F492575

General Info

Members Datasets Scaffolds Average Seq Length
1285 269 1282 338

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100097524|Ga0068852_1000975243
Length 378
Sequence MNLQWPLLCHRVSFTVSDRVQAGLRTRRFSYRRSWPNRFAMHFLDQAKIYVKSGAGGPGAVSFRREKFIEFGGPDDVVFEAVPGLNTLIDFRYTQHFRAPRGKGGAGSNRTGAQGDDLIVKVPVGTQILADDDERTLLADLTEVGQQVTVLKGGLGGRGNASYKSSTNRAPRQHQTGEPGEELWVWLRLKLLADVGLLGLPNAGKSTFLNSVTNASAKVGDYPFTTLRPQLGVVRHKGREFVIADIPGLIEGAAEGAGIGDRFLGHVERTRVLLHLVDGSAEDPLEAWRIVRGELEGYGAGLTQKAEIVALTKADLLDDKQRAMIARALEKASGARVFPVSAPIEEGLDPLLDAIIERLGDAAGMVAETADEGRWSPL

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
3 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
207 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
208 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
209 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
210 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
211 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
212 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
221 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
268 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
269 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0.16
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 4.59
Rhizosphere 94.01
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004341 3300001904 Bacteria 2426
2 JGI24741J21665_1000961 3300001915 Bacteria 8667
3 JGI24752J21851_1003302 3300001976 Bacteria 2127
4 JGI24740J21852_10006220 3300001979 Bacteria 4968
5 JGI24740J21852_10008686 3300001979 Bacteria 4034
6 JGI24740J21852_10019709 3300001979 Bacteria 2370
7 JGI24740J21852_10028850 3300001979 Bacteria 1828
8 JGI24740J21852_10031289 3300001979 Bacteria 1718
9 JGI24739J22299_10000825 3300001989 Bacteria 11382
10 JGI24739J22299_10001423 3300001989 Bacteria 9016
11 JGI24739J22299_10004662 3300001989 Bacteria 5239
12 JGI24739J22299_10028247 3300001989 Bacteria 1957
13 JGI24737J22298_10002103 3300001990 Bacteria 7106
14 JGI24737J22298_10003000 3300001990 Bacteria 5984
15 JGI24743J22301_10015140 3300001991 Bacteria 1427
16 JGI24735J21928_10000320 3300002067 Bacteria 16683
17 JGI24735J21928_10001306 3300002067 Bacteria 8810
18 JGI24735J21928_10001365 3300002067 Bacteria 8644
19 JGI24735J21928_10002667 3300002067 Bacteria 6169
20 JGI24735J21928_10012561 3300002067 Bacteria 2675
21 JGI24735J21928_10013796 3300002067 Bacteria 2534
22 JGI24735J21928_10017202 3300002067 Bacteria 2236
23 JGI24738J21930_10001641 3300002075 Bacteria 6140
24 JGI24744J21845_10005497 3300002077 Bacteria 2621
25 Ga0055529_1009615 3300003763 Bacteria 1265
26 Ga0065704_10005136 3300005289 Bacteria 4587
27 Ga0065704_10120653 3300005289 Bacteria 1779
28 Ga0065715_10146087 3300005293 Bacteria 1787
29 Ga0065715_10162638 3300005293 Bacteria 1615
30 Ga0070658_10000238 3300005327 Bacteria 48804
31 Ga0070658_10000782 3300005327 Bacteria 27329
32 Ga0070658_10000957 3300005327 Bacteria 24684
33 Ga0070658_10001147 3300005327 Bacteria 22607
34 Ga0070658_10001533 3300005327 Bacteria 19572
35 Ga0070658_10002974 3300005327 Bacteria 14038
36 Ga0070658_10013316 3300005327 Bacteria 6600
37 Ga0070658_10017970 3300005327 Bacteria 5656
38 Ga0070658_10020042 3300005327 Bacteria 5357
39 Ga0070658_10027324 3300005327 Bacteria 4580
40 Ga0070676_10012447 3300005328 Bacteria 4645
41 Ga0070676_10035417 3300005328 Bacteria 2871
42 Ga0070683_100005307 3300005329 Bacteria 10738
43 Ga0070683_100009918 3300005329 Bacteria 8163
44 Ga0070683_100014032 3300005329 Bacteria 6997
45 Ga0070683_100019811 3300005329 Bacteria 5980
46 Ga0070683_100098166 3300005329 Bacteria 2756
47 Ga0070683_100136106 3300005329 Bacteria 2326
48 Ga0070690_100001926 3300005330 Bacteria 11028
49 Ga0070690_100109307 3300005330 Bacteria 1843
50 Ga0070670_100004030 3300005331 Bacteria 12267
51 Ga0070670_100011696 3300005331 Bacteria 7506
52 Ga0070670_100016696 3300005331 Bacteria 6301
53 Ga0070670_100020944 3300005331 Bacteria 5623
54 Ga0070670_100048629 3300005331 Bacteria 3649
55 Ga0070670_100059848 3300005331 Bacteria 3269
56 Ga0070670_100166223 3300005331 Bacteria 1913
57 Ga0070670_100174992 3300005331 Bacteria 1862
58 Ga0070677_10004371 3300005333 Bacteria 4609
59 Ga0070677_10011949 3300005333 Bacteria 3005
60 Ga0070677_10032535 3300005333 Bacteria 2001
61 Ga0068869_100166019 3300005334 Bacteria 1722
62 Ga0070666_10001345 3300005335 Bacteria 14906
63 Ga0070666_10009064 3300005335 Bacteria 6202
64 Ga0070666_10015889 3300005335 Bacteria 4808
65 Ga0070666_10087251 3300005335 Bacteria 2138
66 Ga0070680_100000229 3300005336 Bacteria 37007
67 Ga0070680_100008876 3300005336 Bacteria 7706
68 Ga0070680_100010106 3300005336 Bacteria 7275
69 Ga0070680_100054146 3300005336 Bacteria 3275
70 Ga0070680_100332480 3300005336 Bacteria 1290
71 Ga0070682_100024362 3300005337 Bacteria 3601
72 Ga0070682_100079506 3300005337 Bacteria 2118
73 Ga0068868_100011248 3300005338 Bacteria 6517
74 Ga0068868_100066750 3300005338 Bacteria 2861
75 Ga0070660_100000053 3300005339 Bacteria 67349
76 Ga0070660_100000534 3300005339 Bacteria 25407
77 Ga0070660_100004120 3300005339 Bacteria 10030
78 Ga0070660_100008891 3300005339 Bacteria 7043
79 Ga0070660_100010009 3300005339 Bacteria 6686
80 Ga0070660_100010530 3300005339 Bacteria 6533
81 Ga0070660_100011019 3300005339 Bacteria 6408
82 Ga0070660_100013486 3300005339 Bacteria 5864
83 Ga0070660_100014284 3300005339 Bacteria 5719
84 Ga0070660_100028551 3300005339 Bacteria 4175
85 Ga0070660_100040654 3300005339 Bacteria 3540
86 Ga0070660_100069953 3300005339 Bacteria 2738
87 Ga0070660_100075882 3300005339 Bacteria 2633
88 Ga0070660_100080669 3300005339 Bacteria 2553
89 Ga0070660_100110043 3300005339 Bacteria 2191
90 Ga0070660_100169544 3300005339 Bacteria 1762
91 Ga0070660_100262503 3300005339 Bacteria 1410
92 Ga0070691_10000118 3300005341 Bacteria 23914
93 Ga0070661_100000452 3300005344 Bacteria 31380
94 Ga0070661_100006277 3300005344 Bacteria 8201
95 Ga0070661_100008953 3300005344 Bacteria 6928
96 Ga0070661_100011742 3300005344 Bacteria 6111
97 Ga0070661_100011981 3300005344 Bacteria 6057
98 Ga0070661_100013519 3300005344 Bacteria 5732
99 Ga0070661_100024860 3300005344 Bacteria 4299
100 Ga0070661_100027204 3300005344 Bacteria 4117
101 Ga0070661_100029570 3300005344 Bacteria 3955
102 Ga0070661_100053868 3300005344 Bacteria 2946
103 Ga0070661_100082958 3300005344 Bacteria 2367
104 Ga0070661_100338134 3300005344 Bacteria 1179
105 Ga0070692_10005713 3300005345 Bacteria 5340
106 Ga0070692_10016886 3300005345 Bacteria 3479
107 Ga0070692_10017289 3300005345 Bacteria 3444
108 Ga0070668_100003251 3300005347 Bacteria 11982
109 Ga0070668_100374157 3300005347 Bacteria 1211
110 Ga0070669_100002131 3300005353 Bacteria 14306
111 Ga0070669_100077414 3300005353 Bacteria 2471
112 Ga0070675_100015582 3300005354 Bacteria 6014
113 Ga0070675_100016168 3300005354 Bacteria 5916
114 Ga0070675_100022594 3300005354 Bacteria 5026
115 Ga0070675_100038333 3300005354 Bacteria 3905
116 Ga0070675_100283449 3300005354 Bacteria 1456
117 Ga0070671_100000542 3300005355 Bacteria 26647
118 Ga0070671_100002744 3300005355 Bacteria 13674
119 Ga0070671_100002903 3300005355 Bacteria 13339
120 Ga0070671_100002919 3300005355 Bacteria 13293
121 Ga0070671_100006335 3300005355 Bacteria 9441
122 Ga0070671_100009383 3300005355 Bacteria 7857
123 Ga0070671_100012877 3300005355 Bacteria 6743
124 Ga0070671_100015529 3300005355 Bacteria 6154
125 Ga0070671_100017014 3300005355 Bacteria 5881
126 Ga0070671_100037543 3300005355 Bacteria 4017
127 Ga0070671_100040247 3300005355 Bacteria 3881
128 Ga0070671_100044926 3300005355 Bacteria 3671
129 Ga0070671_100054553 3300005355 Bacteria 3323
130 Ga0070671_100060096 3300005355 Bacteria 3164
131 Ga0070671_100063174 3300005355 Bacteria 3083
132 Ga0070674_100011307 3300005356 Bacteria 5430
133 Ga0070674_100031585 3300005356 Bacteria 3510
134 Ga0070674_100037679 3300005356 Bacteria 3254
135 Ga0070674_100060151 3300005356 Bacteria 2647
136 Ga0070673_100001831 3300005364 Bacteria 12708
137 Ga0070673_100003651 3300005364 Bacteria 9636
138 Ga0070673_100016867 3300005364 Bacteria 5178
139 Ga0070673_100020913 3300005364 Bacteria 4730
140 Ga0070673_100021972 3300005364 Bacteria 4637
141 Ga0070673_100068170 3300005364 Bacteria 2848
142 Ga0070673_100069701 3300005364 Bacteria 2819
143 Ga0070673_100089440 3300005364 Bacteria 2513
144 Ga0070673_100097596 3300005364 Bacteria 2413
145 Ga0070673_100525271 3300005364 Bacteria 1073
146 Ga0070659_100000138 3300005366 Bacteria 56073
147 Ga0070659_100002092 3300005366 Bacteria 14226
148 Ga0070659_100004893 3300005366 Bacteria 9574
149 Ga0070659_100010299 3300005366 Bacteria 6875
150 Ga0070659_100017039 3300005366 Bacteria 5461
151 Ga0070659_100017588 3300005366 Bacteria 5385
152 Ga0070659_100023598 3300005366 Bacteria 4709
153 Ga0070659_100032994 3300005366 Bacteria 4021
154 Ga0070659_100046376 3300005366 Bacteria 3407
155 Ga0070659_100047838 3300005366 Bacteria 3357
156 Ga0070659_100109271 3300005366 Bacteria 2232
157 Ga0070659_100196694 3300005366 Bacteria 1658
158 Ga0070659_100203066 3300005366 Bacteria 1632
159 Ga0070667_100002750 3300005367 Bacteria 15219
160 Ga0070667_100005263 3300005367 Bacteria 10820
161 Ga0070667_100006461 3300005367 Bacteria 9746
162 Ga0070667_100007891 3300005367 Bacteria 8831
163 Ga0070667_100021539 3300005367 Bacteria 5351
164 Ga0070667_100023633 3300005367 Bacteria 5101
165 Ga0070667_100026628 3300005367 Bacteria 4810
166 Ga0070667_100064793 3300005367 Bacteria 3101
167 Ga0070667_100067637 3300005367 Bacteria 3038
168 Ga0070667_100170167 3300005367 Bacteria 1923
169 Ga0070667_100211195 3300005367 Bacteria 1725
170 Ga0070667_100318342 3300005367 Bacteria 1403
171 Ga0070667_100347831 3300005367 Bacteria 1342
172 Ga0070709_10010172 3300005434 Bacteria 5198
173 Ga0070714_100023984 3300005435 Bacteria 5018
174 Ga0070714_100049345 3300005435 Bacteria 3582
175 Ga0070714_100055937 3300005435 Bacteria 3373
176 Ga0070714_100177934 3300005435 Bacteria 1934
177 Ga0070713_100013582 3300005436 Bacteria 6020
178 Ga0070713_100188435 3300005436 Bacteria 1858
179 Ga0070694_100042714 3300005444 Bacteria 3029
180 Ga0070708_100072299 3300005445 Bacteria 3107
181 Ga0070663_100001141 3300005455 Bacteria 14636
182 Ga0070663_100002890 3300005455 Bacteria 9769
183 Ga0070663_100009681 3300005455 Bacteria 5977
184 Ga0070663_100041411 3300005455 Bacteria 3230
185 Ga0070663_100097752 3300005455 Bacteria 2186
186 Ga0070663_100291926 3300005455 Bacteria 1303
187 Ga0070678_100012555 3300005456 Bacteria 5274
188 Ga0070678_100014954 3300005456 Bacteria 4916
189 Ga0070678_100031371 3300005456 Bacteria 3665
190 Ga0070678_100062050 3300005456 Bacteria 2758
191 Ga0070662_100000410 3300005457 Bacteria 25434
192 Ga0070662_100007245 3300005457 Bacteria 7189
193 Ga0070662_100012337 3300005457 Bacteria 5665
194 Ga0070662_100013436 3300005457 Bacteria 5450
195 Ga0070662_100014633 3300005457 Bacteria 5246
196 Ga0070662_100021934 3300005457 Bacteria 4365
197 Ga0070662_100032906 3300005457 Bacteria 3648
198 Ga0070662_100044517 3300005457 Bacteria 3179
199 Ga0070681_10108684 3300005458 Bacteria 2714
200 Ga0070681_10176673 3300005458 Bacteria 2057
201 Ga0068867_100003061 3300005459 Bacteria 11788
202 Ga0068867_100003944 3300005459 Bacteria 10437
203 Ga0068867_100007513 3300005459 Bacteria 7706
204 Ga0068867_100029300 3300005459 Bacteria 3966
205 Ga0068867_100079191 3300005459 Bacteria 2473
206 Ga0070679_100013487 3300005530 Bacteria 7826
207 Ga0070679_100019754 3300005530 Bacteria 6558
208 Ga0070679_100111724 3300005530 Bacteria 2719
209 Ga0070679_100412459 3300005530 Bacteria 1296
210 Ga0070684_100005736 3300005535 Bacteria 9542
211 Ga0070684_100035436 3300005535 Bacteria 4270
212 Ga0070684_100120076 3300005535 Bacteria 2364
213 Ga0070684_100145318 3300005535 Bacteria 2146
214 Ga0068853_100000479 3300005539 Bacteria 27267
215 Ga0068853_100004583 3300005539 Bacteria 10721
216 Ga0068853_100008492 3300005539 Bacteria 8254
217 Ga0068853_100011550 3300005539 Bacteria 7179
218 Ga0068853_100017832 3300005539 Bacteria 5863
219 Ga0068853_100041294 3300005539 Bacteria 3939
220 Ga0068853_100046921 3300005539 Bacteria 3706
221 Ga0068853_100075540 3300005539 Bacteria 2941
222 Ga0068853_100194512 3300005539 Bacteria 1844
223 Ga0070672_100002396 3300005543 Bacteria 11865
224 Ga0070672_100016832 3300005543 Bacteria 5244
225 Ga0070672_100017176 3300005543 Bacteria 5203
226 Ga0070672_100029584 3300005543 Bacteria 4109
227 Ga0070672_100139864 3300005543 Bacteria 1996
228 Ga0070686_100010217 3300005544 Bacteria 5284
229 Ga0070693_100137879 3300005547 Bacteria 1532
230 Ga0070693_100149994 3300005547 Bacteria 1476
231 Ga0070665_100001356 3300005548 Bacteria 28943
232 Ga0070665_100005224 3300005548 Bacteria 13434
233 Ga0070665_100012118 3300005548 Bacteria 8699
234 Ga0070665_100016583 3300005548 Bacteria 7385
235 Ga0070665_100022459 3300005548 Bacteria 6350
236 Ga0070665_100025182 3300005548 Bacteria 5995
237 Ga0070665_100025694 3300005548 Bacteria 5932
238 Ga0070665_100079356 3300005548 Bacteria 3288
239 Ga0070665_100081552 3300005548 Bacteria 3240
240 Ga0068855_100000163 3300005563 Bacteria 85587
241 Ga0068855_100000433 3300005563 Bacteria 51890
242 Ga0068855_100009211 3300005563 Bacteria 11925
243 Ga0068855_100056328 3300005563 Bacteria 4613
244 Ga0068855_100070038 3300005563 Bacteria 4081
245 Ga0068855_100096072 3300005563 Bacteria 3415
246 Ga0068855_100102095 3300005563 Bacteria 3301
247 Ga0068855_100221271 3300005563 Bacteria 2122
248 Ga0070664_100000717 3300005564 Bacteria 25407
249 Ga0070664_100004456 3300005564 Bacteria 11247
250 Ga0070664_100005094 3300005564 Bacteria 10541
251 Ga0070664_100008923 3300005564 Bacteria 8128
252 Ga0070664_100010793 3300005564 Bacteria 7408
253 Ga0070664_100016944 3300005564 Bacteria 5979
254 Ga0070664_100026793 3300005564 Bacteria 4786
255 Ga0070664_100033819 3300005564 Bacteria 4285
256 Ga0070664_100038286 3300005564 Bacteria 4036
257 Ga0070664_100044660 3300005564 Bacteria 3741
258 Ga0070664_100053026 3300005564 Bacteria 3436
259 Ga0070664_100165255 3300005564 Bacteria 1960
260 Ga0068857_100005963 3300005577 Bacteria 10408
261 Ga0068857_100011040 3300005577 Bacteria 7861
262 Ga0068857_100017383 3300005577 Bacteria 6301
263 Ga0068857_100021781 3300005577 Bacteria 5640
264 Ga0068857_100033659 3300005577 Bacteria 4532
265 Ga0068857_100130965 3300005577 Bacteria 2262
266 Ga0068857_100299253 3300005577 Bacteria 1483
267 Ga0068857_100308931 3300005577 Bacteria 1458
268 Ga0068854_100000271 3300005578 Bacteria 34948
269 Ga0068854_100000364 3300005578 Bacteria 28993
270 Ga0068854_100000908 3300005578 Bacteria 17823
271 Ga0068854_100004748 3300005578 Bacteria 8568
272 Ga0068854_100014328 3300005578 Bacteria 5224
273 Ga0068854_100018382 3300005578 Bacteria 4691
274 Ga0068854_100054560 3300005578 Bacteria 2875
275 Ga0068854_100090933 3300005578 Bacteria 2270
276 Ga0068854_100214067 3300005578 Bacteria 1521
277 Ga0068856_100000829 3300005614 Bacteria 33313
278 Ga0068856_100004665 3300005614 Bacteria 13611
279 Ga0068856_100012320 3300005614 Bacteria 8280
280 Ga0068856_100016277 3300005614 Bacteria 7195
281 Ga0068856_100020327 3300005614 Bacteria 6449
282 Ga0068856_100021805 3300005614 Bacteria 6226
283 Ga0068856_100246069 3300005614 Bacteria 1803
284 Ga0068856_100378907 3300005614 Bacteria 1434
285 Ga0068852_100000873 3300005616 Bacteria 19972
286 Ga0068852_100001950 3300005616 Bacteria 14049
287 Ga0068852_100002264 3300005616 Bacteria 13216
288 Ga0068852_100004060 3300005616 Bacteria 10301
289 Ga0068852_100004104 3300005616 Bacteria 10251
290 Ga0068852_100004435 3300005616 Bacteria 9921
291 Ga0068852_100013117 3300005616 Bacteria 6331
292 Ga0068852_100013554 3300005616 Bacteria 6240
293 Ga0068852_100019523 3300005616 Bacteria 5366
294 Ga0068852_100053370 3300005616 Bacteria 3479
295 Ga0068852_100067182 3300005616 Bacteria 3134
296 Ga0068852_100071261 3300005616 Bacteria 3051
297 Ga0068852_100097524 3300005616 Bacteria 2645
298 Ga0068852_100105081 3300005616 Bacteria 2558
299 Ga0068859_100006555 3300005617 Bacteria 11817
300 Ga0068859_100028314 3300005617 Bacteria 5617
301 Ga0068859_100041221 3300005617 Bacteria 4638
302 Ga0068859_100049792 3300005617 Bacteria 4208
303 Ga0068859_100099988 3300005617 Bacteria 2956
304 Ga0068859_100111924 3300005617 Bacteria 2793
305 Ga0068864_100000311 3300005618 Bacteria 42930
306 Ga0068864_100000557 3300005618 Bacteria 31825
307 Ga0068864_100001679 3300005618 Bacteria 18210
308 Ga0068864_100010914 3300005618 Bacteria 7511
309 Ga0068864_100011375 3300005618 Bacteria 7353
310 Ga0068864_100013559 3300005618 Bacteria 6758
311 Ga0068864_100020340 3300005618 Bacteria 5553
312 Ga0068864_100116610 3300005618 Bacteria 2383
313 Ga0068866_10004596 3300005718 Bacteria 5658
314 Ga0068861_100036059 3300005719 Bacteria 3668
315 Ga0068851_10040523 3300005834 Bacteria 2341
316 Ga0068851_10047018 3300005834 Bacteria 2184
317 Ga0068851_10084982 3300005834 Bacteria 1658
318 Ga0068870_10155036 3300005840 Bacteria 1353
319 Ga0068863_100000569 3300005841 Bacteria 37520
320 Ga0068863_100010358 3300005841 Bacteria 9058
321 Ga0068863_100010532 3300005841 Bacteria 8979
322 Ga0068863_100019112 3300005841 Bacteria 6558
323 Ga0068863_100033280 3300005841 Bacteria 4910
324 Ga0068863_100055894 3300005841 Bacteria 3737
325 Ga0068863_100060742 3300005841 Bacteria 3574
326 Ga0068863_100064562 3300005841 Bacteria 3462
327 Ga0068863_100128884 3300005841 Bacteria 2415
328 Ga0068858_100000604 3300005842 Bacteria 37527
329 Ga0068858_100005894 3300005842 Bacteria 11961
330 Ga0068858_100013497 3300005842 Bacteria 7708
331 Ga0068858_100019228 3300005842 Bacteria 6387
332 Ga0068858_100019265 3300005842 Bacteria 6381
333 Ga0068858_100020598 3300005842 Bacteria 6161
334 Ga0068858_100086175 3300005842 Bacteria 2922
335 Ga0068858_100203754 3300005842 Bacteria 1871
336 Ga0068858_100398112 3300005842 Bacteria 1323
337 Ga0068860_100004166 3300005843 Bacteria 14825
338 Ga0068860_100007782 3300005843 Bacteria 10703
339 Ga0068860_100012161 3300005843 Bacteria 8478
340 Ga0068860_100045493 3300005843 Bacteria 4186
341 Ga0068860_100055557 3300005843 Bacteria 3764
342 Ga0068860_100123142 3300005843 Bacteria 2484
343 Ga0068862_100004348 3300005844 Bacteria 11991
344 Ga0068862_100005678 3300005844 Bacteria 10412
345 Ga0068862_100007390 3300005844 Bacteria 9110
346 Ga0068862_100018824 3300005844 Bacteria 5754
347 Ga0068862_100034179 3300005844 Bacteria 4300
348 Ga0081539_10048860 3300005985 Bacteria 2404
349 Ga0081539_10048975 3300005985 Bacteria 2400
350 Ga0070717_10052082 3300006028 Bacteria 3371
351 Ga0070717_10202408 3300006028 Bacteria 1739
352 Ga0070712_100024698 3300006175 Bacteria 3986
353 Ga0070712_100041064 3300006175 Bacteria 3174
354 Ga0097621_100004538 3300006237 Bacteria 9683
355 Ga0097621_100048548 3300006237 Bacteria 3444
356 Ga0097621_100052299 3300006237 Bacteria 3327
357 Ga0068871_100006035 3300006358 Bacteria 8526
358 Ga0068871_100015991 3300006358 Bacteria 5636
359 Ga0068871_100025989 3300006358 Bacteria 4563
360 Ga0075433_10005617 3300006852 Bacteria 9859
361 Ga0068865_100001641 3300006881 Bacteria 13103
362 Ga0068865_100015125 3300006881 Bacteria 4916
363 Ga0068865_100115149 3300006881 Bacteria 1989
364 Ga0097620_100006555 3300006931 Bacteria 11817
365 Ga0097620_100028315 3300006931 Bacteria 5617
366 Ga0097620_100041219 3300006931 Bacteria 4638
367 Ga0097620_100049789 3300006931 Bacteria 4208
368 Ga0097620_100099989 3300006931 Bacteria 2956
369 Ga0097620_100111921 3300006931 Bacteria 2793
370 Ga0105251_10001861 3300009011 Bacteria 17335
371 Ga0105250_10029582 3300009092 Bacteria 2203
372 Ga0105240_10019270 3300009093 Bacteria 9119
373 Ga0105240_10074433 3300009093 Bacteria 4192
374 Ga0105240_10089015 3300009093 Bacteria 3776
375 Ga0105240_10143006 3300009093 Bacteria 2858
376 Ga0105240_10242870 3300009093 Bacteria 2087
377 Ga0105245_10028834 3300009098 Bacteria 4899
378 Ga0105243_10006820 3300009148 Bacteria 8803
379 Ga0105243_10060263 3300009148 Bacteria 3032
380 Ga0105241_10008936 3300009174 Bacteria 7368
381 Ga0105241_10268400 3300009174 Bacteria 1453
382 Ga0105242_10029141 3300009176 Bacteria 4401
383 Ga0105248_10000070 3300009177 Bacteria 119985
384 Ga0105248_10000802 3300009177 Bacteria 35320
385 Ga0105248_10001737 3300009177 Bacteria 24220
386 Ga0105248_10002097 3300009177 Bacteria 22084
387 Ga0105248_10003700 3300009177 Bacteria 16941
388 Ga0105248_10007459 3300009177 Bacteria 12000
389 Ga0105248_10012039 3300009177 Bacteria 9540
390 Ga0105248_10013528 3300009177 Bacteria 8982
391 Ga0105248_10015899 3300009177 Bacteria 8288
392 Ga0105248_10020775 3300009177 Bacteria 7274
393 Ga0105248_10048183 3300009177 Bacteria 4779
394 Ga0105248_10053952 3300009177 Bacteria 4509
395 Ga0105248_10125364 3300009177 Bacteria 2897
396 Ga0105248_10205228 3300009177 Bacteria 2221
397 Ga0105248_10428093 3300009177 Bacteria 1490
398 Ga0105237_10066711 3300009545 Bacteria 3593
399 Ga0105237_10127383 3300009545 Bacteria 2540
400 Ga0105238_10037875 3300009551 Bacteria 4900
401 Ga0105238_10047479 3300009551 Bacteria 4329
402 Ga0105238_10050824 3300009551 Bacteria 4172
403 Ga0105249_10209952 3300009553 Bacteria 1910
404 Ga0105249_10591444 3300009553 Bacteria 1164
405 Ga0105239_10038545 3300010375 Bacteria 5237
