteria | 5019 |
| 759 | Ga0495653_0058167 | 3300046463 | Bacteria | 2939 |
| 760 | Ga0495653_0070742 | 3300046463 | Bacteria | 2610 |
| 761 | Ga0495653_0306885 | 3300046463 | Bacteria | 1033 |
| 762 | Ga0495653_0373008 | 3300046463 | Bacteria | 913 |
| 763 | Ga0495580_0068962 | 3300046472 | Bacteria | 2471 |
| 764 | Ga0495582_0001113 | 3300046473 | Bacteria | 15100 |
| 765 | Ga0495582_0074578 | 3300046473 | Bacteria | 1878 |
| 766 | Ga0495582_0109258 | 3300046473 | Bacteria | 1553 |
| 767 | Ga0495582_0164323 | 3300046473 | Bacteria | 1263 |
| 768 | Ga0495639_0002135 | 3300046475 | Bacteria | 8718 |
| 769 | Ga0495639_0084286 | 3300046475 | Bacteria | 1484 |
| 770 | Ga0495639_0095221 | 3300046475 | Bacteria | 1401 |
| 771 | Ga0495662_0031724 | 3300046476 | Bacteria | 2552 |
| 772 | Ga0495662_0061205 | 3300046476 | Bacteria | 1819 |
| 773 | Ga0495664_0005004 | 3300046477 | Bacteria | 7256 |
| 774 | Ga0495664_0012500 | 3300046477 | Bacteria | 4808 |
| 775 | Ga0495664_0047329 | 3300046477 | Bacteria | 2552 |
| 776 | Ga0495664_0124224 | 3300046477 | Bacteria | 1561 |
| 777 | Ga0495664_0143344 | 3300046477 | Bacteria | 1448 |
| 778 | Ga0495664_0402642 | 3300046477 | Bacteria | 822 |
| 779 | Ga0495594_0016153 | 3300046499 | Bacteria | 3930 |
| 780 | Ga0495594_0119789 | 3300046499 | Bacteria | 1487 |
| 781 | Ga0495594_0123368 | 3300046499 | Bacteria | 1465 |
| 782 | Ga0495596_0036764 | 3300046500 | Bacteria | 1939 |
| 783 | Ga0495608_0000044 | 3300046511 | Bacteria | 108171 |
| 784 | Ga0495608_0003725 | 3300046511 | Bacteria | 10952 |
| 785 | Ga0495608_0013028 | 3300046511 | Bacteria | 5769 |
| 786 | Ga0495608_0041756 | 3300046511 | Bacteria | 3068 |
| 787 | Ga0495608_0052083 | 3300046511 | Bacteria | 2710 |
| 788 | Ga0495608_0063252 | 3300046511 | Bacteria | 2429 |
| 789 | Ga0495608_0071915 | 3300046511 | Bacteria | 2256 |
| 790 | Ga0495608_0113406 | 3300046511 | Bacteria | 1741 |
| 791 | Ga0495608_0230472 | 3300046511 | Bacteria | 1160 |
| 792 | Ga0495618_0008862 | 3300046514 | Bacteria | 6072 |
| 793 | Ga0495618_0012673 | 3300046514 | Bacteria | 5123 |
| 794 | Ga0495618_0074891 | 3300046514 | Bacteria | 2156 |
| 795 | Ga0495618_0169551 | 3300046514 | Bacteria | 1389 |
| 796 | Ga0495628_0000123 | 3300046516 | Bacteria | 64063 |
| 797 | Ga0495628_0001019 | 3300046516 | Bacteria | 25587 |
| 798 | Ga0495628_0015522 | 3300046516 | Bacteria | 6359 |
| 799 | Ga0495628_0025365 | 3300046516 | Bacteria | 4843 |
| 800 | Ga0495628_0064278 | 3300046516 | Bacteria | 2873 |
| 801 | Ga0495628_0087795 | 3300046516 | Bacteria | 2411 |
| 802 | Ga0495628_0098527 | 3300046516 | Bacteria | 2258 |
| 803 | Ga0495630_0001285 | 3300046517 | Bacteria | 17291 |
| 804 | Ga0495630_0017790 | 3300046517 | Bacteria | 5211 |
| 805 | Ga0495630_0236059 | 3300046517 | Bacteria | 1397 |
| 806 | Ga0495630_0337205 | 3300046517 | Bacteria | 1153 |
| 807 | Ga0495630_0387584 | 3300046517 | Bacteria | 1070 |
| 808 | Ga0495666_0050744 | 3300046526 | Bacteria | 1994 |
| 809 | Ga0495666_0088624 | 3300046526 | Bacteria | 1461 |
| 810 | Ga0495652_0000108 | 3300046529 | Bacteria | 89636 |
| 811 | Ga0495652_0002108 | 3300046529 | Bacteria | 20955 |
| 812 | Ga0495652_0047091 | 3300046529 | Bacteria | 3699 |
| 813 | Ga0495652_0054033 | 3300046529 | Bacteria | 3421 |
| 814 | Ga0495652_0122964 | 3300046529 | Bacteria | 2066 |
| 815 | Ga0495652_0256085 | 3300046529 | Bacteria | 1294 |
| 816 | Ga0495652_0300368 | 3300046529 | Bacteria | 1167 |
| 817 | Ga0495665_0001114 | 3300046531 | Bacteria | 14219 |
| 818 | Ga0495640_0000776 | 3300046533 | Bacteria | 24055 |
| 819 | Ga0495640_0031026 | 3300046533 | Bacteria | 3819 |
| 820 | Ga0495640_0357501 | 3300046533 | Bacteria | 901 |
| 821 | Ga0495586_0028909 | 3300046535 | Bacteria | 2967 |
| 822 | Ga0495586_0031543 | 3300046535 | Bacteria | 2839 |
| 823 | Ga0495587_0000046 | 3300046536 | Bacteria | 108171 |
| 824 | Ga0495587_0001714 | 3300046536 | Bacteria | 14640 |
| 825 | Ga0495587_0009527 | 3300046536 | Bacteria | 6220 |
| 826 | Ga0495587_0022981 | 3300046536 | Bacteria | 3834 |
| 827 | Ga0495587_0023110 | 3300046536 | Bacteria | 3823 |
| 828 | Ga0495587_0058683 | 3300046536 | Bacteria | 2260 |
| 829 | Ga0495587_0103208 | 3300046536 | Bacteria | 1641 |
| 830 | Ga0495587_0153456 | 3300046536 | Bacteria | 1312 |
| 831 | Ga0495587_0217118 | 3300046536 | Bacteria | 1079 |
| 832 | Ga0495609_0072602 | 3300046538 | Bacteria | 1511 |
| 833 | Ga0495645_0001345 | 3300046543 | Bacteria | 16609 |
| 834 | Ga0495645_0015292 | 3300046543 | Bacteria | 5456 |
| 835 | Ga0495645_0032378 | 3300046543 | Bacteria | 3814 |
| 836 | Ga0495645_0078708 | 3300046543 | Bacteria | 2369 |
| 837 | Ga0495645_0084006 | 3300046543 | Bacteria | 2281 |
| 838 | Ga0495645_0177101 | 3300046543 | Bacteria | 1464 |
| 839 | Ga0495645_0229657 | 3300046543 | Bacteria | 1244 |
| 840 | Ga0495645_0272482 | 3300046543 | Bacteria | 1116 |
| 841 | Ga0495645_0309437 | 3300046543 | Bacteria | 1029 |
| 842 | Ga0495667_0000066 | 3300046559 | Bacteria | 84361 |
| 843 | Ga0495667_0000469 | 3300046559 | Bacteria | 25713 |
| 844 | Ga0495667_0000828 | 3300046559 | Bacteria | 19968 |
| 845 | Ga0495667_0009982 | 3300046559 | Bacteria | 6428 |
| 846 | Ga0495667_0014660 | 3300046559 | Bacteria | 5296 |
| 847 | Ga0495667_0033979 | 3300046559 | Bacteria | 3410 |
| 848 | Ga0495667_0049490 | 3300046559 | Bacteria | 2775 |
| 849 | Ga0495667_0123994 | 3300046559 | Bacteria | 1667 |
| 850 | Ga0495667_0167185 | 3300046559 | Bacteria | 1414 |
| 851 | Ga0495667_0168443 | 3300046559 | Bacteria | 1408 |
| 852 | Ga0495667_0183342 | 3300046559 | Bacteria | 1342 |
| 853 | Ga0495667_0311125 | 3300046559 | Bacteria | 997 |
| 854 | Ga0495667_0434734 | 3300046559 | Bacteria | 825 |
| 855 | Ga0495635_0001007 | 3300046663 | Bacteria | 18614 |
| 856 | Ga0495635_0008192 | 3300046663 | Bacteria | 7300 |
| 857 | Ga0495635_0020988 | 3300046663 | Bacteria | 4552 |
| 858 | Ga0495635_0050191 | 3300046663 | Bacteria | 2876 |
| 859 | Ga0495635_0075969 | 3300046663 | Bacteria | 2302 |
| 860 | Ga0495635_0116471 | 3300046663 | Bacteria | 1824 |
| 861 | Ga0495635_0125870 | 3300046663 | Bacteria | 1747 |
| 862 | Ga0495659_0133478 | 3300046664 | Bacteria | 986 |
| 863 | Ga0495661_0194526 | 3300046665 | Bacteria | 1066 |
| 864 | Ga0495588_0094796 | 3300046674 | Bacteria | 1565 |
| 865 | Ga0495588_0205190 | 3300046674 | Bacteria | 1041 |
| 866 | Ga0495657_0001421 | 3300046675 | Bacteria | 20698 |
| 867 | Ga0495657_0002047 | 3300046675 | Bacteria | 17180 |
| 868 | Ga0495657_0009366 | 3300046675 | Bacteria | 7428 |
| 869 | Ga0495657_0010865 | 3300046675 | Bacteria | 6834 |
| 870 | Ga0495657_0012482 | 3300046675 | Bacteria | 6311 |
| 871 | Ga0495657_0027401 | 3300046675 | Bacteria | 4021 |
| 872 | Ga0495657_0066536 | 3300046675 | Bacteria | 2367 |
| 873 | Ga0495657_0074526 | 3300046675 | Bacteria | 2208 |
| 874 | Ga0495657_0080349 | 3300046675 | Bacteria | 2110 |
| 875 | Ga0495599_0000052 | 3300046678 | Bacteria | 80904 |
| 876 | Ga0495599_0000263 | 3300046678 | Bacteria | 33149 |
| 877 | Ga0495599_0036098 | 3300046678 | Bacteria | 3103 |
| 878 | Ga0495599_0039707 | 3300046678 | Bacteria | 2957 |
| 879 | Ga0495599_0243119 | 3300046678 | Bacteria | 1097 |
| 880 | Ga0495623_0000798 | 3300046679 | Bacteria | 21190 |
| 881 | Ga0495623_0005605 | 3300046679 | Bacteria | 8195 |
| 882 | Ga0495623_0020411 | 3300046679 | Bacteria | 4282 |
| 883 | Ga0495623_0046126 | 3300046679 | Bacteria | 2767 |
| 884 | Ga0495623_0072707 | 3300046679 | Bacteria | 2138 |
| 885 | Ga0495623_0093873 | 3300046679 | Bacteria | 1836 |
| 886 | Ga0495646_0000483 | 3300046680 | Bacteria | 21207 |
| 887 | Ga0495646_0002352 | 3300046680 | Bacteria | 11579 |
| 888 | Ga0495646_0014166 | 3300046680 | Bacteria | 5069 |
| 889 | Ga0495646_0043510 | 3300046680 | Bacteria | 2749 |
| 890 | Ga0495647_0009226 | 3300046681 | Bacteria | 3335 |
| 891 | Ga0495658_0024122 | 3300046683 | Bacteria | 3236 |
| 892 | Ga0495658_0119828 | 3300046683 | Bacteria | 1590 |
| 893 | Ga0495658_0125229 | 3300046683 | Bacteria | 1558 |
| 894 | Ga0495613_0030148 | 3300046689 | Bacteria | 4029 |
| 895 | Ga0495613_0080268 | 3300046689 | Bacteria | 2371 |
| 896 | Ga0495613_0118503 | 3300046689 | Bacteria | 1903 |
| 897 | Ga0495613_0336763 | 3300046689 | Bacteria | 1039 |
| 898 | Ga0495649_0226596 | 3300046694 | Bacteria | 966 |
| 899 | Ga0495589_0105353 | 3300046794 | Bacteria | 1363 |
| 900 | Ga0495600_0000363 | 3300046809 | Bacteria | 23755 |
| 901 | Ga0495600_0021707 | 3300046809 | Bacteria | 4116 |
| 902 | Ga0495600_0037041 | 3300046809 | Bacteria | 3170 |
| 903 | Ga0495600_0037705 | 3300046809 | Bacteria | 3143 |
| 904 | Ga0495600_0259053 | 3300046809 | Bacteria | 1105 |
| 905 | Ga0495581_0012735 | 3300047315 | Bacteria | 4871 |
| 906 | Ga0495581_0012822 | 3300047315 | Bacteria | 4854 |
| 907 | Ga0495581_0080938 | 3300047315 | Bacteria | 1880 |
| 908 | Ga0495604_0000049 | 3300047317 | Bacteria | 108620 |
| 909 | Ga0495604_0000825 | 3300047317 | Bacteria | 25886 |
| 910 | Ga0495604_0019323 | 3300047317 | Bacteria | 5453 |
| 911 | Ga0495604_0044702 | 3300047317 | Bacteria | 3458 |
| 912 | Ga0495604_0046769 | 3300047317 | Bacteria | 3373 |
| 913 | Ga0495604_0077899 | 3300047317 | Bacteria | 2489 |
| 914 | Ga0495604_0172570 | 3300047317 | Bacteria | 1519 |
| 915 | Ga0495604_0457968 | 3300047317 | Bacteria | 832 |
| 916 | Ga0495674_0000509 | 3300047319 | Bacteria | 35677 |
| 917 | Ga0495674_0001040 | 3300047319 | Bacteria | 26667 |
| 918 | Ga0495674_0008480 | 3300047319 | Bacteria | 9791 |
| 919 | Ga0495674_0013623 | 3300047319 | Bacteria | 7639 |
| 920 | Ga0495674_0112862 | 3300047319 | Bacteria | 2302 |
| 921 | Ga0495674_0246133 | 3300047319 | Bacteria | 1472 |
