F492552
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1283 | 654 | 1096 | 181 |
Family's Representative Sequence
| Representative Sequence | 3300035410|Ga0373924_0128840|Ga0373924_0128840_17_622 |
| Length | 201 |
| Sequence | MREVDRQSKYNRRVFLQGAATTVPAVAIATSAGLSIEDAWADDAKTLTPATLKTLVKVARDIYPHDFLGDSYYITAIKPWDGKAAKDPAVKSMIDDGVSRLDQDASDHHKVPYAQVQWEADRVALLQRIEQTAFFQKIRGDLVVSLYNQKELWPKFGYEGSSAEHGGIYQTRLRRHRLAPEGLGPGQREFRRKPNGKIRSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 6 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 7 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 8 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 9 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 12 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 13 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 14 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 15 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 16 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 17 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 18 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 19 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 20 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 21 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 22 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 23 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 24 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 25 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 26 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 27 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 28 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 29 | 2791355199 | |||
| 30 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 31 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 32 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 33 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 34 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 35 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 36 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 37 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 38 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 39 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 40 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 41 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 42 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 43 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 44 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 45 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 46 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 47 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 48 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 49 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 50 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 51 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 52 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 53 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 54 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 55 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 56 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 57 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 58 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 59 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 60 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 61 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 62 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 63 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 64 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 65 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 66 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 67 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 68 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 69 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 70 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 71 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 72 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 73 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 74 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 75 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 76 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 77 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 78 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 79 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 80 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 81 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 82 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 83 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 84 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 85 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 86 | 2904699407 | |||
| 87 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 88 | 2906610324 | |||
| 89 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 90 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 91 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 92 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 93 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 94 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 95 | 2922368715 | |||
| 96 | 2922425934 | |||
| 97 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 98 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 99 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 100 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 101 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 102 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 103 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 104 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 105 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 106 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 107 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 108 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 109 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 110 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 111 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 112 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 113 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 114 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 115 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 116 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 117 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 118 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 119 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 120 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 121 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 122 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 123 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 124 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 125 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 126 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 127 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 128 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 129 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 130 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 131 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 132 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 133 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 134 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 135 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 136 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 137 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 138 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 139 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 140 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 141 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 142 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 143 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 144 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 145 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 146 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 147 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 148 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 149 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 150 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 151 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 152 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 153 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 154 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 155 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 156 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 157 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 158 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 159 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 160 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 161 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 163 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 164 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 166 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 167 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 168 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 169 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 171 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 172 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 173 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 174 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 181 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 184 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 185 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 187 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 188 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 189 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 190 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 192 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 193 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 194 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 195 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 196 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 197 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 198 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 199 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 200 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 201 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 203 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 204 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 205 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 206 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 208 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 209 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 210 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 212 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 213 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 214 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 215 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 216 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 217 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 218 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 219 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 220 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 221 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 222 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 223 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 224 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 225 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 226 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 227 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 229 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 230 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 231 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 232 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 233 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 234 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 235 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 236 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 237 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 238 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 240 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 241 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 242 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 243 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 245 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 246 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 247 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 248 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 249 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 250 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 251 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 252 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 253 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 255 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 256 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 257 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 258 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 259 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 260 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 261 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 262 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 263 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 264 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 265 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 266 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 267 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 268 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 269 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 270 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 271 