406 Ga0105239_10045932 3300010375 Bacteria 4786
407 Ga0105239_10210519 3300010375 Bacteria 2179
408 Ga0105239_10555535 3300010375 Bacteria 1308
409 Ga0105246_10108278 3300011119 Bacteria 2037
410 Ga0157373_10002817 3300013100 Bacteria 13149
411 Ga0157373_10004924 3300013100 Bacteria 10054
412 Ga0157373_10009328 3300013100 Bacteria 7252
413 Ga0157373_10013639 3300013100 Bacteria 5960
414 Ga0157373_10015756 3300013100 Bacteria 5521
415 Ga0157373_10051125 3300013100 Bacteria 2943
416 Ga0157373_10105471 3300013100 Bacteria 1982
417 Ga0157371_10000468 3300013102 Bacteria 49508
418 Ga0157371_10000784 3300013102 Bacteria 36573
419 Ga0157371_10002874 3300013102 Bacteria 16096
420 Ga0157371_10007318 3300013102 Bacteria 8961
421 Ga0157371_10018346 3300013102 Bacteria 5175
422 Ga0157371_10078007 3300013102 Bacteria 2346
423 Ga0157371_10140823 3300013102 Bacteria 1718
424 Ga0157371_10185431 3300013102 Bacteria 1489
425 Ga0157371_10203645 3300013102 Bacteria 1419
426 Ga0157371_10225770 3300013102 Bacteria 1345
427 Ga0157370_10006961 3300013104 Bacteria 12353
428 Ga0157370_10046717 3300013104 Bacteria 4151
429 Ga0157370_10064789 3300013104 Bacteria 3458
430 Ga0157370_10087055 3300013104 Bacteria 2934
431 Ga0157370_10108344 3300013104 Bacteria 2598
432 Ga0157370_10153698 3300013104 Bacteria 2141
433 Ga0157370_10278255 3300013104 Bacteria 1546
434 Ga0157370_10328087 3300013104 Bacteria 1411
435 Ga0157369_10000751 3300013105 Bacteria 41778
436 Ga0157369_10001571 3300013105 Bacteria 27954
437 Ga0157369_10005745 3300013105 Bacteria 14419
438 Ga0157369_10011938 3300013105 Bacteria 9867
439 Ga0157369_10032891 3300013105 Bacteria 5700
440 Ga0157369_10035299 3300013105 Bacteria 5484
441 Ga0157369_10035819 3300013105 Bacteria 5441
442 Ga0157369_10058213 3300013105 Bacteria 4168
443 Ga0157374_10004363 3300013296 Bacteria 11905
444 Ga0157374_10017249 3300013296 Bacteria 6356
445 Ga0157374_10042657 3300013296 Bacteria 4186
446 Ga0157374_10042823 3300013296 Bacteria 4179
447 Ga0157374_10053776 3300013296 Bacteria 3754
448 Ga0157374_10089932 3300013296 Bacteria 2926
449 Ga0157378_10052515 3300013297 Bacteria 3626
450 Ga0157378_10298766 3300013297 Bacteria 1558
451 Ga0157378_10630315 3300013297 Bacteria 1086
452 Ga0163162_10001484 3300013306 Bacteria 21851
453 Ga0163162_10043705 3300013306 Bacteria 4486
454 Ga0163162_10104977 3300013306 Bacteria 2920
455 Ga0157372_10004158 3300013307 Bacteria 15488
456 Ga0157372_10032860 3300013307 Bacteria 5693
457 Ga0157372_10048417 3300013307 Bacteria 4725
458 Ga0157372_10111058 3300013307 Bacteria 3140
459 Ga0157372_10116399 3300013307 Bacteria 3065
460 Ga0157372_10308572 3300013307 Bacteria 1841
461 Ga0157372_10782227 3300013307 Bacteria 1109
462 Ga0157375_10000751 3300013308 Bacteria 28432
463 Ga0157375_10004010 3300013308 Bacteria 12774
464 Ga0157375_10046294 3300013308 Bacteria 4239
465 Ga0157375_10211040 3300013308 Bacteria 2099
466 Ga0163163_10000135 3300014325 Bacteria 75904
467 Ga0163163_10004685 3300014325 Bacteria 11706
468 Ga0163163_10051578 3300014325 Bacteria 4056
469 Ga0163163_10069868 3300014325 Bacteria 3497
470 Ga0163163_10220364 3300014325 Bacteria 1946
471 Ga0157380_10001109 3300014326 Bacteria 17364
472 Ga0157380_10140967 3300014326 Bacteria 2071
473 Ga0157377_10040466 3300014745 Bacteria 2581
474 Ga0157379_10010929 3300014968 Bacteria 7914
475 Ga0157379_10039774 3300014968 Bacteria 4195
476 Ga0157379_10044418 3300014968 Bacteria 3967
477 Ga0157376_10013070 3300014969 Bacteria 6183
478 Ga0157376_10596950 3300014969 Bacteria 1098
479 Ga0163161_10137072 3300017792 Bacteria 1851
480 Ga0206354_10880722 3300020081 Bacteria 3240
481 Ga0206353_10897051 3300020082 Bacteria 2230
482 Ga0213875_10003385 3300021388 Bacteria 9085
483 Ga0213875_10010457 3300021388 Bacteria 4642
484 Ga0209677_104116 3300025253 Bacteria 4355
485 Ga0209455_1000908 3300025272 Bacteria 15432
486 Ga0207697_10011736 3300025315 Bacteria 3698
487 Ga0207656_10027625 3300025321 Bacteria 2322
488 Ga0207713_1002460 3300025735 Bacteria 13462
489 Ga0207682_10001093 3300025893 Bacteria 12530
490 Ga0207682_10023066 3300025893 Bacteria 2457
491 Ga0207682_10034898 3300025893 Bacteria 2030
492 Ga0207688_10029771 3300025901 Bacteria 3008
493 Ga0207680_10000501 3300025903 Bacteria 18664
494 Ga0207680_10003501 3300025903 Bacteria 7397
495 Ga0207680_10007186 3300025903 Bacteria 5414
496 Ga0207680_10017920 3300025903 Bacteria 3750
497 Ga0207647_10000875 3300025904 Bacteria 23349
498 Ga0207647_10000915 3300025904 Bacteria 22771
499 Ga0207647_10002329 3300025904 Bacteria 14424
500 Ga0207647_10004732 3300025904 Bacteria 10081
501 Ga0207647_10010454 3300025904 Bacteria 6556
502 Ga0207647_10013857 3300025904 Bacteria 5582
503 Ga0207647_10017025 3300025904 Bacteria 4948
504 Ga0207647_10029228 3300025904 Bacteria 3569
505 Ga0207645_10010829 3300025907 Bacteria 6249
506 Ga0207645_10021229 3300025907 Bacteria 4237
507 Ga0207705_10000014 3300025909 Bacteria 434286
508 Ga0207705_10000033 3300025909 Bacteria 223997
509 Ga0207705_10000082 3300025909 Bacteria 118194
510 Ga0207705_10000260 3300025909 Bacteria 51366
511 Ga0207705_10000577 3300025909 Bacteria 30703
512 Ga0207705_10004869 3300025909 Bacteria 10074
513 Ga0207705_10005507 3300025909 Bacteria 9468
514 Ga0207705_10009845 3300025909 Bacteria 6957
515 Ga0207705_10012543 3300025909 Bacteria 6116
516 Ga0207705_10014786 3300025909 Bacteria 5612
517 Ga0207705_10016087 3300025909 Bacteria 5368
518 Ga0207705_10018487 3300025909 Bacteria 4983
519 Ga0207705_10028066 3300025909 Bacteria 4013
520 Ga0207705_10035158 3300025909 Bacteria 3584
521 Ga0207705_10043088 3300025909 Bacteria 3241
522 Ga0207705_10045363 3300025909 Bacteria 3159
523 Ga0207705_10061545 3300025909 Bacteria 2711
524 Ga0207705_10123385 3300025909 Bacteria 1924
525 Ga0207705_10129113 3300025909 Bacteria 1880
526 Ga0207705_10176731 3300025909 Bacteria 1610
527 Ga0207705_10195509 3300025909 Bacteria 1531
528 Ga0207654_10009903 3300025911 Bacteria 4846
529 Ga0207654_10044933 3300025911 Bacteria 2512
530 Ga0207707_10050410 3300025912 Bacteria 3626
531 Ga0207707_10074581 3300025912 Bacteria 2959
532 Ga0207707_10089582 3300025912 Bacteria 2689
533 Ga0207695_10007084 3300025913 Bacteria 14369
534 Ga0207695_10007367 3300025913 Bacteria 14042
535 Ga0207695_10021886 3300025913 Bacteria 7278
536 Ga0207695_10137843 3300025913 Bacteria 2392
537 Ga0207695_10175518 3300025913 Bacteria 2065
538 Ga0207695_10256062 3300025913 Bacteria 1649
539 Ga0207695_10288616 3300025913 Bacteria 1533
540 Ga0207671_10065427 3300025914 Bacteria 2704
541 Ga0207671_10077310 3300025914 Bacteria 2491
542 Ga0207671_10094451 3300025914 Bacteria 2257
543 Ga0207693_10012967 3300025915 Bacteria 6724
544 Ga0207693_10108000 3300025915 Bacteria 2183
545 Ga0207660_10000059 3300025917 Bacteria 56766
546 Ga0207660_10000092 3300025917 Bacteria 48931
547 Ga0207660_10004148 3300025917 Bacteria 9427
548 Ga0207660_10007383 3300025917 Bacteria 7112
549 Ga0207660_10009852 3300025917 Bacteria 6188
550 Ga0207660_10033852 3300025917 Bacteria 3538
551 Ga0207662_10091000 3300025918 Bacteria 1876
552 Ga0207657_10000031 3300025919 Bacteria 132167
553 Ga0207657_10000058 3300025919 Bacteria 103811
554 Ga0207657_10000088 3300025919 Bacteria 88065
555 Ga0207657_10001070 3300025919 Bacteria 28973
556 Ga0207657_10002036 3300025919 Bacteria 21865
557 Ga0207657_10004476 3300025919 Bacteria 14778
558 Ga0207657_10004712 3300025919 Bacteria 14390
559 Ga0207657_10004813 3300025919 Bacteria 14228
560 Ga0207657_10004911 3300025919 Bacteria 14062
561 Ga0207657_10006226 3300025919 Bacteria 12402
562 Ga0207657_10007897 3300025919 Bacteria 10854
563 Ga0207657_10012446 3300025919 Bacteria 8402
564 Ga0207657_10013889 3300025919 Bacteria 7880
565 Ga0207657_10014514 3300025919 Bacteria 7683
566 Ga0207657_10014912 3300025919 Bacteria 7556
567 Ga0207657_10015822 3300025919 Bacteria 7290
568 Ga0207657_10019948 3300025919 Bacteria 6351
569 Ga0207657_10025805 3300025919 Bacteria 5412
570 Ga0207657_10044980 3300025919 Bacteria 3878
571 Ga0207657_10053463 3300025919 Bacteria 3499
572 Ga0207657_10069898 3300025919 Bacteria 2977
573 Ga0207657_10114137 3300025919 Bacteria 2228
574 Ga0207657_10189663 3300025919 Bacteria 1659
575 Ga0207649_10000394 3300025920 Bacteria 32788
576 Ga0207649_10001175 3300025920 Bacteria 15781
577 Ga0207649_10007520 3300025920 Bacteria 5921
578 Ga0207649_10015333 3300025920 Bacteria 4307
579 Ga0207649_10019524 3300025920 Bacteria 3873
580 Ga0207649_10041415 3300025920 Bacteria 2803
581 Ga0207649_10097967 3300025920 Bacteria 1934
582 Ga0207649_10216004 3300025920 Bacteria 1363
583 Ga0207649_10263722 3300025920 Bacteria 1246
584 Ga0207652_10003128 3300025921 Bacteria 13802
585 Ga0207652_10045658 3300025921 Bacteria 3735
586 Ga0207652_10087646 3300025921 Bacteria 2730
587 Ga0207652_10158797 3300025921 Bacteria 2026
588 Ga0207652_10322393 3300025921 Bacteria 1395
589 Ga0207681_10000503 3300025923 Bacteria 27243
590 Ga0207681_10032228 3300025923 Bacteria 3430
591 Ga0207681_10039364 3300025923 Bacteria 3138
592 Ga0207681_10072099 3300025923 Bacteria 2411
593 Ga0207694_10009197 3300025924 Bacteria 7455
594 Ga0207694_10026872 3300025924 Bacteria 4383
595 Ga0207694_10052004 3300025924 Bacteria 3175
596 Ga0207694_10107207 3300025924 Bacteria 2219
597 Ga0207694_10252964 3300025924 Bacteria 1442
598 Ga0207650_10002135 3300025925 Bacteria 13824
599 Ga0207650_10010159 3300025925 Bacteria 6450
600 Ga0207650_10015959 3300025925 Bacteria 5239
601 Ga0207650_10067694 3300025925 Bacteria 2680
602 Ga0207650_10070685 3300025925 Bacteria 2624
603 Ga0207650_10075786 3300025925 Bacteria 2540
604 Ga0207650_10084213 3300025925 Bacteria 2417
605 Ga0207650_10108159 3300025925 Bacteria 2149
606 Ga0207650_10164804 3300025925 Bacteria 1758
607 Ga0207650_10236069 3300025925 Bacteria 1476
608 Ga0207659_10003563 3300025926 Bacteria 9370
609 Ga0207659_10018715 3300025926 Bacteria 4544
610 Ga0207659_10028571 3300025926 Bacteria 3792
611 Ga0207659_10054659 3300025926 Bacteria 2852
612 Ga0207659_10103953 3300025926 Bacteria 2147
613 Ga0207659_10253790 3300025926 Bacteria 1428
614 Ga0207687_10034329 3300025927 Bacteria 3444
615 Ga0207687_10083158 3300025927 Bacteria 2317
616 Ga0207700_10161974 3300025928 Bacteria 1858
617 Ga0207664_10112282 3300025929 Bacteria 2268
618 Ga0207664_10156180 3300025929 Bacteria 1942
619 Ga0207644_10000541 3300025931 Bacteria 24562
620 Ga0207644_10001058 3300025931 Bacteria 17593
621 Ga0207644_10001520 3300025931 Bacteria 14966
622 Ga0207644_10001995 3300025931 Bacteria 13214
623 Ga0207644_10002370 3300025931 Bacteria 12164
624 Ga0207644_10005246 3300025931 Bacteria 8458
625 Ga0207644_10005523 3300025931 Bacteria 8230
626 Ga0207644_10010392 3300025931 Bacteria 6132
627 Ga0207644_10025135 3300025931 Bacteria 4093
628 Ga0207644_10028706 3300025931 Bacteria 3855
629 Ga0207644_10035156 3300025931 Bacteria 3509
630 Ga0207644_10086671 3300025931 Bacteria 2325
631 Ga0207644_10147737 3300025931 Bacteria 1816
632 Ga0207690_10002027 3300025932 Bacteria 12421
633 Ga0207690_10002623 3300025932 Bacteria 10829
634 Ga0207690_10003027 3300025932 Bacteria 10115
635 Ga0207690_10004603 3300025932 Bacteria 8155
636 Ga0207690_10010002 3300025932 Bacteria 5634
637 Ga0207690_10012158 3300025932 Bacteria 5150
638 Ga0207690_10016089 3300025932 Bacteria 4547
639 Ga0207690_10029733 3300025932 Bacteria 3477
640 Ga0207690_10032577 3300025932 Bacteria 3345
641 Ga0207690_10036510 3300025932 Bacteria 3182
642 Ga0207690_10046276 3300025932 Bacteria 2880
643 Ga0207690_10077269 3300025932 Bacteria 2314
644 Ga0207690_10126260 3300025932 Bacteria 1866
645 Ga0207690_10189356 3300025932 Bacteria 1555
646 Ga0207690_10218082 3300025932 Bacteria 1458
647 Ga0207690_10283812 3300025932 Bacteria 1290
648 Ga0207706_10000028 3300025933 Bacteria 149092
649 Ga0207706_10001051 3300025933 Bacteria 28061
650 Ga0207706_10001436 3300025933 Bacteria 23850
651 Ga0207706_10005306 3300025933 Bacteria 12012
652 Ga0207706_10018472 3300025933 Bacteria 6273
653 Ga0207706_10019538 3300025933 Bacteria 6094
654 Ga0207706_10028855 3300025933 Bacteria 4953
655 Ga0207706_10030900 3300025933 Bacteria 4776
656 Ga0207706_10031729 3300025933 Bacteria 4705
657 Ga0207706_10032720 3300025933 Bacteria 4629
658 Ga0207706_10039615 3300025933 Bacteria 4178
659 Ga0207706_10071593 3300025933 Bacteria 3049
660 Ga0207706_10071883 3300025933 Bacteria 3043
661 Ga0207706_10090600 3300025933 Bacteria 2689
662 Ga0207706_10113776 3300025933 Bacteria 2380
663 Ga0207686_10044231 3300025934 Bacteria 2733
664 Ga0207669_10006239 3300025937 Bacteria 5431
665 Ga0207669_10064216 3300025937 Bacteria 2271
666 Ga0207669_10150703 3300025937 Bacteria 1628
667 Ga0207669_10236071 3300025937 Bacteria 1352
668 Ga0207704_10028315 3300025938 Bacteria 3106
669 Ga0207704_10036410 3300025938 Bacteria 2831
670 Ga0207704_10070397 3300025938 Bacteria 2215
671 Ga0207704_10140883 3300025938 Bacteria 1687
672 Ga0207704_10190757 3300025938 Bacteria 1491
673 Ga0207665_10087271 3300025939 Bacteria 2156
674 Ga0207691_10000954 3300025940 Bacteria 28639
675 Ga0207691_10012339 3300025940 Bacteria 8190
676 Ga0207691_10017590 3300025940 Bacteria 6775
677 Ga0207691_10041017 3300025940 Bacteria 4276
678 Ga0207691_10042968 3300025940 Bacteria 4166
679 Ga0207691_10139845 3300025940 Bacteria 2134
680 Ga0207691_10233250 3300025940 Bacteria 1593
681 Ga0207711_10000051 3300025941 Bacteria 140854
682 Ga0207711_10000055 3300025941 Bacteria 136126
683 Ga0207711_10002363 3300025941 Bacteria 16902
684 Ga0207711_10002646 3300025941 Bacteria 15840
685 Ga0207711_10003160 3300025941 Bacteria 14356
686 Ga0207711_10003374 3300025941 Bacteria 13834
687 Ga0207711_10003778 3300025941 Bacteria 13042
688 Ga0207711_10006230 3300025941 Bacteria 10071
689 Ga0207711_10010014 3300025941 Bacteria 7878
690 Ga0207711_10013598 3300025941 Bacteria 6761
691 Ga0207711_10016641 3300025941 Bacteria 6107
692 Ga0207711_10043316 3300025941 Bacteria 3838
693 Ga0207711_10055386 3300025941 Bacteria 3405
694 Ga0207711_10064490 3300025941 Bacteria 3164
695 Ga0207711_10066516 3300025941 Bacteria 3117
696 Ga0207711_10355843 3300025941 Bacteria 1356
697 Ga0207689_10007724 3300025942 Bacteria 9411
698 Ga0207689_10051430 3300025942 Bacteria 3397
699 Ga0207689_10123255 3300025942 Bacteria 2131
700 Ga0207661_10013422 3300025944 Bacteria 5983
701 Ga0207661_10015181 3300025944 Bacteria 5663
702 Ga0207661_10021960 3300025944 Bacteria 4794
703 Ga0207661_10035036 3300025944 Bacteria 3908
704 Ga0207661_10037667 3300025944 Bacteria 3784
705 Ga0207661_10268214 3300025944 Bacteria 1523
706 Ga0207679_10000488 3300025945 Bacteria 27329
707 Ga0207679_10004733 3300025945 Bacteria 8473
708 Ga0207679_10006512 3300025945 Bacteria 7384
709 Ga0207679_10007231 3300025945 Bacteria 7036
710 Ga0207679_10015120 3300025945 Bacteria 5091
711 Ga0207679_10018843 3300025945 Bacteria 4630
712 Ga0207679_10023671 3300025945 Bacteria 4203
713 Ga0207679_10030940 3300025945 Bacteria 3742
714 Ga0207679_10033904 3300025945 Bacteria 3597
715 Ga0207679_10062114 3300025945 Bacteria 2783
716 Ga0207679_10096650 3300025945 Bacteria 2299
717 Ga0207679_10102759 3300025945 Bacteria 2239
718 Ga0207679_10120442 3300025945 Bacteria 2088
719 Ga0207679_10339495 3300025945 Bacteria 1306
720 Ga0207667_10000114 3300025949 Bacteria 128923
721 Ga0207667_10003386 3300025949 Bacteria 19669
722 Ga0207667_10006779 3300025949 Bacteria 13834
723 Ga0207667_10008097 3300025949 Bacteria 12529
724 Ga0207667_10008746 3300025949 Bacteria 12003
725 Ga0207667_10021985 3300025949 Bacteria 7058
726 Ga0207667_10080305 3300025949 Bacteria 3379
727 Ga0207667_10125238 3300025949 Bacteria 2646
728 Ga0207667_10180968 3300025949 Bacteria 2165
729 Ga0207667_10311396 3300025949 Bacteria 1608
730 Ga0207667_10326755 3300025949 Bacteria 1566
731 Ga0207667_10464733 3300025949 Bacteria 1285
732 Ga0207667_10467381 3300025949 Bacteria 1281
733 Ga0207651_10000289 3300025960 Bacteria 21606
734 Ga0207651_10007390 3300025960 Bacteria 5851
735 Ga0207651_10008590 3300025960 Bacteria 5527
736 Ga0207651_10029271 3300025960 Bacteria 3488
737 Ga0207651_10167972 3300025960 Bacteria 1727
738 Ga0207651_10168958 3300025960 Bacteria 1723
739 Ga0207651_10202983 3300025960 Bacteria 1590
740 Ga0207651_10355702 3300025960 Bacteria 1234
741 Ga0207712_10001686 3300025961 Bacteria 14836
742 Ga0207668_10000417 3300025972 Bacteria 26845
743 Ga0207668_10003815 3300025972 Bacteria 8882
744 Ga0207668_10043985 3300025972 Bacteria 3035
745 Ga0207668_10155046 3300025972 Bacteria 1778
746 Ga0207668_10339346 3300025972 Bacteria 1253
747 Ga0207640_10000453 3300025981 Bacteria 24954
748 Ga0207640_10001147 3300025981 Bacteria 14546
749 Ga0207640_10006666 3300025981 Bacteria 6344
750 Ga0207640_10031918 3300025981 Bacteria 3261
751 Ga0207640_10072978 3300025981 Bacteria 2317
752 Ga0207658_10003422 3300025986 Bacteria 11234
753 Ga0207658_10004081 3300025986 Bacteria 10191
754 Ga0207658_10011425 3300025986 Bacteria 6044
755 Ga0207658_10018434 3300025986 Bacteria 4819
756 Ga0207658_10024509 3300025986 Bacteria 4222
757 Ga0207658_10025127 3300025986 Bacteria 4169
758 Ga0207658_10027510 3300025986 Bacteria 3995
759 Ga0207658_10029885 3300025986 Bacteria 3853
760 Ga0207658_10036826 3300025986 Bacteria 3510
761 Ga0207658_10043777 3300025986 Bacteria 3256
762 Ga0207658_10090517 3300025986 Bacteria 2371
763 Ga0207658_10093781 3300025986 Bacteria 2334
764 Ga0207658_10251387 3300025986 Bacteria 1502
765 Ga0207677_10032921 3300026023 Bacteria 3337
766 Ga0207677_10074804 3300026023 Bacteria 2405
767 Ga0207703_10002884 3300026035 Bacteria 14642
768 Ga0207703_10003761 3300026035 Bacteria 12623
769 Ga0207703_10005616 3300026035 Bacteria 10071
770 Ga0207703_10015498 3300026035 Bacteria 5943
771 Ga0207703_10018948 3300026035 Bacteria 5376
772 Ga0207703_10036591 3300026035 Bacteria 3908
773 Ga0207703_10057984 3300026035 Bacteria 3159
774 Ga0207703_10067042 3300026035 Bacteria 2953
775 Ga0207703_10077039 3300026035 Bacteria 2767
776 Ga0207639_10000131 3300026041 Bacteria 54681
777 Ga0207639_10000355 3300026041 Bacteria 31674
778 Ga0207639_10001907 3300026041 Bacteria 13994
779 Ga0207639_10006432 3300026041 Bacteria 7988
780 Ga0207639_10017897 3300026041 Bacteria 5027
781 Ga0207639_10019953 3300026041 Bacteria 4790
782 Ga0207639_10022118 3300026041 Bacteria 4578
783 Ga0207639_10041745 3300026041 Bacteria 3434
784 Ga0207639_10077612 3300026041 Bacteria 2619
785 Ga0207639_10081918 3300026041 Bacteria 2557
786 Ga0207639_10115822 3300026041 Bacteria 2193
787 Ga0207639_10407185 3300026041 Bacteria 1227
788 Ga0207678_10000354 3300026067 Bacteria 41704
789 Ga0207678_10002532 3300026067 Bacteria 16661
790 Ga0207678_10003255 3300026067 Bacteria 14659
791 Ga0207678_10005696 3300026067 Bacteria 11123
792 Ga0207678_10005871 3300026067 Bacteria 10947
793 Ga0207678_10010090 3300026067 Bacteria 8287
794 Ga0207678_10011690 3300026067 Bacteria 7707
795 Ga0207678_10012311 3300026067 Bacteria 7511
796 Ga0207678_10013223 3300026067 Bacteria 7242
797 Ga0207678_10020824 3300026067 Bacteria 5747
798 Ga0207678_10044212 3300026067 Bacteria 3853
799 Ga0207678_10083548 3300026067 Bacteria 2731
800 Ga0207678_10084379 3300026067 Bacteria 2716
801 Ga0207678_10102192 3300026067 Bacteria 2447
802 Ga0207678_10146671 3300026067 Bacteria 2014
803 Ga0207678_10153412 3300026067 Bacteria 1967
804 Ga0207702_10000247 3300026078 Bacteria 62873
805 Ga0207702_10005325 3300026078 Bacteria 11284
806 Ga0207702_10005757 3300026078 Bacteria 10784
807 Ga0207702_10010877 3300026078 Bacteria 7589
808 Ga0207702_10017863 3300026078 Bacteria 5871
809 Ga0207702_10125307 3300026078 Bacteria 2305
810 Ga0207702_10249351 3300026078 Bacteria 1667
811 Ga0207641_10000190 3300026088 Bacteria 84715
812 Ga0207641_10014799 3300026088 Bacteria 6396
813 Ga0207641_10022838 3300026088 Bacteria 5151
814 Ga0207641_10031103 3300026088 Bacteria 4425
815 Ga0207641_10066075 3300026088 Bacteria 3095
816 Ga0207641_10102832 3300026088 Bacteria 2520
817 Ga0207641_10175813 3300026088 Bacteria 1957
818 Ga0207648_10013151 3300026089 Bacteria 7713
819 Ga0207648_10051639 3300026089 Bacteria 3594
820 Ga0207648_10101401 3300026089 Bacteria 2523
821 Ga0207676_10000139 3300026095 Bacteria 63189
822 Ga0207676_10000937 3300026095 Bacteria 22548
823 Ga0207676_10009066 3300026095 Bacteria 7085
824 Ga0207676_10009780 3300026095 Bacteria 6818
825 Ga0207676_10010167 3300026095 Bacteria 6698
826 Ga0207676_10015859 3300026095 Bacteria 5448
827 Ga0207676_10057226 3300026095 Bacteria 3069
828 Ga0207676_10401392 3300026095 Bacteria 1281
829 Ga0207674_10000638 3300026116 Bacteria 45617
830 Ga0207674_10001496 3300026116 Bacteria 30156
831 Ga0207674_10003651 3300026116 Bacteria 18764
832 Ga0207674_10003894 3300026116 Bacteria 18157
833 Ga0207674_10006814 3300026116 Bacteria 13400
834 Ga0207674_10009966 3300026116 Bacteria 10812
835 Ga0207674_10020702 3300026116 Bacteria 7099
836 Ga0207674_10054560 3300026116 Bacteria 4068
837 Ga0207674_10084761 3300026116 Bacteria 3166
838 Ga0207674_10096401 3300026116 Bacteria 2943
839 Ga0207674_10300061 3300026116 Bacteria 1555
840 Ga0207675_100026968 3300026118 Bacteria 5348
841 Ga0207675_100126663 3300026118 Bacteria 2419
842 Ga0207675_100329858 3300026118 Bacteria 1491
843 Ga0207683_10001453 3300026121 Bacteria 21380