| 922 | Ga0495674_0288562 | 3300047319 | Bacteria | 1342 |
| 923 | Ga0495674_0449266 | 3300047319 | Bacteria | 1036 |
| 924 | Ga0495676_0004008 | 3300047321 | Bacteria | 13401 |
| 925 | Ga0495676_0095986 | 3300047321 | Bacteria | 2205 |
| 926 | Ga0495680_0000915 | 3300047322 | Bacteria | 32763 |
| 927 | Ga0495680_0001981 | 3300047322 | Bacteria | 21515 |
| 928 | Ga0495680_0002008 | 3300047322 | Bacteria | 21353 |
| 929 | Ga0495680_0008614 | 3300047322 | Bacteria | 9259 |
| 930 | Ga0495680_0011345 | 3300047322 | Bacteria | 7895 |
| 931 | Ga0495680_0019480 | 3300047322 | Bacteria | 5724 |
| 932 | Ga0495680_0040654 | 3300047322 | Bacteria | 3703 |
| 933 | Ga0495680_0049169 | 3300047322 | Bacteria | 3304 |
| 934 | Ga0495680_0220013 | 3300047322 | Bacteria | 1356 |
| 935 | Ga0495680_0278034 | 3300047322 | Bacteria | 1180 |
| 936 | Ga0495675_0000684 | 3300047444 | Bacteria | 21297 |
| 937 | Ga0495675_0015403 | 3300047444 | Bacteria | 4836 |
| 938 | Ga0495675_0041410 | 3300047444 | Bacteria | 2936 |
| 939 | Ga0495675_0074908 | 3300047444 | Bacteria | 2133 |
| 940 | Ga0495675_0146438 | 3300047444 | Bacteria | 1461 |
| 941 | Ga0495684_0001813 | 3300047471 | Bacteria | 17172 |
| 942 | Ga0495684_0009204 | 3300047471 | Bacteria | 7624 |
| 943 | Ga0495684_0018650 | 3300047471 | Bacteria | 5346 |
| 944 | Ga0495684_0105690 | 3300047471 | Bacteria | 2127 |
| 945 | Ga0495684_0123412 | 3300047471 | Bacteria | 1949 |
| 946 | Ga0495684_0197743 | 3300047471 | Bacteria | 1483 |
| 947 | Ga0495593_0009273 | 3300047673 | Bacteria | 5709 |
| 948 | Ga0495593_0014329 | 3300047673 | Bacteria | 4507 |
| 949 | Ga0495593_0074512 | 3300047673 | Bacteria | 1760 |
| 950 | Ga0495593_0173797 | 3300047673 | Bacteria | 1085 |
| 951 | Ga0495602_0001642 | 3300048088 | Bacteria | 22253 |
| 952 | Ga0495602_0002204 | 3300048088 | Bacteria | 19673 |
| 953 | Ga0495602_0020733 | 3300048088 | Bacteria | 6490 |
| 954 | Ga0495602_0027368 | 3300048088 | Bacteria | 5478 |
| 955 | Ga0495602_0062190 | 3300048088 | Bacteria | 3240 |
| 956 | Ga0495602_0079517 | 3300048088 | Bacteria | 2765 |
| 957 | Ga0495602_0109412 | 3300048088 | Bacteria | 2248 |
| 958 | Ga0495602_0247131 | 3300048088 | Bacteria | 1331 |
| 959 | Ga0495602_0496751 | 3300048088 | Bacteria | 853 |
| 960 | Ga0495614_0074477 | 3300048089 | Bacteria | 1466 |
| 961 | Ga0496100_0004806 | 3300048903 | Bacteria | 7216 |
| 962 | Ga0496100_0011762 | 3300048903 | Bacteria | 4992 |
| 963 | Ga0496100_0049972 | 3300048903 | Bacteria | 2707 |
| 964 | Ga0496100_0058398 | 3300048903 | Bacteria | 2531 |
| 965 | Ga0496100_0518683 | 3300048903 | Bacteria | 919 |
| 966 | Ga0496101_0002482 | 3300048904 | Bacteria | 11324 |
| 967 | Ga0496101_0024549 | 3300048904 | Bacteria | 4172 |
| 968 | Ga0496101_0040092 | 3300048904 | Bacteria | 3335 |
| 969 | Ga0496101_0046218 | 3300048904 | Bacteria | 3121 |
| 970 | Ga0496101_0171689 | 3300048904 | Bacteria | 1667 |
| 971 | Ga0496101_0217063 | 3300048904 | Bacteria | 1483 |
| 972 | Ga0496102_0008128 | 3300048905 | Bacteria | 8978 |
| 973 | Ga0496102_0034483 | 3300048905 | Bacteria | 4552 |
| 974 | Ga0496102_0054604 | 3300048905 | Bacteria | 3643 |
| 975 | Ga0496102_0101511 | 3300048905 | Bacteria | 2673 |
| 976 | Ga0496102_0105239 | 3300048905 | Bacteria | 2625 |
| 977 | Ga0496102_0158274 | 3300048905 | Bacteria | 2130 |
| 978 | Ga0496102_0161595 | 3300048905 | Bacteria | 2107 |
| 979 | Ga0496102_0226605 | 3300048905 | Bacteria | 1762 |
| 980 | Ga0496102_0626775 | 3300048905 | Bacteria | 998 |
| 981 | Ga0496103_0013448 | 3300048906 | Bacteria | 4854 |
| 982 | Ga0496103_0015143 | 3300048906 | Bacteria | 4585 |
| 983 | Ga0496103_0082878 | 3300048906 | Bacteria | 2019 |
| 984 | Ga0496104_0000254 | 3300048907 | Bacteria | 47479 |
| 985 | Ga0496104_0005355 | 3300048907 | Bacteria | 11230 |
| 986 | Ga0496104_0044635 | 3300048907 | Bacteria | 4164 |
| 987 | Ga0496104_0088201 | 3300048907 | Bacteria | 2963 |
| 988 | Ga0496104_0091180 | 3300048907 | Bacteria | 2913 |
| 989 | Ga0496104_0345648 | 3300048907 | Bacteria | 1400 |
| 990 | Ga0496105_0000055 | 3300048908 | Bacteria | 88389 |
| 991 | Ga0496105_0010310 | 3300048908 | Bacteria | 7345 |
| 992 | Ga0496105_0019105 | 3300048908 | Bacteria | 5523 |
| 993 | Ga0496105_0027732 | 3300048908 | Bacteria | 4629 |
| 994 | Ga0496105_0057708 | 3300048908 | Bacteria | 3205 |
| 995 | Ga0496105_0165916 | 3300048908 | Bacteria | 1812 |
| 996 | Ga0496105_0368167 | 3300048908 | Bacteria | 1145 |
| 997 | Ga0496106_0011555 | 3300048909 | Bacteria | 6527 |
| 998 | Ga0496106_0022778 | 3300048909 | Bacteria | 4653 |
| 999 | Ga0496106_0072293 | 3300048909 | Bacteria | 2637 |
| 1000 | Ga0496106_0133446 | 3300048909 | Bacteria | 1948 |
| 1001 | Ga0496106_0164377 | 3300048909 | Bacteria | 1756 |
| 1002 | Ga0496106_0222863 | 3300048909 | Bacteria | 1504 |
| 1003 | Ga0496107_0012905 | 3300048910 | Bacteria | 5840 |
| 1004 | Ga0496107_0014053 | 3300048910 | Bacteria | 5604 |
| 1005 | Ga0496107_0028240 | 3300048910 | Bacteria | 3986 |
| 1006 | Ga0496107_0105210 | 3300048910 | Bacteria | 2071 |
| 1007 | Ga0496107_0147581 | 3300048910 | Bacteria | 1739 |
| 1008 | Ga0496108_0001045 | 3300048911 | Bacteria | 21549 |
| 1009 | Ga0496108_0006864 | 3300048911 | Bacteria | 9213 |
| 1010 | Ga0496108_0022625 | 3300048911 | Bacteria | 5169 |
| 1011 | Ga0496108_0024614 | 3300048911 | Bacteria | 4957 |
| 1012 | Ga0496108_0030222 | 3300048911 | Bacteria | 4490 |
| 1013 | Ga0496108_0065294 | 3300048911 | Bacteria | 3068 |
| 1014 | Ga0496108_0136924 | 3300048911 | Bacteria | 2108 |
| 1015 | Ga0496108_0151036 | 3300048911 | Bacteria | 2004 |
| 1016 | Ga0496108_0154859 | 3300048911 | Bacteria | 1979 |
| 1017 | Ga0496108_0201227 | 3300048911 | Bacteria | 1728 |
| 1018 | Ga0496109_0001932 | 3300048912 | Bacteria | 17223 |
| 1019 | Ga0496109_0027051 | 3300048912 | Bacteria | 5118 |
| 1020 | Ga0496109_0034509 | 3300048912 | Bacteria | 4557 |
| 1021 | Ga0496109_0087898 | 3300048912 | Bacteria | 2871 |
| 1022 | Ga0496109_0285301 | 3300048912 | Bacteria | 1556 |
| 1023 | Ga0496109_0287768 | 3300048912 | Bacteria | 1549 |
| 1024 | Ga0496109_0317383 | 3300048912 | Bacteria | 1470 |
| 1025 | Ga0496109_0337535 | 3300048912 | Bacteria | 1423 |
| 1026 | Ga0496109_0344197 | 3300048912 | Bacteria | 1408 |
| 1027 | Ga0496109_0376488 | 3300048912 | Bacteria | 1341 |
| 1028 | Ga0496109_0397230 | 3300048912 | Bacteria | 1302 |
| 1029 | Ga0496109_0627552 | 3300048912 | Bacteria | 1011 |
| 1030 | Ga0496110_0001472 | 3300048913 | Bacteria | 17050 |
| 1031 | Ga0496110_0015265 | 3300048913 | Bacteria | 6388 |
| 1032 | Ga0496110_0024503 | 3300048913 | Bacteria | 5142 |
| 1033 | Ga0496110_0039557 | 3300048913 | Bacteria | 4106 |
| 1034 | Ga0496110_0060635 | 3300048913 | Bacteria | 3337 |
| 1035 | Ga0496110_0078534 | 3300048913 | Bacteria | 2938 |
| 1036 | Ga0496110_0080758 | 3300048913 | Bacteria | 2898 |
| 1037 | Ga0496110_0202524 | 3300048913 | Bacteria | 1803 |
| 1038 | Ga0496110_0533108 | 3300048913 | Bacteria | 1068 |
| 1039 | Ga0496111_0000582 | 3300048914 | Bacteria | 19124 |
| 1040 | Ga0496111_0006467 | 3300048914 | Bacteria | 7613 |
| 1041 | Ga0496111_0010734 | 3300048914 | Bacteria | 6160 |
| 1042 | Ga0496111_0010771 | 3300048914 | Bacteria | 6146 |
| 1043 | Ga0496111_0020021 | 3300048914 | Bacteria | 4655 |
| 1044 | Ga0496111_0059459 | 3300048914 | Bacteria | 2769 |
| 1045 | Ga0496111_0105585 | 3300048914 | Bacteria | 2073 |
| 1046 | Ga0496111_0118417 | 3300048914 | Bacteria | 1955 |
| 1047 | Ga0496111_0125298 | 3300048914 | Bacteria | 1898 |
| 1048 | Ga0496112_0035013 | 3300048915 | Bacteria | 4887 |
| 1049 | Ga0496112_0144166 | 3300048915 | Bacteria | 2350 |
| 1050 | Ga0496112_0246516 | 3300048915 | Bacteria | 1738 |
| 1051 | Ga0496113_0032179 | 3300048916 | Bacteria | 3810 |
| 1052 | Ga0496113_0037996 | 3300048916 | Bacteria | 3537 |
| 1053 | Ga0496113_0080207 | 3300048916 | Bacteria | 2499 |
| 1054 | Ga0496113_0269416 | 3300048916 | Bacteria | 1361 |
| 1055 | Ga0496114_0000256 | 3300048917 | Bacteria | 38442 |
| 1056 | Ga0496114_0002055 | 3300048917 | Bacteria | 15319 |
| 1057 | Ga0496114_0008450 | 3300048917 | Bacteria | 8158 |
| 1058 | Ga0496114_0023237 | 3300048917 | Bacteria | 5058 |
| 1059 | Ga0496114_0039944 | 3300048917 | Bacteria | 3883 |
| 1060 | Ga0496114_0069098 | 3300048917 | Bacteria | 2966 |
| 1061 | Ga0496114_0077619 | 3300048917 | Bacteria | 2800 |
| 1062 | Ga0496114_0095689 | 3300048917 | Bacteria | 2527 |
| 1063 | Ga0496114_0180586 | 3300048917 | Bacteria | 1843 |
| 1064 | Ga0496114_0212649 | 3300048917 | Bacteria | 1696 |
| 1065 | Ga0496114_0227410 | 3300048917 | Bacteria | 1638 |
| 1066 | Ga0496114_0264213 | 3300048917 | Bacteria | 1516 |
| 1067 | Ga0496114_0329684 | 3300048917 | Bacteria | 1349 |
| 1068 | Ga0496114_0440618 | 3300048917 | Bacteria | 1154 |
| 1069 | Ga0496115_0004783 | 3300048918 | Bacteria | 9828 |
| 1070 | Ga0496115_0061389 | 3300048918 | Bacteria | 3030 |
| 1071 | Ga0496115_0107103 | 3300048918 | Bacteria | 2295 |
| 1072 | Ga0496115_0128386 | 3300048918 | Bacteria | 2089 |
| 1073 | Ga0496115_0147106 | 3300048918 | Bacteria | 1945 |
| 1074 | Ga0496115_0344185 | 3300048918 | Bacteria | 1216 |
| 1075 | Ga0496115_0387211 | 3300048918 | Bacteria | 1136 |
| 1076 | Ga0496115_0521682 | 3300048918 | Bacteria | 952 |
| 1077 | Ga0496126_0105857 | 3300048929 | Bacteria | 2455 |
| 1078 | Ga0501031_0015677 | 3300049568 | Bacteria | 4919 |
| 1079 | Ga0501031_0038100 | 3300049568 | Bacteria | 3138 |
| 1080 | Ga0501031_0416810 | 3300049568 | Bacteria | 868 |
| 1081 | Ga0501032_0002084 | 3300049569 | Bacteria | 15788 |
| 1082 | Ga0501032_0005781 | 3300049569 | Bacteria | 9149 |
| 1083 | Ga0501033_0006304 | 3300049570 | Bacteria | 9293 |