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 272 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 273 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 274 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 275 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 276 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 277 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 278 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 279 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 280 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 281 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 282 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 284 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 285 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 286 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 288 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 289 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 290 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 291 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 292 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 293 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 316 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 320 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 322 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 323 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 325 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 326 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 357 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 358 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 359 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 360 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 362 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 366 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 367 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 369 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 370 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 371 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 372 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 373 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 374 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 375 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 376 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 377 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 378 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 379 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 380 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 381 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 382 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 383 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 384 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 385 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 386 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 387 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 388 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 389 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 390 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 391 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 392 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 393 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 394 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 395 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 396 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 397 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 398 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 399 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 400 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 401 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 402 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 403 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 404 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 405 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 406 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 407 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 408 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 409 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 410 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 411 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 412 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 413 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 414 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 415 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 416 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 417 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 418 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 419 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 420 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 421 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 422 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 423 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 424 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 425 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 426 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 427 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 428 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 429 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 438 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 510 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 511 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 512 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 513 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 514 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 515 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 516 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 517 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 518 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 519 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 520 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 521 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 522 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 523 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 524 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 525 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 526 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 527 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 528 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 529 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 530 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 531 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 532 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 533 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 534 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 535 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 538 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 539 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 540 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 541 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 542 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 543 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 544 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 545 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 546 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 547 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 549 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 550 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 551 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 552 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 553 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 554 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 555 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 556 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 557 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 558 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 559 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 560 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 561 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 562 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 563 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 564 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 565 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 566 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 569 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 573 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 574 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 575 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 576 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 577 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 578 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 579 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 580 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 581 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 582 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 583 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 584 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 585 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 586 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 587 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 588 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 589 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 590 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 591 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 592 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 593 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 594 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 595 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 596 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 597 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 598 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 599 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 600 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 601 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 602 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 603 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 604 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 605 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 606 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 607 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 608 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 609 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 610 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 611 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 612 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 613 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 614 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 615 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 616 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 617 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 618 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 619 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 620 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 621 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 622 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 623 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 624 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 625 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 626 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 627 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 628 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 629 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 630 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 631 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 632 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 633 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 634 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 635 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 636 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 637 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 638 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 639 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 640 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 641 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 642 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 643 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 644 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 645 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 646 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 647 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 648 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 649 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 650 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 651 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 652 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 653 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 654 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.13 |
| Metatranscriptomes | 0.63 |
| Isolates | 14.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.3 |
| Nodule | 12 |
| Rhizoplane | 5.77 |
| Rhizosphere | 61.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C399 | 2010549000 | Bacteria | 1198 |
| 2 | JGI24739J22299_10153398 | 3300001989 | Bacteria | 681 |
| 3 | JGI24749J21850_1028922 | 3300002076 | Bacteria | 793 |
| 4 | JGI25153J46596_10003712 | 3300003215 | Bacteria | 8429 |
| 5 | JGI25153J46596_10003975 | 3300003215 | Bacteria | 8089 |
| 6 | JGI25153J46596_10039108 | 3300003215 | Bacteria | 1486 |
| 7 | JGI25404J52841_10017956 | 3300003659 | Bacteria | 1533 |
| 8 | Ga0055531_10008928 | 3300003794 | Bacteria | 5196 |
| 9 | JGI25405J52794_10012119 | 3300003911 | Bacteria | 1656 |
| 10 | Ga0055543_1001247 | 3300004625 | Bacteria | 10557 |