844 Ga0207683_10017922 3300026121 Bacteria 6038
845 Ga0207683_10022042 3300026121 Bacteria 5465
846 Ga0207683_10023930 3300026121 Bacteria 5255
847 Ga0207683_10053408 3300026121 Bacteria 3543
848 Ga0207683_10249991 3300026121 Bacteria 1618
849 Ga0207698_10000697 3300026142 Bacteria 19513
850 Ga0207698_10001730 3300026142 Bacteria 12734
851 Ga0207698_10001918 3300026142 Bacteria 12193
852 Ga0207698_10013777 3300026142 Bacteria 5350
853 Ga0207698_10017231 3300026142 Bacteria 4895
854 Ga0207698_10025698 3300026142 Bacteria 4153
855 Ga0207698_10027171 3300026142 Bacteria 4059
856 Ga0207698_10044760 3300026142 Bacteria 3329
857 Ga0207698_10068707 3300026142 Bacteria 2799
858 Ga0207698_10148430 3300026142 Bacteria 2031
859 Ga0207698_10351326 3300026142 Bacteria 1393
860 Ga0209974_10008323 3300027876 Bacteria 3549
861 Ga0268266_10000534 3300028379 Bacteria 53027
862 Ga0268266_10029009 3300028379 Bacteria 4703
863 Ga0268266_10030705 3300028379 Bacteria 4564
864 Ga0268266_10043628 3300028379 Bacteria 3833
865 Ga0268266_10139577 3300028379 Bacteria 2174
866 Ga0268265_10001838 3300028380 Bacteria 16935
867 Ga0268265_10004697 3300028380 Bacteria 9430
868 Ga0268265_10014260 3300028380 Bacteria 5415
869 Ga0268265_10060919 3300028380 Bacteria 2894
870 Ga0268265_10139416 3300028380 Bacteria 2028
871 Ga0268265_10225334 3300028380 Bacteria 1643
872 Ga0268264_10001693 3300028381 Bacteria 20308
873 Ga0268264_10003174 3300028381 Bacteria 14237
874 Ga0268264_10003956 3300028381 Bacteria 12691
875 Ga0268264_10030355 3300028381 Bacteria 4430
876 Ga0268264_10072645 3300028381 Bacteria 2917
877 Ga0265327_10000784 3300031251 Bacteria 48999
878 Ga0307408_100058160 3300031548 Bacteria 2810
879 Ga0307408_100126696 3300031548 Bacteria 1987
880 Ga0307408_100141603 3300031548 Bacteria 1888
881 Ga0307405_10104935 3300031731 Bacteria 1902
882 Ga0307405_10114961 3300031731 Bacteria 1830
883 Ga0307405_10210169 3300031731 Bacteria 1420
884 Ga0307413_10000576 3300031824 Bacteria 12311
885 Ga0307413_10003861 3300031824 Bacteria 6400
886 Ga0307413_10005338 3300031824 Bacteria 5722
887 Ga0307413_10011539 3300031824 Bacteria 4354
888 Ga0307413_10040734 3300031824 Bacteria 2714
889 Ga0307413_10044222 3300031824 Bacteria 2631
890 Ga0307413_10053678 3300031824 Bacteria 2441
891 Ga0307413_10067332 3300031824 Bacteria 2238
892 Ga0307413_10134928 3300031824 Bacteria 1695
893 Ga0307413_10203958 3300031824 Bacteria 1430
894 Ga0307410_10009738 3300031852 Bacteria 5404
895 Ga0307410_10009830 3300031852 Bacteria 5388
896 Ga0307410_10018312 3300031852 Bacteria 4230
897 Ga0307410_10020545 3300031852 Bacteria 4041
898 Ga0307410_10034163 3300031852 Bacteria 3290
899 Ga0307410_10095886 3300031852 Bacteria 2116
900 Ga0307410_10099373 3300031852 Bacteria 2083
901 Ga0307410_10112459 3300031852 Bacteria 1972
902 Ga0307410_10165994 3300031852 Bacteria 1659
903 Ga0307410_10195386 3300031852 Bacteria 1541
904 Ga0307410_10200438 3300031852 Bacteria 1523
905 Ga0307410_10332006 3300031852 Bacteria 1209
906 Ga0307406_10008366 3300031901 Bacteria 5768
907 Ga0307406_10016557 3300031901 Bacteria 4287
908 Ga0307406_10040511 3300031901 Bacteria 2897
909 Ga0307406_10155922 3300031901 Bacteria 1635
910 Ga0307406_10168314 3300031901 Bacteria 1583
911 Ga0307406_10258681 3300031901 Bacteria 1315
912 Ga0307407_10005056 3300031903 Bacteria 5685
913 Ga0307407_10006481 3300031903 Bacteria 5207
914 Ga0307407_10006983 3300031903 Bacteria 5075
915 Ga0307407_10017965 3300031903 Bacteria 3563
916 Ga0307407_10020686 3300031903 Bacteria 3376
917 Ga0307407_10043567 3300031903 Bacteria 2524
918 Ga0307407_10091470 3300031903 Bacteria 1865
919 Ga0307407_10100606 3300031903 Bacteria 1793
920 Ga0307412_10141754 3300031911 Bacteria 1761
921 Ga0307412_10202483 3300031911 Bacteria 1508
922 Ga0307412_10233525 3300031911 Bacteria 1418
923 Ga0307412_10261246 3300031911 Bacteria 1350
924 Ga0307409_100005419 3300031995 Bacteria 7340
925 Ga0307409_100011071 3300031995 Bacteria 5660
926 Ga0307409_100017575 3300031995 Bacteria 4773
927 Ga0307409_100032301 3300031995 Bacteria 3793
928 Ga0307409_100051503 3300031995 Bacteria 3151
929 Ga0307409_100054766 3300031995 Bacteria 3074
930 Ga0307409_100059982 3300031995 Bacteria 2964
931 Ga0307409_100115096 3300031995 Bacteria 2264
932 Ga0307409_100143918 3300031995 Bacteria 2058
933 Ga0307409_100147945 3300031995 Bacteria 2034
934 Ga0307409_100176565 3300031995 Bacteria 1886
935 Ga0307409_100240097 3300031995 Bacteria 1649
936 Ga0307409_100282620 3300031995 Bacteria 1534
937 Ga0307416_100012344 3300032002 Bacteria 5752
938 Ga0307416_100023528 3300032002 Bacteria 4473
939 Ga0307416_100036621 3300032002 Bacteria 3765
940 Ga0307416_100040456 3300032002 Bacteria 3621
941 Ga0307416_100054179 3300032002 Bacteria 3223
942 Ga0307416_100060117 3300032002 Bacteria 3092
943 Ga0307416_100075041 3300032002 Bacteria 2828
944 Ga0307416_100102563 3300032002 Bacteria 2495
945 Ga0307416_100341330 3300032002 Bacteria 1511
946 Ga0307414_10007540 3300032004 Bacteria 6115
947 Ga0307414_10013449 3300032004 Bacteria 4874
948 Ga0307414_10016557 3300032004 Bacteria 4485
949 Ga0307414_10020246 3300032004 Bacteria 4143
950 Ga0307414_10025457 3300032004 Bacteria 3791
951 Ga0307414_10029975 3300032004 Bacteria 3548
952 Ga0307414_10045557 3300032004 Bacteria 3004
953 Ga0307414_10047767 3300032004 Bacteria 2948
954 Ga0307414_10308754 3300032004 Bacteria 1341
955 Ga0307411_10004433 3300032005 Bacteria 6723
956 Ga0307411_10011377 3300032005 Bacteria 4800
957 Ga0307411_10012448 3300032005 Bacteria 4643
958 Ga0307411_10012934 3300032005 Bacteria 4579
959 Ga0307411_10017789 3300032005 Bacteria 4062
960 Ga0307411_10090144 3300032005 Bacteria 2138
961 Ga0307411_10118444 3300032005 Bacteria 1910
962 Ga0307411_10180795 3300032005 Bacteria 1600
963 Ga0307411_10202280 3300032005 Bacteria 1526
964 Ga0307415_100002314 3300032126 Bacteria 9457
965 Ga0307415_100003284 3300032126 Bacteria 8223
966 Ga0307415_100009295 3300032126 Bacteria 5499
967 Ga0307415_100010903 3300032126 Bacteria 5170
968 Ga0307415_100016520 3300032126 Bacteria 4403
969 Ga0307415_100024162 3300032126 Bacteria 3789
970 Ga0307415_100379842 3300032126 Bacteria 1199
971 Ga0373923_0024592 3300035111 Bacteria 2378
972 Ga0373954_0005781 3300035118 Bacteria 5371
973 Ga0373956_0012542 3300035119 Bacteria 3515
974 Ga0373955_0001193 3300035172 Bacteria 11055
975 Ga0373962_0042162 3300035242 Bacteria 1290
976 Ga0373931_0009145 3300035691 Bacteria 4729
977 Ga0373935_0021058 3300035692 Bacteria 3990
978 Ga0373933_0044727 3300035724 Bacteria 2624
979 Ga0373947_0047513 3300035725 Bacteria 2572
980 Ga0373937_0104961 3300036401 Bacteria 2625
981 Ga0373925_0016330 3300037068 Bacteria 5376
982 Ga0395899_0000113 3300037312 Bacteria 136163
983 Ga0395899_0000230 3300037312 Bacteria 76090
984 Ga0395899_0001895 3300037312 Bacteria 17266
985 Ga0395899_0003735 3300037312 Bacteria 12031
986 Ga0395899_0012024 3300037312 Bacteria 6632
987 Ga0395899_0020525 3300037312 Bacteria 5007
988 Ga0395899_0041900 3300037312 Bacteria 3419
989 Ga0395899_0071293 3300037312 Bacteria 2542
990 Ga0395899_0076848 3300037312 Bacteria 2437
991 Ga0395899_0112441 3300037312 Bacteria 1956
992 Ga0395899_0173823 3300037312 Bacteria 1515
993 Ga0395899_0188205 3300037312 Bacteria 1445
994 Ga0395899_0194563 3300037312 Bacteria 1417
995 Ga0395899_0207156 3300037312 Bacteria 1364
996 Ga0395899_0221756 3300037312 Bacteria 1309
997 Ga0395900_0000124 3300037418 Bacteria 133210
998 Ga0395900_0000583 3300037418 Bacteria 50178
999 Ga0395900_0004212 3300037418 Bacteria 15265
1000 Ga0395900_0004463 3300037418 Bacteria 14822
1001 Ga0395900_0006169 3300037418 Bacteria 12516
1002 Ga0395900_0006697 3300037418 Bacteria 11970
1003 Ga0395900_0015417 3300037418 Bacteria 7791
1004 Ga0395900_0015733 3300037418 Bacteria 7713
1005 Ga0395900_0019236 3300037418 Bacteria 6963
1006 Ga0395900_0019933 3300037418 Bacteria 6836
1007 Ga0395900_0021194 3300037418 Bacteria 6643
1008 Ga0395900_0022001 3300037418 Bacteria 6520
1009 Ga0395900_0025263 3300037418 Bacteria 6081
1010 Ga0395900_0035053 3300037418 Bacteria 5168
1011 Ga0395900_0035862 3300037418 Bacteria 5110
1012 Ga0395900_0039154 3300037418 Bacteria 4885
1013 Ga0395900_0042369 3300037418 Bacteria 4691
1014 Ga0395900_0047564 3300037418 Bacteria 4417
1015 Ga0395900_0048374 3300037418 Bacteria 4380
1016 Ga0395900_0055500 3300037418 Bacteria 4079
1017 Ga0395900_0065971 3300037418 Bacteria 3719
1018 Ga0395900_0071613 3300037418 Bacteria 3563
1019 Ga0395900_0082475 3300037418 Bacteria 3303
1020 Ga0395900_0083275 3300037418 Bacteria 3286
1021 Ga0395900_0099886 3300037418 Bacteria 2981
1022 Ga0395900_0100549 3300037418 Bacteria 2970
1023 Ga0395900_0136684 3300037418 Bacteria 2511
1024 Ga0395900_0144636 3300037418 Bacteria 2432
1025 Ga0395900_0169004 3300037418 Bacteria 2227
1026 Ga0395900_0176255 3300037418 Bacteria 2174
1027 Ga0395900_0213159 3300037418 Bacteria 1949
1028 Ga0395900_0217669 3300037418 Bacteria 1926
1029 Ga0395900_0223589 3300037418 Bacteria 1896
1030 Ga0395900_0355247 3300037418 Bacteria 1438
1031 Ga0395900_0413021 3300037418 Bacteria 1312
1032 Ga0395898_0000087 3300037466 Bacteria 239211
1033 Ga0395898_0002186 3300037466 Bacteria 23900
1034 Ga0395898_0007172 3300037466 Bacteria 11834
1035 Ga0395898_0008160 3300037466 Bacteria 11087
1036 Ga0395898_0010993 3300037466 Bacteria 9432
1037 Ga0395898_0014171 3300037466 Bacteria 8198
1038 Ga0395898_0014797 3300037466 Bacteria 8009
1039 Ga0395898_0021200 3300037466 Bacteria 6591
1040 Ga0395898_0025851 3300037466 Bacteria 5910
1041 Ga0395898_0057083 3300037466 Bacteria 3804
1042 Ga0395898_0063513 3300037466 Bacteria 3583
1043 Ga0395898_0136533 3300037466 Bacteria 2348
1044 Ga0395898_0138684 3300037466 Bacteria 2328
1045 Ga0395898_0264608 3300037466 Bacteria 1640
1046 Ga0395898_0308890 3300037466 Bacteria 1508
1047 Ga0395898_0320524 3300037466 Bacteria 1478
1048 Ga0395898_0328879 3300037466 Bacteria 1457
1049 Ga0395898_0379246 3300037466 Bacteria 1348
1050 Ga0395905_0000005 3300037471 Bacteria 557808
1051 Ga0395905_0000342 3300037471 Bacteria 66255
1052 Ga0395905_0001508 3300037471 Bacteria 27850
1053 Ga0395905_0002977 3300037471 Bacteria 18402
1054 Ga0395905_0003870 3300037471 Bacteria 15790
1055 Ga0395905_0004497 3300037471 Bacteria 14459
1056 Ga0395905_0004925 3300037471 Bacteria 13746
1057 Ga0395905_0009859 3300037471 Bacteria 9310
1058 Ga0395905_0011892 3300037471 Bacteria 8399
1059 Ga0395905_0012554 3300037471 Bacteria 8149
1060 Ga0395905_0012811 3300037471 Bacteria 8062
1061 Ga0395905_0012904 3300037471 Bacteria 8032
1062 Ga0395905_0013410 3300037471 Bacteria 7853
1063 Ga0395905_0016644 3300037471 Bacteria 6989
1064 Ga0395905_0025200 3300037471 Bacteria 5610
1065 Ga0395905_0025566 3300037471 Bacteria 5567
1066 Ga0395905_0028470 3300037471 Bacteria 5268
1067 Ga0395905_0032849 3300037471 Bacteria 4878
1068 Ga0395905_0036128 3300037471 Bacteria 4640
1069 Ga0395905_0037612 3300037471 Bacteria 4543
1070 Ga0395905_0061790 3300037471 Bacteria 3504
1071 Ga0395905_0073520 3300037471 Bacteria 3204
1072 Ga0395905_0086231 3300037471 Bacteria 2942
1073 Ga0395905_0088027 3300037471 Bacteria 2911
1074 Ga0395905_0105513 3300037471 Bacteria 2646
1075 Ga0395905_0112981 3300037471 Bacteria 2551
1076 Ga0395905_0120201 3300037471 Bacteria 2469
1077 Ga0395905_0121793 3300037471 Bacteria 2452
1078 Ga0395905_0132998 3300037471 Bacteria 2339
1079 Ga0395905_0133772 3300037471 Bacteria 2332
1080 Ga0395905_0142749 3300037471 Bacteria 2252
1081 Ga0395905_0222706 3300037471 Bacteria 1765
1082 Ga0395905_0237513 3300037471 Bacteria 1703
1083 Ga0395905_0243840 3300037471 Bacteria 1679
1084 Ga0395905_0248819 3300037471 Bacteria 1660
1085 Ga0395905_0278204 3300037471 Bacteria 1559
1086 Ga0395905_0341767 3300037471 Bacteria 1388
1087 Ga0436364_0354297 3300037853 Bacteria 35362
1088 Ga0436364_1150066 3300037853 Bacteria 29298
1089 Ga0436364_1158546 3300037853 Bacteria 10695
1090 Ga0395901_0000031 3300038443 Bacteria 241733
1091 Ga0395901_0000850 3300038443 Bacteria 33604
1092 Ga0395901_0001812 3300038443 Bacteria 22072
1093 Ga0395901_0002630 3300038443 Bacteria 18159
1094 Ga0395901_0003605 3300038443 Bacteria 15617
1095 Ga0395901_0012933 3300038443 Bacteria 8467
1096 Ga0395901_0019429 3300038443 Bacteria 6948
1097 Ga0395901_0019488 3300038443 Bacteria 6936
1098 Ga0395901_0021460 3300038443 Bacteria 6616
1099 Ga0395901_0022765 3300038443 Bacteria 6425
1100 Ga0395901_0038250 3300038443 Bacteria 4963
1101 Ga0395901_0048382 3300038443 Bacteria 4415
1102 Ga0395901_0065999 3300038443 Bacteria 3769
1103 Ga0395901_0090298 3300038443 Bacteria 3206
1104 Ga0395901_0092713 3300038443 Bacteria 3162
1105 Ga0395901_0096593 3300038443 Bacteria 3096
1106 Ga0395901_0102382 3300038443 Bacteria 3005
1107 Ga0395901_0139296 3300038443 Bacteria 2550
1108 Ga0395901_0143581 3300038443 Bacteria 2509
1109 Ga0395901_0149791 3300038443 Bacteria 2452
1110 Ga0395901_0151464 3300038443 Bacteria 2437
1111 Ga0395901_0154411 3300038443 Bacteria 2411
1112 Ga0395901_0165442 3300038443 Bacteria 2322
1113 Ga0395901_0195708 3300038443 Bacteria 2120
1114 Ga0395901_0197491 3300038443 Bacteria 2109
1115 Ga0395901_0236964 3300038443 Bacteria 1904
1116 Ga0395901_0237045 3300038443 Bacteria 1904
1117 Ga0395901_0319688 3300038443 Bacteria 1606
1118 Ga0436365_1762915 3300039437 Bacteria 10325
1119 Ga0439448_0017655 3300042005 Bacteria 2180
1120 Ga0450914_002434 3300042118 Bacteria 1329
1121 Ga0450890_005761 3300042127 Bacteria 1593
1122 Ga0450905_003289 3300042142 Bacteria 2119
1123 Ga0450889_000230 3300042144 Bacteria 6225
1124 Ga0439458_0000019 3300042157 Bacteria 25805
1125 Ga0439458_0000172 3300042157 Bacteria 14580
1126 Ga0439464_0000119 3300042439 Bacteria 12340
1127 Ga0450918_014181 3300042531 Bacteria 1385
1128 Ga0466969_0020235 3300044656 Bacteria 3448
1129 Ga0466966_0000021 3300044684 Bacteria 116714
1130 Ga0466966_0003525 3300044684 Bacteria 10327
1131 Ga0466966_0013875 3300044684 Bacteria 5333
1132 Ga0466966_0027185 3300044684 Bacteria 3731
1133 Ga0466966_0039521 3300044684 Bacteria 3038
1134 Ga0466966_0046583 3300044684 Bacteria 2767
1135 Ga0466961_0006977 3300044693 Bacteria 7184
1136 Ga0466963_0005295 3300044694 Bacteria 7538
1137 Ga0466963_0007606 3300044694 Bacteria 6468
1138 Ga0466963_0015657 3300044694 Bacteria 4703
1139 Ga0466963_0026091 3300044694 Bacteria 3735
1140 Ga0466963_0039915 3300044694 Bacteria 3076
1141 Ga0466963_0045941 3300044694 Bacteria 2878
1142 Ga0466963_0056143 3300044694 Bacteria 2620
1143 Ga0466963_0102150 3300044694 Bacteria 1963
1144 Ga0466963_0215104 3300044694 Bacteria 1345
1145 Ga0466964_0020668 3300044706 Bacteria 2537
1146 Ga0466964_0060187 3300044706 Bacteria 1579
1147 Ga0453684_0127521 3300044712 Bacteria 3060
1148 Ga0466971_0003365 3300044719 Bacteria 6827
1149 Ga0466971_0025879 3300044719 Bacteria 2621
1150 Ga0466971_0071940 3300044719 Bacteria 1570
1151 Ga0466970_0025641 3300044765 Bacteria 3088
1152 Ga0466957_0001394 3300044842 Bacteria 12603
1153 Ga0466957_0002438 3300044842 Bacteria 9993
1154 Ga0466957_0008285 3300044842 Bacteria 5910
1155 Ga0466957_0032407 3300044842 Bacteria 3129
1156 Ga0466957_0074195 3300044842 Bacteria 2109
1157 Ga0466959_0007227 3300045049 Bacteria 7779
1158 Ga0466959_0016253 3300045049 Bacteria 5434
1159 Ga0466959_0036845 3300045049 Bacteria 3614
1160 Ga0466959_0060354 3300045049 Bacteria 2759
1161 Ga0466959_0092158 3300045049 Bacteria 2175
1162 Ga0466958_0000063 3300045836 Bacteria 32014
1163 Ga0466958_0002246 3300045836 Bacteria 9621
1164 Ga0466958_0042674 3300045836 Bacteria 2731
1165 Ga0466967_0001510 3300045976 Bacteria 13588
1166 Ga0466967_0008570 3300045976 Bacteria 7512
1167 Ga0466967_0020457 3300045976 Bacteria 5350
1168 Ga0466967_0029746 3300045976 Bacteria 4576
1169 Ga0466967_0033304 3300045976 Bacteria 4360
1170 Ga0466967_0064289 3300045976 Bacteria 3263
1171 Ga0466967_0067577 3300045976 Bacteria 3188
1172 Ga0466967_0076084 3300045976 Bacteria 3018
1173 Ga0466967_0107219 3300045976 Bacteria 2562
1174 Ga0466967_0119083 3300045976 Bacteria 2436
1175 Ga0466967_0163681 3300045976 Bacteria 2089
1176 Ga0466967_0357672 3300045976 Bacteria 1414
1177 Ga0495585_0108422 3300046492 Bacteria 1479
1178 Ga0495620_0102887 3300046515 Bacteria 1137
1179 Ga0495663_0005081 3300046525 Bacteria 3675
1180 Ga0495598_0004666 3300046537 Bacteria 2983
1181 Ga0495621_0000366 3300046539 Bacteria 11002
1182 Ga0495621_0000416 3300046539 Bacteria 10505
1183 Ga0495633_0007098 3300046558 Bacteria 6510
1184 Ga0495633_0048204 3300046558 Bacteria 2012
1185 Ga0495668_0004232 3300046616 Bacteria 10326
1186 Ga0495668_0008130 3300046616 Bacteria 6598
1187 Ga0495668_0052600 3300046616 Bacteria 2253
1188 Ga0495659_0019965 3300046664 Bacteria 2246
1189 Ga0495623_0086928 3300046679 Bacteria 1926
1190 Ga0495669_0000563 3300046684 Bacteria 16416
1191 Ga0495669_0002024 3300046684 Bacteria 8307
1192 Ga0495669_0003242 3300046684 Bacteria 6690
1193 Ga0495669_0005221 3300046684 Bacteria 5406
1194 Ga0495669_0009197 3300046684 Bacteria 4164
1195 Ga0495669_0015892 3300046684 Bacteria 3223
1196 Ga0495669_0017842 3300046684 Bacteria 3047
1197 Ga0495669_0023609 3300046684 Bacteria 2678
1198 Ga0495669_0024841 3300046684 Bacteria 2610
1199 Ga0495669_0032525 3300046684 Bacteria 2293
1200 Ga0495669_0058151 3300046684 Bacteria 1745
1201 Ga0495669_0060066 3300046684 Bacteria 1718
1202 Ga0495669_0072460 3300046684 Bacteria 1572
1203 Ga0495670_0000783 3300046691 Bacteria 15269
1204 Ga0495670_0031759 3300046691 Bacteria 2624
1205 Ga0495602_0023552 3300048088 Bacteria 5996
1206 Ga0495615_0041674 3300048090 Bacteria 1148
1207 Ga0496100_0007338 3300048903 Bacteria 6072
1208 Ga0496100_0011373 3300048903 Bacteria 5065
1209 Ga0496100_0341763 3300048903 Bacteria 1129
1210 Ga0496101_0063580 3300048904 Bacteria 2687
1211 Ga0496101_0092331 3300048904 Bacteria 2254
1212 Ga0496101_0248027 3300048904 Bacteria 1387
1213 Ga0496102_0428451 3300048905 Bacteria 1242
1214 Ga0496103_0008964 3300048906 Bacteria 5931
1215 Ga0496103_0120771 3300048906 Bacteria 1669
1216 Ga0496104_0096378 3300048907 Bacteria 2830
1217 Ga0496104_0275860 3300048907 Bacteria 1594
1218 Ga0496106_0047064 3300048909 Bacteria 3244
1219 Ga0496106_0060666 3300048909 Bacteria 2867
1220 Ga0496106_0120069 3300048909 Bacteria 2054
1221 Ga0496107_0003637 3300048910 Bacteria 10355
1222 Ga0496107_0015411 3300048910 Bacteria 5356
1223 Ga0496107_0062617 3300048910 Bacteria 2695
1224 Ga0496107_0103686 3300048910 Bacteria 2087
1225 Ga0496107_0233844 3300048910 Bacteria 1367
1226 Ga0496108_0000700 3300048911 Bacteria 26044
1227 Ga0496108_0001452 3300048911 Bacteria 18729
1228 Ga0496108_0004395 3300048911 Bacteria 11347
1229 Ga0496108_0006634 3300048911 Bacteria 9378
1230 Ga0496108_0013829 3300048911 Bacteria 6583
1231 Ga0496108_0041610 3300048911 Bacteria 3836
1232 Ga0496108_0160416 3300048911 Bacteria 1943
1233 Ga0496109_0002921 3300048912 Bacteria 14284
1234 Ga0496109_0005667 3300048912 Bacteria 10451
1235 Ga0496109_0023357 3300048912 Bacteria 5488
1236 Ga0496109_0028570 3300048912 Bacteria 4988
1237 Ga0496109_0070933 3300048912 Bacteria 3198
1238 Ga0496110_0003386 3300048913 Bacteria 12180
1239 Ga0496110_0009767 3300048913 Bacteria 7772
1240 Ga0496110_0012363 3300048913 Bacteria 7018
1241 Ga0496110_0084410 3300048913 Bacteria 2834
1242 Ga0496110_0112597 3300048913 Bacteria 2447
1243 Ga0496110_0119923 3300048913 Bacteria 2369
1244 Ga0496111_0004889 3300048914 Bacteria 8510
1245 Ga0496111_0007776 3300048914 Bacteria 7059
1246 Ga0496111_0033750 3300048914 Bacteria 3651
1247 Ga0496111_0034762 3300048914 Bacteria 3599
1248 Ga0496111_0068799 3300048914 Bacteria 2574
1249 Ga0496111_0235936 3300048914 Bacteria 1358
1250 Ga0496112_0004870 3300048915 Bacteria 11477
1251 Ga0496112_0006100 3300048915 Bacteria 10536
1252 Ga0496112_0010392 3300048915 Bacteria 8440
1253 Ga0496112_0045733 3300048915 Bacteria 4291
1254 Ga0496112_0113380 3300048915 Bacteria 2682
1255 Ga0496112_0227427 3300048915 Bacteria 1820
1256 Ga0496113_0019687 3300048916 Bacteria 4728
1257 Ga0496113_0020264 3300048916 Bacteria 4672
1258 Ga0496113_0028476 3300048916 Bacteria 4019
1259 Ga0496113_0032626 3300048916 Bacteria 3785
1260 Ga0496113_0045078 3300048916 Bacteria 3269
1261 Ga0496113_0226911 3300048916 Bacteria 1489
1262 Ga0496114_0000006 3300048917 Bacteria 472921
1263 Ga0496114_0052895 3300048917 Bacteria 3384
1264 Ga0496115_0002676 3300048918 Bacteria 12779
1265 Ga0496115_0097442 3300048918 Bacteria 2408
1266 Ga0496116_0132667 3300048919 Bacteria 1416
1267 Ga0496118_0010865 3300048921 Bacteria 8960
1268 Ga0496119_0030628 3300048922 Bacteria 3623
1269 Ga0496121_0012385 3300048924 Bacteria 9312
1270 Ga0496126_0272510 3300048929 Bacteria 1404
1271 Ga0501067_0060966 3300049583 Bacteria 2088
1272 Ga0501069_0080570 3300049585 Bacteria 1834
1273 Ga0501225_0040726 3300049705 Bacteria 1281
1274 Ga0501080_0011338 3300049742 Bacteria 8161
1275 Ga0501268_000472 3300049765 Bacteria 4377
1276 nmdc:mga07m45_18750_c1 3300050496 Bacteria 3741
1277 nmdc:mga05p37_416076_c1 3300050507 Bacteria 1565
1278 nmdc:mga0a205_4261_c1 3300050515 Bacteria 12844
1279 Ga0495612_0047107 3300053078 Bacteria 1766
1280 Ga0500618_000803 3300053125 Bacteria 17291
1281 Ga0500658_0000056 3300053134 Bacteria 57016
1282 Ga0466962_0006544 3300061719 Bacteria 5592