| 1084 | Ga0501034_0068193 | 3300049571 | Bacteria | 3568 |
| 1085 | Ga0501034_0123205 | 3300049571 | Bacteria | 2578 |
| 1086 | Ga0501036_0000591 | 3300049572 | Bacteria | 26291 |
| 1087 | Ga0501036_0039371 | 3300049572 | Bacteria | 4000 |
| 1088 | Ga0501036_0124304 | 3300049572 | Bacteria | 2179 |
| 1089 | Ga0501036_0370608 | 3300049572 | Bacteria | 1195 |
| 1090 | Ga0501037_0006728 | 3300049573 | Bacteria | 8410 |
| 1091 | Ga0501037_0047819 | 3300049573 | Bacteria | 3135 |
| 1092 | Ga0501037_0292336 | 3300049573 | Bacteria | 1133 |
| 1093 | Ga0501038_0012788 | 3300049574 | Bacteria | 7665 |
| 1094 | Ga0501038_0063219 | 3300049574 | Bacteria | 3160 |
| 1095 | Ga0501039_0011789 | 3300049575 | Bacteria | 6657 |
| 1096 | Ga0501039_0090639 | 3300049575 | Bacteria | 2383 |
| 1097 | Ga0501039_0097604 | 3300049575 | Bacteria | 2291 |
| 1098 | Ga0501039_0125388 | 3300049575 | Bacteria | 2014 |
| 1099 | Ga0501039_0288507 | 3300049575 | Bacteria | 1290 |
| 1100 | Ga0501039_0522005 | 3300049575 | Bacteria | 932 |
| 1101 | Ga0501040_0002817 | 3300049576 | Bacteria | 11219 |
| 1102 | Ga0501040_0008241 | 3300049576 | Bacteria | 6778 |
| 1103 | Ga0501040_0023563 | 3300049576 | Bacteria | 4128 |
| 1104 | Ga0501040_0040508 | 3300049576 | Bacteria | 3170 |
| 1105 | Ga0501040_0094030 | 3300049576 | Bacteria | 2085 |
| 1106 | Ga0501040_0134093 | 3300049576 | Bacteria | 1742 |
| 1107 | Ga0501041_0003917 | 3300049577 | Bacteria | 8581 |
| 1108 | Ga0501041_0027722 | 3300049577 | Bacteria | 3415 |
| 1109 | Ga0501041_0039956 | 3300049577 | Bacteria | 2847 |
| 1110 | Ga0501041_0251157 | 3300049577 | Bacteria | 1112 |
| 1111 | Ga0501042_0009634 | 3300049578 | Bacteria | 6449 |
| 1112 | Ga0501042_0019215 | 3300049578 | Bacteria | 4741 |
| 1113 | Ga0501042_0066304 | 3300049578 | Bacteria | 2580 |
| 1114 | Ga0501042_0088999 | 3300049578 | Bacteria | 2215 |
| 1115 | Ga0501042_0275267 | 3300049578 | Bacteria | 1215 |
| 1116 | Ga0501042_0541380 | 3300049578 | Bacteria | 846 |
| 1117 | Ga0501043_0006662 | 3300049579 | Bacteria | 9241 |
| 1118 | Ga0501043_0090816 | 3300049579 | Bacteria | 2402 |
| 1119 | Ga0501046_0009111 | 3300049580 | Bacteria | 8596 |
| 1120 | Ga0501047_0030083 | 3300049581 | Bacteria | 5236 |
| 1121 | Ga0501048_0003882 | 3300049582 | Bacteria | 11373 |
| 1122 | Ga0501048_0012586 | 3300049582 | Bacteria | 6293 |
| 1123 | Ga0501048_0020300 | 3300049582 | Bacteria | 4869 |
| 1124 | Ga0501048_0095022 | 3300049582 | Bacteria | 2102 |
| 1125 | Ga0501067_0003977 | 3300049583 | Bacteria | 8159 |
| 1126 | Ga0501068_0001816 | 3300049584 | Bacteria | 11334 |
| 1127 | Ga0501068_0008703 | 3300049584 | Bacteria | 5658 |
| 1128 | Ga0501068_0031657 | 3300049584 | Bacteria | 3142 |
| 1129 | Ga0501068_0157342 | 3300049584 | Bacteria | 1431 |
| 1130 | Ga0501069_0205306 | 3300049585 | Bacteria | 1142 |
| 1131 | Ga0501070_0001737 | 3300049586 | Bacteria | 19258 |
| 1132 | Ga0501070_0004106 | 3300049586 | Bacteria | 12518 |
| 1133 | Ga0501070_0045415 | 3300049586 | Bacteria | 3654 |
| 1134 | Ga0501071_0005038 | 3300049587 | Bacteria | 8450 |
| 1135 | Ga0501071_0048965 | 3300049587 | Bacteria | 3041 |
| 1136 | Ga0501071_0067283 | 3300049587 | Bacteria | 2605 |
| 1137 | Ga0501071_0146763 | 3300049587 | Bacteria | 1758 |
| 1138 | Ga0501071_0370971 | 3300049587 | Bacteria | 1091 |
| 1139 | Ga0501071_0382872 | 3300049587 | Bacteria | 1073 |
| 1140 | Ga0501071_0424293 | 3300049587 | Bacteria | 1016 |
| 1141 | Ga0501072_0006718 | 3300049588 | Bacteria | 8743 |
| 1142 | Ga0501072_0007195 | 3300049588 | Bacteria | 8443 |
| 1143 | Ga0501072_0013631 | 3300049588 | Bacteria | 6223 |
| 1144 | Ga0501072_0023338 | 3300049588 | Bacteria | 4804 |
| 1145 | Ga0501072_0065511 | 3300049588 | Bacteria | 2865 |
| 1146 | Ga0501072_0162491 | 3300049588 | Bacteria | 1781 |
| 1147 | Ga0501072_0163134 | 3300049588 | Bacteria | 1778 |
| 1148 | Ga0501072_0222542 | 3300049588 | Bacteria | 1504 |
| 1149 | Ga0501072_0581108 | 3300049588 | Bacteria | 884 |
| 1150 | Ga0501072_0768227 | 3300049588 | Bacteria | 755 |
| 1151 | Ga0501073_0004004 | 3300049589 | Bacteria | 11066 |
| 1152 | Ga0501073_0044173 | 3300049589 | Bacteria | 3140 |
| 1153 | Ga0501074_0013566 | 3300049590 | Bacteria | 5923 |
| 1154 | Ga0501074_0015334 | 3300049590 | Bacteria | 5570 |
| 1155 | Ga0501074_0130070 | 3300049590 | Bacteria | 1801 |
| 1156 | Ga0501074_0288955 | 3300049590 | Bacteria | 1165 |
| 1157 | Ga0501075_0002914 | 3300049591 | Bacteria | 11482 |
| 1158 | Ga0501075_0006299 | 3300049591 | Bacteria | 8152 |
| 1159 | Ga0501075_0016462 | 3300049591 | Bacteria | 5326 |
| 1160 | Ga0501075_0047506 | 3300049591 | Bacteria | 3225 |
| 1161 | Ga0501075_0065586 | 3300049591 | Bacteria | 2740 |
| 1162 | Ga0501075_0110102 | 3300049591 | Bacteria | 2094 |
| 1163 | Ga0501075_0176780 | 3300049591 | Bacteria | 1629 |
| 1164 | Ga0501075_0217638 | 3300049591 | Bacteria | 1457 |
| 1165 | Ga0501075_0267434 | 3300049591 | Bacteria | 1303 |
| 1166 | Ga0501076_0003476 | 3300049592 | Bacteria | 11062 |
| 1167 | Ga0501076_0008871 | 3300049592 | Bacteria | 7395 |
| 1168 | Ga0501076_0032100 | 3300049592 | Bacteria | 4097 |
| 1169 | Ga0501076_0036340 | 3300049592 | Bacteria | 3860 |
| 1170 | Ga0501076_0058198 | 3300049592 | Bacteria | 3071 |
| 1171 | Ga0501076_0138735 | 3300049592 | Bacteria | 1975 |
| 1172 | Ga0501076_0366192 | 3300049592 | Bacteria | 1184 |
| 1173 | Ga0501077_0001647 | 3300049593 | Bacteria | 13415 |
| 1174 | Ga0501077_0002374 | 3300049593 | Bacteria | 11305 |
| 1175 | Ga0501077_0004791 | 3300049593 | Bacteria | 8224 |
| 1176 | Ga0501077_0025032 | 3300049593 | Bacteria | 3790 |
| 1177 | Ga0501077_0045344 | 3300049593 | Bacteria | 2793 |
| 1178 | Ga0501077_0089929 | 3300049593 | Bacteria | 1946 |
| 1179 | Ga0501077_0139551 | 3300049593 | Bacteria | 1537 |
| 1180 | Ga0501079_0016897 | 3300049741 | Bacteria | 5573 |
| 1181 | Ga0501079_0024063 | 3300049741 | Bacteria | 4672 |
| 1182 | Ga0501079_0047864 | 3300049741 | Bacteria | 3300 |
| 1183 | Ga0501079_0048947 | 3300049741 | Bacteria | 3262 |
| 1184 | Ga0501079_0064271 | 3300049741 | Bacteria | 2830 |
| 1185 | Ga0501079_0079306 | 3300049741 | Bacteria | 2539 |
| 1186 | Ga0501079_0154482 | 3300049741 | Bacteria | 1789 |
| 1187 | Ga0501079_0336647 | 3300049741 | Bacteria | 1182 |
| 1188 | Ga0501080_0008162 | 3300049742 | Bacteria | 9485 |
| 1189 | Ga0501080_0011073 | 3300049742 | Bacteria | 8252 |
| 1190 | Ga0501080_0393001 | 3300049742 | Bacteria | 1248 |
| 1191 | Ga0501081_0024191 | 3300049743 | Bacteria | 4077 |
| 1192 | Ga0501081_0026153 | 3300049743 | Bacteria | 3932 |
| 1193 | Ga0501081_0045233 | 3300049743 | Bacteria | 3022 |
| 1194 | Ga0501081_0106530 | 3300049743 | Bacteria | 1987 |
| 1195 | Ga0501083_0008832 | 3300049744 | Bacteria | 7112 |
| 1196 | Ga0501083_0012205 | 3300049744 | Bacteria | 6012 |
| 1197 | Ga0501083_0068855 | 3300049744 | Bacteria | 2355 |
| 1198 | Ga0501083_0101284 | 3300049744 | Bacteria | 1899 |
| 1199 | Ga0501035_0003688 | 3300049822 | Bacteria | 14596 |
| 1200 | Ga0501035_0221003 | 3300049822 | Bacteria | 1617 |
| 1201 | Ga0501035_0257749 | 3300049822 | Bacteria | 1479 |
| 1202 | Ga0501044_0013073 | 3300049823 | Bacteria | 8983 |
| 1203 | Ga0501045_0013916 | 3300049824 | Bacteria | 5691 |
| 1204 | Ga0501045_0017443 | 3300049824 | Bacteria | 5097 |
| 1205 | Ga0501045_0057401 | 3300049824 | Bacteria | 2848 |
| 1206 | Ga0501045_0081790 | 3300049824 | Bacteria | 2381 |
| 1207 | Ga0501045_0199650 | 3300049824 | Bacteria | 1490 |
| 1208 | nmdc:mga03683_9500_c1 | 3300050489 | Bacteria | 3462 |
| 1209 | nmdc:mga03n38_30305_c1 | 3300050490 | Bacteria | 2273 |
| 1210 | nmdc:mga03n38_78687_c1 | 3300050490 | Bacteria | 1544 |
| 1211 | nmdc:mga00v17_13011_c1 | 3300050491 | Bacteria | 4610 |
| 1212 | nmdc:mga00v17_141723_c1 | 3300050491 | Bacteria | 1542 |
| 1213 | nmdc:mga00v17_25280_c1 | 3300050491 | Bacteria | 3451 |
| 1214 | nmdc:mga0yw44_1038_c1 | 3300050492 | Bacteria | 10662 |
| 1215 | nmdc:mga0yw44_185170_c1 | 3300050492 | Bacteria | 1372 |
| 1216 | nmdc:mga0yw44_86706_c1 | 3300050492 | Bacteria | 1972 |
| 1217 | nmdc:mga06z11_71297_c1 | 3300050494 | Bacteria | 1839 |
| 1218 | nmdc:mga04h51_14713_c1 | 3300050495 | Bacteria | 2241 |
| 1219 | nmdc:mga04h51_23717_c1 | 3300050495 | Bacteria | 1871 |
| 1220 | nmdc:mga07m45_71199_c1 | 3300050496 | Bacteria | 1978 |
| 1221 | nmdc:mga05p37_13498_c1 | 3300050507 | Bacteria | 9790 |
| 1222 | nmdc:mga05p37_16833_c1 | 3300050507 | Bacteria | 8814 |
| 1223 | nmdc:mga05p37_361180_c2 | 3300050507 | Bacteria | 1080 |
| 1224 | nmdc:mga05p37_72339_c1 | 3300050507 | Bacteria | 4243 |
| 1225 | nmdc:mga05p37_81894_c1 | 3300050507 | Bacteria | 3976 |
| 1226 | nmdc:mga09592_98003_c1 | 3300050508 | Bacteria | 2509 |
| 1227 | nmdc:mga0qj67_20834_c1 | 3300050509 | Bacteria | 3341 |
| 1228 | nmdc:mga06r32_105647_c1 | 3300050510 | Bacteria | 2766 |
| 1229 | nmdc:mga06r32_16822_c1 | 3300050510 | Bacteria | 6669 |
| 1230 | nmdc:mga08y16_26370_c1 | 3300050511 | Bacteria | 6128 |
| 1231 | nmdc:mga08y16_27729_c1 | 3300050511 | Bacteria | 5968 |
| 1232 | nmdc:mga08y16_37172_c1 | 3300050511 | Bacteria | 5114 |
| 1233 | nmdc:mga08y16_470051_c1 | 3300050511 | Bacteria | 1280 |
| 1234 | nmdc:mga08y16_70851_c1 | 3300050511 | Bacteria | 3633 |
| 1235 | nmdc:mga08y16_71864_c1 | 3300050511 | Bacteria | 3605 |
| 1236 | nmdc:mga0n895_161179_c1 | 3300050512 | Bacteria | 2275 |
| 1237 | nmdc:mga0n895_245084_c1 | 3300050512 | Bacteria | 1819 |
| 1238 | nmdc:mga0n895_366073_c1 | 3300050512 | Bacteria | 1460 |
| 1239 | nmdc:mga0n895_39038_c1 | 3300050512 | Bacteria | 4603 |
| 1240 | nmdc:mga0n895_50222_c1 | 3300050512 | Bacteria | 4088 |