| 11 | Ga0065165_1001238 | 3300005262 | Bacteria | 29152 |
| 12 | Ga0065165_1004821 | 3300005262 | Bacteria | 8028 |
| 13 | Ga0065165_1012948 | 3300005262 | Bacteria | 3352 |
| 14 | Ga0065165_1016813 | 3300005262 | Bacteria | 2722 |
| 15 | Ga0070658_10080672 | 3300005327 | Bacteria | 2672 |
| 16 | Ga0070683_100015748 | 3300005329 | Bacteria | 6647 |
| 17 | Ga0070683_100436837 | 3300005329 | Bacteria | 1249 |
| 18 | Ga0070690_100962839 | 3300005330 | Bacteria | 671 |
| 19 | Ga0070670_100327092 | 3300005331 | Bacteria | 1344 |
| 20 | Ga0070670_101252150 | 3300005331 | Bacteria | 679 |
| 21 | Ga0068869_100216708 | 3300005334 | Bacteria | 1516 |
| 22 | Ga0070680_100033950 | 3300005336 | Bacteria | 4114 |
| 23 | Ga0070682_100165238 | 3300005337 | Bacteria | 1533 |
| 24 | Ga0070682_100219358 | 3300005337 | Bacteria | 1352 |
| 25 | Ga0068868_100011625 | 3300005338 | Bacteria | 6412 |
| 26 | Ga0068868_100058807 | 3300005338 | Bacteria | 3039 |
| 27 | Ga0068868_100176891 | 3300005338 | Bacteria | 1769 |
| 28 | Ga0068868_100306128 | 3300005338 | Bacteria | 1351 |
| 29 | Ga0070660_100197657 | 3300005339 | Bacteria | 1631 |
| 30 | Ga0070660_100860512 | 3300005339 | Bacteria | 764 |
| 31 | Ga0070689_100502858 | 3300005340 | Bacteria | 1039 |
| 32 | Ga0070691_10174128 | 3300005341 | Bacteria | 1117 |
| 33 | Ga0070687_100128942 | 3300005343 | Bacteria | 1458 |
| 34 | Ga0070692_10134771 | 3300005345 | Bacteria | 1392 |
| 35 | Ga0070668_100016271 | 3300005347 | Bacteria | 5563 |
| 36 | Ga0070668_100047595 | 3300005347 | Bacteria | 3297 |
| 37 | Ga0070668_100076201 | 3300005347 | Bacteria | 2620 |
| 38 | Ga0070668_100542358 | 3300005347 | Bacteria | 1011 |
| 39 | Ga0070668_100986721 | 3300005347 | Bacteria | 756 |
| 40 | Ga0070668_101022242 | 3300005347 | Bacteria | 743 |
| 41 | Ga0070668_101503618 | 3300005347 | Bacteria | 615 |
| 42 | Ga0070669_100181958 | 3300005353 | Bacteria | 1645 |
| 43 | Ga0070669_101229277 | 3300005353 | Bacteria | 648 |
| 44 | Ga0070675_100264823 | 3300005354 | Bacteria | 1507 |
| 45 | Ga0070671_100254929 | 3300005355 | Bacteria | 1490 |
| 46 | Ga0070671_100465337 | 3300005355 | Bacteria | 1085 |
| 47 | Ga0070671_100545542 | 3300005355 | Bacteria | 999 |
| 48 | Ga0070674_100114350 | 3300005356 | Bacteria | 1987 |
| 49 | Ga0070674_100416633 | 3300005356 | Bacteria | 1101 |
| 50 | Ga0070673_100082174 | 3300005364 | Bacteria | 2614 |
| 51 | Ga0070688_100057420 | 3300005365 | Bacteria | 2446 |
| 52 | Ga0070659_100222395 | 3300005366 | Bacteria | 1559 |
| 53 | Ga0070667_100064004 | 3300005367 | Bacteria | 3119 |
| 54 | Ga0070667_100326035 | 3300005367 | Bacteria | 1386 |
| 55 | Ga0070667_100745512 | 3300005367 | Bacteria | 908 |
| 56 | Ga0070703_10024753 | 3300005406 | Bacteria | 1776 |
| 57 | Ga0070709_10004421 | 3300005434 | Bacteria | 7582 |
| 58 | Ga0070709_10010158 | 3300005434 | Bacteria | 5202 |
| 59 | Ga0070709_10144889 | 3300005434 | Bacteria | 1635 |
| 60 | Ga0070709_10353964 | 3300005434 | Bacteria | 1086 |
| 61 | Ga0070714_100004999 | 3300005435 | Bacteria | 10080 |
| 62 | Ga0070714_100101291 | 3300005435 | Bacteria | 2538 |
| 63 | Ga0070714_100184828 | 3300005435 | Bacteria | 1899 |
| 64 | Ga0070714_100259175 | 3300005435 | Bacteria | 1610 |
| 65 | Ga0070714_100663262 | 3300005435 | Bacteria | 1005 |
| 66 | Ga0070713_100004534 | 3300005436 | Bacteria | 9356 |
| 67 | Ga0070713_100006585 | 3300005436 | Bacteria | 8073 |
| 68 | Ga0070713_100011058 | 3300005436 | Bacteria | 6554 |
| 69 | Ga0070713_100014000 | 3300005436 | Bacteria | 5939 |
| 70 | Ga0070713_100075767 | 3300005436 | Bacteria | 2854 |
| 71 | Ga0070713_100084245 | 3300005436 | Bacteria | 2720 |
| 72 | Ga0070713_100212872 | 3300005436 | Bacteria | 1750 |
| 73 | Ga0070710_10060807 | 3300005437 | Bacteria | 2150 |
| 74 | Ga0070710_10112579 | 3300005437 | Bacteria | 1637 |
| 75 | Ga0070701_10119533 | 3300005438 | Bacteria | 1483 |
| 76 | Ga0070711_100006399 | 3300005439 | Bacteria | 7101 |
| 77 | Ga0070711_100024840 | 3300005439 | Bacteria | 3914 |
| 78 | Ga0070711_100218504 | 3300005439 | Bacteria | 1480 |
| 79 | Ga0070705_100184931 | 3300005440 | Bacteria | 1415 |
| 80 | Ga0070705_100415204 | 3300005440 | Bacteria | 1000 |
| 81 | Ga0070700_100323113 | 3300005441 | Bacteria | 1134 |
| 82 | Ga0070694_100182349 | 3300005444 | Bacteria | 1553 |
| 83 | Ga0070708_100745514 | 3300005445 | Bacteria | 921 |
| 84 | Ga0070663_100044479 | 3300005455 | Bacteria | 3131 |
| 85 | Ga0070663_100051122 | 3300005455 | Bacteria | 2942 |
| 86 | Ga0070663_100061590 | 3300005455 | Bacteria | 2702 |
| 87 | Ga0070663_100183072 | 3300005455 | Bacteria | 1626 |
| 88 | Ga0070663_100305159 | 3300005455 | Bacteria | 1275 |
| 89 | Ga0070663_100313452 | 3300005455 | Bacteria | 1259 |
| 90 | Ga0070663_100320366 | 3300005455 | Bacteria | 1246 |
| 91 | Ga0070663_100644209 | 3300005455 | Bacteria | 895 |
| 92 | Ga0070678_100206008 | 3300005456 | Bacteria | 1626 |
| 93 | Ga0070678_100307277 | 3300005456 | Bacteria | 1350 |
| 94 | Ga0070678_100313336 | 3300005456 | Bacteria | 1338 |
| 95 | Ga0070662_100042613 | 3300005457 | Bacteria | 3242 |
| 96 | Ga0070662_100051832 | 3300005457 | Bacteria | 2964 |
| 97 | Ga0070681_10005842 | 3300005458 | Bacteria | 11917 |
| 98 | Ga0070681_10046271 | 3300005458 | Bacteria | 4350 |
| 99 | Ga0068867_100179243 | 3300005459 | Bacteria | 1683 |
| 100 | Ga0068867_100545419 | 3300005459 | Bacteria | 1004 |
| 101 | Ga0068867_100568483 | 3300005459 | Bacteria | 984 |
| 102 | Ga0070706_100155389 | 3300005467 | Bacteria | 2136 |
| 103 | Ga0070706_100241729 | 3300005467 | Bacteria | 1686 |
| 104 | Ga0070698_100167764 | 3300005471 | Bacteria | 2137 |
| 105 | Ga0070699_100180163 | 3300005518 | Bacteria | 1875 |
| 106 | Ga0070699_100859143 | 3300005518 | Bacteria | 831 |
| 107 | Ga0070699_101301903 | 3300005518 | Bacteria | 667 |
| 108 | Ga0070679_100015322 | 3300005530 | Bacteria | 7366 |
| 109 | Ga0070679_100034222 | 3300005530 | Bacteria | 5034 |
| 110 | Ga0070684_100053919 | 3300005535 | Bacteria | 3502 |
| 111 | Ga0070684_100323388 | 3300005535 | Bacteria | 1417 |
| 112 | Ga0070697_100292726 | 3300005536 | Bacteria | 1398 |
| 113 | Ga0068853_101077338 | 3300005539 | Bacteria | 775 |
| 114 | Ga0070672_100140100 | 3300005543 | Bacteria | 1994 |
| 115 | Ga0070672_100422703 | 3300005543 | Bacteria | 1145 |
| 116 | Ga0070672_100713267 | 3300005543 | Bacteria | 879 |
| 117 | Ga0070686_100023188 | 3300005544 | Bacteria | 3706 |
| 118 | Ga0070695_100323813 | 3300005545 | Bacteria | 1147 |
| 119 | Ga0070696_100400603 | 3300005546 | Bacteria | 1073 |
| 120 | Ga0070696_100405459 | 3300005546 | Bacteria | 1067 |
| 121 | Ga0070696_100597977 | 3300005546 | Bacteria | 889 |
| 122 | Ga0070665_100019999 | 3300005548 | Bacteria | 6723 |
| 123 | Ga0070665_100091696 | 3300005548 | Bacteria | 3043 |
| 124 | Ga0070665_100118504 | 3300005548 | Bacteria | 2649 |
| 125 | Ga0070665_100196813 | 3300005548 | Bacteria | 2016 |
| 126 | Ga0070665_100388257 | 3300005548 | Bacteria | 1403 |
| 127 | Ga0070665_100458678 | 3300005548 | Bacteria | 1284 |
| 128 | Ga0068855_100225014 | 3300005563 | Bacteria | 2102 |
| 129 | Ga0068855_100779440 | 3300005563 | Bacteria | 1017 |
| 130 | Ga0068855_101059062 | 3300005563 | Bacteria | 850 |
| 131 | Ga0070664_100162208 | 3300005564 | Bacteria | 1978 |
| 132 | Ga0070664_100229394 | 3300005564 | Bacteria | 1664 |
| 133 | Ga0070664_100525264 | 3300005564 | Bacteria | 1093 |
| 134 | Ga0068857_100071359 | 3300005577 | Bacteria | 3094 |
| 135 | Ga0068857_100202935 | 3300005577 | Bacteria | 1807 |
| 136 | Ga0068856_100093327 | 3300005614 | Bacteria | 2995 |
| 137 | Ga0068856_100731315 | 3300005614 | Bacteria | 1010 |
| 138 | Ga0068856_100919513 | 3300005614 | Bacteria | 894 |
| 139 | Ga0068852_100112958 | 3300005616 | Bacteria | 2473 |
| 140 | Ga0068852_100542038 | 3300005616 | Bacteria | 1163 |
| 141 | Ga0068852_100562511 | 3300005616 | Bacteria | 1142 |
| 142 | Ga0068859_100268917 | 3300005617 | Bacteria | 1796 |
| 143 | Ga0068859_100474242 | 3300005617 | Bacteria | 1347 |
| 144 | Ga0068859_100902022 | 3300005617 | Bacteria | 968 |
| 145 | Ga0068864_100013398 | 3300005618 | Bacteria | 6795 |
| 146 | Ga0068864_100161872 | 3300005618 | Bacteria | 2035 |
| 147 | Ga0068866_10075702 | 3300005718 | Bacteria | 1793 |
| 148 | Ga0068861_100076323 | 3300005719 | Bacteria | 2611 |
| 149 | Ga0068861_100120266 | 3300005719 | Bacteria | 2117 |
| 150 | Ga0068870_10071748 | 3300005840 | Bacteria | 1890 |
| 151 | Ga0068863_100082691 | 3300005841 | Bacteria | 3043 |
| 152 | Ga0068863_100142925 | 3300005841 | Bacteria | 2288 |
| 153 | Ga0068863_100278724 | 3300005841 | Bacteria | 1620 |
| 154 | Ga0068863_101039854 | 3300005841 | Bacteria | 822 |
| 155 | Ga0068863_101072481 | 3300005841 | Bacteria | 810 |
| 156 | Ga0068858_100122763 | 3300005842 | Bacteria | 2430 |
| 157 | Ga0068858_100142978 | 3300005842 | Bacteria | 2246 |
| 158 | Ga0068858_100892647 | 3300005842 | Bacteria | 869 |
| 159 | Ga0068860_100000367 | 3300005843 | Bacteria | 59534 |
| 160 | Ga0068860_100104480 | 3300005843 | Bacteria | 2704 |
| 161 | Ga0068860_100238758 | 3300005843 | Bacteria | 1767 |
| 162 | Ga0068860_100247941 | 3300005843 | Bacteria | 1733 |
| 163 | Ga0068860_100311735 | 3300005843 | Bacteria | 1543 |
| 164 | Ga0068860_100358870 | 3300005843 | Bacteria | 1435 |
| 165 | Ga0068860_100361843 | 3300005843 | Bacteria | 1429 |
| 166 | Ga0068860_100377664 | 3300005843 | Bacteria | 1399 |
| 167 | Ga0068860_101271536 | 3300005843 | Bacteria | 756 |
| 168 | Ga0068862_100306497 | 3300005844 | Bacteria | 1462 |
| 169 | Ga0068862_100374442 | 3300005844 | Bacteria | 1326 |
| 170 | Ga0068862_100674106 | 3300005844 | Bacteria | 999 |
| 171 | Ga0068862_100824338 | 3300005844 | Bacteria | 907 |
| 172 | Ga0081455_10005963 | 3300005937 | Bacteria | 13212 |
| 173 | Ga0081455_10019148 | 3300005937 | Bacteria | 6487 |
| 174 | Ga0081455_10019874 | 3300005937 | Bacteria | 6342 |
| 175 | Ga0081455_10238149 | 3300005937 | Bacteria | 1339 |
| 176 | Ga0081540_1005978 | 3300005983 | Bacteria | 8963 |
| 177 | Ga0081540_1007083 | 3300005983 | Bacteria | 8057 |
| 178 | Ga0081540_1008425 | 3300005983 | Bacteria | 7208 |
| 179 | Ga0081540_1010630 | 3300005983 | Bacteria | 6211 |
| 180 | Ga0081540_1031564 | 3300005983 | Bacteria | 2910 |
| 181 | Ga0081540_1042398 | 3300005983 | Bacteria | 2347 |
| 182 | Ga0081540_1047481 | 3300005983 | Bacteria | 2159 |
| 183 | Ga0081540_1047752 | 3300005983 | Bacteria | 2150 |
| 184 | Ga0070717_10000254 | 3300006028 | Bacteria | 36784 |
| 185 | Ga0070717_10003385 | 3300006028 | Bacteria | 11402 |
| 186 | Ga0070717_10030814 | 3300006028 | Bacteria | 4310 |
| 187 | Ga0075365_10042633 | 3300006038 | Bacteria | 2967 |
| 188 | Ga0075365_10151609 | 3300006038 | Bacteria | 1612 |
| 189 | Ga0075365_10227051 | 3300006038 | Bacteria | 1310 |
| 190 | Ga0075365_10227378 | 3300006038 | Bacteria | 1309 |
| 191 | Ga0075365_10255577 | 3300006038 | Bacteria | 1232 |
| 192 | Ga0075365_10453491 | 3300006038 | Bacteria | 906 |
| 193 | Ga0075363_100000357 | 3300006048 | Bacteria | 13719 |
| 194 | Ga0075363_100033478 | 3300006048 | Bacteria | 2676 |
| 195 | Ga0075363_100353894 | 3300006048 | Bacteria | 858 |
| 196 | Ga0075364_10011619 | 3300006051 | Bacteria | 5353 |
| 197 | Ga0075364_10112989 | 3300006051 | Bacteria | 1814 |
| 198 | Ga0070715_10000467 | 3300006163 | Bacteria | 10474 |
| 199 | Ga0070715_10136832 | 3300006163 | Bacteria | 1185 |
| 200 | Ga0070715_10317261 | 3300006163 | Bacteria | 840 |
| 201 | Ga0070716_100000841 | 3300006173 | Bacteria | 13244 |
| 202 | Ga0070716_100107742 | 3300006173 | Bacteria | 1721 |
| 203 | Ga0070716_100151373 | 3300006173 | Bacteria | 1493 |
| 204 | Ga0070712_100002446 | 3300006175 | Bacteria | 11447 |
| 205 | Ga0070712_100009088 | 3300006175 | Bacteria | 6258 |
| 206 | Ga0070712_100136191 | 3300006175 | Bacteria | 1868 |
| 207 | Ga0070712_100305479 | 3300006175 | Bacteria | 1289 |
| 208 | Ga0070712_100927680 | 3300006175 | Bacteria | 751 |
| 209 | Ga0075362_10322610 | 3300006177 | Bacteria | 769 |
| 210 | Ga0075362_10443784 | 3300006177 | Bacteria | 658 |
| 211 | Ga0075367_10016273 | 3300006178 | Bacteria | 4060 |
| 212 | Ga0075367_10136736 | 3300006178 | Bacteria | 1516 |
| 213 | Ga0075367_10146349 | 3300006178 | Bacteria | 1465 |
| 214 | Ga0075367_10481996 | 3300006178 | Bacteria | 786 |
| 215 | Ga0075369_10036194 | 3300006186 | Bacteria | 2100 |
| 216 | Ga0075366_10076370 | 3300006195 | Bacteria | 1999 |
| 217 | Ga0075366_10342806 | 3300006195 | Bacteria | 916 |
| 218 | Ga0097621_100074771 | 3300006237 | Bacteria | 2807 |
| 219 | Ga0097621_100093160 | 3300006237 | Bacteria | 2524 |
| 220 | Ga0097621_100094777 | 3300006237 | Bacteria | 2503 |
| 221 | Ga0097621_101035912 | 3300006237 | Bacteria | 769 |
| 222 | Ga0075370_10072587 | 3300006353 | Bacteria | 1970 |
| 223 | Ga0068871_100070981 | 3300006358 | Bacteria | 2863 |
| 224 | Ga0068871_100964353 | 3300006358 | Bacteria | 793 |
| 225 | Ga0075434_100085607 | 3300006871 | Bacteria | 3152 |
| 226 | Ga0068865_100072578 | 3300006881 | Bacteria | 2445 |
| 227 | Ga0068865_100132105 | 3300006881 | Bacteria | 1872 |
| 228 | Ga0097620_100268898 | 3300006931 | Bacteria | 1796 |
| 229 | Ga0097620_100474234 | 3300006931 | Bacteria | 1347 |
| 230 | Ga0097620_100902023 | 3300006931 | Bacteria | 968 |
| 231 | Ga0099825_1020324 | 3300006941 | Bacteria | 4748 |
| 232 | Ga0099825_1039163 | 3300006941 | Bacteria | 1471 |
| 233 | Ga0099824_1010512 | 3300006942 | Bacteria | 10865 |
| 234 | Ga0099824_1014791 | 3300006942 | Bacteria | 7625 |
| 235 | Ga0099824_1046460 | 3300006942 | Bacteria | 891 |
| 236 | Ga0099822_1001984 | 3300006943 | Bacteria | 24919 |
| 237 | Ga0099823_1089075 | 3300006944 | Bacteria | 1075 |
| 238 | Ga0075435_100088077 | 3300007076 | Bacteria | 2559 |
| 239 | Ga0099795_10054104 | 3300007788 | Bacteria | 1471 |
| 240 | Ga0099795_10259631 | 3300007788 | Bacteria | 752 |
| 241 | Ga0105244_10211259 | 3300009036 | Bacteria | 913 |
| 242 | Ga0105250_10126097 | 3300009092 | Bacteria | 1055 |
| 243 | Ga0105240_10679877 | 3300009093 | Bacteria | 1125 |
| 244 | Ga0105240_10867830 | 3300009093 | Bacteria | 973 |
| 245 | Ga0111539_10313176 | 3300009094 | Bacteria | 1827 |
| 246 | Ga0111539_10363720 | 3300009094 | Bacteria | 1684 |
| 247 | Ga0105245_10028789 | 3300009098 | Bacteria | 4902 |
| 248 | Ga0105245_10182260 | 3300009098 | Bacteria | 2007 |
| 249 | Ga0105245_10276300 | 3300009098 | Bacteria | 1640 |