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021388 Ga0213875_10010457 Ga0213875_100104573 301
2 3300037853 Ga0436364_1150066 Ga0436364_1150066_791_1801 301
3 3300010375 Ga0105239_10038545 Ga0105239_100385452 304
4 3300028380 Ga0268265_10139416 Ga0268265_101394162 306
5 3300005328 Ga0070676_10012447 Ga0070676_100124474 308
6 3300005459 Ga0068867_100079191 Ga0068867_1000791912 308
7 3300005719 Ga0068861_100036059 Ga0068861_1000360595 308
8 3300009148 Ga0105243_10006820 Ga0105243_1000682012 308
9 3300013100 Ga0157373_10009328 Ga0157373_100093283 308
10 3300025907 Ga0207645_10021229 Ga0207645_100212295 308
11 3300025938 Ga0207704_10190757 Ga0207704_101907572 308
12 3300025940 Ga0207691_10233250 Ga0207691_102332502 308
13 3300026118 Ga0207675_100026968 Ga0207675_1000269684 308
14 3300005356 Ga0070674_100011307 Ga0070674_1000113074 311
15 3300005456 Ga0070678_100012555 Ga0070678_1000125553 311
16 3300005459 Ga0068867_100007513 Ga0068867_1000075137 311
17 3300011119 Ga0105246_10108278 Ga0105246_101082782 311
18 3300025937 Ga0207669_10006239 Ga0207669_100062394 311
19 3300026089 Ga0207648_10101401 Ga0207648_101014012 311
20 3300026121 Ga0207683_10022042 Ga0207683_100220425 311
21 3300025253 Ga0209677_104116 Ga0209677_1041164 312
22 3300044694 Ga0466963_0005295 Ga0466963_0005295_2228_3268 312
23 3300045049 Ga0466959_0060354 Ga0466959_0060354_764_1810 313
24 3300005339 Ga0070660_100262503 Ga0070660_1002625032 314
25 3300013104 Ga0157370_10006961 Ga0157370_100069612 314
26 3300013307 Ga0157372_10111058 Ga0157372_101110582 314
27 3300025919 Ga0207657_10189663 Ga0207657_101896632 314
28 3300046664 Ga0495659_0019965 Ga0495659_0019965_812_1852 314
29 3300045976 Ga0466967_0020457 Ga0466967_0020457_3291_4337 315
30 3300045976 Ga0466967_0076084 Ga0466967_0076084_779_1819 315
31 3300005344 Ga0070661_100011981 Ga0070661_1000119812 316
32 3300005366 Ga0070659_100002092 Ga0070659_10000209213 316
33 3300005564 Ga0070664_100026793 Ga0070664_1000267933 316
34 3300025920 Ga0207649_10097967 Ga0207649_100979672 316
35 3300044694 Ga0466963_0102150 Ga0466963_0102150_224_1270 316
36 3300046515 Ga0495620_0102887 Ga0495620_0102887_45_1028 316
37 3300044765 Ga0466970_0025641 Ga0466970_0025641_2080_3060 317
38 3300048919 Ga0496116_0132667 Ga0496116_0132667_391_1389 319
39 3300050496 nmdc:mga07m45_18750_c1 nmdc:mga07m45_18750_c1_2014_3138 319
40 3300009174 Ga0105241_10268400 Ga0105241_102684002 321
41 3300038443 Ga0395901_0022765 Ga0395901_0022765_3621_4664 322
42 3300037853 Ga0436364_1158546 Ga0436364_1158546_9135_10145 324
43 3300046558 Ga0495633_0048204 Ga0495633_0048204_88_1095 324
44 3300044712 Ga0453684_0127521 Ga0453684_0127521_1634_2791 325
45 3300044684 Ga0466966_0039521 Ga0466966_0039521_765_1808 327
46 3300005344 Ga0070661_100053868 Ga0070661_1000538682 328
47 3300044706 Ga0466964_0020668 Ga0466964_0020668_49_1095 328
48 3300045049 Ga0466959_0007227 Ga0466959_0007227_2192_3238 328
49 3300045836 Ga0466958_0042674 Ga0466958_0042674_1212_2258 328
50 3300045976 Ga0466967_0163681 Ga0466967_0163681_147_1190 328
51 3300005327 Ga0070658_10002974 Ga0070658_100029747 329
52 3300005445 Ga0070708_100072299 Ga0070708_1000722992 329
53 3300005548 Ga0070665_100005224 Ga0070665_1000052244 329
54 3300025909 Ga0207705_10009845 Ga0207705_100098456 329
55 3300031251 Ga0265327_10000784 Ga0265327_1000078413 329
56 3300037471 Ga0395905_0061790 Ga0395905_0061790_900_1925 329
57 3300053125 Ga0500618_000803 Ga0500618_000803_10430_11482 329
58 3300001989 JGI24739J22299_10004662 JGI24739J22299_100046622 330
59 3300032002 Ga0307416_100023528 Ga0307416_1000235282 331
60 3300032126 Ga0307415_100016520 Ga0307415_1000165203 331
61 3300031901 Ga0307406_10258681 Ga0307406_102586811 332
62 3300031903 Ga0307407_10006983 Ga0307407_100069833 332
63 3300031995 Ga0307409_100032301 Ga0307409_1000323012 332
64 3300032005 Ga0307411_10180795 Ga0307411_101807952 332
65 3300001979 JGI24740J21852_10028850 JGI24740J21852_100288502 333
66 3300002067 JGI24735J21928_10002667 JGI24735J21928_100026674 333
67 3300005339 Ga0070660_100010530 Ga0070660_1000105302 333
68 3300005344 Ga0070661_100338134 Ga0070661_1003381341 333
69 3300005366 Ga0070659_100004893 Ga0070659_1000048939 333
70 3300005539 Ga0068853_100004583 Ga0068853_1000045833 333
71 3300005577 Ga0068857_100011040 Ga0068857_1000110404 333
72 3300005616 Ga0068852_100004435 Ga0068852_1000044359 333
73 3300009093 Ga0105240_10019270 Ga0105240_100192705 333
74 3300013100 Ga0157373_10051125 Ga0157373_100511252 333
75 3300013104 Ga0157370_10064789 Ga0157370_100647892 333
76 3300013105 Ga0157369_10005745 Ga0157369_100057454 333
77 3300013105 Ga0157369_10035299 Ga0157369_100352993 333
78 3300013307 Ga0157372_10004158 Ga0157372_100041589 333
79 3300013307 Ga0157372_10308572 Ga0157372_103085722 333
80 3300025904 Ga0207647_10000915 Ga0207647_1000091511 333
81 3300025913 Ga0207695_10021886 Ga0207695_100218862 333
82 3300025914 Ga0207671_10094451 Ga0207671_100944512 333
83 3300025919 Ga0207657_10004911 Ga0207657_100049111 333
84 3300025920 Ga0207649_10263722 Ga0207649_102637221 333
85 3300025924 Ga0207694_10009197 Ga0207694_100091978 333
86 3300025932 Ga0207690_10002027 Ga0207690_100020275 333
87 3300026041 Ga0207639_10000355 Ga0207639_1000035519 333
88 3300026116 Ga0207674_10006814 Ga0207674_100068144 333
89 3300026142 Ga0207698_10013777 Ga0207698_100137774 333
90 3300031995 Ga0307409_100143918 Ga0307409_1001439182 333
91 3300037312 Ga0395899_0041900 Ga0395899_0041900_2147_3184 333
92 3300037418 Ga0395900_0413021 Ga0395900_0413021_85_1122 333
93 3300037466 Ga0395898_0008160 Ga0395898_0008160_7173_8210 333
94 3300037471 Ga0395905_0222706 Ga0395905_0222706_538_1575 333
95 3300044694 Ga0466963_0056143 Ga0466963_0056143_589_1644 333
96 3300045976 Ga0466967_0008570 Ga0466967_0008570_1209_2246 333
97 3300001979 JGI24740J21852_10019709 JGI24740J21852_100197093 334
98 3300001989 JGI24739J22299_10028247 JGI24739J22299_100282472 334
99 3300005327 Ga0070658_10000782 Ga0070658_1000078213 334
100 3300005329 Ga0070683_100019811 Ga0070683_1000198114 334
101 3300005330 Ga0070690_100109307 Ga0070690_1001093071 334
102 3300005331 Ga0070670_100011696 Ga0070670_1000116964 334
103 3300005335 Ga0070666_10001345 Ga0070666_100013455 334
104 3300005335 Ga0070666_10015889 Ga0070666_100158893 334
105 3300005336 Ga0070680_100000229 Ga0070680_10000022937 334
106 3300005338 Ga0068868_100011248 Ga0068868_1000112482 334
107 3300005339 Ga0070660_100000534 Ga0070660_10000053411 334
108 3300005339 Ga0070660_100011019 Ga0070660_1000110198 334
109 3300005339 Ga0070660_100040654 Ga0070660_1000406542 334
110 3300005339 Ga0070660_100080669 Ga0070660_1000806693 334
111 3300005344 Ga0070661_100000452 Ga0070661_10000045225 334
112 3300005344 Ga0070661_100082958 Ga0070661_1000829582 334
113 3300005355 Ga0070671_100054553 Ga0070671_1000545535 334
114 3300005364 Ga0070673_100525271 Ga0070673_1005252711 334
115 3300005366 Ga0070659_100000138 Ga0070659_10000013853 334
116 3300005366 Ga0070659_100023598 Ga0070659_1000235984 334
117 3300005367 Ga0070667_100002750 Ga0070667_10000275013 334
118 3300005455 Ga0070663_100001141 Ga0070663_1000011419 334
119 3300005457 Ga0070662_100000410 Ga0070662_10000041020 334
120 3300005535 Ga0070684_100005736 Ga0070684_1000057368 334
121 3300005539 Ga0068853_100000479 Ga0068853_10000047921 334
122 3300005539 Ga0068853_100194512 Ga0068853_1001945123 334
123 3300005548 Ga0070665_100012118 Ga0070665_10001211811 334
124 3300005563 Ga0068855_100000163 Ga0068855_1000001633 334
125 3300005564 Ga0070664_100000717 Ga0070664_10000071711 334
126 3300005564 Ga0070664_100005094 Ga0070664_1000050947 334
127 3300005614 Ga0068856_100000829 Ga0068856_10000082913 334
128 3300005614 Ga0068856_100012320 Ga0068856_1000123204 334
129 3300005616 Ga0068852_100004060 Ga0068852_10000406011 334
130 3300005616 Ga0068852_100067182 Ga0068852_1000671825 334
131 3300005617 Ga0068859_100111924 Ga0068859_1001119242 334
132 3300005618 Ga0068864_100020340 Ga0068864_1000203405 334
133 3300005842 Ga0068858_100005894 Ga0068858_1000058949 334
134 3300005985 Ga0081539_10048975 Ga0081539_100489754 334
135 3300006931 Ga0097620_100111921 Ga0097620_1001119212 334
136 3300009174 Ga0105241_10008936 Ga0105241_100089365 334
137 3300009177 Ga0105248_10001737 Ga0105248_100017378 334
138 3300009177 Ga0105248_10002097 Ga0105248_1000209724 334
139 3300009551 Ga0105238_10037875 Ga0105238_100378756 334
140 3300013100 Ga0157373_10002817 Ga0157373_1000281713 334
141 3300013102 Ga0157371_10000784 Ga0157371_1000078415 334
142 3300014325 Ga0163163_10004685 Ga0163163_1000468512 334
143 3300014969 Ga0157376_10596950 Ga0157376_105969501 334
144 3300025903 Ga0207680_10000501 Ga0207680_1000050117 334
145 3300025903 Ga0207680_10003501 Ga0207680_100035016 334
146 3300025904 Ga0207647_10002329 Ga0207647_1000232910 334
147 3300025904 Ga0207647_10013857 Ga0207647_100138576 334
148 3300025909 Ga0207705_10000260 Ga0207705_1000026011 334
149 3300025911 Ga0207654_10009903 Ga0207654_100099036 334
150 3300025912 Ga0207707_10074581 Ga0207707_100745813 334
151 3300025917 Ga0207660_10000092 Ga0207660_1000009240 334
152 3300025918 Ga0207662_10091000 Ga0207662_100910002 334
153 3300025919 Ga0207657_10000031 Ga0207657_10000031143 334
154 3300025919 Ga0207657_10002036 Ga0207657_1000203618 334
155 3300025919 Ga0207657_10004476 Ga0207657_1000447616 334
156 3300025919 Ga0207657_10044980 Ga0207657_100449803 334
157 3300025920 Ga0207649_10000394 Ga0207649_100003946 334
158 3300025920 Ga0207649_10041415 Ga0207649_100414154 334
159 3300025924 Ga0207694_10026872 Ga0207694_100268722 334
160 3300025925 Ga0207650_10075786 Ga0207650_100757862 334
161 3300025931 Ga0207644_10005523 Ga0207644_100055236 334
162 3300025932 Ga0207690_10003027 Ga0207690_100030275 334
163 3300025932 Ga0207690_10004603 Ga0207690_100046037 334
164 3300025932 Ga0207690_10046276 Ga0207690_100462762 334
165 3300025933 Ga0207706_10000028 Ga0207706_10000028161 334
166 3300025941 Ga0207711_10002646 Ga0207711_100026468 334
167 3300025941 Ga0207711_10006230 Ga0207711_1000623010 334
168 3300025944 Ga0207661_10013422 Ga0207661_100134224 334
169 3300025945 Ga0207679_10000488 Ga0207679_1000048819 334
170 3300025945 Ga0207679_10018843 Ga0207679_100188433 334
171 3300025945 Ga0207679_10033904 Ga0207679_100339042 334
172 3300025949 Ga0207667_10003386 Ga0207667_1000338618 334
173 3300025960 Ga0207651_10202983 Ga0207651_102029832 334
174 3300025981 Ga0207640_10006666 Ga0207640_100066666 334
175 3300025986 Ga0207658_10004081 Ga0207658_100040819 334
176 3300026035 Ga0207703_10002884 Ga0207703_100028847 334
177 3300026035 Ga0207703_10015498 Ga0207703_100154981 334
178 3300026041 Ga0207639_10000131 Ga0207639_100001317 334
179 3300026041 Ga0207639_10077612 Ga0207639_100776122 334
180 3300026041 Ga0207639_10115822 Ga0207639_101158222 334
181 3300026067 Ga0207678_10003255 Ga0207678_1000325512 334
182 3300026067 Ga0207678_10005871 Ga0207678_100058716 334
183 3300026067 Ga0207678_10084379 Ga0207678_100843792 334
184 3300026078 Ga0207702_10000247 Ga0207702_1000024757 334
185 3300026078 Ga0207702_10005325 Ga0207702_100053254 334
186 3300026095 Ga0207676_10015859 Ga0207676_100158595 334
187 3300026142 Ga0207698_10044760 Ga0207698_100447603 334
188 3300028379 Ga0268266_10043628 Ga0268266_100436283 334
189 3300035691 Ga0373931_0009145 Ga0373931_0009145_3568_4608 334
190 3300037471 Ga0395905_0037612 Ga0395905_0037612_2765_3802 334
191 3300038443 Ga0395901_0139296 Ga0395901_0139296_966_2003 334
192 3300048913 Ga0496110_0112597 Ga0496110_0112597_489_1529 334
193 3300048915 Ga0496112_0006100 Ga0496112_0006100_5809_6849 334
194 3300048916 Ga0496113_0226911 Ga0496113_0226911_179_1219 334
195 iso_pu_bacteria 2895880812 2895884208 334
196 iso_pu_bacteria 2919138771 2919142786 334
197 3300001915 JGI24741J21665_1000961 JGI24741J21665_10009612 335
198 3300001979 JGI24740J21852_10008686 JGI24740J21852_100086863 335
199 3300001979 JGI24740J21852_10031289 JGI24740J21852_100312892 335
200 3300001989 JGI24739J22299_10001423 JGI24739J22299_100014233 335
201 3300001990 JGI24737J22298_10003000 JGI24737J22298_100030002 335
202 3300001991 JGI24743J22301_10015140 JGI24743J22301_100151402 335
203 3300002067 JGI24735J21928_10000320 JGI24735J21928_1000032014 335
204 3300002067 JGI24735J21928_10013796 JGI24735J21928_100137962 335
205 3300003763 Ga0055529_1009615 Ga0055529_10096152 335
206 3300005293 Ga0065715_10162638 Ga0065715_101626382 335
207 3300005327 Ga0070658_10000957 Ga0070658_1000095715 335
208 3300005327 Ga0070658_10013316 Ga0070658_100133162 335
209 3300005329 Ga0070683_100009918 Ga0070683_1000099185 335
210 3300005331 Ga0070670_100174992 Ga0070670_1001749922 335
211 3300005333 Ga0070677_10011949 Ga0070677_100119494 335
212 3300005335 Ga0070666_10009064 Ga0070666_100090645 335
213 3300005336 Ga0070680_100054146 Ga0070680_1000541463 335
214 3300005337 Ga0070682_100079506 Ga0070682_1000795062 335
215 3300005338 Ga0068868_100066750 Ga0068868_1000667504 335
216 3300005339 Ga0070660_100008891 Ga0070660_1000088917 335
217 3300005339 Ga0070660_100013486 Ga0070660_1000134868 335
218 3300005344 Ga0070661_100013519 Ga0070661_1000135198 335
219 3300005344 Ga0070661_100027204 Ga0070661_1000272042 335
220 3300005353 Ga0070669_100077414 Ga0070669_1000774142 335
221 3300005354 Ga0070675_100015582 Ga0070675_1000155823 335
222 3300005355 Ga0070671_100060096 Ga0070671_1000600962 335
223 3300005355 Ga0070671_100063174 Ga0070671_1000631741 335
224 3300005364 Ga0070673_100020913 Ga0070673_1000209132 335
225 3300005364 Ga0070673_100089440 Ga0070673_1000894401 335
226 3300005364 Ga0070673_100097596 Ga0070673_1000975962 335
227 3300005366 Ga0070659_100032994 Ga0070659_1000329942 335
228 3300005367 Ga0070667_100023633 Ga0070667_1000236335 335
229 3300005457 Ga0070662_100007245 Ga0070662_1000072452 335
230 3300005458 Ga0070681_10176673 Ga0070681_101766731 335
231 3300005535 Ga0070684_100120076 Ga0070684_1001200762 335
232 3300005539 Ga0068853_100008492 Ga0068853_1000084924 335
233 3300005539 Ga0068853_100017832 Ga0068853_1000178326 335
234 3300005548 Ga0070665_100016583 Ga0070665_10001658312 335
235 3300005563 Ga0068855_100221271 Ga0068855_1002212713 335
236 3300005564 Ga0070664_100038286 Ga0070664_1000382862 335
237 3300005577 Ga0068857_100005963 Ga0068857_1000059633 335
238 3300005577 Ga0068857_100021781 Ga0068857_1000217816 335
239 3300005578 Ga0068854_100000271 Ga0068854_1000002718 335
240 3300005578 Ga0068854_100000908 Ga0068854_10000090814 335
241 3300005578 Ga0068854_100004748 Ga0068854_1000047486 335
242 3300005578 Ga0068854_100014328 Ga0068854_1000143283 335
243 3300005616 Ga0068852_100004104 Ga0068852_1000041048 335
244 3300005616 Ga0068852_100013554 Ga0068852_1000135546 335
245 3300005841 Ga0068863_100033280 Ga0068863_1000332806 335
246 3300005841 Ga0068863_100128884 Ga0068863_1001288843 335
247 3300005842 Ga0068858_100019265 Ga0068858_1000192657 335
248 3300005842 Ga0068858_100020598 Ga0068858_1000205988 335
249 3300005843 Ga0068860_100004166 Ga0068860_1000041664 335
250 3300005843 Ga0068860_100055557 Ga0068860_1000555575 335
251 3300006237 Ga0097621_100004538 Ga0097621_1000045385 335
252 3300006358 Ga0068871_100006035 Ga0068871_1000060353 335
253 3300006358 Ga0068871_100025989 Ga0068871_1000259895 335
254 3300006852 Ga0075433_10005617 Ga0075433_100056178 335
255 3300006881 Ga0068865_100115149 Ga0068865_1001151491 335
256 3300009093 Ga0105240_10074433 Ga0105240_100744334 335
257 3300010375 Ga0105239_10045932 Ga0105239_100459327 335
258 3300010375 Ga0105239_10210519 Ga0105239_102105191 335
259 3300013102 Ga0157371_10140823 Ga0157371_101408232 335
260 3300013102 Ga0157371_10225770 Ga0157371_102257701 335
261 3300013104 Ga0157370_10108344 Ga0157370_101083444 335
262 3300013104 Ga0157370_10278255 Ga0157370_102782552 335
263 3300013296 Ga0157374_10053776 Ga0157374_100537764 335
264 3300013307 Ga0157372_10048417 Ga0157372_100484173 335
265 3300013307 Ga0157372_10116399 Ga0157372_101163993 335
266 3300014325 Ga0163163_10051578 Ga0163163_100515782 335
267 3300014326 Ga0157380_10001109 Ga0157380_1000110911 335
268 3300014326 Ga0157380_10140967 Ga0157380_101409672 335
269 3300020081 Ga0206354_10880722 Ga0206354_108807222 335
270 3300020082 Ga0206353_10897051 Ga0206353_108970511 335
271 3300025272 Ga0209455_1000908 Ga0209455_100090819 335
272 3300025893 Ga0207682_10001093 Ga0207682_1000109310 335
273 3300025909 Ga0207705_10004869 Ga0207705_100048697 335
274 3300025909 Ga0207705_10014786 Ga0207705_100147864 335
275 3300025909 Ga0207705_10028066 Ga0207705_100280665 335
276 3300025911 Ga0207654_10044933 Ga0207654_100449332 335
277 3300025912 Ga0207707_10050410 Ga0207707_100504102 335
278 3300025912 Ga0207707_10089582 Ga0207707_100895825 335
279 3300025913 Ga0207695_10137843 Ga0207695_101378433 335
280 3300025913 Ga0207695_10256062 Ga0207695_102560622 335
281 3300025917 Ga0207660_10004148 Ga0207660_100041488 335
282 3300025917 Ga0207660_10007383 Ga0207660_100073833 335
283 3300025919 Ga0207657_10001070 Ga0207657_1000107016 335
284 3300025919 Ga0207657_10012446 Ga0207657_1001244610 335
285 3300025919 Ga0207657_10014514 Ga0207657_100145143 335
286 3300025919 Ga0207657_10114137 Ga0207657_101141372 335
287 3300025920 Ga0207649_10019524 Ga0207649_100195242 335
288 3300025921 Ga0207652_10158797 Ga0207652_101587972 335
289 3300025923 Ga0207681_10039364 Ga0207681_100393641 335
290 3300025923 Ga0207681_10072099 Ga0207681_100720994 335
291 3300025925 Ga0207650_10067694 Ga0207650_100676942 335
292 3300025925 Ga0207650_10164804 Ga0207650_101648042 335
293 3300025925 Ga0207650_10236069 Ga0207650_102360691 335
294 3300025926 Ga0207659_10028571 Ga0207659_100285713 335
295 3300025926 Ga0207659_10103953 Ga0207659_101039532 335
296 3300025927 Ga0207687_10083158 Ga0207687_100831582 335
297 3300025931 Ga0207644_10025135 Ga0207644_100251353 335
298 3300025932 Ga0207690_10010002 Ga0207690_100100023 335
299 3300025932 Ga0207690_10012158 Ga0207690_100121583 335
300 3300025932 Ga0207690_10036510 Ga0207690_100365102 335
301 3300025932 Ga0207690_10189356 Ga0207690_101893562 335
302 3300025933 Ga0207706_10001051 Ga0207706_1000105114 335
303 3300025933 Ga0207706_10005306 Ga0207706_1000530615 335
304 3300025933 Ga0207706_10018472 Ga0207706_100184725 335
305 3300025933 Ga0207706_10039615 Ga0207706_100396153 335
306 3300025933 Ga0207706_10090600 Ga0207706_100906003 335
307 3300025938 Ga0207704_10070397 Ga0207704_100703971 335
308 3300025940 Ga0207691_10139845 Ga0207691_101398452 335
309 3300025941 Ga0207711_10055386 Ga0207711_100553864 335
310 3300025941 Ga0207711_10066516 Ga0207711_100665164 335
311 3300025942 Ga0207689_10007724 Ga0207689_100077247 335
312 3300025945 Ga0207679_10007231 Ga0207679_100072313 335
313 3300025945 Ga0207679_10096650 Ga0207679_100966502 335
314 3300025945 Ga0207679_10339495 Ga0207679_103394952 335
315 3300025949 Ga0207667_10125238 Ga0207667_101252383 335
316 3300025949 Ga0207667_10180968 Ga0207667_101809682 335
317 3300025960 Ga0207651_10167972 Ga0207651_101679721 335
318 3300025961 Ga0207712_10001686 Ga0207712_1000168618 335
319 3300025972 Ga0207668_10043985 Ga0207668_100439854 335
320 3300025981 Ga0207640_10001147 Ga0207640_100011477 335
321 3300025986 Ga0207658_10093781 Ga0207658_100937812 335
322 3300026023 Ga0207677_10074804 Ga0207677_100748041 335
323 3300026035 Ga0207703_10018948 Ga0207703_100189488 335
324 3300026035 Ga0207703_10067042 Ga0207703_100670424 335
325 3300026041 Ga0207639_10006432 Ga0207639_100064327 335
326 3300026041 Ga0207639_10017897 Ga0207639_100178978 335
327 3300026041 Ga0207639_10019953 Ga0207639_100199533 335