| 1241 | nmdc:mga0n895_838543_c1 | 3300050512 | Bacteria | 908 |
| 1242 | nmdc:mga0rr50_11223_c1 | 3300050513 | Bacteria | 5721 |
| 1243 | nmdc:mga0rr50_295431_c1 | 3300050513 | Bacteria | 1354 |
| 1244 | nmdc:mga08x19_180488_c1 | 3300050514 | Bacteria | 1441 |
| 1245 | nmdc:mga08x19_62858_c1 | 3300050514 | Bacteria | 2408 |
| 1246 | nmdc:mga0a205_115469_c1 | 3300050515 | Bacteria | 2583 |
| 1247 | nmdc:mga0a205_137707_c1 | 3300050515 | Bacteria | 2342 |
| 1248 | nmdc:mga0a205_159635_c1 | 3300050515 | Bacteria | 2152 |
| 1249 | nmdc:mga0a205_197968_c1 | 3300050515 | Bacteria | 1900 |
| 1250 | nmdc:mga0a205_25714_c1 | 3300050515 | Bacteria | 5610 |
| 1251 | nmdc:mga0a205_89620_c1 | 3300050515 | Bacteria | 2973 |
| 1252 | nmdc:mga0sz30_18724_c1 | 3300050516 | Bacteria | 2773 |
| 1253 | Ga0495601_0020423 | 3300053077 | Bacteria | 4046 |
| 1254 | Ga0495601_0021938 | 3300053077 | Bacteria | 3916 |
| 1255 | Ga0495601_0041459 | 3300053077 | Bacteria | 2886 |
| 1256 | Ga0495601_0077649 | 3300053077 | Bacteria | 2127 |
| 1257 | Ga0495601_0098688 | 3300053077 | Bacteria | 1885 |
| 1258 | Ga0495601_0147676 | 3300053077 | Bacteria | 1534 |
| 1259 | Ga0495612_0002621 | 3300053078 | Bacteria | 7414 |
| 1260 | Ga0495612_0090587 | 3300053078 | Bacteria | 1294 |
| 1261 | Ga0495595_0005279 | 3300053084 | Bacteria | 5224 |
| 1262 | Ga0495595_0035215 | 3300053084 | Bacteria | 2268 |
| 1263 | Ga0495595_0042766 | 3300053084 | Bacteria | 2076 |
| 1264 | Ga0495595_0183883 | 3300053084 | Bacteria | 1037 |
| 1265 | Ga0495619_0004394 | 3300053085 | Bacteria | 8990 |
| 1266 | Ga0495619_0013127 | 3300053085 | Bacteria | 5220 |
| 1267 | Ga0495619_0017477 | 3300053085 | Bacteria | 4540 |
| 1268 | Ga0495619_0082854 | 3300053085 | Bacteria | 2162 |
| 1269 | Ga0495619_0087413 | 3300053085 | Bacteria | 2107 |
| 1270 | Ga0495619_0175685 | 3300053085 | Bacteria | 1481 |
| 1271 | Ga0495619_0234006 | 3300053085 | Bacteria | 1273 |
| 1272 | Ga0495619_0347781 | 3300053085 | Bacteria | 1026 |
| 1273 | Ga0501084_0005328 | 3300054114 | Bacteria | 10531 |
| 1274 | Ga0501084_0110156 | 3300054114 | Bacteria | 2313 |
| 1275 | Ga0501084_0136837 | 3300054114 | Bacteria | 2062 |
| 1276 | Ga0501084_0164692 | 3300054114 | Bacteria | 1871 |
| 1277 | Ga0501084_0191748 | 3300054114 | Bacteria | 1724 |
| 1278 | Ga0501084_0331625 | 3300054114 | Bacteria | 1285 |
| 1279 | Ga0501082_0006774 | 3300060353 | Bacteria | 9902 |
| 1280 | Ga0501082_0012448 | 3300060353 | Bacteria | 7309 |
| 1281 | Ga0501082_0034537 | 3300060353 | Bacteria | 4358 |
| 1282 | Ga0501082_0061051 | 3300060353 | Bacteria | 3245 |
| 1283 | Ga0501082_0324933 | 3300060353 | Bacteria | 1340 |
| 1284 | Ga0501082_0449104 | 3300060353 | Bacteria | 1126 |
| 1285 | Ga0466962_0018395 | 3300061719 | Bacteria | 3361 |
| 1286 | Ga0530510_0001773 | 3300061734 | Bacteria | 14719 |
| 1287 | Ga0530510_0021207 | 3300061734 | Bacteria | 4621 |
| 1288 | Ga0530510_0029823 | 3300061734 | Bacteria | 3916 |
| 1289 | Ga0530510_0071060 | 3300061734 | Bacteria | 2526 |
| 1290 | Ga0530510_0168454 | 3300061734 | Bacteria | 1622 |
| 1291 | 2753267114 | 2751185782 | Bacteria | 11227053 |
| 1292 | Ga0081540_1059413 | |||
| 1293 | rootL2_10015499 | |||
| 1294 | JGI25404J52841_10000237 | |||
| 1295 | Ga0070658_10047099 | |||
| 1296 | Ga0070676_10276945 | |||
| 1297 | Ga0070683_100007611 | |||
| 1298 | Ga0070683_100014788 | |||
| 1299 | Ga0070683_100095658 | |||
| 1300 | Ga0070683_100272286 | |||
| 1301 | Ga0070683_100427548 | |||
| 1302 | Ga0070690_100039157 | |||
| 1303 | Ga0070670_100539439 | |||
| 1304 | Ga0068869_100160561 | |||
| 1305 | Ga0070680_100011226 | |||
| 1306 | Ga0070680_100046621 | |||
| 1307 | Ga0070680_100059338 | |||
| 1308 | Ga0070680_100235341 | |||
| 1309 | Ga0070680_100285299 | |||
| 1310 | Ga0070682_100012732 | |||
| 1311 | Ga0070682_100197546 | |||
| 1312 | Ga0070682_100227251 | |||
| 1313 | Ga0068868_100123465 | |||
| 1314 | Ga0068868_100311897 | |||
| 1315 | Ga0068868_100317352 | |||
| 1316 | Ga0070660_100013359 | |||
| 1317 | Ga0070689_100010689 | |||
| 1318 | Ga0070689_100237409 | |||
| 1319 | Ga0070687_100041658 | |||
| 1320 | Ga0070661_100021551 | |||
| 1321 | Ga0070661_100413636 | |||
| 1322 | Ga0070692_10003019 | |||
| 1323 | Ga0070668_100049423 | |||
| 1324 | Ga0070668_100271665 | |||
| 1325 | Ga0070669_100126274 | |||
| 1326 | Ga0070675_100006014 | |||
| 1327 | Ga0070671_100015038 | |||
| 1328 | Ga0070671_100261342 | |||
| 1329 | Ga0070674_100153889 | |||
| 1330 | Ga0070674_100322653 | |||
| 1331 | Ga0070673_100011696 | |||
| 1332 | Ga0070673_100039781 | |||
| 1333 | Ga0070673_100354941 | |||
| 1334 | Ga0070688_100005380 | |||
| 1335 | Ga0070659_100011096 | |||
| 1336 | Ga0070659_100127085 | |||
| 1337 | Ga0070659_100278023 | |||
| 1338 | Ga0070667_100086800 | |||
| 1339 | Ga0070709_10012185 | |||
| 1340 | Ga0070709_10021705 | |||
| 1341 | Ga0070709_10024809 | |||
| 1342 | Ga0070714_100014645 | |||
| 1343 | Ga0070714_100041916 | |||
| 1344 | Ga0070714_100079967 | |||
| 1345 | Ga0070714_100130485 | |||
| 1346 | Ga0070713_100023990 | |||
| 1347 | Ga0070713_100042357 | |||
| 1348 | Ga0070713_100061806 | |||
| 1349 | Ga0070713_100185993 | |||
| 1350 | Ga0070713_100241101 | |||
| 1351 | Ga0070713_100272504 | |||
| 1352 | Ga0070713_100277213 | |||
| 1353 | Ga0070710_10025738 | |||
| 1354 | Ga0070710_10054260 | |||
| 1355 | Ga0070710_10055742 | |||
| 1356 | Ga0070710_10369199 | |||
| 1357 | Ga0070701_10001668 | |||
| 1358 | Ga0070711_100038623 | |||
| 1359 | Ga0070711_100143041 | |||
| 1360 | Ga0070711_100359425 | |||
| 1361 | Ga0070711_100375352 | |||
| 1362 | Ga0070711_100596988 | |||
| 1363 | Ga0070705_100048810 | |||
| 1364 | Ga0070700_100025865 | |||
| 1365 | Ga0070694_100065947 | |||
| 1366 | Ga0070694_100253036 | |||
| 1367 | Ga0070708_100204879 | |||
| 1368 | Ga0070708_100268473 | |||
| 1369 | Ga0070708_100299806 | |||
| 1370 | Ga0070663_100015332 | |||
| 1371 | Ga0070663_100074075 | |||
| 1372 | Ga0070678_100005693 | |||
| 1373 | Ga0070678_100023233 | |||
| 1374 | Ga0070678_100025740 | |||
| 1375 | Ga0070678_100038354 | |||
| 1376 | Ga0070678_100039968 | |||
| 1377 | Ga0070678_100277132 | |||
| 1378 | Ga0070662_100119312 | |||
| 1379 | Ga0070681_10028584 | |||
| 1380 | Ga0070681_10082738 | |||
| 1381 | Ga0070681_10092886 | |||
| 1382 | Ga0070681_10363817 | |||
| 1383 | Ga0068867_100010705 | |||
| 1384 | Ga0070685_10001614 | |||
| 1385 | Ga0070706_100008251 | |||
| 1386 | Ga0070706_100062383 | |||
| 1387 | Ga0070706_100246344 | |||
| 1388 | Ga0070707_100040233 | |||
| 1389 | Ga0070707_100138119 | |||
| 1390 | Ga0070707_100750095 | |||
| 1391 | Ga0070698_100002351 | |||
| 1392 | Ga0070698_100081412 | |||
| 1393 | Ga0070698_100145421 | |||
| 1394 | Ga0070698_100168502 | |||
| 1395 | Ga0070698_100222614 | |||
| 1396 | Ga0070698_100508347 | |||
| 1397 | Ga0070698_100806645 | |||
| 1398 | Ga0070699_100024741 | |||
| 1399 | Ga0070699_100027183 | |||
| 1400 | Ga0070699_100081933 | |||
| 1401 | Ga0070679_100004020 | |||
| 1402 | Ga0070679_100011266 | |||
| 1403 | Ga0070679_100113962 | |||
| 1404 | Ga0070679_100150313 | |||
| 1405 | Ga0070679_100173548 | |||
| 1406 | Ga0070684_100039442 | |||
| 1407 | Ga0070684_100046268 | |||
| 1408 | Ga0070684_100061135 | |||
| 1409 | Ga0070684_100074379 | |||
| 1410 | Ga0070684_100089813 | |||
| 1411 | Ga0070684_100106927 | |||
| 1412 | Ga0070684_100359163 | |||
| 1413 | Ga0070697_100000480 | |||
| 1414 | Ga0068853_100058644 | |||
| 1415 | Ga0068853_100186807 | |||
| 1416 | Ga0070672_100060447 | |||
| 1417 | Ga0070686_100019541 | |||
| 1418 | Ga0070686_100124990 | |||
| 1419 | Ga0070695_100052160 | |||
| 1420 | Ga0070696_100049012 | |||
| 1421 | Ga0070696_100202441 | |||
| 1422 | Ga0070693_100005137 | |||
| 1423 | Ga0070693_100035325 | |||
| 1424 | Ga0070693_100165235 | |||
| 1425 | Ga0070665_100531107 | |||
| 1426 | Ga0070704_100025959 | |||
| 1427 | Ga0068855_100175852 | |||
| 1428 | Ga0070664_100014886 | |||
| 1429 | Ga0070664_100021859 | |||
| 1430 | Ga0070664_100160646 | |||
| 1431 | Ga0070664_100439364 | |||
| 1432 | Ga0068857_100011972 | |||
| 1433 | Ga0068857_100136882 | |||
| 1434 | Ga0068856_100036063 | |||
| 1435 | Ga0068856_100070781 | |||
| 1436 | Ga0068856_100071480 | |||
| 1437 | Ga0068856_100088638 | |||
| 1438 | Ga0068856_100328703 | |||
| 1439 | Ga0068856_100482604 | |||
| 1440 | Ga0068856_100761745 | |||
| 1441 | Ga0070702_100014672 | |||
| 1442 | Ga0070702_100100814 | |||
| 1443 | Ga0070702_100219328 | |||
| 1444 | Ga0070702_100275043 | |||
| 1445 | Ga0068852_100211680 | |||
| 1446 | Ga0068859_100017374 | |||
| 1447 | Ga0068864_100010496 | |||
| 1448 | Ga0068864_100208733 | |||
| 1449 | Ga0068866_10004410 | |||
| 1450 | Ga0068866_10116933 | |||
| 1451 | Ga0068861_100010676 | |||
| 1452 | Ga0068851_10050125 | |||
| 1453 | Ga0068870_10067222 | |||
| 1454 | Ga0068870_10123105 | |||
| 1455 | Ga0068863_100208041 | |||
| 1456 | Ga0068863_100601631 | |||
| 1457 | Ga0068863_100819903 | |||
| 1458 | Ga0068858_100012604 | |||
| 1459 | Ga0068858_100037424 | |||
| 1460 | Ga0068858_100249215 | |||
| 1461 | Ga0068860_100017643 | |||
| 1462 | Ga0068860_100065396 | |||
| 1463 | Ga0068860_100088667 | |||
| 1464 | Ga0068862_100057713 | |||
| 1465 | Ga0081455_10003582 | |||
| 1466 | Ga0081455_10023662 | |||
| 1467 | Ga0081455_10032587 | |||
| 1468 | Ga0081455_10039497 | |||
| 1469 | Ga0081455_10084652 | |||
| 1470 | Ga0081538_10003610 | |||
| 1471 | Ga0081538_10012556 | |||
| 1472 | Ga0081538_10069513 | |||
| 1473 | Ga0081540_1000936 | |||
| 1474 | Ga0081540_1068089 | |||
| 1475 | Ga0081539_10005354 | |||
| 1476 | Ga0070717_10001324 | |||
| 1477 | Ga0070717_10006096 | |||
| 1478 | Ga0070717_10023163 | |||
| 1479 | Ga0070717_10041201 | |||