| 250 | Ga0105245_11192035 | 3300009098 | Bacteria | 809 |
| 251 | Ga0105247_10057933 | 3300009101 | Bacteria | 2396 |
| 252 | Ga0105247_10060291 | 3300009101 | Bacteria | 2351 |
| 253 | Ga0105247_10107421 | 3300009101 | Bacteria | 1792 |
| 254 | Ga0105247_10221345 | 3300009101 | Bacteria | 1281 |
| 255 | Ga0105247_10253332 | 3300009101 | Bacteria | 1204 |
| 256 | Ga0105247_10300555 | 3300009101 | Bacteria | 1113 |
| 257 | Ga0105243_10281547 | 3300009148 | Bacteria | 1498 |
| 258 | Ga0105243_11621434 | 3300009148 | Bacteria | 674 |
| 259 | Ga0105243_12031488 | 3300009148 | Bacteria | 610 |
| 260 | Ga0105241_10016637 | 3300009174 | Bacteria | 5397 |
| 261 | Ga0105241_10042053 | 3300009174 | Bacteria | 3455 |
| 262 | Ga0105241_10585759 | 3300009174 | Bacteria | 1006 |
| 263 | Ga0105242_10915942 | 3300009176 | Bacteria | 878 |
| 264 | Ga0105242_11194547 | 3300009176 | Bacteria | 779 |
| 265 | Ga0105248_10292121 | 3300009177 | Bacteria | 1835 |
| 266 | Ga0105248_11098099 | 3300009177 | Bacteria | 899 |
| 267 | Ga0105248_11497591 | 3300009177 | Bacteria | 764 |
| 268 | Ga0105237_10126837 | 3300009545 | Bacteria | 2546 |
| 269 | Ga0105237_10333372 | 3300009545 | Bacteria | 1521 |
| 270 | Ga0105237_10672703 | 3300009545 | Bacteria | 1042 |
| 271 | Ga0105237_11289100 | 3300009545 | Bacteria | 737 |
| 272 | Ga0105238_10309954 | 3300009551 | Bacteria | 1563 |
| 273 | Ga0105238_10637142 | 3300009551 | Bacteria | 1075 |
| 274 | Ga0105238_10768623 | 3300009551 | Bacteria | 978 |
| 275 | Ga0105238_10958028 | 3300009551 | Bacteria | 876 |
| 276 | Ga0105238_11219444 | 3300009551 | Bacteria | 777 |
| 277 | Ga0105249_10298478 | 3300009553 | Bacteria | 1615 |
| 278 | Ga0105249_10354663 | 3300009553 | Bacteria | 1487 |
| 279 | Ga0105249_10703451 | 3300009553 | Bacteria | 1071 |
| 280 | Ga0105249_11024961 | 3300009553 | Bacteria | 894 |
| 281 | Ga0099796_10015205 | 3300010159 | Bacteria | 2245 |
| 282 | Ga0099796_10182110 | 3300010159 | Bacteria | 844 |
| 283 | Ga0105239_10184727 | 3300010375 | Bacteria | 2333 |
| 284 | Ga0105239_10337343 | 3300010375 | Bacteria | 1701 |
| 285 | Ga0105239_10341586 | 3300010375 | Bacteria | 1690 |
| 286 | Ga0105239_10568705 | 3300010375 | Bacteria | 1292 |
| 287 | Ga0105239_11131298 | 3300010375 | Bacteria | 902 |
| 288 | Ga0105246_10094671 | 3300011119 | Bacteria | 2161 |
| 289 | Ga0105246_10162306 | 3300011119 | Bacteria | 1703 |
| 290 | Ga0105246_11011435 | 3300011119 | Bacteria | 753 |
| 291 | Ga0157369_10020020 | 3300013105 | Bacteria | 7484 |
| 292 | Ga0157369_10490873 | 3300013105 | Bacteria | 1271 |
| 293 | Ga0157374_10036491 | 3300013296 | Bacteria | 4502 |
| 294 | Ga0157374_10091944 | 3300013296 | Bacteria | 2894 |
| 295 | Ga0157378_10235465 | 3300013297 | Bacteria | 1747 |
| 296 | Ga0157378_10297752 | 3300013297 | Bacteria | 1560 |
| 297 | Ga0163162_10033688 | 3300013306 | Bacteria | 5091 |
| 298 | Ga0163162_10192615 | 3300013306 | Bacteria | 2166 |
| 299 | Ga0163162_10196746 | 3300013306 | Bacteria | 2145 |
| 300 | Ga0163162_10905989 | 3300013306 | Bacteria | 995 |
| 301 | Ga0163162_11615165 | 3300013306 | Bacteria | 740 |
| 302 | Ga0163162_11734292 | 3300013306 | Bacteria | 713 |
| 303 | Ga0157372_10255072 | 3300013307 | Bacteria | 2036 |
| 304 | Ga0157372_12060231 | 3300013307 | Bacteria | 656 |
| 305 | Ga0157375_10042135 | 3300013308 | Bacteria | 4416 |
| 306 | Ga0157375_10088435 | 3300013308 | Bacteria | 3153 |
| 307 | Ga0157375_10316195 | 3300013308 | Bacteria | 1726 |
| 308 | Ga0157375_10437699 | 3300013308 | Bacteria | 1473 |
| 309 | Ga0157375_11124440 | 3300013308 | Bacteria | 920 |
| 310 | Ga0157375_11373761 | 3300013308 | Bacteria | 832 |
| 311 | Ga0157375_11772664 | 3300013308 | Bacteria | 732 |
| 312 | Ga0163163_10050507 | 3300014325 | Bacteria | 4095 |
| 313 | Ga0163163_10141356 | 3300014325 | Bacteria | 2449 |
| 314 | Ga0163163_10221492 | 3300014325 | Bacteria | 1941 |
| 315 | Ga0163163_10294188 | 3300014325 | Bacteria | 1676 |
| 316 | Ga0163163_10948135 | 3300014325 | Bacteria | 924 |
| 317 | Ga0157380_10165577 | 3300014326 | Bacteria | 1926 |
| 318 | Ga0157380_10497827 | 3300014326 | Bacteria | 1183 |
| 319 | Ga0157377_10282611 | 3300014745 | Bacteria | 1088 |
| 320 | Ga0157377_10341276 | 3300014745 | Bacteria | 1002 |
| 321 | Ga0157379_10079606 | 3300014968 | Bacteria | 2934 |
| 322 | Ga0157379_10107522 | 3300014968 | Bacteria | 2504 |
| 323 | Ga0157379_10138478 | 3300014968 | Bacteria | 2194 |
| 324 | Ga0157379_10227748 | 3300014968 | Bacteria | 1689 |
| 325 | Ga0157376_10004272 | 3300014969 | Bacteria | 9918 |
| 326 | Ga0157376_10041292 | 3300014969 | Bacteria | 3776 |
| 327 | Ga0157376_10074244 | 3300014969 | Bacteria | 2899 |
| 328 | Ga0157376_10214414 | 3300014969 | Bacteria | 1779 |
| 329 | Ga0157376_10929481 | 3300014969 | Bacteria | 889 |
| 330 | Ga0163161_10314640 | 3300017792 | Bacteria | 1236 |
| 331 | Ga0197907_10173837 | 3300020069 | Bacteria | 1745 |
| 332 | Ga0206356_10315111 | 3300020070 | Bacteria | 679 |
| 333 | Ga0206356_10644697 | 3300020070 | Bacteria | 1811 |
| 334 | Ga0206352_11357288 | 3300020078 | Bacteria | 1744 |
| 335 | Ga0206353_10982674 | 3300020082 | Bacteria | 1597 |
| 336 | Ga0154015_1039217 | 3300020610 | Bacteria | 776 |
| 337 | Ga0213874_10040348 | 3300021377 | Bacteria | 1393 |
| 338 | Ga0209563_103469 | 3300025230 | Bacteria | 3248 |
| 339 | Ga0209677_102593 | 3300025253 | Bacteria | 6606 |
| 340 | Ga0209233_1016731 | 3300025261 | Bacteria | 2014 |
| 341 | Ga0209233_1027116 | 3300025261 | Bacteria | 1392 |
| 342 | Ga0209130_1038983 | 3300025284 | Bacteria | 928 |
| 343 | Ga0209758_1000595 | 3300025297 | Bacteria | 56364 |
| 344 | Ga0209758_1000604 | 3300025297 | Bacteria | 55558 |
| 345 | Ga0209758_1001332 | 3300025297 | Bacteria | 29913 |
| 346 | Ga0209758_1025154 | 3300025297 | Bacteria | 2621 |
| 347 | Ga0209758_1049382 | 3300025297 | Bacteria | 1486 |
| 348 | Ga0209758_1106602 | 3300025297 | Bacteria | 784 |
| 349 | Ga0209256_1008443 | 3300025299 | Bacteria | 4774 |
| 350 | Ga0209256_1074700 | 3300025299 | Bacteria | 753 |
| 351 | Ga0207426_1000500 | 3300025302 | Bacteria | 58181 |
| 352 | Ga0207426_1001477 | 3300025302 | Bacteria | 19322 |
| 353 | Ga0207426_1007029 | 3300025302 | Bacteria | 4776 |
| 354 | Ga0207426_1012937 | 3300025302 | Bacteria | 3114 |
| 355 | Ga0209051_1093743 | 3300025303 | Bacteria | 827 |
| 356 | Ga0209257_1001217 | 3300025304 | Bacteria | 32229 |
| 357 | Ga0209257_1039914 | 3300025304 | Bacteria | 1406 |
| 358 | Ga0207697_10125145 | 3300025315 | Bacteria | 1108 |
| 359 | Ga0207696_1045828 | 3300025711 | Bacteria | 1263 |
| 360 | Ga0207653_10022622 | 3300025885 | Bacteria | 1998 |
| 361 | Ga0207692_10002241 | 3300025898 | Bacteria | 7397 |
| 362 | Ga0207692_10343202 | 3300025898 | Bacteria | 919 |
| 363 | Ga0207692_10457622 | 3300025898 | Bacteria | 804 |
| 364 | Ga0207642_10137858 | 3300025899 | Bacteria | 1282 |
| 365 | Ga0207642_10203052 | 3300025899 | Bacteria | 1096 |
| 366 | Ga0207710_10031300 | 3300025900 | Bacteria | 2326 |
| 367 | Ga0207710_10042758 | 3300025900 | Bacteria | 2013 |
| 368 | Ga0207710_10055220 | 3300025900 | Bacteria | 1790 |
| 369 | Ga0207710_10068167 | 3300025900 | Bacteria | 1627 |
| 370 | Ga0207710_10121193 | 3300025900 | Bacteria | 1249 |
| 371 | Ga0207688_10072723 | 3300025901 | Bacteria | 1954 |
| 372 | Ga0207688_10167946 | 3300025901 | Bacteria | 1303 |
| 373 | Ga0207680_10438132 | 3300025903 | Bacteria | 927 |
| 374 | Ga0207680_10897925 | 3300025903 | Bacteria | 635 |
| 375 | Ga0207647_10135326 | 3300025904 | Bacteria | 1446 |
| 376 | Ga0207685_10000741 | 3300025905 | Bacteria | 5960 |
| 377 | Ga0207685_10341978 | 3300025905 | Bacteria | 752 |
| 378 | Ga0207699_10006247 | 3300025906 | Bacteria | 5752 |
| 379 | Ga0207699_10008256 | 3300025906 | Bacteria | 5129 |
| 380 | Ga0207699_10772660 | 3300025906 | Bacteria | 705 |
| 381 | Ga0207699_10864446 | 3300025906 | Bacteria | 666 |
| 382 | Ga0207645_10121320 | 3300025907 | Bacteria | 1697 |
| 383 | Ga0207645_10678390 | 3300025907 | Bacteria | 700 |
| 384 | Ga0207643_10178655 | 3300025908 | Bacteria | 1283 |
| 385 | Ga0207643_10290527 | 3300025908 | Bacteria | 1015 |
| 386 | Ga0207705_10196045 | 3300025909 | Bacteria | 1529 |
| 387 | Ga0207684_10140603 | 3300025910 | Bacteria | 2075 |
| 388 | Ga0207684_10658444 | 3300025910 | Bacteria | 892 |
| 389 | Ga0207654_10005980 | 3300025911 | Bacteria | 6122 |
| 390 | Ga0207654_10222223 | 3300025911 | Bacteria | 1253 |
| 391 | Ga0207707_10000639 | 3300025912 | Bacteria | 34565 |
| 392 | Ga0207695_10186767 | 3300025913 | Bacteria | 1991 |
| 393 | Ga0207695_10383565 | 3300025913 | Bacteria | 1291 |
| 394 | Ga0207695_10741449 | 3300025913 | Bacteria | 862 |
| 395 | Ga0207671_10256048 | 3300025914 | Bacteria | 1377 |
| 396 | Ga0207671_10355742 | 3300025914 | Bacteria | 1162 |
| 397 | Ga0207693_10003759 | 3300025915 | Bacteria | 12937 |
| 398 | Ga0207693_10102545 | 3300025915 | Bacteria | 2244 |
| 399 | Ga0207693_10122223 | 3300025915 | Bacteria | 2045 |
| 400 | Ga0207693_10159400 | 3300025915 | Bacteria | 1775 |
| 401 | Ga0207693_10918528 | 3300025915 | Bacteria | 671 |
| 402 | Ga0207663_10000502 | 3300025916 | Bacteria | 17107 |
| 403 | Ga0207663_10102757 | 3300025916 | Bacteria | 1923 |
| 404 | Ga0207663_10108965 | 3300025916 | Bacteria | 1876 |
| 405 | Ga0207662_10120318 | 3300025918 | Bacteria | 1646 |
| 406 | Ga0207657_10038451 | 3300025919 | Bacteria | 4259 |
| 407 | Ga0207657_11046913 | 3300025919 | Bacteria | 625 |
| 408 | Ga0207652_10010036 | 3300025921 | Bacteria | 7626 |
| 409 | Ga0207646_10142063 | 3300025922 | Bacteria | 2163 |
| 410 | Ga0207681_10124704 | 3300025923 | Bacteria | 1894 |
| 411 | Ga0207681_11342004 | 3300025923 | Bacteria | 600 |
| 412 | Ga0207694_10084505 | 3300025924 | Bacteria | 2497 |
| 413 | Ga0207650_10124649 | 3300025925 | Bacteria | 2010 |
| 414 | Ga0207650_10187060 | 3300025925 | Bacteria | 1653 |
| 415 | Ga0207650_10588635 | 3300025925 | Bacteria | 935 |
| 416 | Ga0207659_10911632 | 3300025926 | Bacteria | 756 |
| 417 | Ga0207659_11316578 | 3300025926 | Bacteria | 620 |
| 418 | Ga0207687_10093119 | 3300025927 | Bacteria | 2202 |
| 419 | Ga0207687_10199345 | 3300025927 | Bacteria | 1563 |
| 420 | Ga0207687_10654990 | 3300025927 | Bacteria | 889 |
| 421 | Ga0207700_10005398 | 3300025928 | Bacteria | 7638 |
| 422 | Ga0207700_10064289 | 3300025928 | Bacteria | 2794 |
| 423 | Ga0207700_10090508 | 3300025928 | Bacteria | 2415 |
| 424 | Ga0207700_10174803 | 3300025928 | Bacteria | 1794 |
| 425 | Ga0207700_10208505 | 3300025928 | Bacteria | 1651 |
| 426 | Ga0207700_10384295 | 3300025928 | Bacteria | 1228 |
| 427 | Ga0207700_10778836 | 3300025928 | Bacteria | 855 |
| 428 | Ga0207700_10781577 | 3300025928 | Bacteria | 854 |
| 429 | Ga0207664_10043298 | 3300025929 | Bacteria | 3519 |
| 430 | Ga0207664_10045215 | 3300025929 | Bacteria | 3452 |
| 431 | Ga0207664_10085612 | 3300025929 | Bacteria | 2573 |
| 432 | Ga0207664_10388205 | 3300025929 | Bacteria | 1240 |
| 433 | Ga0207664_10622377 | 3300025929 | Bacteria | 970 |
| 434 | Ga0207664_10787086 | 3300025929 | Bacteria | 856 |
| 435 | Ga0207664_10978238 | 3300025929 | Bacteria | 759 |
| 436 | Ga0207644_10187921 | 3300025931 | Bacteria | 1623 |
| 437 | Ga0207644_10316355 | 3300025931 | Bacteria | 1261 |
| 438 | Ga0207644_10543247 | 3300025931 | Bacteria | 961 |
| 439 | Ga0207644_10649033 | 3300025931 | Bacteria | 878 |
| 440 | Ga0207706_10055854 | 3300025933 | Bacteria | 3481 |
| 441 | Ga0207706_10159120 | 3300025933 | Bacteria | 1986 |
| 442 | Ga0207706_10181565 | 3300025933 | Bacteria | 1848 |
| 443 | Ga0207706_10216572 | 3300025933 | Bacteria | 1678 |
| 444 | Ga0207686_10131143 | 3300025934 | Bacteria | 1719 |
| 445 | Ga0207686_10561627 | 3300025934 | Bacteria | 893 |
| 446 | Ga0207709_10055044 | 3300025935 | Bacteria | 2456 |
| 447 | Ga0207709_10347985 | 3300025935 | Bacteria | 1118 |
| 448 | Ga0207709_10452824 | 3300025935 | Bacteria | 992 |
| 449 | Ga0207670_10092679 | 3300025936 | Bacteria | 2139 |
| 450 | Ga0207670_10333659 | 3300025936 | Bacteria | 1196 |
| 451 | Ga0207669_10064377 | 3300025937 | Bacteria | 2268 |
| 452 | Ga0207669_10869200 | 3300025937 | Bacteria | 751 |
| 453 | Ga0207704_10042041 | 3300025938 | Bacteria | 2687 |
| 454 | Ga0207704_10091861 | 3300025938 | Bacteria | 1996 |
| 455 | Ga0207665_10002009 | 3300025939 | Bacteria | 13693 |
| 456 | Ga0207665_10062598 | 3300025939 | Bacteria | 2525 |
| 457 | Ga0207665_10091603 | 3300025939 | Bacteria | 2108 |
| 458 | Ga0207665_10317582 | 3300025939 | Bacteria | 1168 |
| 459 | Ga0207665_10651756 | 3300025939 | Bacteria | 825 |
| 460 | Ga0207691_10018692 | 3300025940 | Bacteria | 6566 |
| 461 | Ga0207691_10110689 | 3300025940 | Bacteria | 2442 |
| 462 | Ga0207691_10368011 | 3300025940 | Bacteria | 1228 |
| 463 | Ga0207691_10934336 | 3300025940 | Bacteria | 725 |
| 464 | Ga0207711_10253859 | 3300025941 | Bacteria | 1615 |
| 465 | Ga0207711_10954309 | 3300025941 | Bacteria | 796 |
| 466 | Ga0207689_10048603 | 3300025942 | Bacteria | 3499 |
| 467 | Ga0207689_10100307 | 3300025942 | Bacteria | 2379 |
| 468 | Ga0207689_10477296 | 3300025942 | Bacteria | 1044 |
| 469 | Ga0207689_10532497 | 3300025942 | Bacteria | 986 |
| 470 | Ga0207689_10570017 | 3300025942 | Bacteria | 951 |
| 471 | Ga0207661_10007291 | 3300025944 | Bacteria | 7866 |
| 472 | Ga0207661_10054657 | 3300025944 | Bacteria | 3199 |
| 473 | Ga0207679_10125519 | 3300025945 | Bacteria | 2050 |
| 474 | Ga0207679_10674846 | 3300025945 | Bacteria | 936 |
| 475 | Ga0207679_10805164 | 3300025945 | Bacteria | 857 |
| 476 | Ga0207667_10154496 | 3300025949 | Bacteria | 2361 |
| 477 | Ga0207667_10487924 | 3300025949 | Bacteria | 1250 |
| 478 | Ga0207667_11066099 | 3300025949 | Bacteria | 793 |
| 479 | Ga0207651_10064250 | 3300025960 | Bacteria | 2568 |
| 480 | Ga0207651_10368596 | 3300025960 | Bacteria | 1214 |
| 481 | Ga0207651_10823545 | 3300025960 | Bacteria | 824 |
| 482 | Ga0207712_10054730 | 3300025961 | Bacteria | 2804 |
| 483 | Ga0207712_10115924 | 3300025961 | Bacteria | 2018 |
| 484 | Ga0207712_10216066 | 3300025961 | Bacteria | 1530 |
| 485 | Ga0207712_10321796 | 3300025961 | Bacteria | 1276 |
| 486 | Ga0207712_11167174 | 3300025961 | Bacteria | 686 |
| 487 | Ga0207668_10030240 | 3300025972 | Bacteria | 3557 |
| 488 | Ga0207668_10078317 | 3300025972 | Bacteria | 2386 |
| 489 | Ga0207668_10169342 | 3300025972 | Bacteria | 1711 |