328 3300026067 Ga0207678_10000354 Ga0207678_1000035425 335
329 3300026067 Ga0207678_10010090 Ga0207678_100100905 335
330 3300026078 Ga0207702_10125307 Ga0207702_101253072 335
331 3300026088 Ga0207641_10014799 Ga0207641_100147996 335
332 3300026088 Ga0207641_10066075 Ga0207641_100660754 335
333 3300026116 Ga0207674_10001496 Ga0207674_1000149623 335
334 3300026116 Ga0207674_10003651 Ga0207674_100036517 335
335 3300026116 Ga0207674_10020702 Ga0207674_100207022 335
336 3300026116 Ga0207674_10096401 Ga0207674_100964012 335
337 3300026121 Ga0207683_10249991 Ga0207683_102499912 335
338 3300026142 Ga0207698_10025698 Ga0207698_100256982 335
339 3300028380 Ga0268265_10060919 Ga0268265_100609193 335
340 3300028381 Ga0268264_10003174 Ga0268264_1000317415 335
341 3300031824 Ga0307413_10003861 Ga0307413_100038615 335
342 3300031824 Ga0307413_10011539 Ga0307413_100115393 335
343 3300031824 Ga0307413_10053678 Ga0307413_100536782 335
344 3300031852 Ga0307410_10034163 Ga0307410_100341632 335
345 3300031852 Ga0307410_10200438 Ga0307410_102004382 335
346 3300031903 Ga0307407_10005056 Ga0307407_100050563 335
347 3300031995 Ga0307409_100017575 Ga0307409_1000175756 335
348 3300032002 Ga0307416_100102563 Ga0307416_1001025632 335
349 3300032004 Ga0307414_10007540 Ga0307414_100075406 335
350 3300032005 Ga0307411_10004433 Ga0307411_1000443312 335
351 3300032005 Ga0307411_10011377 Ga0307411_100113772 335
352 3300037312 Ga0395899_0000113 Ga0395899_0000113_130238_131278 335
353 3300037312 Ga0395899_0071293 Ga0395899_0071293_987_2033 335
354 3300037312 Ga0395899_0207156 Ga0395899_0207156_176_1216 335
355 3300037418 Ga0395900_0000583 Ga0395900_0000583_22811_23851 335
356 3300037418 Ga0395900_0039154 Ga0395900_0039154_293_1333 335
357 3300037418 Ga0395900_0082475 Ga0395900_0082475_510_1556 335
358 3300037418 Ga0395900_0099886 Ga0395900_0099886_222_1262 335
359 3300037418 Ga0395900_0355247 Ga0395900_0355247_13_1062 335
360 3300037466 Ga0395898_0000087 Ga0395898_0000087_229624_230664 335
361 3300037466 Ga0395898_0007172 Ga0395898_0007172_2432_3472 335
362 3300037466 Ga0395898_0328879 Ga0395898_0328879_26_1072 335
363 3300037471 Ga0395905_0000005 Ga0395905_0000005_229624_230664 335
364 3300037471 Ga0395905_0002977 Ga0395905_0002977_3553_4593 335
365 3300037471 Ga0395905_0013410 Ga0395905_0013410_713_1762 335
366 3300037471 Ga0395905_0086231 Ga0395905_0086231_149_1195 335
367 3300037471 Ga0395905_0132998 Ga0395905_0132998_112_1152 335
368 3300037471 Ga0395905_0243840 Ga0395905_0243840_196_1236 335
369 3300037471 Ga0395905_0341767 Ga0395905_0341767_262_1302 335
370 3300038443 Ga0395901_0001812 Ga0395901_0001812_7036_8076 335
371 3300038443 Ga0395901_0012933 Ga0395901_0012933_4791_5831 335
372 3300038443 Ga0395901_0096593 Ga0395901_0096593_510_1556 335
373 3300038443 Ga0395901_0151464 Ga0395901_0151464_110_1150 335
374 3300038443 Ga0395901_0154411 Ga0395901_0154411_451_1491 335
375 3300044684 Ga0466966_0003525 Ga0466966_0003525_4675_5721 335
376 3300044684 Ga0466966_0027185 Ga0466966_0027185_80_1123 335
377 3300044684 Ga0466966_0046583 Ga0466966_0046583_75_1121 335
378 3300044694 Ga0466963_0215104 Ga0466963_0215104_74_1117 335
379 3300045976 Ga0466967_0033304 Ga0466967_0033304_1642_2682 335
380 3300046616 Ga0495668_0008130 Ga0495668_0008130_3672_4712 335
381 3300046684 Ga0495669_0000563 Ga0495669_0000563_4730_5770 335
382 3300046684 Ga0495669_0005221 Ga0495669_0005221_3627_4667 335
383 3300046684 Ga0495669_0015892 Ga0495669_0015892_463_1503 335
384 3300046684 Ga0495669_0017842 Ga0495669_0017842_1165_2205 335
385 3300048903 Ga0496100_0341763 Ga0496100_0341763_47_1090 335
386 3300048911 Ga0496108_0000700 Ga0496108_0000700_11106_12146 335
387 3300048915 Ga0496112_0004870 Ga0496112_0004870_3668_4711 335
388 3300048915 Ga0496112_0045733 Ga0496112_0045733_2238_3278 335
389 3300048916 Ga0496113_0032626 Ga0496113_0032626_1644_2684 335
390 3300049742 Ga0501080_0011338 Ga0501080_0011338_555_1595 335
391 3300050507 nmdc:mga05p37_416076_c1 nmdc:mga05p37_416076_c1_56_1096 335
392 3300050515 nmdc:mga0a205_4261_c1 nmdc:mga0a205_4261_c1_4850_5890 335
393 iso_pu_bacteria 2510917021 2511127887 335
394 3300001976 JGI24752J21851_1003302 JGI24752J21851_10033022 336
395 3300001979 JGI24740J21852_10006220 JGI24740J21852_100062206 336
396 3300001989 JGI24739J22299_10000825 JGI24739J22299_100008258 336
397 3300001990 JGI24737J22298_10002103 JGI24737J22298_100021036 336
398 3300002067 JGI24735J21928_10001306 JGI24735J21928_100013067 336
399 3300002067 JGI24735J21928_10001365 JGI24735J21928_100013654 336
400 3300002067 JGI24735J21928_10012561 JGI24735J21928_100125612 336
401 3300002067 JGI24735J21928_10017202 JGI24735J21928_100172023 336
402 3300002075 JGI24738J21930_10001641 JGI24738J21930_100016416 336
403 3300002077 JGI24744J21845_10005497 JGI24744J21845_100054972 336
404 3300005293 Ga0065715_10146087 Ga0065715_101460872 336
405 3300005327 Ga0070658_10000238 Ga0070658_100002382 336
406 3300005327 Ga0070658_10020042 Ga0070658_100200427 336
407 3300005327 Ga0070658_10027324 Ga0070658_100273241 336
408 3300005328 Ga0070676_10035417 Ga0070676_100354171 336
409 3300005329 Ga0070683_100005307 Ga0070683_10000530710 336
410 3300005329 Ga0070683_100098166 Ga0070683_1000981661 336
411 3300005330 Ga0070690_100001926 Ga0070690_1000019264 336
412 3300005331 Ga0070670_100004030 Ga0070670_1000040309 336
413 3300005331 Ga0070670_100016696 Ga0070670_1000166967 336
414 3300005331 Ga0070670_100020944 Ga0070670_1000209442 336
415 3300005331 Ga0070670_100048629 Ga0070670_1000486296 336
416 3300005331 Ga0070670_100059848 Ga0070670_1000598484 336
417 3300005331 Ga0070670_100166223 Ga0070670_1001662232 336
418 3300005333 Ga0070677_10004371 Ga0070677_100043714 336
419 3300005333 Ga0070677_10032535 Ga0070677_100325352 336
420 3300005334 Ga0068869_100166019 Ga0068869_1001660192 336
421 3300005335 Ga0070666_10087251 Ga0070666_100872511 336
422 3300005336 Ga0070680_100010106 Ga0070680_1000101069 336
423 3300005337 Ga0070682_100024362 Ga0070682_1000243622 336
424 3300005339 Ga0070660_100010009 Ga0070660_1000100095 336
425 3300005339 Ga0070660_100028551 Ga0070660_1000285512 336
426 3300005339 Ga0070660_100069953 Ga0070660_1000699532 336
427 3300005339 Ga0070660_100075882 Ga0070660_1000758822 336
428 3300005339 Ga0070660_100110043 Ga0070660_1001100433 336
429 3300005341 Ga0070691_10000118 Ga0070691_100001187 336
430 3300005344 Ga0070661_100006277 Ga0070661_1000062773 336
431 3300005344 Ga0070661_100008953 Ga0070661_1000089532 336
432 3300005344 Ga0070661_100024860 Ga0070661_1000248603 336
433 3300005344 Ga0070661_100029570 Ga0070661_1000295702 336
434 3300005345 Ga0070692_10017289 Ga0070692_100172892 336
435 3300005347 Ga0070668_100374157 Ga0070668_1003741571 336
436 3300005354 Ga0070675_100016168 Ga0070675_1000161688 336
437 3300005354 Ga0070675_100038333 Ga0070675_1000383337 336
438 3300005354 Ga0070675_100283449 Ga0070675_1002834491 336
439 3300005355 Ga0070671_100002744 Ga0070671_10000274410 336
440 3300005355 Ga0070671_100002903 Ga0070671_1000029034 336
441 3300005355 Ga0070671_100002919 Ga0070671_1000029195 336
442 3300005355 Ga0070671_100006335 Ga0070671_1000063352 336
443 3300005355 Ga0070671_100009383 Ga0070671_1000093839 336
444 3300005355 Ga0070671_100012877 Ga0070671_1000128776 336
445 3300005355 Ga0070671_100015529 Ga0070671_1000155292 336
446 3300005355 Ga0070671_100037543 Ga0070671_1000375433 336
447 3300005355 Ga0070671_100040247 Ga0070671_1000402475 336
448 3300005355 Ga0070671_100044926 Ga0070671_1000449265 336
449 3300005356 Ga0070674_100031585 Ga0070674_1000315853 336
450 3300005356 Ga0070674_100037679 Ga0070674_1000376794 336
451 3300005364 Ga0070673_100001831 Ga0070673_1000018313 336
452 3300005364 Ga0070673_100003651 Ga0070673_1000036517 336
453 3300005364 Ga0070673_100016867 Ga0070673_1000168673 336
454 3300005364 Ga0070673_100068170 Ga0070673_1000681704 336
455 3300005364 Ga0070673_100069701 Ga0070673_1000697013 336
456 3300005366 Ga0070659_100017039 Ga0070659_1000170391 336
457 3300005366 Ga0070659_100017588 Ga0070659_1000175887 336
458 3300005366 Ga0070659_100046376 Ga0070659_1000463762 336
459 3300005366 Ga0070659_100109271 Ga0070659_1001092712 336
460 3300005366 Ga0070659_100196694 Ga0070659_1001966942 336
461 3300005366 Ga0070659_100203066 Ga0070659_1002030662 336
462 3300005367 Ga0070667_100005263 Ga0070667_1000052638 336
463 3300005367 Ga0070667_100006461 Ga0070667_1000064619 336
464 3300005367 Ga0070667_100007891 Ga0070667_1000078916 336
465 3300005367 Ga0070667_100026628 Ga0070667_1000266284 336
466 3300005367 Ga0070667_100064793 Ga0070667_1000647933 336
467 3300005367 Ga0070667_100067637 Ga0070667_1000676375 336
468 3300005367 Ga0070667_100170167 Ga0070667_1001701671 336
469 3300005367 Ga0070667_100211195 Ga0070667_1002111951 336
470 3300005367 Ga0070667_100347831 Ga0070667_1003478311 336
471 3300005434 Ga0070709_10010172 Ga0070709_100101724 336
472 3300005435 Ga0070714_100023984 Ga0070714_1000239847 336
473 3300005435 Ga0070714_100049345 Ga0070714_1000493452 336
474 3300005435 Ga0070714_100055937 Ga0070714_1000559372 336
475 3300005435 Ga0070714_100177934 Ga0070714_1001779342 336
476 3300005436 Ga0070713_100013582 Ga0070713_1000135822 336
477 3300005436 Ga0070713_100188435 Ga0070713_1001884352 336
478 3300005444 Ga0070694_100042714 Ga0070694_1000427141 336
479 3300005455 Ga0070663_100009681 Ga0070663_1000096818 336
480 3300005455 Ga0070663_100041411 Ga0070663_1000414112 336
481 3300005456 Ga0070678_100014954 Ga0070678_1000149544 336
482 3300005456 Ga0070678_100062050 Ga0070678_1000620502 336
483 3300005457 Ga0070662_100012337 Ga0070662_1000123373 336
484 3300005457 Ga0070662_100013436 Ga0070662_1000134361 336
485 3300005457 Ga0070662_100014633 Ga0070662_1000146334 336
486 3300005457 Ga0070662_100021934 Ga0070662_1000219342 336
487 3300005457 Ga0070662_100032906 Ga0070662_1000329063 336
488 3300005457 Ga0070662_100044517 Ga0070662_1000445173 336
489 3300005458 Ga0070681_10108684 Ga0070681_101086844 336
490 3300005459 Ga0068867_100003061 Ga0068867_1000030616 336
491 3300005459 Ga0068867_100003944 Ga0068867_10000394412 336
492 3300005459 Ga0068867_100029300 Ga0068867_1000293006 336
493 3300005530 Ga0070679_100013487 Ga0070679_1000134876 336
494 3300005530 Ga0070679_100412459 Ga0070679_1004124591 336
495 3300005535 Ga0070684_100035436 Ga0070684_1000354363 336
496 3300005535 Ga0070684_100145318 Ga0070684_1001453181 336
497 3300005539 Ga0068853_100011550 Ga0068853_1000115508 336
498 3300005539 Ga0068853_100041294 Ga0068853_1000412943 336
499 3300005539 Ga0068853_100046921 Ga0068853_1000469214 336
500 3300005539 Ga0068853_100075540 Ga0068853_1000755403 336
501 3300005543 Ga0070672_100002396 Ga0070672_1000023968 336
502 3300005543 Ga0070672_100016832 Ga0070672_1000168323 336
503 3300005543 Ga0070672_100017176 Ga0070672_1000171762 336
504 3300005543 Ga0070672_100139864 Ga0070672_1001398642 336
505 3300005544 Ga0070686_100010217 Ga0070686_1000102177 336
506 3300005547 Ga0070693_100137879 Ga0070693_1001378792 336
507 3300005547 Ga0070693_100149994 Ga0070693_1001499941 336
508 3300005548 Ga0070665_100022459 Ga0070665_1000224599 336
509 3300005548 Ga0070665_100025694 Ga0070665_1000256944 336
510 3300005548 Ga0070665_100079356 Ga0070665_1000793563 336
511 3300005548 Ga0070665_100081552 Ga0070665_1000815524 336
512 3300005563 Ga0068855_100070038 Ga0068855_1000700383 336
513 3300005563 Ga0068855_100096072 Ga0068855_1000960722 336
514 3300005563 Ga0068855_100102095 Ga0068855_1001020952 336
515 3300005564 Ga0070664_100004456 Ga0070664_1000044567 336
516 3300005564 Ga0070664_100008923 Ga0070664_1000089238 336
517 3300005564 Ga0070664_100010793 Ga0070664_1000107935 336
518 3300005564 Ga0070664_100016944 Ga0070664_1000169446 336
519 3300005564 Ga0070664_100033819 Ga0070664_1000338195 336
520 3300005564 Ga0070664_100044660 Ga0070664_1000446605 336
521 3300005564 Ga0070664_100053026 Ga0070664_1000530263 336
522 3300005564 Ga0070664_100165255 Ga0070664_1001652552 336
523 3300005577 Ga0068857_100017383 Ga0068857_1000173835 336
524 3300005577 Ga0068857_100033659 Ga0068857_1000336593 336
525 3300005577 Ga0068857_100130965 Ga0068857_1001309653 336
526 3300005577 Ga0068857_100299253 Ga0068857_1002992532 336
527 3300005577 Ga0068857_100308931 Ga0068857_1003089312 336
528 3300005578 Ga0068854_100018382 Ga0068854_1000183826 336
529 3300005578 Ga0068854_100054560 Ga0068854_1000545605 336
530 3300005578 Ga0068854_100090933 Ga0068854_1000909332 336
531 3300005578 Ga0068854_100214067 Ga0068854_1002140672 336
532 3300005614 Ga0068856_100016277 Ga0068856_1000162773 336
533 3300005614 Ga0068856_100246069 Ga0068856_1002460692 336
534 3300005614 Ga0068856_100378907 Ga0068856_1003789072 336
535 3300005616 Ga0068852_100001950 Ga0068852_1000019505 336
536 3300005616 Ga0068852_100013117 Ga0068852_1000131179 336
537 3300005616 Ga0068852_100019523 Ga0068852_1000195233 336
538 3300005616 Ga0068852_100053370 Ga0068852_1000533703 336
539 3300005616 Ga0068852_100097524 Ga0068852_1000975243 336
540 3300005616 Ga0068852_100105081 Ga0068852_1001050813 336
541 3300005617 Ga0068859_100006555 Ga0068859_1000065559 336
542 3300005617 Ga0068859_100028314 Ga0068859_1000283144 336
543 3300005617 Ga0068859_100041221 Ga0068859_1000412214 336
544 3300005617 Ga0068859_100049792 Ga0068859_1000497922 336
545 3300005617 Ga0068859_100099988 Ga0068859_1000999882 336
546 3300005618 Ga0068864_100000311 Ga0068864_10000031110 336
547 3300005618 Ga0068864_100000557 Ga0068864_10000055714 336
548 3300005618 Ga0068864_100001679 Ga0068864_10000167918 336
549 3300005618 Ga0068864_100010914 Ga0068864_1000109148 336
550 3300005618 Ga0068864_100011375 Ga0068864_10001137510 336
551 3300005618 Ga0068864_100013559 Ga0068864_1000135597 336
552 3300005618 Ga0068864_100116610 Ga0068864_1001166103 336
553 3300005718 Ga0068866_10004596 Ga0068866_100045967 336
554 3300005834 Ga0068851_10040523 Ga0068851_100405232 336
555 3300005834 Ga0068851_10047018 Ga0068851_100470182 336
556 3300005834 Ga0068851_10084982 Ga0068851_100849821 336
557 3300005840 Ga0068870_10155036 Ga0068870_101550362 336
558 3300005841 Ga0068863_100000569 Ga0068863_10000056915 336
559 3300005841 Ga0068863_100010532 Ga0068863_10001053212 336
560 3300005841 Ga0068863_100019112 Ga0068863_1000191129 336
561 3300005841 Ga0068863_100055894 Ga0068863_1000558942 336
562 3300005841 Ga0068863_100060742 Ga0068863_1000607422 336
563 3300005841 Ga0068863_100064562 Ga0068863_1000645622 336
564 3300005842 Ga0068858_100000604 Ga0068858_10000060416 336
565 3300005842 Ga0068858_100013497 Ga0068858_1000134972 336
566 3300005842 Ga0068858_100019228 Ga0068858_1000192284 336
567 3300005842 Ga0068858_100086175 Ga0068858_1000861752 336
568 3300005842 Ga0068858_100398112 Ga0068858_1003981122 336
569 3300005843 Ga0068860_100007782 Ga0068860_10000778216 336
570 3300005843 Ga0068860_100012161 Ga0068860_10001216111 336
571 3300005843 Ga0068860_100045493 Ga0068860_1000454934 336
572 3300005844 Ga0068862_100004348 Ga0068862_10000434811 336
573 3300005844 Ga0068862_100005678 Ga0068862_1000056784 336
574 3300005844 Ga0068862_100007390 Ga0068862_10000739010 336
575 3300005844 Ga0068862_100018824 Ga0068862_1000188243 336
576 3300005985 Ga0081539_10048860 Ga0081539_100488603 336
577 3300006028 Ga0070717_10052082 Ga0070717_100520822 336
578 3300006028 Ga0070717_10202408 Ga0070717_102024082 336
579 3300006175 Ga0070712_100024698 Ga0070712_1000246982 336
580 3300006175 Ga0070712_100041064 Ga0070712_1000410643 336
581 3300006237 Ga0097621_100048548 Ga0097621_1000485482 336
582 3300006237 Ga0097621_100052299 Ga0097621_1000522993 336
583 3300006358 Ga0068871_100015991 Ga0068871_1000159912 336
584 3300006881 Ga0068865_100001641 Ga0068865_10000164111 336
585 3300006881 Ga0068865_100015125 Ga0068865_1000151258 336
586 3300006931 Ga0097620_100006555 Ga0097620_1000065559 336
587 3300006931 Ga0097620_100028315 Ga0097620_1000283154 336
588 3300006931 Ga0097620_100041219 Ga0097620_1000412194 336
589 3300006931 Ga0097620_100049789 Ga0097620_1000497896 336
590 3300006931 Ga0097620_100099989 Ga0097620_1000999894 336
591 3300009092 Ga0105250_10029582 Ga0105250_100295823 336
592 3300009093 Ga0105240_10143006 Ga0105240_101430061 336
593 3300009098 Ga0105245_10028834 Ga0105245_100288344 336
594 3300009148 Ga0105243_10060263 Ga0105243_100602633 336
595 3300009176 Ga0105242_10029141 Ga0105242_100291413 336
596 3300009177 Ga0105248_10000070 Ga0105248_1000007036 336
597 3300009177 Ga0105248_10000802 Ga0105248_100008023 336
598 3300009177 Ga0105248_10003700 Ga0105248_100037009 336
599 3300009177 Ga0105248_10007459 Ga0105248_1000745913 336
600 3300009177 Ga0105248_10012039 Ga0105248_100120397 336
601 3300009177 Ga0105248_10015899 Ga0105248_100158995 336
602 3300009177 Ga0105248_10020775 Ga0105248_100207758 336
603 3300009177 Ga0105248_10048183 Ga0105248_100481835 336
604 3300009177 Ga0105248_10125364 Ga0105248_101253642 336
605 3300009177 Ga0105248_10428093 Ga0105248_104280931 336
606 3300009545 Ga0105237_10066711 Ga0105237_100667115 336
607 3300009551 Ga0105238_10047479 Ga0105238_100474794 336
608 3300009551 Ga0105238_10050824 Ga0105238_100508242 336
609 3300009553 Ga0105249_10209952 Ga0105249_102099522 336
610 3300009553 Ga0105249_10591444 Ga0105249_105914441 336
611 3300010375 Ga0105239_10555535 Ga0105239_105555351 336
612 3300013100 Ga0157373_10004924 Ga0157373_100049242 336
613 3300013100 Ga0157373_10015756 Ga0157373_100157562 336
614 3300013100 Ga0157373_10105471 Ga0157373_101054712 336
615 3300013102 Ga0157371_10007318 Ga0157371_100073183 336
616 3300013102 Ga0157371_10185431 Ga0157371_101854312 336
617 3300013102 Ga0157371_10203645 Ga0157371_102036452 336
618 3300013104 Ga0157370_10046717 Ga0157370_100467175 336
619 3300013104 Ga0157370_10087055 Ga0157370_100870554 336
620 3300013104 Ga0157370_10153698 Ga0157370_101536982 336
621 3300013105 Ga0157369_10001571 Ga0157369_100015713 336
622 3300013105 Ga0157369_10032891 Ga0157369_100328919 336
623 3300013105 Ga0157369_10058213 Ga0157369_100582134 336
624 3300013296 Ga0157374_10017249 Ga0157374_1001724910 336
625 3300013296 Ga0157374_10042657 Ga0157374_100426572 336
626 3300013296 Ga0157374_10042823 Ga0157374_100428235 336
627 3300013297 Ga0157378_10052515 Ga0157378_100525152 336
628 3300013297 Ga0157378_10298766 Ga0157378_102987662 336
629 3300013297 Ga0157378_10630315 Ga0157378_106303151 336
630 3300013306 Ga0163162_10001484 Ga0163162_1000148412 336
631 3300013306 Ga0163162_10043705 Ga0163162_100437052 336
632 3300013306 Ga0163162_10104977 Ga0163162_101049776 336
633 3300013307 Ga0157372_10032860 Ga0157372_100328602 336
634 3300013307 Ga0157372_10782227 Ga0157372_107822271 336
635 3300013308 Ga0157375_10000751 Ga0157375_1000075119 336
636 3300013308 Ga0157375_10004010 Ga0157375_100040108 336
637 3300013308 Ga0157375_10046294 Ga0157375_100462943 336
638 3300013308 Ga0157375_10211040 Ga0157375_102110402 336
639 3300014325 Ga0163163_10000135 Ga0163163_1000013562 336
640 3300014325 Ga0163163_10069868 Ga0163163_100698683 336
641 3300014325 Ga0163163_10220364 Ga0163163_102203642 336
642 3300014745 Ga0157377_10040466 Ga0157377_100404663 336
643 3300014968 Ga0157379_10010929 Ga0157379_100109297 336
644 3300014968 Ga0157379_10039774 Ga0157379_100397745 336
645 3300014968 Ga0157379_10044418 Ga0157379_100444184 336
646 3300014969 Ga0157376_10013070 Ga0157376_100130703 336
647 3300017792 Ga0163161_10137072 Ga0163161_101370722 336
648 3300021388 Ga0213875_10003385 Ga0213875_100033852 336
649 3300025315 Ga0207697_10011736 Ga0207697_100117364 336