| 1480 | Ga0070717_10041740 | |||
| 1481 | Ga0070717_10046387 | |||
| 1482 | Ga0070717_10050868 | |||
| 1483 | Ga0070717_10061134 | |||
| 1484 | Ga0070717_10097157 | |||
| 1485 | Ga0075365_10000551 | |||
| 1486 | Ga0075365_10004769 | |||
| 1487 | Ga0075365_10313674 | |||
| 1488 | Ga0075368_10019378 | |||
| 1489 | Ga0075368_10044783 | |||
| 1490 | Ga0075368_10047394 | |||
| 1491 | Ga0075363_100005505 | |||
| 1492 | Ga0075363_100039755 | |||
| 1493 | Ga0075363_100075681 | |||
| 1494 | Ga0075363_100077460 | |||
| 1495 | Ga0075363_100252637 | |||
| 1496 | Ga0075364_10003741 | |||
| 1497 | Ga0075364_10016558 | |||
| 1498 | Ga0075364_10040075 | |||
| 1499 | Ga0075364_10243597 | |||
| 1500 | Ga0075432_10012318 | |||
| 1501 | Ga0075432_10014283 | |||
| 1502 | Ga0070715_10014288 | |||
| 1503 | Ga0070715_10118581 | |||
| 1504 | Ga0070715_10188865 | |||
| 1505 | Ga0070716_100265101 | |||
| 1506 | Ga0070712_100011634 | |||
| 1507 | Ga0070712_100022010 | |||
| 1508 | Ga0070712_100055945 | |||
| 1509 | Ga0070712_100087827 | |||
| 1510 | Ga0070712_100129460 | |||
| 1511 | Ga0070712_100212123 | |||
| 1512 | Ga0075362_10043341 | |||
| 1513 | Ga0075362_10156742 | |||
| 1514 | Ga0075367_10037625 | |||
| 1515 | Ga0075367_10048254 | |||
| 1516 | Ga0075367_10255811 | |||
| 1517 | Ga0097621_100014585 | |||
| 1518 | Ga0097621_100151140 | |||
| 1519 | Ga0075370_10061924 | |||
| 1520 | Ga0068871_100006269 | |||
| 1521 | Ga0068871_100206822 | |||
| 1522 | Ga0075428_100005147 | |||
| 1523 | Ga0075430_100636575 | |||
| 1524 | Ga0075431_100181903 | |||
| 1525 | Ga0075431_100254561 | |||
| 1526 | Ga0075433_10060219 | |||
| 1527 | Ga0075433_10083867 | |||
| 1528 | Ga0075433_10093514 | |||
| 1529 | Ga0075433_10121916 | |||
| 1530 | Ga0075433_10159160 | |||
| 1531 | Ga0075434_100007864 | |||
| 1532 | Ga0075434_100173746 | |||
| 1533 | Ga0075434_100376501 | |||
| 1534 | Ga0075434_100558776 | |||
| 1535 | Ga0075429_100089560 | |||
| 1536 | Ga0075429_100168608 | |||
| 1537 | Ga0075429_100232361 | |||
| 1538 | Ga0068865_100047339 | |||
| 1539 | Ga0068865_100082886 | |||
| 1540 | Ga0075436_100041056 | |||
| 1541 | Ga0075436_100202302 | |||
| 1542 | Ga0097620_100017374 | |||
| 1543 | Ga0075435_100015622 | |||
| 1544 | Ga0075435_100018686 | |||
| 1545 | Ga0075435_100032377 | |||
| 1546 | Ga0075435_100178362 | |||
| 1547 | Ga0075435_100525068 | |||
| 1548 | Ga0075435_100655278 | |||
| 1549 | Ga0099795_10022772 | |||
| 1550 | Ga0105240_10662366 | |||
| 1551 | Ga0111539_10022685 | |||
| 1552 | Ga0111539_10034085 | |||
| 1553 | Ga0111539_10096837 | |||
| 1554 | Ga0111539_10166545 | |||
| 1555 | Ga0105245_10026307 | |||
| 1556 | Ga0105245_10032395 | |||
| 1557 | Ga0105245_10055135 | |||
| 1558 | Ga0105245_10066233 | |||
| 1559 | Ga0105245_10094014 | |||
| 1560 | Ga0105245_10557600 | |||
| 1561 | Ga0105247_10018783 | |||
| 1562 | Ga0105247_10136238 | |||
| 1563 | Ga0114129_10000926 | |||
| 1564 | Ga0114129_10008895 | |||
| 1565 | Ga0114129_10041949 | |||
| 1566 | Ga0114129_11147598 | |||
| 1567 | Ga0105243_10080721 | |||
| 1568 | Ga0105243_10151947 | |||
| 1569 | Ga0105243_10355355 | |||
| 1570 | Ga0105241_10076027 | |||
| 1571 | Ga0105241_10200801 | |||
| 1572 | Ga0105241_10704692 | |||
| 1573 | Ga0105242_10007042 | |||
| 1574 | Ga0105242_10024097 | |||
| 1575 | Ga0105242_10283292 | |||
| 1576 | Ga0105248_10014103 | |||
| 1577 | Ga0105248_10026145 | |||
| 1578 | Ga0105248_10819917 | |||
| 1579 | Ga0105248_11127599 | |||
| 1580 | Ga0105237_10129012 | |||
| 1581 | Ga0105237_10830945 | |||
| 1582 | Ga0105238_10012955 | |||
| 1583 | Ga0105238_10593329 | |||
| 1584 | Ga0105249_10014381 | |||
| 1585 | Ga0105249_10101151 | |||
| 1586 | Ga0105249_11128727 | |||
| 1587 | Ga0099796_10033381 | |||
| 1588 | Ga0099796_10121599 | |||
| 1589 | Ga0105239_10063118 | |||
| 1590 | Ga0105239_11109202 | |||
| 1591 | Ga0105246_10024802 | |||
| 1592 | Ga0105246_10080496 | |||
| 1593 | Ga0105246_10240817 | |||
| 1594 | Ga0157340_1003493 | |||
| 1595 | Ga0157338_1008935 | |||
| 1596 | Ga0157373_10092233 | |||
| 1597 | Ga0157371_10105689 | |||
| 1598 | Ga0157369_10072595 | |||
| 1599 | Ga0157369_10077811 | |||
| 1600 | Ga0157369_10115357 | |||
| 1601 | Ga0157369_10851718 | |||
| 1602 | Ga0157378_10549956 | |||
| 1603 | Ga0157378_10821570 | |||
| 1604 | Ga0163162_10012158 | |||
| 1605 | Ga0163162_10415145 | |||
| 1606 | Ga0157375_10012051 | |||
| 1607 | Ga0157375_10191379 | |||
| 1608 | Ga0157375_10340894 | |||
| 1609 | Ga0163163_10115540 | |||
| 1610 | Ga0163163_10204952 | |||
| 1611 | Ga0157380_10006251 | |||
| 1612 | Ga0157380_10631838 | |||
| 1613 | Ga0182008_10296888 | |||
| 1614 | Ga0157377_10061398 | |||
| 1615 | Ga0157377_10184817 | |||
| 1616 | Ga0157377_10197402 | |||
| 1617 | Ga0157377_10230537 | |||
| 1618 | Ga0157377_10311089 | |||
| 1619 | Ga0157377_10530120 | |||
| 1620 | Ga0157379_10006395 | |||
| 1621 | Ga0157379_10017040 | |||
| 1622 | Ga0157376_10005806 | |||
| 1623 | Ga0157376_10035530 | |||
| 1624 | Ga0157376_10160601 | |||
| 1625 | Ga0157376_10679414 | |||
| 1626 | Ga0163161_10008515 | |||
| 1627 | Ga0163161_10021369 | |||
| 1628 | Ga0206356_10213329 | |||
| 1629 | Ga0206356_10978510 | |||
| 1630 | Ga0206353_11752886 | |||
| 1631 | Ga0213874_10001831 | |||
| 1632 | Ga0213874_10005759 | |||
| 1633 | Ga0213876_10015845 | |||
| 1634 | Ga0213876_10029848 | |||
| 1635 | Ga0213875_10000934 | |||
| 1636 | Ga0213875_10010235 | |||
| 1637 | Ga0213875_10018494 | |||
| 1638 | Ga0213875_10021540 | |||
| 1639 | Ga0213875_10179480 | |||
| 1640 | Ga0207656_10035713 | |||
| 1641 | Ga0207656_10258600 | |||
| 1642 | Ga0207653_10005149 | |||
| 1643 | Ga0207692_10017284 | |||
| 1644 | Ga0207692_10086879 | |||
| 1645 | Ga0207692_10107464 | |||
| 1646 | Ga0207692_10217705 | |||
| 1647 | Ga0207642_10003988 | |||
| 1648 | Ga0207710_10033540 | |||
| 1649 | Ga0207688_10015412 | |||
| 1650 | Ga0207688_10021594 | |||
| 1651 | Ga0207680_10124484 | |||
| 1652 | Ga0207685_10106308 | |||
| 1653 | Ga0207699_10006382 | |||
| 1654 | Ga0207699_10021386 | |||
| 1655 | Ga0207699_10033971 | |||
| 1656 | Ga0207699_10107677 | |||
| 1657 | Ga0207699_10113141 | |||
| 1658 | Ga0207699_10138005 | |||
| 1659 | Ga0207643_10003445 | |||
| 1660 | Ga0207643_10010851 | |||
| 1661 | Ga0207684_10007560 | |||
| 1662 | Ga0207684_10115814 | |||
| 1663 | Ga0207684_10263327 | |||
| 1664 | Ga0207684_10506724 | |||
| 1665 | Ga0207654_10241170 | |||
| 1666 | Ga0207707_10001584 | |||
| 1667 | Ga0207693_10014459 | |||
| 1668 | Ga0207693_10017499 | |||
| 1669 | Ga0207693_10021237 | |||
| 1670 | Ga0207693_10182188 | |||
| 1671 | Ga0207693_10192779 | |||
| 1672 | Ga0207693_10201492 | |||
| 1673 | Ga0207693_10236452 | |||
| 1674 | Ga0207693_10355262 | |||
| 1675 | Ga0207663_10030425 | |||
| 1676 | Ga0207663_10055624 | |||
| 1677 | Ga0207663_10068956 | |||
| 1678 | Ga0207660_10054585 | |||
| 1679 | Ga0207660_10083264 | |||
| 1680 | Ga0207660_10198304 | |||
| 1681 | Ga0207662_10005077 | |||
| 1682 | Ga0207657_10001843 | |||
| 1683 | Ga0207657_10062133 | |||
| 1684 | Ga0207649_10321784 | |||
| 1685 | Ga0207649_10608046 | |||
| 1686 | Ga0207652_10033721 | |||
| 1687 | Ga0207652_10034319 | |||
| 1688 | Ga0207652_10070720 | |||
| 1689 | Ga0207652_10080065 | |||
| 1690 | Ga0207646_10010709 | |||
| 1691 | Ga0207646_10015301 | |||
| 1692 | Ga0207646_10287335 | |||
| 1693 | Ga0207681_10018267 | |||
| 1694 | Ga0207681_10166283 | |||
| 1695 | Ga0207694_10487920 | |||
| 1696 | Ga0207650_10044635 | |||
| 1697 | Ga0207650_10111015 | |||
| 1698 | Ga0207659_10056399 | |||
| 1699 | Ga0207659_10156145 | |||
| 1700 | Ga0207687_10036796 | |||
| 1701 | Ga0207687_10071637 | |||
| 1702 | Ga0207687_10189976 | |||
| 1703 | Ga0207687_10374964 | |||
| 1704 | Ga0207687_10436315 | |||
| 1705 | Ga0207700_10032985 | |||
| 1706 | Ga0207700_10068058 | |||
| 1707 | Ga0207700_10069439 | |||
| 1708 | Ga0207700_10087041 | |||
| 1709 | Ga0207700_10128919 | |||
| 1710 | Ga0207700_10154442 | |||
| 1711 | Ga0207700_10446945 | |||
| 1712 | Ga0207700_10456930 | |||
| 1713 | Ga0207664_10002425 | |||
| 1714 | Ga0207664_10005168 | |||
| 1715 | Ga0207664_10015898 | |||
| 1716 | Ga0207664_10020974 | |||
| 1717 | Ga0207664_10032683 | |||
| 1718 | Ga0207664_10039208 | |||
| 1719 | Ga0207664_10052909 | |||
| 1720 | Ga0207664_10072900 | |||
| 1721 | Ga0207664_10460899 | |||
| 1722 | Ga0207644_10136573 | |||
| 1723 | Ga0207690_10011653 | |||
| 1724 | Ga0207690_10065424 | |||
| 1725 | Ga0207706_10008643 | |||
| 1726 | Ga0207686_10109239 | |||
| 1727 | Ga0207709_10011567 | |||
| 1728 | Ga0207709_10014406 | |||
| 1729 | Ga0207709_10253185 | |||
| 1730 | Ga0207670_10005858 | |||
| 1731 | Ga0207670_10256130 | |||
| 1732 | Ga0207669_10010843 | |||
| 1733 | Ga0207669_10128968 | |||
| 1734 | Ga0207704_10006943 | |||
| 1735 | Ga0207704_10037653 | |||
| 1736 | Ga0207665_10041688 | |||
| 1737 | Ga0207665_10044459 | |||
| 1738 | Ga0207665_10091095 | |||
| 1739 | Ga0207665_10185131 | |||
| 1740 | Ga0207691_10020083 | |||
| 1741 | Ga0207691_10058230 | |||
| 1742 | Ga0207711_10015219 | |||
| 1743 | Ga0207689_10009295 | |||
| 1744 | Ga0207689_10018914 | |||
| 1745 | Ga0207661_10006975 | |||
| 1746 | Ga0207661_10007758 | |||
| 1747 | Ga0207661_10046413 | |||
| 1748 | Ga0207661_10057842 | |||
| 1749 | Ga0207661_10059390 | |||
| 1750 | Ga0207661_10076878 | |||
| 1751 | Ga0207661_10537164 | |||
| 1752 | Ga0207679_10108982 | |||
| 1753 | Ga0207679_10145994 | |||
| 1754 | Ga0207679_10581139 | |||
| 1755 | Ga0207667_10924513 | |||
| 1756 | Ga0207651_10049958 | |||
| 1757 | Ga0207651_10570524 | |||
| 1758 | Ga0207712_10013444 | |||
| 1759 | Ga0207668_10006340 | |||
| 1760 | Ga0207668_10059741 | |||
| 1761 | Ga0207668_10303624 | |||
| 1762 | Ga0207668_10881028 | |||