| 490 | Ga0207668_10322913 | 3300025972 | Bacteria | 1281 |
| 491 | Ga0207668_10508646 | 3300025972 | Bacteria | 1037 |
| 492 | Ga0207668_11277806 | 3300025972 | Bacteria | 660 |
| 493 | Ga0207640_10919525 | 3300025981 | Bacteria | 765 |
| 494 | Ga0207658_10294509 | 3300025986 | Bacteria | 1396 |
| 495 | Ga0207677_10005995 | 3300026023 | Bacteria | 6622 |
| 496 | Ga0207677_10049586 | 3300026023 | Bacteria | 2834 |
| 497 | Ga0207677_10181010 | 3300026023 | Bacteria | 1658 |
| 498 | Ga0207677_10239123 | 3300026023 | Bacteria | 1468 |
| 499 | Ga0207677_10696208 | 3300026023 | Bacteria | 901 |
| 500 | Ga0207703_10228892 | 3300026035 | Bacteria | 1666 |
| 501 | Ga0207703_10307145 | 3300026035 | Bacteria | 1448 |
| 502 | Ga0207703_10923455 | 3300026035 | Bacteria | 836 |
| 503 | Ga0207703_10982617 | 3300026035 | Bacteria | 810 |
| 504 | Ga0207639_10285322 | 3300026041 | Bacteria | 1453 |
| 505 | Ga0207639_10794876 | 3300026041 | Bacteria | 881 |
| 506 | Ga0207678_10018446 | 3300026067 | Bacteria | 6127 |
| 507 | Ga0207678_10069771 | 3300026067 | Bacteria | 3013 |
| 508 | Ga0207678_10079380 | 3300026067 | Bacteria | 2810 |
| 509 | Ga0207678_10109411 | 3300026067 | Bacteria | 2357 |
| 510 | Ga0207678_10109881 | 3300026067 | Bacteria | 2352 |
| 511 | Ga0207678_10334194 | 3300026067 | Bacteria | 1305 |
| 512 | Ga0207678_10999165 | 3300026067 | Bacteria | 740 |
| 513 | Ga0207708_10183920 | 3300026075 | Bacteria | 1660 |
| 514 | Ga0207708_10908885 | 3300026075 | Bacteria | 762 |
| 515 | Ga0207708_10925574 | 3300026075 | Bacteria | 755 |
| 516 | Ga0207708_10974905 | 3300026075 | Bacteria | 736 |
| 517 | Ga0207702_10079376 | 3300026078 | Bacteria | 2844 |
| 518 | Ga0207641_10273614 | 3300026088 | Bacteria | 1585 |
| 519 | Ga0207641_10328037 | 3300026088 | Bacteria | 1453 |
| 520 | Ga0207641_10459810 | 3300026088 | Bacteria | 1231 |
| 521 | Ga0207641_11832556 | 3300026088 | Bacteria | 608 |
| 522 | Ga0207648_10052565 | 3300026089 | Bacteria | 3563 |
| 523 | Ga0207648_10090372 | 3300026089 | Bacteria | 2675 |
| 524 | Ga0207648_10932079 | 3300026089 | Bacteria | 812 |
| 525 | Ga0207676_10068608 | 3300026095 | Bacteria | 2837 |
| 526 | Ga0207676_10127863 | 3300026095 | Bacteria | 2155 |
| 527 | Ga0207676_10452614 | 3300026095 | Bacteria | 1210 |
| 528 | Ga0207676_10700932 | 3300026095 | Bacteria | 981 |
| 529 | Ga0207676_11265358 | 3300026095 | Bacteria | 732 |
| 530 | Ga0207675_100015313 | 3300026118 | Bacteria | 7154 |
| 531 | Ga0207675_100115027 | 3300026118 | Bacteria | 2541 |
| 532 | Ga0207675_100399899 | 3300026118 | Bacteria | 1353 |
| 533 | Ga0207675_100680119 | 3300026118 | Bacteria | 1037 |
| 534 | Ga0207675_101207895 | 3300026118 | Bacteria | 776 |
| 535 | Ga0207683_10082409 | 3300026121 | Bacteria | 2858 |
| 536 | Ga0207683_10111729 | 3300026121 | Bacteria | 2447 |
| 537 | Ga0207683_10304582 | 3300026121 | Bacteria | 1458 |
| 538 | Ga0207698_10024589 | 3300026142 | Bacteria | 4231 |
| 539 | Ga0207698_10081623 | 3300026142 | Bacteria | 2611 |
| 540 | Ga0207698_10208977 | 3300026142 | Bacteria | 1754 |
| 541 | Ga0207698_10467902 | 3300026142 | Bacteria | 1220 |
| 542 | Ga0207698_10483186 | 3300026142 | Bacteria | 1202 |
| 543 | Ga0209389_1000019 | 3300027296 | Bacteria | 172067 |
| 544 | Ga0209389_1000070 | 3300027296 | Bacteria | 97498 |
| 545 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 546 | Ga0209589_1000420 | 3300027357 | Bacteria | 58471 |
| 547 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 548 | Ga0209489_100033 | 3300027361 | Bacteria | 172166 |
| 549 | Ga0209489_100196 | 3300027361 | Bacteria | 97498 |
| 550 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 551 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 552 | Ga0209588_1081802 | 3300027671 | Bacteria | 1043 |
| 553 | Ga0209813_10215257 | 3300027866 | Bacteria | 717 |
| 554 | Ga0268266_10001750 | 3300028379 | Bacteria | 24844 |
| 555 | Ga0268266_10012580 | 3300028379 | Bacteria | 7312 |
| 556 | Ga0268266_10020716 | 3300028379 | Bacteria | 5605 |
| 557 | Ga0268266_10182525 | 3300028379 | Bacteria | 1911 |
| 558 | Ga0268266_10440426 | 3300028379 | Bacteria | 1237 |
| 559 | Ga0268266_11062369 | 3300028379 | Bacteria | 783 |
| 560 | Ga0268265_10078508 | 3300028380 | Bacteria | 2596 |
| 561 | Ga0268265_10098350 | 3300028380 | Bacteria | 2356 |
| 562 | Ga0268265_10182067 | 3300028380 | Bacteria | 1806 |
| 563 | Ga0268265_10317928 | 3300028380 | Bacteria | 1408 |
| 564 | Ga0268265_11219140 | 3300028380 | Bacteria | 750 |
| 565 | Ga0268265_11260766 | 3300028380 | Bacteria | 738 |
| 566 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 567 | Ga0268264_10157436 | 3300028381 | Bacteria | 2043 |
| 568 | Ga0268264_10208538 | 3300028381 | Bacteria | 1792 |
| 569 | Ga0268264_10240998 | 3300028381 | Bacteria | 1675 |
| 570 | Ga0268264_10484116 | 3300028381 | Bacteria | 1204 |
| 571 | Ga0268264_10999100 | 3300028381 | Bacteria | 843 |
| 572 | Ga0307517_10111696 | 3300028786 | Bacteria | 2075 |
| 573 | Ga0307517_10319483 | 3300028786 | Bacteria | 860 |
| 574 | Ga0307511_10097830 | 3300030521 | Bacteria | 1946 |
| 575 | Ga0307511_10357059 | 3300030521 | Bacteria | 624 |
| 576 | Ga0265763_1003622 | 3300030763 | Bacteria | 1237 |
| 577 | Ga0265330_10041534 | 3300031235 | Bacteria | 2039 |
| 578 | Ga0265332_10010699 | 3300031238 | Bacteria | 4080 |
| 579 | Ga0265332_10069712 | 3300031238 | Bacteria | 1498 |
| 580 | Ga0265325_10006203 | 3300031241 | Bacteria | 7289 |
| 581 | Ga0265340_10422145 | 3300031247 | Bacteria | 588 |
| 582 | Ga0265339_10058663 | 3300031249 | Bacteria | 2078 |
| 583 | Ga0307513_10661935 | 3300031456 | Bacteria | 751 |
| 584 | Ga0307509_10064485 | 3300031507 | Bacteria | 3852 |
| 585 | Ga0307509_10145606 | 3300031507 | Bacteria | 2295 |
| 586 | Ga0307509_10236279 | 3300031507 | Bacteria | 1625 |
| 587 | Ga0307408_100297561 | 3300031548 | Bacteria | 1350 |
| 588 | Ga0307408_101237452 | 3300031548 | Bacteria | 698 |
| 589 | Ga0265313_10128288 | 3300031595 | Bacteria | 1101 |
| 590 | Ga0307508_10000019 | 3300031616 | Bacteria | 197575 |
| 591 | Ga0307508_10028707 | 3300031616 | Bacteria | 5030 |
| 592 | Ga0307508_10527312 | 3300031616 | Bacteria | 777 |
| 593 | Ga0265314_10062912 | 3300031711 | Bacteria | 2520 |
| 594 | Ga0265314_10101325 | 3300031711 | Bacteria | 1850 |
| 595 | Ga0265342_10024875 | 3300031712 | Bacteria | 3773 |
| 596 | Ga0307516_10031276 | 3300031730 | Bacteria | 5365 |
| 597 | Ga0307516_10222211 | 3300031730 | Bacteria | 1597 |
| 598 | Ga0307516_10479814 | 3300031730 | Bacteria | 898 |
| 599 | Ga0307405_10404626 | 3300031731 | Bacteria | 1069 |
| 600 | Ga0307413_10046074 | 3300031824 | Bacteria | 2590 |
| 601 | Ga0307410_10178068 | 3300031852 | Bacteria | 1608 |
| 602 | Ga0307407_11114944 | 3300031903 | Bacteria | 614 |
| 603 | Ga0307416_101070613 | 3300032002 | Bacteria | 910 |
| 604 | Ga0307415_100152049 | 3300032126 | Bacteria | 1783 |
| 605 | Ga0307507_10027162 | 3300033179 | Bacteria | 6144 |
| 606 | Ga0307510_10012956 | 3300033180 | Bacteria | 9898 |
| 607 | Ga0307510_10063261 | 3300033180 | Bacteria | 3770 |
| 608 | Ga0307510_10212742 | 3300033180 | Bacteria | 1454 |
| 609 | Ga0315911_1000012 | 3300033442 | Bacteria | 248988 |
| 610 | Ga0316215_1006075 | 3300033544 | Bacteria | 1168 |
| 611 | Ga0373948_0063694 | 3300034817 | Bacteria | 814 |
| 612 | Ga0373934_0032798 | 3300035086 | Bacteria | 2038 |
| 613 | Ga0373952_0017318 | 3300035092 | Bacteria | 1477 |
| 614 | Ga0373923_0001449 | 3300035111 | Bacteria | 6805 |
| 615 | Ga0373923_0071395 | 3300035111 | Bacteria | 1491 |
| 616 | Ga0373945_0274618 | 3300035116 | Bacteria | 717 |
| 617 | Ga0373953_0020632 | 3300035117 | Bacteria | 2463 |
| 618 | Ga0373954_0005227 | 3300035118 | Bacteria | 5609 |
| 619 | Ga0373954_0024857 | 3300035118 | Bacteria | 2733 |
| 620 | Ga0373956_0037950 | 3300035119 | Bacteria | 2130 |
| 621 | Ga0373943_0057731 | 3300035170 | Bacteria | 1929 |
| 622 | Ga0373946_0031993 | 3300035171 | Bacteria | 2110 |
| 623 | Ga0373955_0018171 | 3300035172 | Bacteria | 3493 |
| 624 | Ga0373955_0112026 | 3300035172 | Bacteria | 1578 |
| 625 | Ga0373924_0128840 | 3300035410 | Bacteria | 1100 |
| 626 | Ga0373931_0259862 | 3300035691 | Bacteria | 1059 |
| 627 | Ga0373935_0731878 | 3300035692 | Bacteria | 728 |
| 628 | Ga0373927_0019061 | 3300035695 | Bacteria | 4499 |
| 629 | Ga0373927_0033776 | 3300035695 | Bacteria | 3329 |
| 630 | Ga0373927_0226772 | 3300035695 | Bacteria | 1227 |
| 631 | Ga0373933_0000063 | 3300035724 | Bacteria | 64367 |
| 632 | Ga0373933_0022082 | 3300035724 | Bacteria | 3622 |
| 633 | Ga0373947_0010644 | 3300035725 | Bacteria | 5278 |
| 634 | Ga0373947_0356258 | 3300035725 | Bacteria | 982 |
| 635 | Ga0373947_0754854 | 3300035725 | Bacteria | 664 |
| 636 | Ga0373937_0015969 | 3300036401 | Bacteria | 6658 |
| 637 | Ga0373937_0166920 | 3300036401 | Bacteria | 2064 |
| 638 | Ga0372808_024717 | 3300036459 | Bacteria | 862 |
| 639 | Ga0373925_0014564 | 3300037068 | Bacteria | 5684 |
| 640 | Ga0373925_0031600 | 3300037068 | Bacteria | 3891 |
| 641 | Ga0373925_0182921 | 3300037068 | Bacteria | 1660 |
| 642 | Ga0373925_0663440 | 3300037068 | Bacteria | 860 |
| 643 | Ga0395900_0257682 | 3300037418 | Bacteria | 1743 |
| 644 | Ga0395900_0467664 | 3300037418 | Bacteria | 1215 |
| 645 | Ga0395905_0036933 | 3300037471 | Bacteria | 4589 |
| 646 | Ga0395905_0141495 | 3300037471 | Bacteria | 2263 |
| 647 | Ga0395905_0331798 | 3300037471 | Bacteria | 1412 |
| 648 | Ga0395901_0181460 | 3300038443 | Bacteria | 2208 |
| 649 | Ga0395901_0791282 | 3300038443 | Bacteria | 938 |
| 650 | Ga0436365_0717605 | 3300039437 | Bacteria | 7228 |
| 651 | Ga0436365_1325472 | 3300039437 | Bacteria | 669 |
| 652 | Ga0436360_1239273 | 3300039438 | Bacteria | 1782 |
| 653 | Ga0436361_0844543 | 3300039447 | Bacteria | 5946 |
| 654 | Ga0436363_0375853 | 3300039450 | Bacteria | 1141 |
| 655 | Ga0436363_0392343 | 3300039450 | Bacteria | 1978 |
| 656 | Ga0439465_0069580 | 3300041413 | Bacteria | 1178 |
| 657 | Ga0451791_1341753 | 3300041451 | Bacteria | 692 |
| 658 | Ga0451795_1660820 | 3300041456 | Bacteria | 1327 |
| 659 | Ga0451802_1316910 | 3300041460 | Bacteria | 852 |
| 660 | Ga0439455_0042423 | 3300042012 | Bacteria | 1169 |
| 661 | Ga0466969_0037060 | 3300044656 | Bacteria | 2461 |
| 662 | Ga0466965_0001649 | 3300044683 | Bacteria | 9145 |
| 663 | Ga0466966_0437489 | 3300044684 | Bacteria | 786 |
| 664 | Ga0466968_0177229 | 3300044735 | Bacteria | 990 |
| 665 | Ga0466959_0093678 | 3300045049 | Bacteria | 2155 |
| 666 | Ga0466959_0227168 | 3300045049 | Bacteria | 1293 |
| 667 | Ga0466967_0006925 | 3300045976 | Bacteria | 8105 |
| 668 | Ga0466967_0220271 | 3300045976 | Bacteria | 1803 |
| 669 | Ga0466967_0652546 | 3300045976 | Bacteria | 1040 |
| 670 | Ga0466967_0731326 | 3300045976 | Bacteria | 981 |
| 671 | Ga0466967_0757066 | 3300045976 | Bacteria | 963 |
| 672 | Ga0466967_1313103 | 3300045976 | Bacteria | 720 |
| 673 | Ga0495617_066080 | 3300046452 | Bacteria | 1192 |
| 674 | Ga0495617_075090 | 3300046452 | Bacteria | 1109 |
| 675 | Ga0495592_0066237 | 3300046454 | Bacteria | 2643 |
| 676 | Ga0495592_0586255 | 3300046454 | Bacteria | 681 |
| 677 | Ga0495603_0046839 | 3300046455 | Bacteria | 2576 |
| 678 | Ga0495603_0098426 | 3300046455 | Bacteria | 1708 |
| 679 | Ga0495603_0207647 | 3300046455 | Bacteria | 1131 |
| 680 | Ga0495603_0308214 | 3300046455 | Bacteria | 909 |
| 681 | Ga0495603_0481901 | 3300046455 | Bacteria | 710 |
| 682 | Ga0495590_0116349 | 3300046457 | Bacteria | 956 |
| 683 | Ga0495590_0216556 | 3300046457 | Bacteria | 707 |
| 684 | Ga0495591_072731 | 3300046458 | Bacteria | 890 |
| 685 | Ga0495629_0062767 | 3300046459 | Bacteria | 2594 |
| 686 | Ga0495629_0063946 | 3300046459 | Bacteria | 2569 |
| 687 | Ga0495629_0292168 | 3300046459 | Bacteria | 1117 |
| 688 | Ga0495638_0018594 | 3300046460 | Bacteria | 4612 |
| 689 | Ga0495638_0376603 | 3300046460 | Bacteria | 742 |
| 690 | Ga0495641_0168302 | 3300046461 | Bacteria | 981 |
| 691 | Ga0495641_0250126 | 3300046461 | Bacteria | 797 |
| 692 | Ga0495651_0008281 | 3300046462 | Bacteria | 7967 |
| 693 | Ga0495651_0070262 | 3300046462 | Bacteria | 2665 |
| 694 | Ga0495653_0015404 | 3300046463 | Bacteria | 6232 |
| 695 | Ga0495650_0059806 | 3300046471 | Bacteria | 1533 |
| 696 | Ga0495580_0136985 | 3300046472 | Bacteria | 1697 |
| 697 | Ga0495580_0261951 | 3300046472 | Bacteria | 1182 |
| 698 | Ga0495582_0039702 | 3300046473 | Bacteria | 2591 |
| 699 | Ga0495639_0027583 | 3300046475 | Bacteria | 2514 |
| 700 | Ga0495639_0172023 | 3300046475 | Bacteria | 1052 |
| 701 | Ga0495662_0067305 | 3300046476 | Bacteria | 1733 |
| 702 | Ga0495662_0174281 | 3300046476 | Bacteria | 1060 |
| 703 | Ga0495664_0006295 | 3300046477 | Bacteria | 6554 |
| 704 | Ga0495664_0007640 | 3300046477 | Bacteria | 6010 |
| 705 | Ga0495664_0040645 | 3300046477 | Bacteria | 2751 |
| 706 | Ga0495664_0077643 | 3300046477 | Bacteria | 1989 |
| 707 | Ga0495664_0156330 | 3300046477 | Bacteria | 1383 |
| 708 | Ga0495664_0411068 | 3300046477 | Bacteria | 812 |
| 709 | Ga0495584_0199374 | 3300046491 | Bacteria | 1017 |
| 710 | Ga0495584_0310754 | 3300046491 | Bacteria | 800 |
| 711 | Ga0495584_0510450 | 3300046491 | Bacteria | 612 |
| 712 | Ga0495585_0125079 | 3300046492 | Bacteria | 1357 |
| 713 | Ga0495585_0295182 | 3300046492 | Bacteria | 798 |
| 714 | Ga0495596_0031995 | 3300046500 | Bacteria | 2099 |
| 715 | Ga0495596_0037542 | 3300046500 | Bacteria | 1915 |
| 716 | Ga0495607_0079379 | 3300046501 | Bacteria | 1808 |
| 717 | Ga0495607_0117166 | 3300046501 | Bacteria | 1404 |
| 718 | Ga0495607_0126593 | 3300046501 | Bacteria | 1335 |
| 719 | Ga0495606_0034184 | 3300046507 | Bacteria | 3492 |
| 720 | Ga0495606_0062400 | 3300046507 | Bacteria | 2379 |
| 721 | Ga0495606_0218832 | 3300046507 | Bacteria | 1074 |
| 722 | Ga0495606_0299848 | 3300046507 | Bacteria | 871 |
| 723 | Ga0495608_0030647 | 3300046511 | Bacteria | 3641 |
| 724 | Ga0495608_0037928 | 3300046511 | Bacteria | 3239 |
| 725 | Ga0495608_0090356 | 3300046511 | Bacteria | 1981 |
| 726 | Ga0495608_0131373 | 3300046511 | Bacteria | 1602 |
| 727 | Ga0495610_0114525 | 3300046512 | Bacteria | 1190 |
| 728 | Ga0495618_0027210 | 3300046514 | Bacteria | 3560 |
| 729 | Ga0495618_0159045 | 3300046514 | Bacteria | 1441 |
| 730 | Ga0495620_0124095 | 3300046515 | Bacteria | 1016 |
| 731 | Ga0495628_0012808 | 3300046516 | Bacteria | 7061 |