650 3300025321 Ga0207656_10027625 Ga0207656_100276253 336
651 3300025893 Ga0207682_10023066 Ga0207682_100230663 336
652 3300025893 Ga0207682_10034898 Ga0207682_100348982 336
653 3300025901 Ga0207688_10029771 Ga0207688_100297712 336
654 3300025903 Ga0207680_10007186 Ga0207680_100071867 336
655 3300025903 Ga0207680_10017920 Ga0207680_100179202 336
656 3300025904 Ga0207647_10000875 Ga0207647_1000087515 336
657 3300025904 Ga0207647_10004732 Ga0207647_100047329 336
658 3300025904 Ga0207647_10010454 Ga0207647_100104542 336
659 3300025907 Ga0207645_10010829 Ga0207645_100108296 336
660 3300025909 Ga0207705_10000014 Ga0207705_10000014108 336
661 3300025909 Ga0207705_10012543 Ga0207705_100125439 336
662 3300025909 Ga0207705_10016087 Ga0207705_100160876 336
663 3300025909 Ga0207705_10018487 Ga0207705_100184872 336
664 3300025909 Ga0207705_10035158 Ga0207705_100351585 336
665 3300025909 Ga0207705_10043088 Ga0207705_100430882 336
666 3300025909 Ga0207705_10045363 Ga0207705_100453633 336
667 3300025909 Ga0207705_10061545 Ga0207705_100615453 336
668 3300025909 Ga0207705_10123385 Ga0207705_101233852 336
669 3300025909 Ga0207705_10129113 Ga0207705_101291131 336
670 3300025909 Ga0207705_10176731 Ga0207705_101767312 336
671 3300025909 Ga0207705_10195509 Ga0207705_101955092 336
672 3300025913 Ga0207695_10007367 Ga0207695_1000736711 336
673 3300025913 Ga0207695_10288616 Ga0207695_102886161 336
674 3300025914 Ga0207671_10065427 Ga0207671_100654272 336
675 3300025915 Ga0207693_10012967 Ga0207693_100129676 336
676 3300025915 Ga0207693_10108000 Ga0207693_101080001 336
677 3300025917 Ga0207660_10000059 Ga0207660_1000005910 336
678 3300025917 Ga0207660_10033852 Ga0207660_100338523 336
679 3300025919 Ga0207657_10006226 Ga0207657_100062262 336
680 3300025919 Ga0207657_10007897 Ga0207657_1000789710 336
681 3300025919 Ga0207657_10013889 Ga0207657_100138895 336
682 3300025919 Ga0207657_10014912 Ga0207657_100149127 336
683 3300025919 Ga0207657_10015822 Ga0207657_100158224 336
684 3300025919 Ga0207657_10019948 Ga0207657_100199483 336
685 3300025919 Ga0207657_10025805 Ga0207657_100258053 336
686 3300025919 Ga0207657_10053463 Ga0207657_100534634 336
687 3300025920 Ga0207649_10007520 Ga0207649_100075208 336
688 3300025920 Ga0207649_10015333 Ga0207649_100153333 336
689 3300025921 Ga0207652_10045658 Ga0207652_100456582 336
690 3300025921 Ga0207652_10322393 Ga0207652_103223932 336
691 3300025923 Ga0207681_10032228 Ga0207681_100322283 336
692 3300025924 Ga0207694_10052004 Ga0207694_100520042 336
693 3300025924 Ga0207694_10107207 Ga0207694_101072072 336
694 3300025925 Ga0207650_10002135 Ga0207650_1000213510 336
695 3300025925 Ga0207650_10010159 Ga0207650_100101595 336
696 3300025925 Ga0207650_10015959 Ga0207650_100159592 336
697 3300025925 Ga0207650_10070685 Ga0207650_100706852 336
698 3300025925 Ga0207650_10108159 Ga0207650_101081592 336
699 3300025926 Ga0207659_10003563 Ga0207659_1000356312 336
700 3300025926 Ga0207659_10253790 Ga0207659_102537902 336
701 3300025927 Ga0207687_10034329 Ga0207687_100343294 336
702 3300025928 Ga0207700_10161974 Ga0207700_101619742 336
703 3300025929 Ga0207664_10112282 Ga0207664_101122823 336
704 3300025929 Ga0207664_10156180 Ga0207664_101561802 336
705 3300025931 Ga0207644_10000541 Ga0207644_1000054116 336
706 3300025931 Ga0207644_10001058 Ga0207644_1000105822 336
707 3300025931 Ga0207644_10001995 Ga0207644_1000199512 336
708 3300025931 Ga0207644_10002370 Ga0207644_100023707 336
709 3300025931 Ga0207644_10010392 Ga0207644_100103922 336
710 3300025931 Ga0207644_10028706 Ga0207644_100287065 336
711 3300025931 Ga0207644_10035156 Ga0207644_100351562 336
712 3300025931 Ga0207644_10086671 Ga0207644_100866713 336
713 3300025931 Ga0207644_10147737 Ga0207644_101477372 336
714 3300025932 Ga0207690_10002623 Ga0207690_100026231 336
715 3300025932 Ga0207690_10016089 Ga0207690_100160895 336
716 3300025932 Ga0207690_10029733 Ga0207690_100297334 336
717 3300025932 Ga0207690_10126260 Ga0207690_101262602 336
718 3300025932 Ga0207690_10218082 Ga0207690_102180821 336
719 3300025932 Ga0207690_10283812 Ga0207690_102838121 336
720 3300025933 Ga0207706_10019538 Ga0207706_100195383 336
721 3300025933 Ga0207706_10028855 Ga0207706_100288554 336
722 3300025933 Ga0207706_10031729 Ga0207706_100317292 336
723 3300025933 Ga0207706_10032720 Ga0207706_100327205 336
724 3300025933 Ga0207706_10071593 Ga0207706_100715933 336
725 3300025933 Ga0207706_10071883 Ga0207706_100718833 336
726 3300025933 Ga0207706_10113776 Ga0207706_101137763 336
727 3300025934 Ga0207686_10044231 Ga0207686_100442312 336
728 3300025937 Ga0207669_10064216 Ga0207669_100642162 336
729 3300025937 Ga0207669_10150703 Ga0207669_101507032 336
730 3300025938 Ga0207704_10028315 Ga0207704_100283152 336
731 3300025938 Ga0207704_10036410 Ga0207704_100364102 336
732 3300025938 Ga0207704_10140883 Ga0207704_101408832 336
733 3300025939 Ga0207665_10087271 Ga0207665_100872712 336
734 3300025940 Ga0207691_10000954 Ga0207691_1000095414 336
735 3300025940 Ga0207691_10012339 Ga0207691_100123392 336
736 3300025940 Ga0207691_10017590 Ga0207691_100175902 336
737 3300025940 Ga0207691_10042968 Ga0207691_100429682 336
738 3300025941 Ga0207711_10000051 Ga0207711_10000051119 336
739 3300025941 Ga0207711_10000055 Ga0207711_1000005579 336
740 3300025941 Ga0207711_10003160 Ga0207711_1000316011 336
741 3300025941 Ga0207711_10003374 Ga0207711_100033747 336
742 3300025941 Ga0207711_10003778 Ga0207711_100037785 336
743 3300025941 Ga0207711_10010014 Ga0207711_100100148 336
744 3300025941 Ga0207711_10013598 Ga0207711_100135989 336
745 3300025941 Ga0207711_10016641 Ga0207711_100166417 336
746 3300025941 Ga0207711_10064490 Ga0207711_100644903 336
747 3300025941 Ga0207711_10355843 Ga0207711_103558432 336
748 3300025942 Ga0207689_10051430 Ga0207689_100514305 336
749 3300025942 Ga0207689_10123255 Ga0207689_101232552 336
750 3300025944 Ga0207661_10015181 Ga0207661_100151817 336
751 3300025944 Ga0207661_10035036 Ga0207661_100350363 336
752 3300025944 Ga0207661_10037667 Ga0207661_100376672 336
753 3300025945 Ga0207679_10004733 Ga0207679_100047334 336
754 3300025945 Ga0207679_10006512 Ga0207679_100065125 336
755 3300025945 Ga0207679_10015120 Ga0207679_100151206 336
756 3300025945 Ga0207679_10023671 Ga0207679_100236715 336
757 3300025945 Ga0207679_10030940 Ga0207679_100309403 336
758 3300025945 Ga0207679_10062114 Ga0207679_100621142 336
759 3300025949 Ga0207667_10008097 Ga0207667_1000809714 336
760 3300025949 Ga0207667_10021985 Ga0207667_100219852 336
761 3300025949 Ga0207667_10311396 Ga0207667_103113962 336
762 3300025949 Ga0207667_10326755 Ga0207667_103267552 336
763 3300025949 Ga0207667_10467381 Ga0207667_104673811 336
764 3300025960 Ga0207651_10000289 Ga0207651_1000028922 336
765 3300025960 Ga0207651_10007390 Ga0207651_100073903 336
766 3300025960 Ga0207651_10029271 Ga0207651_100292712 336
767 3300025960 Ga0207651_10168958 Ga0207651_101689582 336
768 3300025960 Ga0207651_10355702 Ga0207651_103557022 336
769 3300025972 Ga0207668_10000417 Ga0207668_1000041712 336
770 3300025972 Ga0207668_10155046 Ga0207668_101550461 336
771 3300025972 Ga0207668_10339346 Ga0207668_103393462 336
772 3300025981 Ga0207640_10031918 Ga0207640_100319183 336
773 3300025981 Ga0207640_10072978 Ga0207640_100729782 336
774 3300025986 Ga0207658_10003422 Ga0207658_100034226 336
775 3300025986 Ga0207658_10011425 Ga0207658_100114255 336
776 3300025986 Ga0207658_10018434 Ga0207658_100184344 336
777 3300025986 Ga0207658_10024509 Ga0207658_100245093 336
778 3300025986 Ga0207658_10027510 Ga0207658_100275102 336
779 3300025986 Ga0207658_10029885 Ga0207658_100298853 336
780 3300025986 Ga0207658_10043777 Ga0207658_100437773 336
781 3300025986 Ga0207658_10090517 Ga0207658_100905172 336
782 3300025986 Ga0207658_10251387 Ga0207658_102513872 336
783 3300026023 Ga0207677_10032921 Ga0207677_100329214 336
784 3300026035 Ga0207703_10003761 Ga0207703_1000376110 336
785 3300026035 Ga0207703_10005616 Ga0207703_100056169 336
786 3300026035 Ga0207703_10036591 Ga0207703_100365912 336
787 3300026035 Ga0207703_10057984 Ga0207703_100579842 336
788 3300026035 Ga0207703_10077039 Ga0207703_100770394 336
789 3300026041 Ga0207639_10001907 Ga0207639_1000190711 336
790 3300026041 Ga0207639_10041745 Ga0207639_100417453 336
791 3300026041 Ga0207639_10081918 Ga0207639_100819183 336
792 3300026041 Ga0207639_10407185 Ga0207639_104071852 336
793 3300026067 Ga0207678_10002532 Ga0207678_1000253215 336
794 3300026067 Ga0207678_10013223 Ga0207678_100132233 336
795 3300026067 Ga0207678_10020824 Ga0207678_100208249 336
796 3300026067 Ga0207678_10083548 Ga0207678_100835484 336
797 3300026067 Ga0207678_10102192 Ga0207678_101021922 336
798 3300026067 Ga0207678_10153412 Ga0207678_101534122 336
799 3300026078 Ga0207702_10017863 Ga0207702_100178636 336
800 3300026088 Ga0207641_10000190 Ga0207641_100001909 336
801 3300026088 Ga0207641_10031103 Ga0207641_100311036 336
802 3300026088 Ga0207641_10102832 Ga0207641_101028322 336
803 3300026088 Ga0207641_10175813 Ga0207641_101758132 336
804 3300026089 Ga0207648_10013151 Ga0207648_1001315111 336
805 3300026089 Ga0207648_10051639 Ga0207648_100516394 336
806 3300026095 Ga0207676_10000139 Ga0207676_1000013941 336
807 3300026095 Ga0207676_10000937 Ga0207676_1000093717 336
808 3300026095 Ga0207676_10009066 Ga0207676_100090663 336
809 3300026095 Ga0207676_10009780 Ga0207676_100097807 336
810 3300026095 Ga0207676_10010167 Ga0207676_100101678 336
811 3300026095 Ga0207676_10057226 Ga0207676_100572262 336
812 3300026095 Ga0207676_10401392 Ga0207676_104013921 336
813 3300026116 Ga0207674_10000638 Ga0207674_1000063835 336
814 3300026116 Ga0207674_10003894 Ga0207674_1000389418 336
815 3300026116 Ga0207674_10009966 Ga0207674_100099665 336
816 3300026116 Ga0207674_10054560 Ga0207674_100545605 336
817 3300026116 Ga0207674_10084761 Ga0207674_100847614 336
818 3300026116 Ga0207674_10300061 Ga0207674_103000612 336
819 3300026118 Ga0207675_100126663 Ga0207675_1001266632 336
820 3300026118 Ga0207675_100329858 Ga0207675_1003298582 336
821 3300026121 Ga0207683_10001453 Ga0207683_100014539 336
822 3300026121 Ga0207683_10017922 Ga0207683_100179227 336
823 3300026121 Ga0207683_10023930 Ga0207683_100239304 336
824 3300026142 Ga0207698_10001730 Ga0207698_1000173011 336
825 3300026142 Ga0207698_10001918 Ga0207698_1000191811 336
826 3300026142 Ga0207698_10017231 Ga0207698_100172315 336
827 3300026142 Ga0207698_10027171 Ga0207698_100271714 336
828 3300026142 Ga0207698_10068707 Ga0207698_100687072 336
829 3300026142 Ga0207698_10148430 Ga0207698_101484302 336
830 3300027876 Ga0209974_10008323 Ga0209974_100083232 336
831 3300028379 Ga0268266_10029009 Ga0268266_100290095 336
832 3300028379 Ga0268266_10030705 Ga0268266_100307053 336
833 3300028379 Ga0268266_10139577 Ga0268266_101395772 336
834 3300028380 Ga0268265_10001838 Ga0268265_1000183816 336
835 3300028380 Ga0268265_10004697 Ga0268265_100046973 336
836 3300028380 Ga0268265_10014260 Ga0268265_100142604 336
837 3300028381 Ga0268264_10001693 Ga0268264_100016939 336
838 3300028381 Ga0268264_10003956 Ga0268264_1000395616 336
839 3300028381 Ga0268264_10030355 Ga0268264_100303555 336
840 3300031548 Ga0307408_100058160 Ga0307408_1000581603 336
841 3300031548 Ga0307408_100126696 Ga0307408_1001266962 336
842 3300031548 Ga0307408_100141603 Ga0307408_1001416032 336
843 3300031731 Ga0307405_10104935 Ga0307405_101049352 336
844 3300031731 Ga0307405_10210169 Ga0307405_102101692 336
845 3300031824 Ga0307413_10000576 Ga0307413_100005765 336
846 3300031824 Ga0307413_10005338 Ga0307413_100053382 336
847 3300031824 Ga0307413_10040734 Ga0307413_100407343 336
848 3300031824 Ga0307413_10044222 Ga0307413_100442222 336
849 3300031824 Ga0307413_10067332 Ga0307413_100673322 336
850 3300031824 Ga0307413_10134928 Ga0307413_101349282 336
851 3300031824 Ga0307413_10203958 Ga0307413_102039582 336
852 3300031852 Ga0307410_10009738 Ga0307410_100097386 336
853 3300031852 Ga0307410_10009830 Ga0307410_100098302 336
854 3300031852 Ga0307410_10018312 Ga0307410_100183126 336
855 3300031852 Ga0307410_10020545 Ga0307410_100205454 336
856 3300031852 Ga0307410_10095886 Ga0307410_100958861 336
857 3300031852 Ga0307410_10099373 Ga0307410_100993732 336
858 3300031852 Ga0307410_10165994 Ga0307410_101659942 336
859 3300031852 Ga0307410_10195386 Ga0307410_101953861 336
860 3300031852 Ga0307410_10332006 Ga0307410_103320061 336
861 3300031901 Ga0307406_10016557 Ga0307406_100165573 336
862 3300031901 Ga0307406_10040511 Ga0307406_100405112 336
863 3300031901 Ga0307406_10155922 Ga0307406_101559222 336
864 3300031901 Ga0307406_10168314 Ga0307406_101683142 336
865 3300031903 Ga0307407_10006481 Ga0307407_100064813 336
866 3300031903 Ga0307407_10017965 Ga0307407_100179651 336
867 3300031903 Ga0307407_10020686 Ga0307407_100206862 336
868 3300031903 Ga0307407_10043567 Ga0307407_100435673 336
869 3300031903 Ga0307407_10091470 Ga0307407_100914702 336
870 3300031903 Ga0307407_10100606 Ga0307407_101006062 336
871 3300031911 Ga0307412_10141754 Ga0307412_101417541 336
872 3300031911 Ga0307412_10202483 Ga0307412_102024832 336
873 3300031911 Ga0307412_10233525 Ga0307412_102335252 336
874 3300031911 Ga0307412_10261246 Ga0307412_102612462 336
875 3300031995 Ga0307409_100005419 Ga0307409_1000054195 336
876 3300031995 Ga0307409_100011071 Ga0307409_1000110713 336
877 3300031995 Ga0307409_100051503 Ga0307409_1000515034 336
878 3300031995 Ga0307409_100054766 Ga0307409_1000547662 336
879 3300031995 Ga0307409_100059982 Ga0307409_1000599823 336
880 3300031995 Ga0307409_100115096 Ga0307409_1001150962 336
881 3300031995 Ga0307409_100176565 Ga0307409_1001765652 336
882 3300031995 Ga0307409_100240097 Ga0307409_1002400972 336
883 3300031995 Ga0307409_100282620 Ga0307409_1002826201 336
884 3300032002 Ga0307416_100012344 Ga0307416_1000123443 336
885 3300032002 Ga0307416_100040456 Ga0307416_1000404563 336
886 3300032002 Ga0307416_100054179 Ga0307416_1000541792 336
887 3300032002 Ga0307416_100060117 Ga0307416_1000601172 336
888 3300032002 Ga0307416_100075041 Ga0307416_1000750413 336
889 3300032002 Ga0307416_100341330 Ga0307416_1003413302 336
890 3300032004 Ga0307414_10013449 Ga0307414_100134494 336
891 3300032004 Ga0307414_10025457 Ga0307414_100254575 336
892 3300032004 Ga0307414_10029975 Ga0307414_100299752 336
893 3300032004 Ga0307414_10045557 Ga0307414_100455574 336
894 3300032004 Ga0307414_10047767 Ga0307414_100477672 336
895 3300032004 Ga0307414_10308754 Ga0307414_103087542 336
896 3300032005 Ga0307411_10012448 Ga0307411_100124483 336
897 3300032005 Ga0307411_10012934 Ga0307411_100129344 336
898 3300032005 Ga0307411_10017789 Ga0307411_100177895 336
899 3300032005 Ga0307411_10118444 Ga0307411_101184442 336
900 3300032005 Ga0307411_10202280 Ga0307411_102022802 336
901 3300032126 Ga0307415_100003284 Ga0307415_1000032842 336
902 3300032126 Ga0307415_100009295 Ga0307415_1000092955 336
903 3300032126 Ga0307415_100010903 Ga0307415_1000109035 336
904 3300032126 Ga0307415_100024162 Ga0307415_1000241624 336
905 3300032126 Ga0307415_100379842 Ga0307415_1003798421 336
906 3300035242 Ga0373962_0042162 Ga0373962_0042162_108_1151 336
907 3300035692 Ga0373935_0021058 Ga0373935_0021058_2317_3360 336
908 3300035724 Ga0373933_0044727 Ga0373933_0044727_322_1365 336
909 3300035725 Ga0373947_0047513 Ga0373947_0047513_202_1245 336
910 3300037068 Ga0373925_0016330 Ga0373925_0016330_2889_3932 336
911 3300037312 Ga0395899_0001895 Ga0395899_0001895_14157_15200 336
912 3300037312 Ga0395899_0076848 Ga0395899_0076848_914_1957 336
913 3300037312 Ga0395899_0112441 Ga0395899_0112441_621_1664 336
914 3300037312 Ga0395899_0173823 Ga0395899_0173823_282_1325 336
915 3300037312 Ga0395899_0188205 Ga0395899_0188205_191_1234 336
916 3300037312 Ga0395899_0194563 Ga0395899_0194563_214_1260 336
917 3300037312 Ga0395899_0221756 Ga0395899_0221756_179_1219 336
918 3300037418 Ga0395900_0004212 Ga0395900_0004212_502_1545 336
919 3300037418 Ga0395900_0006697 Ga0395900_0006697_2129_3172 336
920 3300037418 Ga0395900_0015417 Ga0395900_0015417_4784_5824 336
921 3300037418 Ga0395900_0019236 Ga0395900_0019236_5136_6179 336
922 3300037418 Ga0395900_0019933 Ga0395900_0019933_5009_6052 336
923 3300037418 Ga0395900_0021194 Ga0395900_0021194_4301_5341 336
924 3300037418 Ga0395900_0022001 Ga0395900_0022001_4047_5090 336
925 3300037418 Ga0395900_0025263 Ga0395900_0025263_1143_2186 336
926 3300037418 Ga0395900_0035053 Ga0395900_0035053_3861_4907 336
927 3300037418 Ga0395900_0035862 Ga0395900_0035862_2416_3459 336
928 3300037418 Ga0395900_0042369 Ga0395900_0042369_991_2034 336
929 3300037418 Ga0395900_0055500 Ga0395900_0055500_1262_2305 336
930 3300037418 Ga0395900_0065971 Ga0395900_0065971_1707_2750 336
931 3300037418 Ga0395900_0071613 Ga0395900_0071613_416_1459 336
932 3300037418 Ga0395900_0083275 Ga0395900_0083275_262_1308 336
933 3300037418 Ga0395900_0144636 Ga0395900_0144636_1162_2205 336
934 3300037418 Ga0395900_0169004 Ga0395900_0169004_194_1237 336
935 3300037418 Ga0395900_0176255 Ga0395900_0176255_1106_2149 336
936 3300037466 Ga0395898_0002186 Ga0395898_0002186_16679_17722 336
937 3300037466 Ga0395898_0057083 Ga0395898_0057083_2445_3488 336
938 3300037466 Ga0395898_0063513 Ga0395898_0063513_2276_3322 336
939 3300037466 Ga0395898_0136533 Ga0395898_0136533_205_1248 336
940 3300037466 Ga0395898_0138684 Ga0395898_0138684_583_1626 336
941 3300037466 Ga0395898_0264608 Ga0395898_0264608_356_1399 336
942 3300037466 Ga0395898_0308890 Ga0395898_0308890_425_1471 336
943 3300037466 Ga0395898_0320524 Ga0395898_0320524_245_1288 336
944 3300037466 Ga0395898_0379246 Ga0395898_0379246_282_1325 336
945 3300037471 Ga0395905_0000342 Ga0395905_0000342_24224_25267 336
946 3300037471 Ga0395905_0001508 Ga0395905_0001508_15106_16149 336
947 3300037471 Ga0395905_0003870 Ga0395905_0003870_5278_6321 336
948 3300037471 Ga0395905_0004497 Ga0395905_0004497_13010_14056 336
949 3300037471 Ga0395905_0004925 Ga0395905_0004925_2514_3557 336
950 3300037471 Ga0395905_0009859 Ga0395905_0009859_3711_4754 336
951 3300037471 Ga0395905_0011892 Ga0395905_0011892_120_1163 336
952 3300037471 Ga0395905_0012811 Ga0395905_0012811_5155_6198 336
953 3300037471 Ga0395905_0012904 Ga0395905_0012904_5881_6924 336
954 3300037471 Ga0395905_0025200 Ga0395905_0025200_1189_2232 336
955 3300037471 Ga0395905_0025566 Ga0395905_0025566_505_1548 336
956 3300037471 Ga0395905_0028470 Ga0395905_0028470_2587_3630 336
957 3300037471 Ga0395905_0032849 Ga0395905_0032849_2128_3174 336
958 3300037471 Ga0395905_0036128 Ga0395905_0036128_3335_4378 336
959 3300037471 Ga0395905_0073520 Ga0395905_0073520_222_1265 336
960 3300037471 Ga0395905_0088027 Ga0395905_0088027_791_1834 336
961 3300037471 Ga0395905_0105513 Ga0395905_0105513_1079_2122 336
962 3300037471 Ga0395905_0112981 Ga0395905_0112981_321_1364 336
963 3300037471 Ga0395905_0121793 Ga0395905_0121793_374_1417 336
964 3300037471 Ga0395905_0133772 Ga0395905_0133772_687_1730 336
965 3300037471 Ga0395905_0248819 Ga0395905_0248819_99_1145 336
966 3300037471 Ga0395905_0278204 Ga0395905_0278204_194_1237 336
967 3300037853 Ga0436364_0354297 Ga0436364_0354297_11708_12751 336
968 3300038443 Ga0395901_0000850 Ga0395901_0000850_11796_12836 336
969 3300038443 Ga0395901_0002630 Ga0395901_0002630_7244_8287 336
970 3300038443 Ga0395901_0019429 Ga0395901_0019429_2112_3158 336
971 3300038443 Ga0395901_0021460 Ga0395901_0021460_748_1791 336
972 3300038443 Ga0395901_0038250 Ga0395901_0038250_620_1663 336
973 3300038443 Ga0395901_0048382 Ga0395901_0048382_3108_4154 336
974 3300038443 Ga0395901_0065999 Ga0395901_0065999_873_1913 336
975 3300038443 Ga0395901_0090298 Ga0395901_0090298_994_2037 336