| 1763 | Ga0207703_10007760 | |||
| 1764 | Ga0207703_10120627 | |||
| 1765 | Ga0207639_10019887 | |||
| 1766 | Ga0207639_10057672 | |||
| 1767 | Ga0207678_10012485 | |||
| 1768 | Ga0207678_10049018 | |||
| 1769 | Ga0207678_10288416 | |||
| 1770 | Ga0207678_10924451 | |||
| 1771 | Ga0207708_10010788 | |||
| 1772 | Ga0207708_10214371 | |||
| 1773 | Ga0207708_10880563 | |||
| 1774 | Ga0207702_10024939 | |||
| 1775 | Ga0207702_10039177 | |||
| 1776 | Ga0207702_10412804 | |||
| 1777 | Ga0207702_10464120 | |||
| 1778 | Ga0207702_10567792 | |||
| 1779 | Ga0207702_10641501 | |||
| 1780 | Ga0207641_10478807 | |||
| 1781 | Ga0207641_10532009 | |||
| 1782 | Ga0207641_10559965 | |||
| 1783 | Ga0207648_10023769 | |||
| 1784 | Ga0207648_10043798 | |||
| 1785 | Ga0207648_10094750 | |||
| 1786 | Ga0207648_10138893 | |||
| 1787 | Ga0207676_10227097 | |||
| 1788 | Ga0207674_10009266 | |||
| 1789 | Ga0207674_10021925 | |||
| 1790 | Ga0207674_10278111 | |||
| 1791 | Ga0207674_10495346 | |||
| 1792 | Ga0207675_100009277 | |||
| 1793 | Ga0207675_100016831 | |||
| 1794 | Ga0207675_100098975 | |||
| 1795 | Ga0207675_100556275 | |||
| 1796 | Ga0207683_10006539 | |||
| 1797 | Ga0207683_10012640 | |||
| 1798 | Ga0207683_10085257 | |||
| 1799 | Ga0207683_10348115 | |||
| 1800 | Ga0207698_10391364 | |||
| 1801 | Ga0209813_10063302 | |||
| 1802 | Ga0207428_10016087 | |||
| 1803 | Ga0207428_10105603 | |||
| 1804 | Ga0268265_10066231 | |||
| 1805 | Ga0268265_11058065 | |||
| 1806 | Ga0268264_10097244 | |||
| 1807 | Ga0265337_1000033 | |||
| 1808 | Ga0265337_1035722 | |||
| 1809 | Ga0265326_10001841 | |||
| 1810 | Ga0265319_1002186 | |||
| 1811 | Ga0265334_10006906 | |||
| 1812 | Ga0265334_10031619 | |||
| 1813 | Ga0265318_10002086 | |||
| 1814 | Ga0265318_10009588 | |||
| 1815 | Ga0265318_10011629 | |||
| 1816 | Ga0265318_10126186 | |||
| 1817 | Ga0265323_10004662 | |||
| 1818 | Ga0265322_10003011 | |||
| 1819 | Ga0265322_10009522 | |||
| 1820 | Ga0265322_10051176 | |||
| 1821 | Ga0265336_10003443 | |||
| 1822 | Ga0265336_10041308 | |||
| 1823 | Ga0265338_10000059 | |||
| 1824 | Ga0265338_10002834 | |||
| 1825 | Ga0265338_10009051 | |||
| 1826 | Ga0265338_10026943 | |||
| 1827 | Ga0265338_10088243 | |||
| 1828 | Ga0265324_10000810 | |||
| 1829 | Ga0265330_10064966 | |||
| 1830 | Ga0265330_10066888 | |||
| 1831 | Ga0265332_10000315 | |||
| 1832 | Ga0265332_10112041 | |||
| 1833 | Ga0265320_10003479 | |||
| 1834 | Ga0265320_10013756 | |||
| 1835 | Ga0265320_10073655 | |||
| 1836 | Ga0265325_10062542 | |||
| 1837 | Ga0265325_10065324 | |||
| 1838 | Ga0265329_10049954 | |||
| 1839 | Ga0265340_10000168 | |||
| 1840 | Ga0265340_10041197 | |||
| 1841 | Ga0265340_10084773 | |||
| 1842 | Ga0265339_10015478 | |||
| 1843 | Ga0265339_10126140 | |||
| 1844 | Ga0265331_10054975 | |||
| 1845 | Ga0265331_10064200 | |||
| 1846 | Ga0265327_10072976 | |||
| 1847 | Ga0265327_10165307 | |||
| 1848 | Ga0265316_10007783 | |||
| 1849 | Ga0265316_10019343 | |||
| 1850 | Ga0307509_10168616 | |||
| 1851 | Ga0265313_10006538 | |||
| 1852 | Ga0265313_10026175 | |||
| 1853 | Ga0265313_10164033 | |||
| 1854 | Ga0265314_10005746 | |||
| 1855 | Ga0265314_10014093 | |||
| 1856 | Ga0265314_10045899 | |||
| 1857 | Ga0265314_10132511 | |||
| 1858 | Ga0265342_10001322 | |||
| 1859 | Ga0265342_10040773 | |||
| 1860 | Ga0265342_10064181 | |||
| 1861 | Ga0307405_10375765 | |||
| 1862 | Ga0307416_100178966 | |||
| 1863 | Ga0307416_100501622 | |||
| 1864 | Ga0373948_0003612 | |||
| 1865 | Ga0373948_0061127 | |||
| 1866 | Ga0373950_0051435 | |||
| 1867 | Ga0373958_0012987 | |||
| 1868 | Ga0373958_0013501 | |||
| 1869 | Ga0373926_0056484 | |||
| 1870 | Ga0373929_0074714 | |||
| 1871 | Ga0373934_0002258 | |||
| 1872 | Ga0373934_0011853 | |||
| 1873 | Ga0373934_0123875 | |||
| 1874 | Ga0373949_0002596 | |||
| 1875 | Ga0373949_0017890 | |||
| 1876 | Ga0373949_0027952 | |||
| 1877 | Ga0373923_0008085 | |||
| 1878 | Ga0373923_0149773 | |||
| 1879 | Ga0373932_0057276 | |||
| 1880 | Ga0373936_0011457 | |||
| 1881 | Ga0373936_0011809 | |||
| 1882 | Ga0373939_0052315 | |||
| 1883 | Ga0373945_0002605 | |||
| 1884 | Ga0373945_0070097 | |||
| 1885 | Ga0373953_0000386 | |||
| 1886 | Ga0373953_0002454 | |||
| 1887 | Ga0373953_0034216 | |||
| 1888 | Ga0373953_0069609 | |||
| 1889 | Ga0373953_0106760 | |||
| 1890 | Ga0373953_0129062 | |||
| 1891 | Ga0373954_0022705 | |||
| 1892 | Ga0373954_0050231 | |||
| 1893 | Ga0373954_0073094 | |||
| 1894 | Ga0373954_0132796 | |||
| 1895 | Ga0373956_0001244 | |||
| 1896 | Ga0373956_0008563 | |||
| 1897 | Ga0373956_0127642 | |||
| 1898 | Ga0373956_0155328 | |||
| 1899 | Ga0373957_0000246 | |||
| 1900 | Ga0373957_0054480 | |||
| 1901 | Ga0373957_0066495 | |||
| 1902 | Ga0373960_0049976 | |||
| 1903 | Ga0373943_0074747 | |||
| 1904 | Ga0373946_0115537 | |||
| 1905 | Ga0373955_0000228 | |||
| 1906 | Ga0373955_0013489 | |||
| 1907 | Ga0373955_0044965 | |||
| 1908 | Ga0373955_0082384 | |||
| 1909 | Ga0373955_0177833 | |||
| 1910 | Ga0373955_0226574 | |||
| 1911 | Ga0373955_0244728 | |||
| 1912 | Ga0373955_0348733 | |||
| 1913 | Ga0373942_0005087 | |||
| 1914 | Ga0373942_0027404 | |||
| 1915 | Ga0373961_0016088 | |||
| 1916 | Ga0373961_0018101 | |||
| 1917 | Ga0373962_0023258 | |||
| 1918 | Ga0316574_0103985 | |||
| 1919 | Ga0373924_0002099 | |||
| 1920 | Ga0373924_0042617 | |||
| 1921 | Ga0373931_0008158 | |||
| 1922 | Ga0373931_0091615 | |||
| 1923 | Ga0373931_0092396 | |||
| 1924 | Ga0373931_0105452 | |||
| 1925 | Ga0373927_0009389 | |||
| 1926 | Ga0373927_0109158 | |||
| 1927 | Ga0373933_0000012 | |||
| 1928 | Ga0373933_0018359 | |||
| 1929 | Ga0373933_0022298 | |||
| 1930 | Ga0373933_0267120 | |||
| 1931 | Ga0373933_0294100 | |||
| 1932 | Ga0373933_0382669 | |||
| 1933 | Ga0373947_0019792 | |||
| 1934 | Ga0373947_0048661 | |||
| 1935 | Ga0373947_0048860 | |||
| 1936 | Ga0373947_0052979 | |||
| 1937 | Ga0373947_0056510 | |||
| 1938 | Ga0373937_0000040 | |||
| 1939 | Ga0373937_0002649 | |||
| 1940 | Ga0373937_0003488 | |||
| 1941 | Ga0373937_0028479 | |||
| 1942 | Ga0373937_0052183 | |||
| 1943 | Ga0373937_0057123 | |||
| 1944 | Ga0373937_0200759 | |||
| 1945 | Ga0373937_0506048 | |||
| 1946 | Ga0372808_001465 | |||
| 1947 | Ga0373925_0000014 | |||
| 1948 | Ga0373925_0004085 | |||
| 1949 | Ga0373925_0010821 | |||
| 1950 | Ga0373925_0023001 | |||
| 1951 | Ga0373925_0077614 | |||
| 1952 | Ga0373925_0431063 | |||
| 1953 | Ga0395899_0277109 | |||
| 1954 | Ga0395900_0155133 | |||
| 1955 | Ga0395898_0082521 | |||
| 1956 | Ga0395898_0087463 | |||
| 1957 | Ga0395898_0736505 | |||
| 1958 | Ga0436364_0296603 | |||
| 1959 | Ga0436364_0305992 | |||
| 1960 | Ga0436364_0330965 | |||
| 1961 | Ga0436364_0970657 | |||
| 1962 | Ga0436364_1003558 | |||
| 1963 | Ga0436364_1091382 | |||
| 1964 | Ga0436364_1207495 | |||
| 1965 | Ga0436364_1309732 | |||
| 1966 | Ga0436364_1515661 | |||
| 1967 | Ga0395901_0058914 | |||
| 1968 | Ga0395901_0105133 | |||
| 1969 | Ga0395901_0563324 | |||
| 1970 | Ga0395901_1056289 | |||
| 1971 | Ga0400483_027790 | |||
| 1972 | Ga0400483_040279 | |||
| 1973 | Ga0400483_148576 | |||
| 1974 | Ga0436365_0122816 | |||
| 1975 | Ga0436365_0501329 | |||
| 1976 | Ga0436365_0722652 | |||
| 1977 | Ga0436365_0741127 | |||
| 1978 | Ga0436365_0772721 | |||
| 1979 | Ga0436365_1118937 | |||
| 1980 | Ga0436365_1384528 | |||
| 1981 | Ga0436365_1709192 | |||
| 1982 | Ga0436365_1928355 | |||
| 1983 | Ga0436361_0405093 | |||
| 1984 | Ga0436363_0275177 | |||
| 1985 | Ga0436363_0440163 | |||
| 1986 | Ga0436363_0510149 | |||
| 1987 | Ga0436363_1273328 | |||
| 1988 | Ga0436363_1413520 | |||
| 1989 | Ga0436362_0833178 | |||
| 1990 | Ga0436362_0953937 | |||
| 1991 | Ga0450917_009097 | |||
| 1992 | Ga0466965_0256018 | |||
| 1993 | Ga0466966_0180031 | |||
| 1994 | Ga0466966_0473861 | |||
| 1995 | Ga0466963_0001738 | |||
| 1996 | Ga0466963_0022259 | |||
| 1997 | Ga0466963_0139269 | |||
| 1998 | Ga0466963_0214943 | |||
| 1999 | Ga0466964_0069867 | |||
| 2000 | Ga0466971_0098857 | |||
| 2001 | Ga0466959_0037694 | |||
| 2002 | Ga0466959_0042235 | |||
| 2003 | Ga0466959_0050502 | |||
| 2004 | Ga0466959_0149684 | |||
| 2005 | Ga0466959_0232645 | |||
| 2006 | Ga0466958_0001703 | |||
| 2007 | Ga0466958_0266968 | |||
| 2008 | Ga0466958_0450580 | |||
| 2009 | Ga0466967_0002363 | |||
| 2010 | Ga0466967_0003356 | |||
| 2011 | Ga0466967_0026541 | |||
| 2012 | Ga0466967_0070646 | |||
| 2013 | Ga0466967_0155534 | |||
| 2014 | Ga0466967_0249603 | |||
| 2015 | Ga0466967_0432380 | |||
| 2016 | Ga0466967_0688114 | |||
| 2017 | Ga0495592_0000311 | |||
| 2018 | Ga0495592_0000527 | |||
| 2019 | Ga0495592_0025649 | |||
| 2020 | Ga0495592_0034230 | |||
| 2021 | Ga0495592_0050225 | |||
| 2022 | Ga0495592_0110199 | |||
| 2023 | Ga0495592_0205353 | |||
| 2024 | Ga0495603_0208477 | |||
| 2025 | Ga0495603_0276899 | |||
| 2026 | Ga0495629_0015038 | |||
| 2027 | Ga0495629_0033434 | |||
| 2028 | Ga0495629_0078458 | |||
| 2029 | Ga0495629_0161204 | |||
| 2030 | Ga0495629_0182369 | |||
| 2031 | Ga0495641_0007063 | |||
| 2032 | Ga0495641_0063175 | |||
| 2033 | Ga0495641_0064991 | |||
| 2034 | Ga0495651_0000040 | |||
| 2035 | Ga0495651_0000432 | |||
| 2036 | Ga0495651_0010333 | |||
| 2037 | Ga0495651_0012108 | |||
| 2038 | Ga0495651_0020217 | |||
| 2039 | Ga0495651_0040043 | |||
| 2040 | Ga0495651_0061895 | |||
| 2041 | Ga0495651_0080139 | |||
| 2042 | Ga0495651_0102253 | |||
| 2043 | Ga0495651_0131711 | |||
| 2044 | Ga0495651_0260350 | |||
| 2045 | Ga0495653_0001251 | |||
| 2046 | Ga0495653_0007460 | |||
| 2047 | Ga0495653_0010425 | |||
| 2048 | Ga0495653_0013540 | |||
| 2049 | Ga0495653_0023183 | |||
| 2050 | Ga0495653_0058167 | |||
| 2051 | Ga0495653_0070742 | |||