| 732 | Ga0495628_0073069 | 3300046516 | Bacteria | 2672 |
| 733 | Ga0495628_0823006 | 3300046516 | Bacteria | 648 |
| 734 | Ga0495630_0025809 | 3300046517 | Bacteria | 4346 |
| 735 | Ga0495631_0076240 | 3300046518 | Bacteria | 1447 |
| 736 | Ga0495631_0178702 | 3300046518 | Bacteria | 909 |
| 737 | Ga0495631_0278335 | 3300046518 | Bacteria | 712 |
| 738 | Ga0495632_0336178 | 3300046519 | Bacteria | 665 |
| 739 | Ga0495644_0106168 | 3300046523 | Bacteria | 1064 |
| 740 | Ga0495648_0065044 | 3300046524 | Bacteria | 2146 |
| 741 | Ga0495648_0112223 | 3300046524 | Bacteria | 1481 |
| 742 | Ga0495648_0324407 | 3300046524 | Bacteria | 712 |
| 743 | Ga0495666_0082498 | 3300046526 | Bacteria | 1520 |
| 744 | Ga0495652_0008389 | 3300046529 | Bacteria | 9433 |
| 745 | Ga0495652_0015423 | 3300046529 | Bacteria | 6843 |
| 746 | Ga0495652_0298760 | 3300046529 | Bacteria | 1171 |
| 747 | Ga0495665_0014869 | 3300046531 | Bacteria | 4192 |
| 748 | Ga0495640_0007684 | 3300046533 | Bacteria | 8479 |
| 749 | Ga0495640_0069972 | 3300046533 | Bacteria | 2359 |
| 750 | Ga0495640_0122825 | 3300046533 | Bacteria | 1686 |
| 751 | Ga0495586_0097950 | 3300046535 | Bacteria | 1625 |
| 752 | Ga0495587_0004526 | 3300046536 | Bacteria | 9134 |
| 753 | Ga0495587_0041752 | 3300046536 | Bacteria | 2736 |
| 754 | Ga0495587_0150985 | 3300046536 | Bacteria | 1324 |
| 755 | Ga0495598_0085115 | 3300046537 | Bacteria | 1021 |
| 756 | Ga0495609_0054630 | 3300046538 | Bacteria | 1773 |
| 757 | Ga0495609_0223900 | 3300046538 | Bacteria | 780 |
| 758 | Ga0495621_0013631 | 3300046539 | Bacteria | 2558 |
| 759 | Ga0495622_0032380 | 3300046557 | Bacteria | 2441 |
| 760 | Ga0495622_0073468 | 3300046557 | Bacteria | 1577 |
| 761 | Ga0495622_0088900 | 3300046557 | Bacteria | 1420 |
| 762 | Ga0495633_0032239 | 3300046558 | Bacteria | 2533 |
| 763 | Ga0495633_0228016 | 3300046558 | Bacteria | 852 |
| 764 | Ga0495667_0066349 | 3300046559 | Bacteria | 2359 |
| 765 | Ga0495656_0005186 | 3300046615 | Bacteria | 4492 |
| 766 | Ga0495656_0278278 | 3300046615 | Bacteria | 852 |
| 767 | Ga0495656_0407025 | 3300046615 | Bacteria | 712 |
| 768 | Ga0495668_0153560 | 3300046616 | Bacteria | 1261 |
| 769 | Ga0495668_0210281 | 3300046616 | Bacteria | 1065 |
| 770 | Ga0495634_0042931 | 3300046642 | Bacteria | 3066 |
| 771 | Ga0495634_0139915 | 3300046642 | Bacteria | 1537 |
| 772 | Ga0495611_0307394 | 3300046648 | Bacteria | 730 |
| 773 | Ga0495625_0181455 | 3300046660 | Bacteria | 1399 |
| 774 | Ga0495625_0222170 | 3300046660 | Bacteria | 1237 |
| 775 | Ga0495625_0253983 | 3300046660 | Bacteria | 1140 |
| 776 | Ga0495625_0346260 | 3300046660 | Bacteria | 940 |
| 777 | Ga0495625_0453145 | 3300046660 | Bacteria | 792 |
| 778 | Ga0495635_0038939 | 3300046663 | Bacteria | 3291 |
| 779 | Ga0495635_0066373 | 3300046663 | Bacteria | 2474 |
| 780 | Ga0495635_0245259 | 3300046663 | Bacteria | 1208 |
| 781 | Ga0495659_0012114 | 3300046664 | Bacteria | 2788 |
| 782 | Ga0495661_0192003 | 3300046665 | Bacteria | 1075 |
| 783 | Ga0495588_0002970 | 3300046674 | Bacteria | 7327 |
| 784 | Ga0495657_0004660 | 3300046675 | Bacteria | 10937 |
| 785 | Ga0495657_0007028 | 3300046675 | Bacteria | 8729 |
| 786 | Ga0495657_0058516 | 3300046675 | Bacteria | 2559 |
| 787 | Ga0495599_0003699 | 3300046678 | Bacteria | 8962 |
| 788 | Ga0495599_0004338 | 3300046678 | Bacteria | 8391 |
| 789 | Ga0495599_0094757 | 3300046678 | Bacteria | 1862 |
| 790 | Ga0495623_0003278 | 3300046679 | Bacteria | 10685 |
| 791 | Ga0495623_0003743 | 3300046679 | Bacteria | 10032 |
| 792 | Ga0495623_0331496 | 3300046679 | Bacteria | 833 |
| 793 | Ga0495646_0010569 | 3300046680 | Bacteria | 5864 |
| 794 | Ga0495646_0028033 | 3300046680 | Bacteria | 3529 |
| 795 | Ga0495647_0032616 | 3300046681 | Bacteria | 1942 |
| 796 | Ga0495647_0331069 | 3300046681 | Bacteria | 691 |
| 797 | Ga0495658_0007910 | 3300046683 | Bacteria | 5263 |
| 798 | Ga0495669_0011303 | 3300046684 | Bacteria | 3789 |
| 799 | Ga0495669_0142073 | 3300046684 | Bacteria | 1133 |
| 800 | Ga0495613_0373748 | 3300046689 | Bacteria | 976 |
| 801 | Ga0495624_0083074 | 3300046690 | Bacteria | 1981 |
| 802 | Ga0495624_0115589 | 3300046690 | Bacteria | 1649 |
| 803 | Ga0495649_0034578 | 3300046694 | Bacteria | 2780 |
| 804 | Ga0495649_0230755 | 3300046694 | Bacteria | 955 |
| 805 | Ga0495649_0516047 | 3300046694 | Bacteria | 593 |
| 806 | Ga0495589_0393543 | 3300046794 | Bacteria | 636 |
| 807 | Ga0495600_0008553 | 3300046809 | Bacteria | 6293 |
| 808 | Ga0495600_0032974 | 3300046809 | Bacteria | 3361 |
| 809 | Ga0495600_0207430 | 3300046809 | Bacteria | 1256 |
| 810 | Ga0495660_0281799 | 3300046810 | Bacteria | 760 |
| 811 | Ga0495581_0025228 | 3300047315 | Bacteria | 3447 |
| 812 | Ga0495581_0151802 | 3300047315 | Bacteria | 1353 |
| 813 | Ga0495604_0011018 | 3300047317 | Bacteria | 7175 |
| 814 | Ga0495604_0089032 | 3300047317 | Bacteria | 2295 |
| 815 | Ga0495674_0003624 | 3300047319 | Bacteria | 15031 |
| 816 | Ga0495674_0026977 | 3300047319 | Bacteria | 5253 |
| 817 | Ga0495674_0314800 | 3300047319 | Bacteria | 1276 |
| 818 | Ga0495674_0373135 | 3300047319 | Bacteria | 1155 |
| 819 | Ga0495672_0031547 | 3300047320 | Bacteria | 3307 |
| 820 | Ga0495672_0077853 | 3300047320 | Bacteria | 1857 |
| 821 | Ga0495676_0073366 | 3300047321 | Bacteria | 2624 |
| 822 | Ga0495676_0219164 | 3300047321 | Bacteria | 1312 |
| 823 | Ga0495676_0556659 | 3300047321 | Bacteria | 749 |
| 824 | Ga0495680_0021316 | 3300047322 | Bacteria | 5426 |
| 825 | Ga0495680_0063648 | 3300047322 | Bacteria | 2832 |
| 826 | Ga0495680_0390104 | 3300047322 | Bacteria | 963 |
| 827 | Ga0495683_0266808 | 3300047323 | Bacteria | 746 |
| 828 | Ga0495675_0054298 | 3300047444 | Bacteria | 2542 |
| 829 | Ga0495675_0167543 | 3300047444 | Bacteria | 1350 |
| 830 | Ga0495677_0016237 | 3300047445 | Bacteria | 2701 |
| 831 | Ga0495673_0027590 | 3300047469 | Bacteria | 2700 |
| 832 | Ga0495673_0116220 | 3300047469 | Bacteria | 1064 |
| 833 | Ga0495673_0162606 | 3300047469 | Bacteria | 856 |
| 834 | Ga0495673_0194194 | 3300047469 | Bacteria | 762 |
| 835 | Ga0495684_0144787 | 3300047471 | Bacteria | 1780 |
| 836 | Ga0495686_0022800 | 3300047472 | Bacteria | 4137 |
| 837 | Ga0495686_0092187 | 3300047472 | Bacteria | 1838 |
| 838 | Ga0495686_0137307 | 3300047472 | Bacteria | 1445 |
| 839 | Ga0495686_0205080 | 3300047472 | Bacteria | 1129 |
| 840 | Ga0495593_0080074 | 3300047673 | Bacteria | 1690 |
| 841 | Ga0495593_0153827 | 3300047673 | Bacteria | 1163 |
| 842 | Ga0495602_0009817 | 3300048088 | Bacteria | 9933 |
| 843 | Ga0495602_0030956 | 3300048088 | Bacteria | 5065 |
| 844 | Ga0495615_0072732 | 3300048090 | Bacteria | 929 |
| 845 | Ga0496100_0025148 | 3300048903 | Bacteria | 3639 |
| 846 | Ga0496100_0073207 | 3300048903 | Bacteria | 2292 |
| 847 | Ga0496100_0133391 | 3300048903 | Bacteria | 1752 |
| 848 | Ga0496100_0156872 | 3300048903 | Bacteria | 1628 |
| 849 | Ga0496100_0425267 | 3300048903 | Bacteria | 1015 |
| 850 | Ga0496100_0522323 | 3300048903 | Bacteria | 916 |
| 851 | Ga0496101_0066084 | 3300048904 | Bacteria | 2637 |
| 852 | Ga0496101_0125304 | 3300048904 | Bacteria | 1946 |
| 853 | Ga0496101_0129051 | 3300048904 | Bacteria | 1918 |
| 854 | Ga0496101_0141529 | 3300048904 | Bacteria | 1834 |
| 855 | Ga0496101_0309829 | 3300048904 | Bacteria | 1237 |
| 856 | Ga0496101_0637172 | 3300048904 | Bacteria | 842 |
| 857 | Ga0496102_0011346 | 3300048905 | Bacteria | 7677 |
| 858 | Ga0496102_0014546 | 3300048905 | Bacteria | 6838 |
| 859 | Ga0496102_0129342 | 3300048905 | Bacteria | 2362 |
| 860 | Ga0496102_0160421 | 3300048905 | Bacteria | 2115 |
| 861 | Ga0496102_0229966 | 3300048905 | Bacteria | 1748 |
| 862 | Ga0496102_0908406 | 3300048905 | Bacteria | 802 |
| 863 | Ga0496103_0047445 | 3300048906 | Bacteria | 2654 |
| 864 | Ga0496103_0239888 | 3300048906 | Bacteria | 1166 |
| 865 | Ga0496104_0008837 | 3300048907 | Bacteria | 8957 |
| 866 | Ga0496104_0016671 | 3300048907 | Bacteria | 6677 |
| 867 | Ga0496104_0053104 | 3300048907 | Bacteria | 3828 |
| 868 | Ga0496104_0400116 | 3300048907 | Bacteria | 1285 |
| 869 | Ga0496105_0004610 | 3300048908 | Bacteria | 10383 |
| 870 | Ga0496105_0010647 | 3300048908 | Bacteria | 7236 |
| 871 | Ga0496105_0157233 | 3300048908 | Bacteria | 1867 |
| 872 | Ga0496105_0417425 | 3300048908 | Bacteria | 1063 |
| 873 | Ga0496106_0000686 | 3300048909 | Bacteria | 24281 |
| 874 | Ga0496106_0018004 | 3300048909 | Bacteria | 5224 |
| 875 | Ga0496106_0045929 | 3300048909 | Bacteria | 3282 |
| 876 | Ga0496106_0264207 | 3300048909 | Bacteria | 1377 |
| 877 | Ga0496106_0952757 | 3300048909 | Bacteria | 676 |
| 878 | Ga0496107_0002437 | 3300048910 | Bacteria | 12048 |
| 879 | Ga0496107_0050506 | 3300048910 | Bacteria | 2998 |
| 880 | Ga0496107_0221256 | 3300048910 | Bacteria | 1408 |
| 881 | Ga0496107_0258987 | 3300048910 | Bacteria | 1294 |
| 882 | Ga0496108_0025485 | 3300048911 | Bacteria | 4873 |
| 883 | Ga0496108_0044102 | 3300048911 | Bacteria | 3724 |
| 884 | Ga0496108_0410083 | 3300048911 | Bacteria | 1183 |
| 885 | Ga0496108_0749129 | 3300048911 | Bacteria | 845 |
| 886 | Ga0496108_0852258 | 3300048911 | Bacteria | 784 |
| 887 | Ga0496109_0003924 | 3300048912 | Bacteria | 12429 |
| 888 | Ga0496109_0045827 | 3300048912 | Bacteria | 3970 |
| 889 | Ga0496109_0165052 | 3300048912 | Bacteria | 2076 |
| 890 | Ga0496109_0233844 | 3300048912 | Bacteria | 1729 |
| 891 | Ga0496110_0089556 | 3300048913 | Bacteria | 2750 |
| 892 | Ga0496110_0209409 | 3300048913 | Bacteria | 1772 |
| 893 | Ga0496111_0035774 | 3300048914 | Bacteria | 3550 |
| 894 | Ga0496111_0097953 | 3300048914 | Bacteria | 2153 |
| 895 | Ga0496111_0288787 | 3300048914 | Bacteria | 1216 |
| 896 | Ga0496111_0340517 | 3300048914 | Bacteria | 1110 |
| 897 | Ga0496111_0608327 | 3300048914 | Bacteria | 800 |
| 898 | Ga0496112_0006770 | 3300048915 | Bacteria | 10100 |
| 899 | Ga0496112_0051032 | 3300048915 | Bacteria | 4057 |
| 900 | Ga0496112_0148125 | 3300048915 | Bacteria | 2315 |
| 901 | Ga0496113_0044120 | 3300048916 | Bacteria | 3302 |
| 902 | Ga0496113_0093280 | 3300048916 | Bacteria | 2323 |
| 903 | Ga0496113_0260109 | 3300048916 | Bacteria | 1386 |
| 904 | Ga0496114_0008237 | 3300048917 | Bacteria | 8262 |
| 905 | Ga0496114_0058373 | 3300048917 | Bacteria | 3222 |
| 906 | Ga0496114_0061251 | 3300048917 | Bacteria | 3147 |
| 907 | Ga0496114_0453507 | 3300048917 | Bacteria | 1135 |
| 908 | Ga0496115_0004137 | 3300048918 | Bacteria | 10474 |
| 909 | Ga0496115_0038906 | 3300048918 | Bacteria | 3777 |
| 910 | Ga0496115_0070621 | 3300048918 | Bacteria | 2831 |
| 911 | Ga0496115_0073684 | 3300048918 | Bacteria | 2772 |
| 912 | Ga0496115_0457806 | 3300048918 | Bacteria | 1030 |
| 913 | Ga0496115_0562589 | 3300048918 | Bacteria | 910 |
| 914 | Ga0496115_0909291 | 3300048918 | Bacteria | 678 |
| 915 | Ga0496116_0051720 | 3300048919 | Bacteria | 2727 |
| 916 | Ga0496116_0146804 | 3300048919 | Bacteria | 1317 |
| 917 | Ga0496116_0349303 | 3300048919 | Bacteria | 678 |
| 918 | Ga0496117_0099835 | 3300048920 | Bacteria | 1840 |
| 919 | Ga0496117_0212196 | 3300048920 | Bacteria | 1084 |
| 920 | Ga0496118_0002254 | 3300048921 | Bacteria | 26418 |
| 921 | Ga0496118_0066683 | 3300048921 | Bacteria | 2626 |
| 922 | Ga0496118_0207120 | 3300048921 | Bacteria | 1155 |
| 923 | Ga0496119_0028316 | 3300048922 | Bacteria | 3825 |
| 924 | Ga0496119_0060196 | 3300048922 | Bacteria | 2275 |
| 925 | Ga0496119_0146391 | 3300048922 | Bacteria | 1270 |
| 926 | Ga0496120_0025120 | 3300048923 | Bacteria | 3702 |
| 927 | Ga0496120_0026454 | 3300048923 | Bacteria | 3582 |
| 928 | Ga0496120_0252140 | 3300048923 | Bacteria | 828 |
| 929 | Ga0496121_0000418 | 3300048924 | Bacteria | 84182 |
| 930 | Ga0496121_0002936 | 3300048924 | Bacteria | 24924 |
| 931 | Ga0496121_0069154 | 3300048924 | Bacteria | 2851 |
| 932 | Ga0496121_0089141 | 3300048924 | Bacteria | 2416 |
| 933 | Ga0496121_0094832 | 3300048924 | Bacteria | 2320 |
| 934 | Ga0496121_0105044 | 3300048924 | Bacteria | 2168 |
| 935 | Ga0496121_0165237 | 3300048924 | Bacteria | 1614 |
| 936 | Ga0496121_0187326 | 3300048924 | Bacteria | 1487 |
| 937 | Ga0496121_0471870 | 3300048924 | Bacteria | 803 |
| 938 | Ga0496121_0490409 | 3300048924 | Bacteria | 782 |
| 939 | Ga0496122_0060272 | 3300048925 | Bacteria | 2796 |
| 940 | Ga0496124_0013566 | 3300048927 | Bacteria | 7945 |
| 941 | Ga0496124_0352026 | 3300048927 | Bacteria | 1041 |
| 942 | Ga0496124_0447110 | 3300048927 | Bacteria | 882 |
| 943 | Ga0496124_0673290 | 3300048927 | Bacteria | 660 |
| 944 | Ga0496125_0079515 | 3300048928 | Bacteria | 2515 |
| 945 | Ga0496125_0326424 | 3300048928 | Bacteria | 928 |
| 946 | Ga0496125_0556472 | 3300048928 | Bacteria | 634 |
| 947 | Ga0496126_0014146 | 3300048929 | Bacteria | 8076 |
| 948 | Ga0496126_0047134 | 3300048929 | Bacteria | 3946 |
| 949 | Ga0496126_0059646 | 3300048929 | Bacteria | 3435 |
| 950 | Ga0496126_0067084 | 3300048929 | Bacteria | 3206 |
| 951 | Ga0496126_0085351 | 3300048929 | Bacteria | 2783 |
| 952 | Ga0496126_0085769 | 3300048929 | Bacteria | 2775 |
| 953 | Ga0496126_0112964 | 3300048929 | Bacteria | 2365 |
| 954 | Ga0496126_0223051 | 3300048929 | Bacteria | 1582 |
| 955 | Ga0496126_0292524 | 3300048929 | Bacteria | 1346 |
| 956 | Ga0496126_0564181 | 3300048929 | Bacteria | 901 |
| 957 | Ga0496126_0621626 | 3300048929 | Bacteria | 849 |
| 958 | Ga0496126_0624353 | 3300048929 | Bacteria | 846 |
| 959 | Ga0495678_048931 | 3300049459 | Bacteria | 1646 |
| 960 | Ga0495682_0025714 | 3300049460 | Bacteria | 2190 |
| 961 | Ga0495682_0183012 | 3300049460 | Bacteria | 744 |
| 962 | Ga0501032_0147452 | 3300049569 | Bacteria | 1548 |
| 963 | Ga0501033_0046533 | 3300049570 | Bacteria | 3225 |
| 964 | Ga0501033_0528186 | 3300049570 | Bacteria | 814 |
| 965 | Ga0501036_0280472 | 3300049572 | Bacteria | 1394 |
| 966 | Ga0501038_0492247 | 3300049574 | Bacteria | 938 |
| 967 | Ga0501038_0833650 | 3300049574 | Bacteria | 684 |
| 968 | Ga0501042_0204330 | 3300049578 | Bacteria | 1425 |
| 969 | Ga0501043_0217688 | 3300049579 | Bacteria | 1478 |
| 970 | Ga0501046_0098652 | 3300049580 | Bacteria | 2243 |
| 971 | Ga0501046_0224021 | 3300049580 | Bacteria | 1391 |
| 972 | Ga0501046_0339157 | 3300049580 | Bacteria | 1093 |
| 973 | Ga0501047_0016108 | 3300049581 | Bacteria | 7130 |
| 974 | Ga0501047_0245365 | 3300049581 | Bacteria | 1640 |