976 3300038443 Ga0395901_0092713 Ga0395901_0092713_1506_2549 336
977 3300038443 Ga0395901_0102382 Ga0395901_0102382_851_1894 336
978 3300038443 Ga0395901_0143581 Ga0395901_0143581_1248_2291 336
979 3300038443 Ga0395901_0149791 Ga0395901_0149791_1312_2355 336
980 3300038443 Ga0395901_0165442 Ga0395901_0165442_236_1279 336
981 3300038443 Ga0395901_0195708 Ga0395901_0195708_840_1883 336
982 3300038443 Ga0395901_0197491 Ga0395901_0197491_496_1539 336
983 3300038443 Ga0395901_0236964 Ga0395901_0236964_115_1158 336
984 3300038443 Ga0395901_0237045 Ga0395901_0237045_661_1704 336
985 3300039437 Ga0436365_1762915 Ga0436365_1762915_607_1650 336
986 3300042005 Ga0439448_0017655 Ga0439448_0017655_664_1707 336
987 3300042118 Ga0450914_002434 Ga0450914_002434_148_1191 336
988 3300042127 Ga0450890_005761 Ga0450890_005761_77_1120 336
989 3300042142 Ga0450905_003289 Ga0450905_003289_687_1730 336
990 3300042144 Ga0450889_000230 Ga0450889_000230_1303_2346 336
991 3300042157 Ga0439458_0000019 Ga0439458_0000019_9061_10104 336
992 3300042157 Ga0439458_0000172 Ga0439458_0000172_13083_14126 336
993 3300042439 Ga0439464_0000119 Ga0439464_0000119_2643_3686 336
994 3300042531 Ga0450918_014181 Ga0450918_014181_225_1268 336
995 3300044693 Ga0466961_0006977 Ga0466961_0006977_4562_5605 336
996 3300044694 Ga0466963_0015657 Ga0466963_0015657_334_1377 336
997 3300044694 Ga0466963_0026091 Ga0466963_0026091_2426_3469 336
998 3300044694 Ga0466963_0039915 Ga0466963_0039915_163_1206 336
999 3300044719 Ga0466971_0003365 Ga0466971_0003365_647_1690 336
1000 3300044719 Ga0466971_0025879 Ga0466971_0025879_915_1958 336
1001 3300044719 Ga0466971_0071940 Ga0466971_0071940_30_1073 336
1002 3300044842 Ga0466957_0001394 Ga0466957_0001394_3583_4626 336
1003 3300044842 Ga0466957_0032407 Ga0466957_0032407_194_1309 336
1004 3300044842 Ga0466957_0074195 Ga0466957_0074195_737_1780 336
1005 3300045049 Ga0466959_0036845 Ga0466959_0036845_1623_2666 336
1006 3300045836 Ga0466958_0002246 Ga0466958_0002246_936_1979 336
1007 3300045976 Ga0466967_0029746 Ga0466967_0029746_2166_3209 336
1008 3300045976 Ga0466967_0064289 Ga0466967_0064289_804_1847 336
1009 3300045976 Ga0466967_0067577 Ga0466967_0067577_814_1857 336
1010 3300045976 Ga0466967_0107219 Ga0466967_0107219_1384_2427 336
1011 3300045976 Ga0466967_0119083 Ga0466967_0119083_1091_2134 336
1012 3300045976 Ga0466967_0357672 Ga0466967_0357672_65_1108 336
1013 3300046492 Ga0495585_0108422 Ga0495585_0108422_128_1177 336
1014 3300046525 Ga0495663_0005081 Ga0495663_0005081_2535_3584 336
1015 3300046539 Ga0495621_0000366 Ga0495621_0000366_263_1312 336
1016 3300046558 Ga0495633_0007098 Ga0495633_0007098_1841_2890 336
1017 3300046616 Ga0495668_0004232 Ga0495668_0004232_4152_5195 336
1018 3300046616 Ga0495668_0052600 Ga0495668_0052600_266_1309 336
1019 3300046684 Ga0495669_0002024 Ga0495669_0002024_3966_5009 336
1020 3300046684 Ga0495669_0003242 Ga0495669_0003242_3921_4964 336
1021 3300046684 Ga0495669_0009197 Ga0495669_0009197_424_1467 336
1022 3300046684 Ga0495669_0024841 Ga0495669_0024841_1530_2579 336
1023 3300046684 Ga0495669_0032525 Ga0495669_0032525_183_1226 336
1024 3300046684 Ga0495669_0058151 Ga0495669_0058151_233_1276 336
1025 3300046684 Ga0495669_0060066 Ga0495669_0060066_398_1441 336
1026 3300046684 Ga0495669_0072460 Ga0495669_0072460_344_1387 336
1027 3300046691 Ga0495670_0031759 Ga0495670_0031759_264_1313 336
1028 3300048090 Ga0495615_0041674 Ga0495615_0041674_74_1123 336
1029 3300048903 Ga0496100_0007338 Ga0496100_0007338_2281_3324 336
1030 3300048903 Ga0496100_0011373 Ga0496100_0011373_746_1789 336
1031 3300048904 Ga0496101_0063580 Ga0496101_0063580_1452_2495 336
1032 3300048904 Ga0496101_0092331 Ga0496101_0092331_841_1884 336
1033 3300048905 Ga0496102_0428451 Ga0496102_0428451_93_1136 336
1034 3300048906 Ga0496103_0008964 Ga0496103_0008964_1807_2850 336
1035 3300048906 Ga0496103_0120771 Ga0496103_0120771_417_1460 336
1036 3300048907 Ga0496104_0096378 Ga0496104_0096378_659_1702 336
1037 3300048907 Ga0496104_0275860 Ga0496104_0275860_440_1483 336
1038 3300048909 Ga0496106_0047064 Ga0496106_0047064_127_1170 336
1039 3300048909 Ga0496106_0060666 Ga0496106_0060666_636_1679 336
1040 3300048909 Ga0496106_0120069 Ga0496106_0120069_250_1293 336
1041 3300048910 Ga0496107_0003637 Ga0496107_0003637_3918_4961 336
1042 3300048910 Ga0496107_0015411 Ga0496107_0015411_388_1431 336
1043 3300048910 Ga0496107_0062617 Ga0496107_0062617_959_2002 336
1044 3300048910 Ga0496107_0103686 Ga0496107_0103686_810_1853 336
1045 3300048910 Ga0496107_0233844 Ga0496107_0233844_188_1231 336
1046 3300048911 Ga0496108_0001452 Ga0496108_0001452_15778_16821 336
1047 3300048911 Ga0496108_0004395 Ga0496108_0004395_8472_9515 336
1048 3300048911 Ga0496108_0006634 Ga0496108_0006634_7322_8365 336
1049 3300048911 Ga0496108_0013829 Ga0496108_0013829_887_1930 336
1050 3300048911 Ga0496108_0041610 Ga0496108_0041610_2371_3414 336
1051 3300048911 Ga0496108_0160416 Ga0496108_0160416_189_1232 336
1052 3300048912 Ga0496109_0002921 Ga0496109_0002921_3510_4553 336
1053 3300048912 Ga0496109_0005667 Ga0496109_0005667_6227_7270 336
1054 3300048912 Ga0496109_0023357 Ga0496109_0023357_1913_2956 336
1055 3300048912 Ga0496109_0028570 Ga0496109_0028570_3934_4977 336
1056 3300048912 Ga0496109_0070933 Ga0496109_0070933_997_2040 336
1057 3300048913 Ga0496110_0003386 Ga0496110_0003386_2129_3172 336
1058 3300048913 Ga0496110_0009767 Ga0496110_0009767_986_2029 336
1059 3300048913 Ga0496110_0012363 Ga0496110_0012363_4744_5787 336
1060 3300048913 Ga0496110_0084410 Ga0496110_0084410_1493_2536 336
1061 3300048913 Ga0496110_0119923 Ga0496110_0119923_323_1366 336
1062 3300048914 Ga0496111_0004889 Ga0496111_0004889_6523_7566 336
1063 3300048914 Ga0496111_0007776 Ga0496111_0007776_1600_2643 336
1064 3300048914 Ga0496111_0033750 Ga0496111_0033750_1294_2337 336
1065 3300048914 Ga0496111_0034762 Ga0496111_0034762_339_1382 336
1066 3300048914 Ga0496111_0068799 Ga0496111_0068799_327_1370 336
1067 3300048914 Ga0496111_0235936 Ga0496111_0235936_104_1147 336
1068 3300048915 Ga0496112_0010392 Ga0496112_0010392_4249_5292 336
1069 3300048915 Ga0496112_0113380 Ga0496112_0113380_1629_2672 336
1070 3300048915 Ga0496112_0227427 Ga0496112_0227427_161_1204 336
1071 3300048916 Ga0496113_0019687 Ga0496113_0019687_1628_2671 336
1072 3300048916 Ga0496113_0020264 Ga0496113_0020264_694_1737 336
1073 3300048916 Ga0496113_0028476 Ga0496113_0028476_2591_3634 336
1074 3300048916 Ga0496113_0045078 Ga0496113_0045078_355_1398 336
1075 3300048917 Ga0496114_0000006 Ga0496114_0000006_274433_275476 336
1076 3300048917 Ga0496114_0052895 Ga0496114_0052895_1672_2715 336
1077 3300048918 Ga0496115_0002676 Ga0496115_0002676_239_1282 336
1078 3300048918 Ga0496115_0097442 Ga0496115_0097442_509_1552 336
1079 3300049583 Ga0501067_0060966 Ga0501067_0060966_713_1759 336
1080 3300049585 Ga0501069_0080570 Ga0501069_0080570_603_1646 336
1081 3300049705 Ga0501225_0040726 Ga0501225_0040726_118_1158 336
1082 3300049765 Ga0501268_000472 Ga0501268_000472_1447_2487 336
1083 3300053134 Ga0500658_0000056 Ga0500658_0000056_48403_49446 336
1084 3300061719 Ga0466962_0006544 Ga0466962_0006544_1020_2063 336
1085 3300005289 Ga0065704_10120653 Ga0065704_101206532 337
1086 3300005327 Ga0070658_10017970 Ga0070658_100179704 337
1087 3300005329 Ga0070683_100136106 Ga0070683_1001361064 337
1088 3300005336 Ga0070680_100008876 Ga0070680_1000088766 337
1089 3300005339 Ga0070660_100004120 Ga0070660_1000041205 337
1090 3300005345 Ga0070692_10016886 Ga0070692_100168862 337
1091 3300005355 Ga0070671_100017014 Ga0070671_1000170146 337
1092 3300005356 Ga0070674_100060151 Ga0070674_1000601512 337
1093 3300005364 Ga0070673_100021972 Ga0070673_1000219724 337
1094 3300005367 Ga0070667_100021539 Ga0070667_1000215394 337
1095 3300005456 Ga0070678_100031371 Ga0070678_1000313712 337
1096 3300005530 Ga0070679_100019754 Ga0070679_1000197544 337
1097 3300005543 Ga0070672_100029584 Ga0070672_1000295844 337
1098 3300005548 Ga0070665_100025182 Ga0070665_1000251825 337
1099 3300005563 Ga0068855_100009211 Ga0068855_1000092118 337
1100 3300005614 Ga0068856_100021805 Ga0068856_1000218052 337
1101 3300005616 Ga0068852_100002264 Ga0068852_1000022645 337
1102 3300009177 Ga0105248_10053952 Ga0105248_100539525 337
1103 3300009177 Ga0105248_10205228 Ga0105248_102052282 337
1104 3300013296 Ga0157374_10004363 Ga0157374_1000436311 337
1105 3300025909 Ga0207705_10005507 Ga0207705_100055074 337
1106 3300025917 Ga0207660_10009852 Ga0207660_100098523 337
1107 3300025919 Ga0207657_10004813 Ga0207657_100048134 337
1108 3300025921 Ga0207652_10003128 Ga0207652_100031286 337
1109 3300025926 Ga0207659_10054659 Ga0207659_100546592 337
1110 3300025931 Ga0207644_10005246 Ga0207644_100052462 337
1111 3300025933 Ga0207706_10030900 Ga0207706_100309007 337
1112 3300025937 Ga0207669_10236071 Ga0207669_102360712 337
1113 3300025940 Ga0207691_10041017 Ga0207691_100410174 337
1114 3300025941 Ga0207711_10043316 Ga0207711_100433163 337
1115 3300025944 Ga0207661_10021960 Ga0207661_100219602 337
1116 3300025945 Ga0207679_10102759 Ga0207679_101027592 337
1117 3300025949 Ga0207667_10008746 Ga0207667_100087466 337
1118 3300025960 Ga0207651_10008590 Ga0207651_100085904 337
1119 3300025986 Ga0207658_10036826 Ga0207658_100368264 337
1120 3300026041 Ga0207639_10022118 Ga0207639_100221183 337
1121 3300026067 Ga0207678_10005696 Ga0207678_100056964 337
1122 3300026121 Ga0207683_10053408 Ga0207683_100534084 337
1123 3300026142 Ga0207698_10351326 Ga0207698_103513261 337
1124 3300031731 Ga0307405_10114961 Ga0307405_101149611 337
1125 3300031852 Ga0307410_10112459 Ga0307410_101124592 337
1126 3300031901 Ga0307406_10008366 Ga0307406_100083662 337
1127 3300031995 Ga0307409_100147945 Ga0307409_1001479452 337
1128 3300032002 Ga0307416_100036621 Ga0307416_1000366212 337
1129 3300032004 Ga0307414_10016557 Ga0307414_100165573 337
1130 3300032004 Ga0307414_10020246 Ga0307414_100202462 337
1131 3300032005 Ga0307411_10090144 Ga0307411_100901442 337
1132 3300032126 Ga0307415_100002314 Ga0307415_1000023146 337
1133 3300035111 Ga0373923_0024592 Ga0373923_0024592_974_2020 337
1134 3300035118 Ga0373954_0005781 Ga0373954_0005781_1157_2203 337
1135 3300035119 Ga0373956_0012542 Ga0373956_0012542_240_1286 337
1136 3300035172 Ga0373955_0001193 Ga0373955_0001193_8078_9124 337
1137 3300036401 Ga0373937_0104961 Ga0373937_0104961_27_1073 337
1138 3300037418 Ga0395900_0006169 Ga0395900_0006169_1744_2796 337
1139 3300037418 Ga0395900_0048374 Ga0395900_0048374_1020_2075 337
1140 3300037418 Ga0395900_0223589 Ga0395900_0223589_717_1760 337
1141 3300037466 Ga0395898_0021200 Ga0395898_0021200_3420_4472 337
1142 3300037471 Ga0395905_0012554 Ga0395905_0012554_6245_7297 337
1143 3300037471 Ga0395905_0120201 Ga0395905_0120201_539_1582 337
1144 3300037471 Ga0395905_0237513 Ga0395905_0237513_295_1338 337
1145 3300038443 Ga0395901_0003605 Ga0395901_0003605_10803_11855 337
1146 3300044694 Ga0466963_0045941 Ga0466963_0045941_1223_2278 337
1147 3300044842 Ga0466957_0008285 Ga0466957_0008285_2406_3461 337
1148 3300046537 Ga0495598_0004666 Ga0495598_0004666_458_1504 337
1149 3300046539 Ga0495621_0000416 Ga0495621_0000416_1762_2808 337
1150 3300046679 Ga0495623_0086928 Ga0495623_0086928_825_1871 337
1151 3300046684 Ga0495669_0023609 Ga0495669_0023609_738_1784 337
1152 3300046691 Ga0495670_0000783 Ga0495670_0000783_7767_8813 337
1153 3300048088 Ga0495602_0023552 Ga0495602_0023552_767_1813 337
1154 3300053078 Ga0495612_0047107 Ga0495612_0047107_178_1224 337
1155 3300005289 Ga0065704_10005136 Ga0065704_100051364 338
1156 3300005347 Ga0070668_100003251 Ga0070668_10000325111 338
1157 3300005353 Ga0070669_100002131 Ga0070669_10000213117 338
1158 3300005355 Ga0070671_100000542 Ga0070671_10000054210 338
1159 3300005367 Ga0070667_100318342 Ga0070667_1003183422 338
1160 3300005455 Ga0070663_100291926 Ga0070663_1002919261 338
1161 3300005548 Ga0070665_100001356 Ga0070665_10000135611 338
1162 3300005841 Ga0068863_100010358 Ga0068863_1000103588 338
1163 3300005843 Ga0068860_100123142 Ga0068860_1001231422 338
1164 3300005844 Ga0068862_100034179 Ga0068862_1000341792 338
1165 3300009011 Ga0105251_10001861 Ga0105251_100018611 338
1166 3300009177 Ga0105248_10013528 Ga0105248_100135285 338
1167 3300025735 Ga0207713_1002460 Ga0207713_100246012 338
1168 3300025923 Ga0207681_10000503 Ga0207681_1000050311 338
1169 3300025931 Ga0207644_10001520 Ga0207644_100015208 338
1170 3300025941 Ga0207711_10002363 Ga0207711_1000236313 338
1171 3300025972 Ga0207668_10003815 Ga0207668_100038155 338
1172 3300025986 Ga0207658_10025127 Ga0207658_100251274 338
1173 3300026067 Ga0207678_10012311 Ga0207678_100123113 338
1174 3300026088 Ga0207641_10022838 Ga0207641_100228384 338
1175 3300028379 Ga0268266_10000534 Ga0268266_1000053411 338
1176 3300028380 Ga0268265_10225334 Ga0268265_102253343 338
1177 3300028381 Ga0268264_10072645 Ga0268264_100726454 338
1178 3300044706 Ga0466964_0060187 Ga0466964_0060187_26_1066 338
1179 3300045976 Ga0466967_0001510 Ga0466967_0001510_977_2017 338
1180 3300048904 Ga0496101_0248027 Ga0496101_0248027_168_1226 338
1181 3300048921 Ga0496118_0010865 Ga0496118_0010865_7363_8421 338
1182 3300048922 Ga0496119_0030628 Ga0496119_0030628_2012_3070 338
1183 3300048924 Ga0496121_0012385 Ga0496121_0012385_1376_2434 338
1184 3300048929 Ga0496126_0272510 Ga0496126_0272510_329_1387 338
1185 3300001904 JGI24736J21556_1004341 JGI24736J21556_10043412 339
1186 3300005327 Ga0070658_10001147 Ga0070658_100011476 339
1187 3300005327 Ga0070658_10001533 Ga0070658_1000153312 339
1188 3300005329 Ga0070683_100014032 Ga0070683_1000140326 339
1189 3300005336 Ga0070680_100332480 Ga0070680_1003324801 339
1190 3300005339 Ga0070660_100000053 Ga0070660_1000000535 339
1191 3300005339 Ga0070660_100014284 Ga0070660_1000142843 339
1192 3300005339 Ga0070660_100169544 Ga0070660_1001695442 339
1193 3300005344 Ga0070661_100011742 Ga0070661_1000117426 339
1194 3300005345 Ga0070692_10005713 Ga0070692_100057132 339
1195 3300005354 Ga0070675_100022594 Ga0070675_1000225942 339
1196 3300005366 Ga0070659_100010299 Ga0070659_1000102996 339
1197 3300005366 Ga0070659_100047838 Ga0070659_1000478382 339
1198 3300005455 Ga0070663_100002890 Ga0070663_1000028907 339
1199 3300005455 Ga0070663_100097752 Ga0070663_1000977522 339
1200 3300005530 Ga0070679_100111724 Ga0070679_1001117243 339
1201 3300005563 Ga0068855_100000433 Ga0068855_10000043344 339
1202 3300005563 Ga0068855_100056328 Ga0068855_1000563282 339
1203 3300005578 Ga0068854_100000364 Ga0068854_10000036410 339
1204 3300005614 Ga0068856_100004665 Ga0068856_1000046656 339
1205 3300005614 Ga0068856_100020327 Ga0068856_1000203275 339
1206 3300005616 Ga0068852_100000873 Ga0068852_10000087312 339
1207 3300005616 Ga0068852_100071261 Ga0068852_1000712614 339
1208 3300005842 Ga0068858_100203754 Ga0068858_1002037541 339
1209 3300009093 Ga0105240_10089015 Ga0105240_100890152 339
1210 3300009093 Ga0105240_10242870 Ga0105240_102428702 339
1211 3300009545 Ga0105237_10127383 Ga0105237_101273832 339
1212 3300013100 Ga0157373_10013639 Ga0157373_100136397 339
1213 3300013102 Ga0157371_10000468 Ga0157371_100004687 339
1214 3300013102 Ga0157371_10002874 Ga0157371_100028749 339
1215 3300013102 Ga0157371_10018346 Ga0157371_100183462 339
1216 3300013102 Ga0157371_10078007 Ga0157371_100780072 339
1217 3300013104 Ga0157370_10328087 Ga0157370_103280872 339
1218 3300013105 Ga0157369_10000751 Ga0157369_1000075110 339
1219 3300013105 Ga0157369_10011938 Ga0157369_100119389 339
1220 3300013105 Ga0157369_10035819 Ga0157369_100358194 339
1221 3300013296 Ga0157374_10089932 Ga0157374_100899323 339
1222 3300025904 Ga0207647_10017025 Ga0207647_100170255 339
1223 3300025904 Ga0207647_10029228 Ga0207647_100292282 339
1224 3300025909 Ga0207705_10000033 Ga0207705_1000003344 339
1225 3300025909 Ga0207705_10000082 Ga0207705_1000008295 339
1226 3300025909 Ga0207705_10000577 Ga0207705_100005776 339
1227 3300025913 Ga0207695_10007084 Ga0207695_1000708410 339
1228 3300025913 Ga0207695_10175518 Ga0207695_101755182 339
1229 3300025914 Ga0207671_10077310 Ga0207671_100773102 339
1230 3300025919 Ga0207657_10000058 Ga0207657_1000005865 339
1231 3300025919 Ga0207657_10000088 Ga0207657_1000008870 339
1232 3300025919 Ga0207657_10004712 Ga0207657_1000471211 339
1233 3300025919 Ga0207657_10069898 Ga0207657_100698981 339
1234 3300025920 Ga0207649_10001175 Ga0207649_100011759 339
1235 3300025920 Ga0207649_10216004 Ga0207649_102160041 339
1236 3300025921 Ga0207652_10087646 Ga0207652_100876462 339
1237 3300025924 Ga0207694_10252964 Ga0207694_102529642 339
1238 3300025925 Ga0207650_10084213 Ga0207650_100842132 339
1239 3300025926 Ga0207659_10018715 Ga0207659_100187152 339
1240 3300025932 Ga0207690_10032577 Ga0207690_100325772 339
1241 3300025932 Ga0207690_10077269 Ga0207690_100772692 339
1242 3300025933 Ga0207706_10001436 Ga0207706_1000143612 339
1243 3300025944 Ga0207661_10268214 Ga0207661_102682142 339
1244 3300025945 Ga0207679_10120442 Ga0207679_101204422 339
1245 3300025949 Ga0207667_10000114 Ga0207667_1000011461 339
1246 3300025949 Ga0207667_10006779 Ga0207667_1000677912 339
1247 3300025949 Ga0207667_10080305 Ga0207667_100803052 339
1248 3300025949 Ga0207667_10464733 Ga0207667_104647332 339
1249 3300025981 Ga0207640_10000453 Ga0207640_1000045310 339
1250 3300026067 Ga0207678_10011690 Ga0207678_100116902 339
1251 3300026067 Ga0207678_10044212 Ga0207678_100442124 339
1252 3300026067 Ga0207678_10146671 Ga0207678_101466712 339
1253 3300026078 Ga0207702_10005757 Ga0207702_100057576 339
1254 3300026078 Ga0207702_10010877 Ga0207702_100108778 339
1255 3300026078 Ga0207702_10249351 Ga0207702_102493512 339
1256 3300026142 Ga0207698_10000697 Ga0207698_100006974 339
1257 3300037312 Ga0395899_0000230 Ga0395899_0000230_15631_16674 339
1258 3300037312 Ga0395899_0003735 Ga0395899_0003735_443_1486 339
1259 3300037312 Ga0395899_0012024 Ga0395899_0012024_106_1149 339
1260 3300037312 Ga0395899_0020525 Ga0395899_0020525_695_1738 339
1261 3300037418 Ga0395900_0000124 Ga0395900_0000124_66676_67719 339
1262 3300037418 Ga0395900_0004463 Ga0395900_0004463_7537_8580 339
1263 3300037418 Ga0395900_0015733 Ga0395900_0015733_2040_3083 339
1264 3300037418 Ga0395900_0047564 Ga0395900_0047564_2384_3427 339
1265 3300037418 Ga0395900_0100549 Ga0395900_0100549_1614_2657 339
1266 3300037418 Ga0395900_0136684 Ga0395900_0136684_1044_2090 339
1267 3300037418 Ga0395900_0213159 Ga0395900_0213159_157_1200 339
1268 3300037418 Ga0395900_0217669 Ga0395900_0217669_730_1773 339
1269 3300037466 Ga0395898_0010993 Ga0395898_0010993_48_1091 339
1270 3300037466 Ga0395898_0014171 Ga0395898_0014171_920_1963 339
1271 3300037466 Ga0395898_0014797 Ga0395898_0014797_3880_4923 339
1272 3300037466 Ga0395898_0025851 Ga0395898_0025851_4411_5454 339
1273 3300037471 Ga0395905_0016644 Ga0395905_0016644_5750_6793 339
1274 3300037471 Ga0395905_0142749 Ga0395905_0142749_648_1691 339
1275 3300038443 Ga0395901_0000031 Ga0395901_0000031_67119_68162 339
1276 3300038443 Ga0395901_0019488 Ga0395901_0019488_4814_5857 339
1277 3300038443 Ga0395901_0319688 Ga0395901_0319688_340_1383 339
1278 3300044656 Ga0466969_0020235 Ga0466969_0020235_1757_2800 339
1279 3300044684 Ga0466966_0000021 Ga0466966_0000021_5374_6417 339
1280 3300044684 Ga0466966_0013875 Ga0466966_0013875_585_1628 339
1281 3300044694 Ga0466963_0007606 Ga0466963_0007606_128_1171 339
1282 3300044842 Ga0466957_0002438 Ga0466957_0002438_1898_2941 339
1283 3300045049 Ga0466959_0016253 Ga0466959_0016253_3709_4752 339
1284 3300045049 Ga0466959_0092158 Ga0466959_0092158_883_1926 339
1285 3300045836 Ga0466958_0000063 Ga0466958_0000063_26540_27583 339