| 2052 | Ga0495653_0306885 | |||
| 2053 | Ga0495653_0373008 | |||
| 2054 | Ga0495580_0068962 | |||
| 2055 | Ga0495582_0001113 | |||
| 2056 | Ga0495582_0074578 | |||
| 2057 | Ga0495582_0109258 | |||
| 2058 | Ga0495582_0164323 | |||
| 2059 | Ga0495639_0002135 | |||
| 2060 | Ga0495639_0084286 | |||
| 2061 | Ga0495639_0095221 | |||
| 2062 | Ga0495662_0031724 | |||
| 2063 | Ga0495662_0061205 | |||
| 2064 | Ga0495664_0005004 | |||
| 2065 | Ga0495664_0012500 | |||
| 2066 | Ga0495664_0047329 | |||
| 2067 | Ga0495664_0124224 | |||
| 2068 | Ga0495664_0143344 | |||
| 2069 | Ga0495664_0402642 | |||
| 2070 | Ga0495594_0016153 | |||
| 2071 | Ga0495594_0119789 | |||
| 2072 | Ga0495594_0123368 | |||
| 2073 | Ga0495596_0036764 | |||
| 2074 | Ga0495608_0000044 | |||
| 2075 | Ga0495608_0003725 | |||
| 2076 | Ga0495608_0013028 | |||
| 2077 | Ga0495608_0041756 | |||
| 2078 | Ga0495608_0052083 | |||
| 2079 | Ga0495608_0063252 | |||
| 2080 | Ga0495608_0071915 | |||
| 2081 | Ga0495608_0113406 | |||
| 2082 | Ga0495608_0230472 | |||
| 2083 | Ga0495618_0008862 | |||
| 2084 | Ga0495618_0012673 | |||
| 2085 | Ga0495618_0074891 | |||
| 2086 | Ga0495618_0169551 | |||
| 2087 | Ga0495628_0000123 | |||
| 2088 | Ga0495628_0001019 | |||
| 2089 | Ga0495628_0015522 | |||
| 2090 | Ga0495628_0025365 | |||
| 2091 | Ga0495628_0064278 | |||
| 2092 | Ga0495628_0087795 | |||
| 2093 | Ga0495628_0098527 | |||
| 2094 | Ga0495630_0001285 | |||
| 2095 | Ga0495630_0017790 | |||
| 2096 | Ga0495630_0236059 | |||
| 2097 | Ga0495630_0337205 | |||
| 2098 | Ga0495630_0387584 | |||
| 2099 | Ga0495666_0050744 | |||
| 2100 | Ga0495666_0088624 | |||
| 2101 | Ga0495652_0000108 | |||
| 2102 | Ga0495652_0002108 | |||
| 2103 | Ga0495652_0047091 | |||
| 2104 | Ga0495652_0054033 | |||
| 2105 | Ga0495652_0122964 | |||
| 2106 | Ga0495652_0256085 | |||
| 2107 | Ga0495652_0300368 | |||
| 2108 | Ga0495665_0001114 | |||
| 2109 | Ga0495640_0000776 | |||
| 2110 | Ga0495640_0031026 | |||
| 2111 | Ga0495640_0357501 | |||
| 2112 | Ga0495586_0028909 | |||
| 2113 | Ga0495586_0031543 | |||
| 2114 | Ga0495587_0000046 | |||
| 2115 | Ga0495587_0001714 | |||
| 2116 | Ga0495587_0009527 | |||
| 2117 | Ga0495587_0022981 | |||
| 2118 | Ga0495587_0023110 | |||
| 2119 | Ga0495587_0058683 | |||
| 2120 | Ga0495587_0103208 | |||
| 2121 | Ga0495587_0153456 | |||
| 2122 | Ga0495587_0217118 | |||
| 2123 | Ga0495609_0072602 | |||
| 2124 | Ga0495645_0001345 | |||
| 2125 | Ga0495645_0015292 | |||
| 2126 | Ga0495645_0032378 | |||
| 2127 | Ga0495645_0078708 | |||
| 2128 | Ga0495645_0084006 | |||
| 2129 | Ga0495645_0177101 | |||
| 2130 | Ga0495645_0229657 | |||
| 2131 | Ga0495645_0272482 | |||
| 2132 | Ga0495645_0309437 | |||
| 2133 | Ga0495667_0000066 | |||
| 2134 | Ga0495667_0000469 | |||
| 2135 | Ga0495667_0000828 | |||
| 2136 | Ga0495667_0009982 | |||
| 2137 | Ga0495667_0014660 | |||
| 2138 | Ga0495667_0033979 | |||
| 2139 | Ga0495667_0049490 | |||
| 2140 | Ga0495667_0123994 | |||
| 2141 | Ga0495667_0167185 | |||
| 2142 | Ga0495667_0168443 | |||
| 2143 | Ga0495667_0183342 | |||
| 2144 | Ga0495667_0311125 | |||
| 2145 | Ga0495667_0434734 | |||
| 2146 | Ga0495635_0001007 | |||
| 2147 | Ga0495635_0008192 | |||
| 2148 | Ga0495635_0020988 | |||
| 2149 | Ga0495635_0050191 | |||
| 2150 | Ga0495635_0075969 | |||
| 2151 | Ga0495635_0116471 | |||
| 2152 | Ga0495635_0125870 | |||
| 2153 | Ga0495659_0133478 | |||
| 2154 | Ga0495661_0194526 | |||
| 2155 | Ga0495588_0094796 | |||
| 2156 | Ga0495588_0205190 | |||
| 2157 | Ga0495657_0001421 | |||
| 2158 | Ga0495657_0002047 | |||
| 2159 | Ga0495657_0009366 | |||
| 2160 | Ga0495657_0010865 | |||
| 2161 | Ga0495657_0012482 | |||
| 2162 | Ga0495657_0027401 | |||
| 2163 | Ga0495657_0066536 | |||
| 2164 | Ga0495657_0074526 | |||
| 2165 | Ga0495657_0080349 | |||
| 2166 | Ga0495599_0000052 | |||
| 2167 | Ga0495599_0000263 | |||
| 2168 | Ga0495599_0036098 | |||
| 2169 | Ga0495599_0039707 | |||
| 2170 | Ga0495599_0243119 | |||
| 2171 | Ga0495623_0000798 | |||
| 2172 | Ga0495623_0005605 | |||
| 2173 | Ga0495623_0020411 | |||
| 2174 | Ga0495623_0046126 | |||
| 2175 | Ga0495623_0072707 | |||
| 2176 | Ga0495623_0093873 | |||
| 2177 | Ga0495646_0000483 | |||
| 2178 | Ga0495646_0002352 | |||
| 2179 | Ga0495646_0014166 | |||
| 2180 | Ga0495646_0043510 | |||
| 2181 | Ga0495647_0009226 | |||
| 2182 | Ga0495658_0024122 | |||
| 2183 | Ga0495658_0119828 | |||
| 2184 | Ga0495658_0125229 | |||
| 2185 | Ga0495613_0030148 | |||
| 2186 | Ga0495613_0080268 | |||
| 2187 | Ga0495613_0118503 | |||
| 2188 | Ga0495613_0336763 | |||
| 2189 | Ga0495649_0226596 | |||
| 2190 | Ga0495589_0105353 | |||
| 2191 | Ga0495600_0000363 | |||
| 2192 | Ga0495600_0021707 | |||
| 2193 | Ga0495600_0037041 | |||
| 2194 | Ga0495600_0037705 | |||
| 2195 | Ga0495600_0259053 | |||
| 2196 | Ga0495581_0012735 | |||
| 2197 | Ga0495581_0012822 | |||
| 2198 | Ga0495581_0080938 | |||
| 2199 | Ga0495604_0000049 | |||
| 2200 | Ga0495604_0000825 | |||
| 2201 | Ga0495604_0019323 | |||
| 2202 | Ga0495604_0044702 | |||
| 2203 | Ga0495604_0046769 | |||
| 2204 | Ga0495604_0077899 | |||
| 2205 | Ga0495604_0172570 | |||
| 2206 | Ga0495604_0457968 | |||
| 2207 | Ga0495674_0000509 | |||
| 2208 | Ga0495674_0001040 | |||
| 2209 | Ga0495674_0008480 | |||
| 2210 | Ga0495674_0013623 | |||
| 2211 | Ga0495674_0112862 | |||
| 2212 | Ga0495674_0246133 | |||
| 2213 | Ga0495674_0288562 | |||
| 2214 | Ga0495674_0449266 | |||
| 2215 | Ga0495676_0004008 | |||
| 2216 | Ga0495676_0095986 | |||
| 2217 | Ga0495680_0000915 | |||
| 2218 | Ga0495680_0001981 | |||
| 2219 | Ga0495680_0002008 | |||
| 2220 | Ga0495680_0008614 | |||
| 2221 | Ga0495680_0011345 | |||
| 2222 | Ga0495680_0019480 | |||
| 2223 | Ga0495680_0040654 | |||
| 2224 | Ga0495680_0049169 | |||
| 2225 | Ga0495680_0220013 | |||
| 2226 | Ga0495680_0278034 | |||
| 2227 | Ga0495675_0000684 | |||
| 2228 | Ga0495675_0015403 | |||
| 2229 | Ga0495675_0041410 | |||
| 2230 | Ga0495675_0074908 | |||
| 2231 | Ga0495675_0146438 | |||
| 2232 | Ga0495684_0001813 | |||
| 2233 | Ga0495684_0009204 | |||
| 2234 | Ga0495684_0018650 | |||
| 2235 | Ga0495684_0105690 | |||
| 2236 | Ga0495684_0123412 | |||
| 2237 | Ga0495684_0197743 | |||
| 2238 | Ga0495593_0009273 | |||
| 2239 | Ga0495593_0014329 | |||
| 2240 | Ga0495593_0074512 | |||
| 2241 | Ga0495593_0173797 | |||
| 2242 | Ga0495602_0001642 | |||
| 2243 | Ga0495602_0002204 | |||
| 2244 | Ga0495602_0020733 | |||
| 2245 | Ga0495602_0027368 | |||
| 2246 | Ga0495602_0062190 | |||
| 2247 | Ga0495602_0079517 | |||
| 2248 | Ga0495602_0109412 | |||
| 2249 | Ga0495602_0247131 | |||
| 2250 | Ga0495602_0496751 | |||
| 2251 | Ga0495614_0074477 | |||
| 2252 | Ga0496100_0004806 | |||
| 2253 | Ga0496100_0011762 | |||
| 2254 | Ga0496100_0049972 | |||
| 2255 | Ga0496100_0058398 | |||
| 2256 | Ga0496100_0518683 | |||
| 2257 | Ga0496101_0002482 | |||
| 2258 | Ga0496101_0024549 | |||
| 2259 | Ga0496101_0040092 | |||
| 2260 | Ga0496101_0046218 | |||
| 2261 | Ga0496101_0171689 | |||
| 2262 | Ga0496101_0217063 | |||
| 2263 | Ga0496102_0008128 | |||
| 2264 | Ga0496102_0034483 | |||
| 2265 | Ga0496102_0054604 | |||
| 2266 | Ga0496102_0101511 | |||
| 2267 | Ga0496102_0105239 | |||
| 2268 | Ga0496102_0158274 | |||
| 2269 | Ga0496102_0161595 | |||
| 2270 | Ga0496102_0226605 | |||
| 2271 | Ga0496102_0626775 | |||
| 2272 | Ga0496103_0013448 | |||
| 2273 | Ga0496103_0015143 | |||
| 2274 | Ga0496103_0082878 | |||
| 2275 | Ga0496104_0000254 | |||
| 2276 | Ga0496104_0005355 | |||
| 2277 | Ga0496104_0044635 | |||
| 2278 | Ga0496104_0088201 | |||
| 2279 | Ga0496104_0091180 | |||
| 2280 | Ga0496104_0345648 | |||
| 2281 | Ga0496105_0000055 | |||
| 2282 | Ga0496105_0010310 | |||
| 2283 | Ga0496105_0019105 | |||
| 2284 | Ga0496105_0027732 | |||
| 2285 | Ga0496105_0057708 | |||
| 2286 | Ga0496105_0165916 | |||
| 2287 | Ga0496105_0368167 | |||
| 2288 | Ga0496106_0011555 | |||
| 2289 | Ga0496106_0022778 | |||
| 2290 | Ga0496106_0072293 | |||
| 2291 | Ga0496106_0133446 | |||
| 2292 | Ga0496106_0164377 | |||
| 2293 | Ga0496106_0222863 | |||
| 2294 | Ga0496107_0012905 | |||
| 2295 | Ga0496107_0014053 | |||
| 2296 | Ga0496107_0028240 | |||
| 2297 | Ga0496107_0105210 | |||
| 2298 | Ga0496107_0147581 | |||
| 2299 | Ga0496108_0001045 | |||
| 2300 | Ga0496108_0006864 | |||
| 2301 | Ga0496108_0022625 | |||
| 2302 | Ga0496108_0024614 | |||
| 2303 | Ga0496108_0030222 | |||
| 2304 | Ga0496108_0065294 | |||
| 2305 | Ga0496108_0136924 | |||
| 2306 | Ga0496108_0151036 | |||
| 2307 | Ga0496108_0154859 | |||
| 2308 | Ga0496108_0201227 | |||
| 2309 | Ga0496109_0001932 | |||
| 2310 | Ga0496109_0027051 | |||
| 2311 | Ga0496109_0034509 | |||
| 2312 | Ga0496109_0087898 | |||
| 2313 | Ga0496109_0285301 | |||
| 2314 | Ga0496109_0287768 | |||
| 2315 | Ga0496109_0317383 | |||
| 2316 | Ga0496109_0337535 | |||
| 2317 | Ga0496109_0344197 | |||
| 2318 | Ga0496109_0376488 | |||
| 2319 | Ga0496109_0397230 | |||
| 2320 | Ga0496109_0627552 | |||
| 2321 | Ga0496110_0001472 | |||
| 2322 | Ga0496110_0015265 | |||
| 2323 | Ga0496110_0024503 | |||
| 2324 | Ga0496110_0039557 | |||
| 2325 | Ga0496110_0060635 | |||
| 2326 | Ga0496110_0078534 | |||
| 2327 | Ga0496110_0080758 | |||
| 2328 | Ga0496110_0202524 | |||
| 2329 | Ga0496110_0533108 | |||
| 2330 | Ga0496111_0000582 | |||
| 2331 | Ga0496111_0006467 | |||
| 2332 | Ga0496111_0010734 | |||
| 2333 | Ga0496111_0010771 | |||
| 2334 | Ga0496111_0020021 | |||
| 2335 | Ga0496111_0059459 | |||
| 2336 | Ga0496111_0105585 | |||
| 2337 | Ga0496111_0118417 | |||
| 2338 | Ga0496111_0125298 | |||
| 2339 | Ga0496112_0035013 | |||
| 2340 | Ga0496112_0144166 | |||
| 2341 | Ga0496112_0246516 | |||
| 2342 | Ga0496113_0032179 | |||
| 2343 | Ga0496113_0037996 | |||