| 975 | Ga0501047_0800163 | 3300049581 | Bacteria | 757 |
| 976 | Ga0501067_0376761 | 3300049583 | Bacteria | 791 |
| 977 | Ga0501068_0377371 | 3300049584 | Bacteria | 913 |
| 978 | Ga0501070_0023474 | 3300049586 | Bacteria | 5166 |
| 979 | Ga0501073_0385148 | 3300049589 | Bacteria | 969 |
| 980 | Ga0501074_0009318 | 3300049590 | Bacteria | 7132 |
| 981 | Ga0501079_0587908 | 3300049741 | Bacteria | 876 |
| 982 | Ga0501080_0078718 | 3300049742 | Bacteria | 3065 |
| 983 | Ga0501080_0269278 | 3300049742 | Bacteria | 1551 |
| 984 | Ga0501044_0021890 | 3300049823 | Bacteria | 6817 |
| 985 | Ga0501045_0277812 | 3300049824 | Bacteria | 1247 |
| 986 | nmdc:mga03n38_292223_c1 | 3300050490 | Bacteria | 873 |
| 987 | nmdc:mga03n38_50730_c1 | 3300050490 | Bacteria | 1851 |
| 988 | nmdc:mga00v17_60702_c1 | 3300050491 | Bacteria | 2323 |
| 989 | nmdc:mga0yw44_127605_c1 | 3300050492 | Bacteria | 1644 |
| 990 | nmdc:mga0yw44_202907_c1 | 3300050492 | Bacteria | 1310 |
| 991 | nmdc:mga0yw44_58600_c1 | 3300050492 | Bacteria | 2353 |
| 992 | nmdc:mga0yw44_658171_c1 | 3300050492 | Bacteria | 712 |
| 993 | nmdc:mga0yw44_91492_c1 | 3300050492 | Bacteria | 1923 |
| 994 | nmdc:mga0yw44_99297_c1 | 3300050492 | Bacteria | 1852 |
| 995 | nmdc:mga0k408_141336_c1 | 3300050493 | Bacteria | 1432 |
| 996 | nmdc:mga0k408_31373_c1 | 3300050493 | Bacteria | 3034 |
| 997 | nmdc:mga0k408_423327_c1 | 3300050493 | Bacteria | 792 |
| 998 | nmdc:mga0k408_447766_c1 | 3300050493 | Bacteria | 767 |
| 999 | nmdc:mga06z11_118819_c1 | 3300050494 | Bacteria | 1473 |
| 1000 | nmdc:mga06z11_535315_c1 | 3300050494 | Bacteria | 711 |
| 1001 | nmdc:mga06z11_70679_c1 | 3300050494 | Bacteria | 1846 |
| 1002 | nmdc:mga06z11_71378_c1 | 3300050494 | Bacteria | 1838 |
| 1003 | nmdc:mga07m45_15195_c1 | 3300050496 | Bacteria | 4110 |
| 1004 | nmdc:mga07m45_54820_c1 | 3300050496 | Bacteria | 2253 |
| 1005 | nmdc:mga05p37_625615_c1 | 3300050507 | Bacteria | 1210 |
| 1006 | nmdc:mga08y16_608506_c1 | 3300050511 | Bacteria | 1101 |
| 1007 | nmdc:mga0n895_92585_c1 | 3300050512 | Bacteria | 3026 |
| 1008 | nmdc:mga0rr50_190052_c1 | 3300050513 | Bacteria | 1682 |
| 1009 | nmdc:mga08x19_226641_c1 | 3300050514 | Bacteria | 1285 |
| 1010 | nmdc:mga0sz30_12995_c1 | 3300050516 | Bacteria | 3251 |
| 1011 | Ga0495601_0006668 | 3300053077 | Bacteria | 6757 |
| 1012 | Ga0495601_0049547 | 3300053077 | Bacteria | 2648 |
| 1013 | Ga0495601_0458751 | 3300053077 | Bacteria | 824 |
| 1014 | Ga0495601_0636049 | 3300053077 | Bacteria | 683 |
| 1015 | Ga0495612_0017107 | 3300053078 | Bacteria | 2904 |
| 1016 | Ga0495612_0020652 | 3300053078 | Bacteria | 2640 |
| 1017 | Ga0495612_0047459 | 3300053078 | Bacteria | 1760 |
| 1018 | Ga0495612_0057198 | 3300053078 | Bacteria | 1610 |
| 1019 | Ga0500635_0008731 | 3300053080 | Bacteria | 2789 |
| 1020 | Ga0500635_0027860 | 3300053080 | Bacteria | 1799 |
| 1021 | Ga0495655_0032705 | 3300053083 | Bacteria | 1275 |
| 1022 | Ga0495595_0003659 | 3300053084 | Bacteria | 6105 |
| 1023 | Ga0495619_0127330 | 3300053085 | Bacteria | 1748 |
| 1024 | Ga0500578_0225374 | 3300053086 | Bacteria | 1138 |
| 1025 | Ga0500578_0374342 | 3300053086 | Bacteria | 827 |
| 1026 | Ga0500578_0427379 | 3300053086 | Bacteria | 758 |
| 1027 | Ga0500643_000013 | 3300053087 | Bacteria | 324296 |
| 1028 | Ga0500643_031899 | 3300053087 | Bacteria | 1603 |
| 1029 | Ga0500647_0025467 | 3300053091 | Bacteria | 2788 |
| 1030 | Ga0500583_0021956 | 3300053092 | Bacteria | 2666 |
| 1031 | Ga0500566_0001097 | 3300053094 | Bacteria | 15678 |
| 1032 | Ga0500566_0165914 | 3300053094 | Bacteria | 1146 |
| 1033 | Ga0500566_0201950 | 3300053094 | Bacteria | 1003 |
| 1034 | Ga0500566_0253961 | 3300053094 | Bacteria | 853 |
| 1035 | Ga0500640_011592 | 3300053095 | Bacteria | 3596 |
| 1036 | Ga0500641_0024104 | 3300053096 | Bacteria | 2344 |
| 1037 | Ga0500641_0063860 | 3300053096 | Bacteria | 1537 |
| 1038 | Ga0500554_051934 | 3300053102 | Bacteria | 1293 |
| 1039 | Ga0500555_002043 | 3300053103 | Bacteria | 5947 |
| 1040 | Ga0500557_000030 | 3300053105 | Bacteria | 76944 |
| 1041 | Ga0500562_081766 | 3300053108 | Bacteria | 874 |
| 1042 | Ga0500569_000335 | 3300053109 | Bacteria | 7533 |
| 1043 | Ga0500569_034409 | 3300053109 | Bacteria | 1446 |
| 1044 | Ga0500572_000564 | 3300053111 | Bacteria | 12638 |
| 1045 | Ga0500591_101917 | 3300053115 | Bacteria | 1225 |
| 1046 | Ga0500594_0053729 | 3300053118 | Bacteria | 1142 |
| 1047 | Ga0500595_004179 | 3300053119 | Bacteria | 6538 |
| 1048 | Ga0500595_020224 | 3300053119 | Bacteria | 2400 |
| 1049 | Ga0500595_086750 | 3300053119 | Bacteria | 910 |
| 1050 | Ga0500608_043507 | 3300053122 | Bacteria | 2156 |
| 1051 | Ga0500614_001304 | 3300053123 | Bacteria | 6021 |
| 1052 | Ga0500626_077751 | 3300053128 | Bacteria | 1470 |
| 1053 | Ga0500642_0001580 | 3300053130 | Bacteria | 6569 |
| 1054 | Ga0500642_0102946 | 3300053130 | Bacteria | 1329 |
| 1055 | Ga0500642_0172867 | 3300053130 | Bacteria | 1011 |
| 1056 | Ga0500655_021885 | 3300053133 | Bacteria | 1201 |
| 1057 | Ga0500655_081654 | 3300053133 | Bacteria | 666 |
| 1058 | Ga0500658_0368940 | 3300053134 | Bacteria | 658 |
| 1059 | Ga0500559_0002228 | 3300053136 | Bacteria | 10247 |
| 1060 | Ga0500559_0006528 | 3300053136 | Bacteria | 5265 |
| 1061 | Ga0500577_0057543 | 3300053142 | Bacteria | 1484 |
| 1062 | Ga0500577_0088701 | 3300053142 | Bacteria | 1246 |
| 1063 | Ga0500588_0169645 | 3300053146 | Bacteria | 798 |
| 1064 | Ga0500590_042681 | 3300053148 | Bacteria | 2328 |
| 1065 | Ga0500590_058776 | 3300053148 | Bacteria | 1936 |
| 1066 | Ga0500603_001009 | 3300053150 | Bacteria | 6625 |
| 1067 | Ga0500603_155260 | 3300053150 | Bacteria | 711 |
| 1068 | Ga0500604_0055264 | 3300053151 | Bacteria | 1234 |
| 1069 | Ga0500616_0050783 | 3300053153 | Bacteria | 2188 |
| 1070 | Ga0500622_0006329 | 3300053156 | Bacteria | 6904 |
| 1071 | Ga0500622_0180231 | 3300053156 | Bacteria | 977 |
| 1072 | Ga0500624_016763 | 3300053157 | Bacteria | 1135 |
| 1073 | Ga0500627_0216478 | 3300053158 | Bacteria | 856 |
| 1074 | Ga0500627_0361846 | 3300053158 | Bacteria | 624 |
| 1075 | Ga0500630_034670 | 3300053159 | Bacteria | 2474 |
| 1076 | Ga0500634_0146500 | 3300053161 | Bacteria | 1110 |
| 1077 | Ga0500638_081586 | 3300053162 | Bacteria | 1535 |
| 1078 | Ga0500638_316079 | 3300053162 | Bacteria | 595 |
| 1079 | Ga0500639_000006 | 3300053163 | Bacteria | 165068 |
| 1080 | Ga0500639_203396 | 3300053163 | Bacteria | 848 |
| 1081 | Ga0500636_0002456 | 3300053177 | Bacteria | 10275 |
| 1082 | Ga0500636_0033974 | 3300053177 | Bacteria | 3018 |
| 1083 | Ga0500636_0183865 | 3300053177 | Bacteria | 1120 |
| 1084 | Ga0500637_0055570 | 3300053178 | Bacteria | 2261 |
| 1085 | Ga0500637_0083616 | 3300053178 | Bacteria | 1845 |
| 1086 | Ga0500611_015747 | 3300053727 | Bacteria | 1345 |
| 1087 | Ga0500645_048655 | 3300053730 | Bacteria | 1241 |
| 1088 | Ga0500645_160437 | 3300053730 | Bacteria | 617 |
| 1089 | Ga0500609_019840 | 3300053731 | Bacteria | 916 |
| 1090 | Ga0500552_022651 | 3300053733 | Bacteria | 909 |
| 1091 | Ga0500596_002150 | 3300053735 | Bacteria | 3909 |
| 1092 | Ga0500596_009653 | 3300053735 | Bacteria | 1501 |
| 1093 | Ga0500601_000881 | 3300053737 | Bacteria | 3603 |
| 1094 | Ga0500661_011876 | 3300055283 | Bacteria | 1575 |
| 1095 | Ga0501082_0742092 | 3300060353 | Bacteria | 859 |
| 1096 | Ga0466962_0035331 | 3300061719 | Bacteria | 2393 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025315 | Ga0207697_10125145 | Ga0207697_101251452 | 160 |
| 2 | 3300006941 | Ga0099825_1039163 | Ga0099825_10391632 | 162 |
| 3 | 3300006942 | Ga0099824_1010512 | Ga0099824_10105123 | 162 |
| 4 | 3300006943 | Ga0099822_1001984 | Ga0099822_10019846 | 162 |
| 5 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005486 | 162 |
| 6 | 3300027361 | Ga0209489_100005 | Ga0209489_100005486 | 162 |
| 7 | 3300027363 | Ga0209700_100006 | Ga0209700_100006486 | 162 |
| 8 | 3300006048 | Ga0075363_100353894 | Ga0075363_1003538942 | 166 |
| 9 | 3300010375 | Ga0105239_11131298 | Ga0105239_111312982 | 166 |
| 10 | 3300025261 | Ga0209233_1016731 | Ga0209233_10167314 | 166 |
| 11 | 3300048924 | Ga0496121_0490409 | Ga0496121_0490409_150_698 | 166 |
| 12 | 3300050490 | nmdc:mga03n38_292223_c1 | nmdc:mga03n38_292223_c1_49_609 | 166 |
| 13 | 3300053077 | Ga0495601_0049547 | Ga0495601_0049547_755_1303 | 166 |
| 14 | 3300035695 | Ga0373927_0226772 | Ga0373927_0226772_456_959 | 167 |
| 15 | 3300045976 | Ga0466967_0757066 | Ga0466967_0757066_44_592 | 167 |
| 16 | 3300048929 | Ga0496126_0047134 | Ga0496126_0047134_2504_3007 | 167 |
| 17 | 3300028381 | Ga0268264_10240998 | Ga0268264_102409982 | 168 |
| 18 | 3300046477 | Ga0495664_0156330 | Ga0495664_0156330_98_646 | 169 |
| 19 | 3300046535 | Ga0495586_0097950 | Ga0495586_0097950_1054_1563 | 169 |
| 20 | 3300046678 | Ga0495599_0094757 | Ga0495599_0094757_560_1108 | 169 |
| 21 | 3300049580 | Ga0501046_0339157 | Ga0501046_0339157_154_702 | 169 |
| 22 | 3300049581 | Ga0501047_0016108 | Ga0501047_0016108_135_683 | 169 |
| 23 | 3300049586 | Ga0501070_0023474 | Ga0501070_0023474_1654_2202 | 169 |
| 24 | 3300049590 | Ga0501074_0009318 | Ga0501074_0009318_637_1185 | 169 |
| 25 | 3300049742 | Ga0501080_0078718 | Ga0501080_0078718_394_942 | 169 |
| 26 | 3300049823 | Ga0501044_0021890 | Ga0501044_0021890_3786_4334 | 169 |
| 27 | 3300053078 | Ga0495612_0047459 | Ga0495612_0047459_858_1406 | 169 |
| 28 | 3300046477 | Ga0495664_0077643 | Ga0495664_0077643_513_1061 | 170 |
| 29 | 3300005436 | Ga0070713_100075767 | Ga0070713_1000757672 | 172 |
| 30 | 3300005467 | Ga0070706_100155389 | Ga0070706_1001553892 | 172 |
| 31 | 3300005471 | Ga0070698_100167764 | Ga0070698_1001677644 | 172 |
| 32 | 3300005614 | Ga0068856_100731315 | Ga0068856_1007313152 | 172 |
| 33 | 3300009101 | Ga0105247_10107421 | Ga0105247_101074213 | 172 |
| 34 | 3300011119 | Ga0105246_10094671 | Ga0105246_100946712 | 172 |
| 35 | 3300014968 | Ga0157379_10079606 | Ga0157379_100796064 | 172 |
| 36 | 3300021377 | Ga0213874_10040348 | Ga0213874_100403482 | 172 |
| 37 | 3300025910 | Ga0207684_10140603 | Ga0207684_101406032 | 172 |
| 38 | 3300025922 | Ga0207646_10142063 | Ga0207646_101420632 | 172 |
| 39 | 3300039437 | Ga0436365_0717605 | Ga0436365_0717605_5049_5597 | 172 |
| 40 | 3300039450 | Ga0436363_0392343 | Ga0436363_0392343_1205_1753 | 172 |
| 41 | iso_pu_bacteria | 8016583857 | 8016587881 | 176 |
| 42 | 3300033442 | Ga0315911_1000012 | Ga0315911_100001272 | 177 |
| 43 | iso_pu_bacteria | 2888419890 | 2888426705 | 177 |
| 44 | iso_pu_bacteria | 2507262055 | 2507511968 | 178 |
| 45 | iso_pu_bacteria | 2508501128 | 2509148092 | 178 |
| 46 | iso_pu_bacteria | 2511231028 | 2511398041 | 178 |
| 47 | iso_pu_bacteria | 2513237094 | 2513643220 | 178 |
| 48 | iso_pu_bacteria | 2513237095 | 2513651011 | 178 |
| 49 | iso_pu_bacteria | 2513237096 | 2513655623 | 178 |
| 50 | iso_pu_bacteria | 2513237098 | 2513673579 | 178 |
| 51 | iso_pu_bacteria | 2513237101 | 2513697841 | 178 |
| 52 | iso_pu_bacteria | 2513237102 | 2513699442 | 178 |
| 53 | iso_pu_bacteria | 2513237137 | 2513859692 | 178 |
| 54 | iso_pu_bacteria | 2513237141 | 2513887831 | 178 |
| 55 | iso_pu_bacteria | 2513237145 | 2513916299 | 178 |
| 56 | iso_pu_bacteria | 2513237161 | 2514017240 | 178 |
| 57 | iso_pu_bacteria | 2515154112 | 2515624626 | 178 |
| 58 | iso_pu_bacteria | 2517093001 | 2517104444 | 178 |
| 59 | iso_pu_bacteria | 2517572143 | 2517890087 | 178 |
| 60 | iso_pu_bacteria | 2524023205 | 2524438413 | 178 |
| 61 | iso_pu_bacteria | 2524023210 | 2524466383 | 178 |
| 62 | iso_pu_bacteria | 2524023228 | 2524538198 | 178 |
| 63 | iso_pu_bacteria | 2528768022 | 2528856756 | 178 |
| 64 | iso_pu_bacteria | 2617270735 | 2617349719 | 178 |
| 65 | iso_pu_bacteria | 2667528175 | 2671124324 | 178 |
| 66 | iso_pu_bacteria | 2721755755 | 2723846018 | 178 |
| 67 | iso_pu_bacteria | 2728368998 | 2728748999 | 178 |
| 68 | iso_pu_bacteria | 2744054633 | 2745078435 | 178 |
| 69 | iso_pu_bacteria | 2791355196 | 2793059545 | 178 |
| 70 | iso_pu_bacteria | 2791355197 | 2793067935 | 178 |
| 71 | iso_pu_bacteria | 2791355199 | 2793080409 | 178 |
| 72 | iso_pu_bacteria | 2816332527 | 2818242273 | 178 |
| 73 | iso_pu_bacteria | 2824600985 | 2824608508 | 178 |
| 74 | iso_pu_bacteria | 2824609381 | 2824617497 | 178 |
| 75 | iso_pu_bacteria | 2824617872 | 2824625770 | 178 |
| 76 | iso_pu_bacteria | 2824626560 | 2824633309 | 178 |
| 77 | iso_pu_bacteria | 2824635225 | 2824642223 | 178 |
| 78 | iso_pu_bacteria | 2824644064 | 2824649571 | 178 |
| 79 | iso_pu_bacteria | 2824653114 | 2824660487 | 178 |
| 80 | iso_pu_bacteria | 2824661429 | 2824671028 | 178 |
| 81 | iso_pu_bacteria | 2824671348 | 2824674314 | 178 |
| 82 | iso_pu_bacteria | 2824687955 | 2824690830 | 178 |
| 83 | iso_pu_bacteria | 2824696289 | 2824700260 | 178 |
| 84 | iso_pu_bacteria | 2824704595 | 2824713290 | 178 |
| 85 | iso_pu_bacteria | 2824714736 | 2824722148 | 178 |
| 86 | iso_pu_bacteria | 2824723954 | 2824731940 | 178 |
| 87 | iso_pu_bacteria | 2824753945 | 2824763267 | 178 |
| 88 | iso_pu_bacteria | 2824763712 | 2824771009 | 178 |
| 89 | iso_pu_bacteria | 2824773399 | 2824776906 | 178 |
| 90 | iso_pu_bacteria | 2838122688 | 2838128475 | 178 |
| 91 | iso_pu_bacteria | 2841941048 | 2841942335 | 178 |
| 92 | iso_pu_bacteria | 2841949485 | 2841955535 | 178 |
| 93 | iso_pu_bacteria | 2841957949 | 2841960871 | 178 |
| 94 | iso_pu_bacteria | 2841966195 | 2841971144 | 178 |
| 95 | iso_pu_bacteria | 2841974524 | 2841982262 | 178 |
| 96 | iso_pu_bacteria | 2841983080 | 2841984349 | 178 |
| 97 | iso_pu_bacteria | 2847930680 | 2847932222 | 178 |
| 98 | iso_pu_bacteria | 2847939898 | 2847943456 | 178 |
| 99 | iso_pu_bacteria | 2849076700 | 2849077175 | 178 |
| 100 | iso_pu_bacteria | 2857509624 | 2857515250 | 178 |
| 101 | iso_pu_bacteria | 2874590934 | 2874592147 | 178 |
| 102 | iso_pu_bacteria | 2874612657 | 2874617864 | 178 |
| 103 | iso_pu_bacteria | 2874620515 | 2874624095 | 178 |
| 104 | iso_pu_bacteria | 2874628541 | 2874630890 | 178 |
| 105 | iso_pu_bacteria | 2874645413 | 2874646981 | 178 |
| 106 | iso_pu_bacteria | 2876761206 | 2876767514 | 178 |
| 107 | iso_pu_bacteria | 2876771140 | 2876772358 | 178 |
| 108 | iso_pu_bacteria | 2876808645 | 2876814468 | 178 |
| 109 | iso_pu_bacteria | 2876818435 | 2876819627 | 178 |
| 110 | iso_pu_bacteria | 2879074833 | 2879076202 | 178 |
| 111 | iso_pu_bacteria | 2879083081 | 2879089371 | 178 |