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01018

GTP1_OBG

GTP1/OBG

44

191

0.96

PF01926

MMR_HSR1

50S ribosome-binding GTPase

194

313

0.87

PF02421

FeoB_N

Ferrous iron transport protein B

193

355

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dyk-assembly2.cif.gz_B crystal structure of n-terminal gtp-binding domain of enga from thermus thermophilus hb8 0.8162 152 318
5x4b-assembly2.cif.gz_B crystal structure of n-terminal g-domain of enga from bacillus subtilis 0.81 155 318
2dyk-assembly2.cif.gz_B crystal structure of n-terminal gtp-binding domain of enga from thermus thermophilus hb8 0.8014 152 318
3b1w-assembly4.cif.gz_D crystal structure of an s. thermophilus nfeob e67a mutant bound to gdp 0.7932 152 318
2e87-assembly1.cif.gz_A crystal structure of hypothetical gtp-binding protein ph1320 from pyrococcus horikoshii ot3, in complex with gdp 0.7916 155 325
ID Description Score Start End Superfamily
af_Q9VLN0_205_380_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8677 152 330 3.40.50.300
af_Q59PR1_373_547_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.866 152 322 3.40.50.300
af_Q9VLN0_205_380_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8631 152 330 3.40.50.300
af_K7K3X8_315_495_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8623 152 322 3.40.50.300
af_O45691_188_358_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8616 152 318 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7U8KYS2-F1-model_v4 deleted 0.9355 219 319
AF-A0A526YLT7-F1-model_v4 GTPase ObgE 0.9328 219 315 GO:0003924
GO:0005525
AF-A0A3S2NAP8-F1-model_v4 deleted 0.9255 222 319
AF-A0A3E0QBR7-F1-model_v4 GTPase ObgE 0.9123 193 319 GO:0003924
GO:0005525
AF-A0A2C9M1X0-F1-model_v4 OBG-type G domain-containing protein 0.9115 148 302 GO:0003924
GO:0005525
GO:0008199

Feature Viewer

pLDDT pTM Quality
73.57 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map