| 2344 | Ga0496113_0080207 | |||
| 2345 | Ga0496113_0269416 | |||
| 2346 | Ga0496114_0000256 | |||
| 2347 | Ga0496114_0002055 | |||
| 2348 | Ga0496114_0008450 | |||
| 2349 | Ga0496114_0023237 | |||
| 2350 | Ga0496114_0039944 | |||
| 2351 | Ga0496114_0069098 | |||
| 2352 | Ga0496114_0077619 | |||
| 2353 | Ga0496114_0095689 | |||
| 2354 | Ga0496114_0180586 | |||
| 2355 | Ga0496114_0212649 | |||
| 2356 | Ga0496114_0227410 | |||
| 2357 | Ga0496114_0264213 | |||
| 2358 | Ga0496114_0329684 | |||
| 2359 | Ga0496114_0440618 | |||
| 2360 | Ga0496115_0004783 | |||
| 2361 | Ga0496115_0061389 | |||
| 2362 | Ga0496115_0107103 | |||
| 2363 | Ga0496115_0128386 | |||
| 2364 | Ga0496115_0147106 | |||
| 2365 | Ga0496115_0344185 | |||
| 2366 | Ga0496115_0387211 | |||
| 2367 | Ga0496115_0521682 | |||
| 2368 | Ga0496126_0105857 | |||
| 2369 | Ga0501031_0015677 | |||
| 2370 | Ga0501031_0038100 | |||
| 2371 | Ga0501031_0416810 | |||
| 2372 | Ga0501032_0002084 | |||
| 2373 | Ga0501032_0005781 | |||
| 2374 | Ga0501033_0006304 | |||
| 2375 | Ga0501034_0068193 | |||
| 2376 | Ga0501034_0123205 | |||
| 2377 | Ga0501036_0000591 | |||
| 2378 | Ga0501036_0039371 | |||
| 2379 | Ga0501036_0124304 | |||
| 2380 | Ga0501036_0370608 | |||
| 2381 | Ga0501037_0006728 | |||
| 2382 | Ga0501037_0047819 | |||
| 2383 | Ga0501037_0292336 | |||
| 2384 | Ga0501038_0012788 | |||
| 2385 | Ga0501038_0063219 | |||
| 2386 | Ga0501039_0011789 | |||
| 2387 | Ga0501039_0090639 | |||
| 2388 | Ga0501039_0097604 | |||
| 2389 | Ga0501039_0125388 | |||
| 2390 | Ga0501039_0288507 | |||
| 2391 | Ga0501039_0522005 | |||
| 2392 | Ga0501040_0002817 | |||
| 2393 | Ga0501040_0008241 | |||
| 2394 | Ga0501040_0023563 | |||
| 2395 | Ga0501040_0040508 | |||
| 2396 | Ga0501040_0094030 | |||
| 2397 | Ga0501040_0134093 | |||
| 2398 | Ga0501041_0003917 | |||
| 2399 | Ga0501041_0027722 | |||
| 2400 | Ga0501041_0039956 | |||
| 2401 | Ga0501041_0251157 | |||
| 2402 | Ga0501042_0009634 | |||
| 2403 | Ga0501042_0019215 | |||
| 2404 | Ga0501042_0066304 | |||
| 2405 | Ga0501042_0088999 | |||
| 2406 | Ga0501042_0275267 | |||
| 2407 | Ga0501042_0541380 | |||
| 2408 | Ga0501043_0006662 | |||
| 2409 | Ga0501043_0090816 | |||
| 2410 | Ga0501046_0009111 | |||
| 2411 | Ga0501047_0030083 | |||
| 2412 | Ga0501048_0003882 | |||
| 2413 | Ga0501048_0012586 | |||
| 2414 | Ga0501048_0020300 | |||
| 2415 | Ga0501048_0095022 | |||
| 2416 | Ga0501067_0003977 | |||
| 2417 | Ga0501068_0001816 | |||
| 2418 | Ga0501068_0008703 | |||
| 2419 | Ga0501068_0031657 | |||
| 2420 | Ga0501068_0157342 | |||
| 2421 | Ga0501069_0205306 | |||
| 2422 | Ga0501070_0001737 | |||
| 2423 | Ga0501070_0004106 | |||
| 2424 | Ga0501070_0045415 | |||
| 2425 | Ga0501071_0005038 | |||
| 2426 | Ga0501071_0048965 | |||
| 2427 | Ga0501071_0067283 | |||
| 2428 | Ga0501071_0146763 | |||
| 2429 | Ga0501071_0370971 | |||
| 2430 | Ga0501071_0382872 | |||
| 2431 | Ga0501071_0424293 | |||
| 2432 | Ga0501072_0006718 | |||
| 2433 | Ga0501072_0007195 | |||
| 2434 | Ga0501072_0013631 | |||
| 2435 | Ga0501072_0023338 | |||
| 2436 | Ga0501072_0065511 | |||
| 2437 | Ga0501072_0162491 | |||
| 2438 | Ga0501072_0163134 | |||
| 2439 | Ga0501072_0222542 | |||
| 2440 | Ga0501072_0581108 | |||
| 2441 | Ga0501072_0768227 | |||
| 2442 | Ga0501073_0004004 | |||
| 2443 | Ga0501073_0044173 | |||
| 2444 | Ga0501074_0013566 | |||
| 2445 | Ga0501074_0015334 | |||
| 2446 | Ga0501074_0130070 | |||
| 2447 | Ga0501074_0288955 | |||
| 2448 | Ga0501075_0002914 | |||
| 2449 | Ga0501075_0006299 | |||
| 2450 | Ga0501075_0016462 | |||
| 2451 | Ga0501075_0047506 | |||
| 2452 | Ga0501075_0065586 | |||
| 2453 | Ga0501075_0110102 | |||
| 2454 | Ga0501075_0176780 | |||
| 2455 | Ga0501075_0217638 | |||
| 2456 | Ga0501075_0267434 | |||
| 2457 | Ga0501076_0003476 | |||
| 2458 | Ga0501076_0008871 | |||
| 2459 | Ga0501076_0032100 | |||
| 2460 | Ga0501076_0036340 | |||
| 2461 | Ga0501076_0058198 | |||
| 2462 | Ga0501076_0138735 | |||
| 2463 | Ga0501076_0366192 | |||
| 2464 | Ga0501077_0001647 | |||
| 2465 | Ga0501077_0002374 | |||
| 2466 | Ga0501077_0004791 | |||
| 2467 | Ga0501077_0025032 | |||
| 2468 | Ga0501077_0045344 | |||
| 2469 | Ga0501077_0089929 | |||
| 2470 | Ga0501077_0139551 | |||
| 2471 | Ga0501079_0016897 | |||
| 2472 | Ga0501079_0024063 | |||
| 2473 | Ga0501079_0047864 | |||
| 2474 | Ga0501079_0048947 | |||
| 2475 | Ga0501079_0064271 | |||
| 2476 | Ga0501079_0079306 | |||
| 2477 | Ga0501079_0154482 | |||
| 2478 | Ga0501079_0336647 | |||
| 2479 | Ga0501080_0008162 | |||
| 2480 | Ga0501080_0011073 | |||
| 2481 | Ga0501080_0393001 | |||
| 2482 | Ga0501081_0024191 | |||
| 2483 | Ga0501081_0026153 | |||
| 2484 | Ga0501081_0045233 | |||
| 2485 | Ga0501081_0106530 | |||
| 2486 | Ga0501083_0008832 | |||
| 2487 | Ga0501083_0012205 | |||
| 2488 | Ga0501083_0068855 | |||
| 2489 | Ga0501083_0101284 | |||
| 2490 | Ga0501035_0003688 | |||
| 2491 | Ga0501035_0221003 | |||
| 2492 | Ga0501035_0257749 | |||
| 2493 | Ga0501044_0013073 | |||
| 2494 | Ga0501045_0013916 | |||
| 2495 | Ga0501045_0017443 | |||
| 2496 | Ga0501045_0057401 | |||
| 2497 | Ga0501045_0081790 | |||
| 2498 | Ga0501045_0199650 | |||
| 2499 | nmdc:mga03683_9500_c1 | |||
| 2500 | nmdc:mga03n38_30305_c1 | |||
| 2501 | nmdc:mga03n38_78687_c1 | |||
| 2502 | nmdc:mga00v17_13011_c1 | |||
| 2503 | nmdc:mga00v17_141723_c1 | |||
| 2504 | nmdc:mga00v17_25280_c1 | |||
| 2505 | nmdc:mga0yw44_1038_c1 | |||
| 2506 | nmdc:mga0yw44_185170_c1 | |||
| 2507 | nmdc:mga0yw44_86706_c1 | |||
| 2508 | nmdc:mga06z11_71297_c1 | |||
| 2509 | nmdc:mga04h51_14713_c1 | |||
| 2510 | nmdc:mga04h51_23717_c1 | |||
| 2511 | nmdc:mga07m45_71199_c1 | |||
| 2512 | nmdc:mga05p37_13498_c1 | |||
| 2513 | nmdc:mga05p37_16833_c1 | |||
| 2514 | nmdc:mga05p37_361180_c2 | |||
| 2515 | nmdc:mga05p37_72339_c1 | |||
| 2516 | nmdc:mga05p37_81894_c1 | |||
| 2517 | nmdc:mga09592_98003_c1 | |||
| 2518 | nmdc:mga0qj67_20834_c1 | |||
| 2519 | nmdc:mga06r32_105647_c1 | |||
| 2520 | nmdc:mga06r32_16822_c1 | |||
| 2521 | nmdc:mga08y16_26370_c1 | |||
| 2522 | nmdc:mga08y16_27729_c1 | |||
| 2523 | nmdc:mga08y16_37172_c1 | |||
| 2524 | nmdc:mga08y16_470051_c1 | |||
| 2525 | nmdc:mga08y16_70851_c1 | |||
| 2526 | nmdc:mga08y16_71864_c1 | |||
| 2527 | nmdc:mga0n895_161179_c1 | |||
| 2528 | nmdc:mga0n895_245084_c1 | |||
| 2529 | nmdc:mga0n895_366073_c1 | |||
| 2530 | nmdc:mga0n895_39038_c1 | |||
| 2531 | nmdc:mga0n895_50222_c1 | |||
| 2532 | nmdc:mga0n895_838543_c1 | |||
| 2533 | nmdc:mga0rr50_11223_c1 | |||
| 2534 | nmdc:mga0rr50_295431_c1 | |||
| 2535 | nmdc:mga08x19_180488_c1 | |||
| 2536 | nmdc:mga08x19_62858_c1 | |||
| 2537 | nmdc:mga0a205_115469_c1 | |||
| 2538 | nmdc:mga0a205_137707_c1 | |||
| 2539 | nmdc:mga0a205_159635_c1 | |||
| 2540 | nmdc:mga0a205_197968_c1 | |||
| 2541 | nmdc:mga0a205_25714_c1 | |||
| 2542 | nmdc:mga0a205_89620_c1 | |||
| 2543 | nmdc:mga0sz30_18724_c1 | |||
| 2544 | Ga0495601_0020423 | |||
| 2545 | Ga0495601_0021938 | |||
| 2546 | Ga0495601_0041459 | |||
| 2547 | Ga0495601_0077649 | |||
| 2548 | Ga0495601_0098688 | |||
| 2549 | Ga0495601_0147676 | |||
| 2550 | Ga0495612_0002621 | |||
| 2551 | Ga0495612_0090587 | |||
| 2552 | Ga0495595_0005279 | |||
| 2553 | Ga0495595_0035215 | |||
| 2554 | Ga0495595_0042766 | |||
| 2555 | Ga0495595_0183883 | |||
| 2556 | Ga0495619_0004394 | |||
| 2557 | Ga0495619_0013127 | |||
| 2558 | Ga0495619_0017477 | |||
| 2559 | Ga0495619_0082854 | |||
| 2560 | Ga0495619_0087413 | |||
| 2561 | Ga0495619_0175685 | |||
| 2562 | Ga0495619_0234006 | |||
| 2563 | Ga0495619_0347781 | |||
| 2564 | Ga0501084_0005328 | |||
| 2565 | Ga0501084_0110156 | |||
| 2566 | Ga0501084_0136837 | |||
| 2567 | Ga0501084_0164692 | |||
| 2568 | Ga0501084_0191748 | |||
| 2569 | Ga0501084_0331625 | |||
| 2570 | Ga0501082_0006774 | |||
| 2571 | Ga0501082_0012448 | |||
| 2572 | Ga0501082_0034537 | |||
| 2573 | Ga0501082_0061051 | |||
| 2574 | Ga0501082_0324933 | |||
| 2575 | Ga0501082_0449104 | |||
| 2576 | Ga0466962_0018395 | |||
| 2577 | Ga0530510_0001773 | |||
| 2578 | Ga0530510_0021207 | |||
| 2579 | Ga0530510_0029823 | |||
| 2580 | Ga0530510_0071060 | |||
| 2581 | Ga0530510_0168454 | |||
| 2582 | 2753267114 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_D | mycobacterium smegmatis sugabc complex | 0.925 | 2 | 221 |
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.9237 | 2 | 218 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9231 | 1 | 221 |
| 8ja7-assembly1.cif.gz_D | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.9178 | 2 | 230 |
| 2it1-assembly1.cif.gz_B | structure of ph0203 protein from pyrococcus horikoshii | 0.9175 | 2 | 221 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8T6J0_514_774_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9344 | 2 | 221 | 3.40.50.300 |
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.931 | 2 | 233 | 3.40.50.300 |
| af_P0AAI1_7_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9304 | 2 | 218 | 3.40.50.300 |
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9284 | 2 | 217 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.927 | 2 | 217 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C4S8X1-F1-model_v4 | ABC transporter ATP-binding protein | 0.9605 | 2 | 233 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A512DTK1-F1-model_v4 | ABC transporter ATP-binding protein | 0.9577 | 2 | 236 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
| AF-A0A2R4M201-F1-model_v4 | ABC transporter ATP-binding protein | 0.9562 | 2 | 233 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
| AF-A0A0S8CEG3-F1-model_v4 | ABC transporter | 0.9512 | 1 | 233 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A5P9GIF8-F1-model_v4 | deleted | 0.9471 | 1 | 221 |
|