| 112 | iso_pu_bacteria | 2879099564 | 2879106374 | 178 |
| 113 | iso_pu_bacteria | 2879110137 | 2879112058 | 178 |
| 114 | iso_pu_bacteria | 2879127579 | 2879132618 | 178 |
| 115 | iso_pu_bacteria | 2879142872 | 2879144672 | 178 |
| 116 | iso_pu_bacteria | 2881364244 | 2881371050 | 178 |
| 117 | iso_pu_bacteria | 2881665667 | 2881669174 | 178 |
| 118 | iso_pu_bacteria | 2885374607 | 2885381754 | 178 |
| 119 | iso_pu_bacteria | 2885383462 | 2885392498 | 178 |
| 120 | iso_pu_bacteria | 2885409591 | 2885412453 | 178 |
| 121 | iso_pu_bacteria | 2888378607 | 2888387472 | 178 |
| 122 | iso_pu_bacteria | 2888388044 | 2888391717 | 178 |
| 123 | iso_pu_bacteria | 2903748898 | 2903752141 | 178 |
| 124 | iso_pu_bacteria | 2903768456 | 2903777173 | 178 |
| 125 | iso_pu_bacteria | 2904666416 | 2904670806 | 178 |
| 126 | iso_pu_bacteria | 2904690495 | 2904697567 | 178 |
| 127 | iso_pu_bacteria | 2904699407 | 2904706771 | 178 |
| 128 | iso_pu_bacteria | 2904711408 | 2904713768 | 178 |
| 129 | iso_pu_bacteria | 2906610324 | 2906612147 | 178 |
| 130 | iso_pu_bacteria | 2906626472 | 2906630096 | 178 |
| 131 | iso_pu_bacteria | 2906635258 | 2906642557 | 178 |
| 132 | iso_pu_bacteria | 2906643746 | 2906651784 | 178 |
| 133 | iso_pu_bacteria | 2906660503 | 2906661615 | 178 |
| 134 | iso_pu_bacteria | 2908739725 | 2908740313 | 178 |
| 135 | iso_pu_bacteria | 2908756301 | 2908757952 | 178 |
| 136 | iso_pu_bacteria | 2922368715 | 2922370455 | 178 |
| 137 | iso_pu_bacteria | 2922425934 | 2922427150 | 178 |
| 138 | iso_pu_bacteria | 2929615660 | 2929620038 | 178 |
| 139 | iso_pu_bacteria | 2929624759 | 2929629351 | 178 |
| 140 | iso_pu_bacteria | 2932784394 | 2932789519 | 178 |
| 141 | iso_pu_bacteria | 2932809354 | 2932814974 | 178 |
| 142 | iso_pu_bacteria | 2932818245 | 2932824169 | 178 |
| 143 | iso_pu_bacteria | 2932828146 | 2932834103 | 178 |
| 144 | iso_pu_bacteria | 2933577622 | 2933581956 | 178 |
| 145 | iso_pu_bacteria | 2935608549 | 2935613393 | 178 |
| 146 | iso_pu_bacteria | 2935616580 | 2935623507 | 178 |
| 147 | iso_pu_bacteria | 2935630451 | 2935633299 | 178 |
| 148 | iso_pu_bacteria | 2935638405 | 2935644875 | 178 |
| 149 | iso_pu_bacteria | 2935665750 | 2935671943 | 178 |
| 150 | iso_pu_bacteria | 2935675223 | 2935683129 | 178 |
| 151 | iso_pu_bacteria | 2935684952 | 2935689297 | 178 |
| 152 | iso_pu_bacteria | 2935694250 | 2935697443 | 178 |
| 153 | iso_pu_bacteria | 2935703347 | 2935711018 | 178 |
| 154 | iso_pu_bacteria | 2935713505 | 2935720243 | 178 |
| 155 | iso_pu_bacteria | 2935722832 | 2935728140 | 178 |
| 156 | iso_pu_bacteria | 2935732158 | 2935737263 | 178 |
| 157 | iso_pu_bacteria | 2935741537 | 2935746676 | 178 |
| 158 | iso_pu_bacteria | 2935750917 | 2935757643 | 178 |
| 159 | iso_pu_bacteria | 2935760218 | 2935764019 | 178 |
| 160 | iso_pu_bacteria | 2935769743 | 2935776512 | 178 |
| 161 | iso_pu_bacteria | 2935777560 | 2935784068 | 178 |
| 162 | iso_pu_bacteria | 2935785616 | 2935789940 | 178 |
| 163 | iso_pu_bacteria | 2935793552 | 2935798294 | 178 |
| 164 | iso_pu_bacteria | 2935801545 | 2935808607 | 178 |
| 165 | iso_pu_bacteria | 2935810662 | 2935817404 | 178 |
| 166 | iso_pu_bacteria | 2935819856 | 2935824754 | 178 |
| 167 | iso_pu_bacteria | 2935827899 | 2935834279 | 178 |
| 168 | iso_pu_bacteria | 2935837841 | 2935844862 | 178 |
| 169 | iso_pu_bacteria | 2935847175 | 2935851974 | 178 |
| 170 | iso_pu_bacteria | 2935855204 | 2935861886 | 178 |
| 171 | iso_pu_bacteria | 2935864058 | 2935868479 | 178 |
| 172 | iso_pu_bacteria | 2935873716 | 2935879253 | 178 |
| 173 | iso_pu_bacteria | 2935908558 | 2935911322 | 178 |
| 174 | iso_pu_bacteria | 2935916978 | 2935920854 | 178 |
| 175 | iso_pu_bacteria | 2935926038 | 2935928351 | 178 |
| 176 | iso_pu_bacteria | 2935934488 | 2935937996 | 178 |
| 177 | iso_pu_bacteria | 2935942939 | 2935945278 | 178 |
| 178 | iso_pu_bacteria | 2935951376 | 2935954216 | 178 |
| 179 | iso_pu_bacteria | 2935959822 | 2935965712 | 178 |
| 180 | iso_pu_bacteria | 2935967501 | 2935971516 | 178 |
| 181 | iso_pu_bacteria | 2935975950 | 2935982135 | 178 |
| 182 | iso_pu_bacteria | 2935992306 | 2935998580 | 178 |
| 183 | iso_pu_bacteria | 2936002035 | 2936008959 | 178 |
| 184 | iso_pu_bacteria | 2936037263 | 2936044201 | 178 |
| 185 | iso_pu_bacteria | 2940556831 | 2940563535 | 178 |
| 186 | iso_pu_bacteria | 2941507105 | 2941509399 | 178 |
| 187 | iso_pu_bacteria | 2941515067 | 2941517228 | 178 |
| 188 | iso_pu_bacteria | 2941523033 | 2941529917 | 178 |
| 189 | iso_pu_bacteria | 2941531003 | 2941537364 | 178 |
| 190 | iso_pu_bacteria | 2941538514 | 2941545244 | 178 |
| 191 | iso_pu_bacteria | 3005474847 | 3005476323 | 178 |
| 192 | iso_pu_bacteria | 3005506211 | 3005506820 | 178 |
| 193 | iso_pu_bacteria | 3005594810 | 3005597889 | 178 |
| 194 | iso_pu_bacteria | 8006933436 | 8006937659 | 178 |
| 195 | iso_pu_bacteria | 8006973647 | 8006977691 | 178 |
| 196 | iso_pu_bacteria | 8006984368 | 8006989846 | 178 |
| 197 | iso_pu_bacteria | 8016511872 | 8016519390 | 178 |
| 198 | iso_pu_bacteria | 8016522445 | 8016524961 | 178 |
| 199 | iso_pu_bacteria | 8016530956 | 8016538536 | 178 |
| 200 | iso_pu_bacteria | 8016539877 | 8016542820 | 178 |
| 201 | iso_pu_bacteria | 8016548790 | 8016550467 | 178 |
| 202 | iso_pu_bacteria | 8016557553 | 8016558884 | 178 |
| 203 | iso_pu_bacteria | 8016566248 | 8016568209 | 178 |
| 204 | iso_pu_bacteria | 8016575299 | 8016580875 | 178 |
| 205 | iso_pu_bacteria | 8016595262 | 8016596847 | 178 |
| 206 | iso_pu_bacteria | 8016603502 | 8016607747 | 178 |
| 207 | iso_pu_bacteria | 8016613128 | 8016619536 | 178 |
| 208 | iso_pu_bacteria | 8016622563 | 8016630069 | 178 |
| 209 | iso_pu_bacteria | 8017057580 | 8017066131 | 178 |
| 210 | iso_pu_bacteria | 8019530166 | 8019538201 | 178 |
| 211 | iso_pu_bacteria | 8019538911 | 8019541781 | 178 |
| 212 | iso_pu_bacteria | 8019547302 | 8019549013 | 178 |
| 213 | iso_pu_bacteria | 8019555841 | 8019560970 | 178 |
| 214 | iso_pu_bacteria | 8019565922 | 8019571054 | 178 |
| 215 | iso_pu_bacteria | 8019576017 | 8019578499 | 178 |
| 216 | iso_pu_bacteria | 8019586578 | 8019596544 | 178 |
| 217 | iso_pu_bacteria | 8019597564 | 8019605160 | 178 |
| 218 | iso_pu_bacteria | 8019608314 | 8019613383 | 178 |
| 219 | iso_pu_bacteria | 8019619141 | 8019624059 | 178 |
| 220 | iso_pu_bacteria | 8019629233 | 8019637969 | 178 |
| 221 | iso_pu_bacteria | 8019638758 | 8019641658 | 178 |
| 222 | iso_pu_bacteria | 8019648815 | 8019653584 | 178 |
| 223 | iso_pu_bacteria | 8019659431 | 8019665899 | 178 |
| 224 | iso_pu_bacteria | 8019668869 | 8019675420 | 178 |
| 225 | iso_pu_bacteria | 8019687851 | 8019695085 | 178 |
| 226 | iso_pu_bacteria | 8055742211 | 8055750209 | 178 |
| 227 | iso_pu_bacteria | 8056681323 | 8056686109 | 178 |
| 228 | iso_pu_bacteria | 8056689827 | 8056695419 | 178 |
| 229 | 3300039437 | Ga0436365_1325472 | Ga0436365_1325472_64_606 | 180 |
| 230 | 3300046507 | Ga0495606_0299848 | Ga0495606_0299848_147_689 | 180 |
| 231 | 3300013307 | Ga0157372_12060231 | Ga0157372_120602311 | 181 |
| 232 | 3300025942 | Ga0207689_10100307 | Ga0207689_101003071 | 181 |
| 233 | 2010549000 | RicEn_C399 | RicEn_07300 | 182 |
| 234 | 3300001989 | JGI24739J22299_10153398 | JGI24739J22299_101533982 | 182 |
| 235 | 3300002076 | JGI24749J21850_1028922 | JGI24749J21850_10289221 | 182 |
| 236 | 3300003215 | JGI25153J46596_10003712 | JGI25153J46596_100037121 | 182 |
| 237 | 3300003215 | JGI25153J46596_10003975 | JGI25153J46596_100039751 | 182 |
| 238 | 3300003215 | JGI25153J46596_10039108 | JGI25153J46596_100391083 | 182 |
| 239 | 3300003659 | JGI25404J52841_10017956 | JGI25404J52841_100179562 | 182 |
| 240 | 3300003794 | Ga0055531_10008928 | Ga0055531_100089282 | 182 |
| 241 | 3300003911 | JGI25405J52794_10012119 | JGI25405J52794_100121192 | 182 |
| 242 | 3300004625 | Ga0055543_1001247 | Ga0055543_10012475 | 182 |
| 243 | 3300005262 | Ga0065165_1001238 | Ga0065165_100123821 | 182 |
| 244 | 3300005262 | Ga0065165_1004821 | Ga0065165_10048218 | 182 |
| 245 | 3300005262 | Ga0065165_1012948 | Ga0065165_10129482 | 182 |
| 246 | 3300005262 | Ga0065165_1016813 | Ga0065165_10168132 | 182 |
| 247 | 3300005327 | Ga0070658_10080672 | Ga0070658_100806722 | 182 |
| 248 | 3300005329 | Ga0070683_100015748 | Ga0070683_1000157482 | 182 |
| 249 | 3300005329 | Ga0070683_100436837 | Ga0070683_1004368373 | 182 |
| 250 | 3300005330 | Ga0070690_100962839 | Ga0070690_1009628391 | 182 |
| 251 | 3300005331 | Ga0070670_100327092 | Ga0070670_1003270921 | 182 |
| 252 | 3300005331 | Ga0070670_101252150 | Ga0070670_1012521501 | 182 |
| 253 | 3300005334 | Ga0068869_100216708 | Ga0068869_1002167082 | 182 |
| 254 | 3300005336 | Ga0070680_100033950 | Ga0070680_1000339505 | 182 |
| 255 | 3300005337 | Ga0070682_100165238 | Ga0070682_1001652382 | 182 |
| 256 | 3300005337 | Ga0070682_100219358 | Ga0070682_1002193582 | 182 |
| 257 | 3300005338 | Ga0068868_100011625 | Ga0068868_1000116256 | 182 |
| 258 | 3300005338 | Ga0068868_100058807 | Ga0068868_1000588072 | 182 |
| 259 | 3300005338 | Ga0068868_100176891 | Ga0068868_1001768912 | 182 |
| 260 | 3300005338 | Ga0068868_100306128 | Ga0068868_1003061281 | 182 |
| 261 | 3300005339 | Ga0070660_100197657 | Ga0070660_1001976573 | 182 |
| 262 | 3300005339 | Ga0070660_100860512 | Ga0070660_1008605121 | 182 |
| 263 | 3300005340 | Ga0070689_100502858 | Ga0070689_1005028582 | 182 |
| 264 | 3300005341 | Ga0070691_10174128 | Ga0070691_101741282 | 182 |
| 265 | 3300005343 | Ga0070687_100128942 | Ga0070687_1001289422 | 182 |
| 266 | 3300005345 | Ga0070692_10134771 | Ga0070692_101347712 | 182 |
| 267 | 3300005347 | Ga0070668_100016271 | Ga0070668_1000162716 | 182 |
| 268 | 3300005347 | Ga0070668_100047595 | Ga0070668_1000475952 | 182 |
| 269 | 3300005347 | Ga0070668_100076201 | Ga0070668_1000762012 | 182 |
| 270 | 3300005347 | Ga0070668_100542358 | Ga0070668_1005423581 | 182 |
| 271 | 3300005347 | Ga0070668_100986721 | Ga0070668_1009867212 | 182 |
| 272 | 3300005347 | Ga0070668_101022242 | Ga0070668_1010222421 | 182 |
| 273 | 3300005347 | Ga0070668_101503618 | Ga0070668_1015036181 | 182 |
| 274 | 3300005353 | Ga0070669_100181958 | Ga0070669_1001819582 | 182 |
| 275 | 3300005353 | Ga0070669_101229277 | Ga0070669_1012292771 | 182 |
| 276 | 3300005354 | Ga0070675_100264823 | Ga0070675_1002648231 | 182 |
| 277 | 3300005355 | Ga0070671_100254929 | Ga0070671_1002549293 | 182 |
| 278 | 3300005355 | Ga0070671_100465337 | Ga0070671_1004653372 | 182 |
| 279 | 3300005355 | Ga0070671_100545542 | Ga0070671_1005455422 | 182 |
| 280 | 3300005356 | Ga0070674_100114350 | Ga0070674_1001143502 | 182 |
| 281 | 3300005356 | Ga0070674_100416633 | Ga0070674_1004166332 | 182 |
| 282 | 3300005364 | Ga0070673_100082174 | Ga0070673_1000821742 | 182 |
| 283 | 3300005365 | Ga0070688_100057420 | Ga0070688_1000574202 | 182 |
| 284 | 3300005366 | Ga0070659_100222395 | Ga0070659_1002223952 | 182 |
| 285 | 3300005367 | Ga0070667_100064004 | Ga0070667_1000640044 | 182 |
| 286 | 3300005367 | Ga0070667_100326035 | Ga0070667_1003260351 | 182 |
| 287 | 3300005367 | Ga0070667_100745512 | Ga0070667_1007455121 | 182 |
| 288 | 3300005406 | Ga0070703_10024753 | Ga0070703_100247532 | 182 |
| 289 | 3300005434 | Ga0070709_10004421 | Ga0070709_100044216 | 182 |
| 290 | 3300005434 | Ga0070709_10010158 | Ga0070709_100101582 | 182 |
| 291 | 3300005434 | Ga0070709_10144889 | Ga0070709_101448892 | 182 |
| 292 | 3300005434 | Ga0070709_10353964 | Ga0070709_103539641 | 182 |
| 293 | 3300005435 | Ga0070714_100004999 | Ga0070714_1000049993 | 182 |
| 294 | 3300005435 | Ga0070714_100101291 | Ga0070714_1001012912 | 182 |
| 295 | 3300005435 | Ga0070714_100184828 | Ga0070714_1001848282 | 182 |
| 296 | 3300005435 | Ga0070714_100259175 | Ga0070714_1002591753 | 182 |
| 297 | 3300005435 | Ga0070714_100663262 | Ga0070714_1006632622 | 182 |
| 298 | 3300005436 | Ga0070713_100004534 | Ga0070713_1000045343 | 182 |
| 299 | 3300005436 | Ga0070713_100006585 | Ga0070713_1000065854 | 182 |
| 300 | 3300005436 | Ga0070713_100011058 | Ga0070713_1000110587 | 182 |
| 301 | 3300005436 | Ga0070713_100014000 | Ga0070713_1000140007 | 182 |
| 302 | 3300005436 | Ga0070713_100084245 | Ga0070713_1000842454 | 182 |
| 303 | 3300005436 | Ga0070713_100212872 | Ga0070713_1002128722 | 182 |
| 304 | 3300005437 | Ga0070710_10060807 | Ga0070710_100608074 | 182 |
| 305 | 3300005437 | Ga0070710_10112579 | Ga0070710_101125793 | 182 |
| 306 | 3300005438 | Ga0070701_10119533 | Ga0070701_101195332 | 182 |
| 307 | 3300005439 | Ga0070711_100006399 | Ga0070711_1000063992 | 182 |
| 308 | 3300005439 | Ga0070711_100024840 | Ga0070711_1000248402 | 182 |
| 309 | 3300005439 | Ga0070711_100218504 | Ga0070711_1002185042 | 182 |
| 310 | 3300005440 | Ga0070705_100184931 | Ga0070705_1001849311 | 182 |
| 311 | 3300005440 | Ga0070705_100415204 | Ga0070705_1004152042 | 182 |
| 312 | 3300005441 | Ga0070700_100323113 | Ga0070700_1003231131 | 182 |
| 313 | 3300005444 | Ga0070694_100182349 | Ga0070694_1001823492 | 182 |
| 314 | 3300005445 | Ga0070708_100745514 | Ga0070708_1007455141 | 182 |
| 315 | 3300005455 | Ga0070663_100044479 | Ga0070663_1000444792 | 182 |
| 316 | 3300005455 | Ga0070663_100051122 | Ga0070663_1000511222 | 182 |
| 317 | 3300005455 | Ga0070663_100061590 | Ga0070663_1000615904 | 182 |
| 318 | 3300005455 | Ga0070663_100183072 | Ga0070663_1001830723 | 182 |
| 319 | 3300005455 | Ga0070663_100305159 | Ga0070663_1003051591 | 182 |
| 320 | 3300005455 | Ga0070663_100313452 | Ga0070663_1003134522 | 182 |
| 321 | 3300005455 | Ga0070663_100320366 | Ga0070663_1003203663 | 182 |
| 322 | 3300005455 | Ga0070663_100644209 | Ga0070663_1006442092 | 182 |
| 323 | 3300005456 | Ga0070678_100206008 | Ga0070678_1002060082 | 182 |
| 324 | 3300005456 | Ga0070678_100307277 | Ga0070678_1003072772 | 182 |
| 325 | 3300005456 | Ga0070678_100313336 | Ga0070678_1003133362 | 182 |
| 326 | 3300005457 | Ga0070662_100042613 | Ga0070662_1000426131 | 182 |
| 327 | 3300005457 | Ga0070662_100051832 | Ga0070662_1000518324 | 182 |
| 328 | 3300005458 | Ga0070681_10005842 | Ga0070681_100058426 | 182 |
| 329 | 3300005458 | Ga0070681_10046271 | Ga0070681_100462712 | 182 |
| 330 | 3300005459 | Ga0068867_100179243 | Ga0068867_1001792432 | 182 |
| 331 | 3300005459 | Ga0068867_100545419 | Ga0068867_1005454191 | 182 |
| 332 | 3300005459 | Ga0068867_100568483 | Ga0068867_1005684832 | 182 |
| 333 | 3300005467 | Ga0070706_100241729 | Ga0070706_1002417293 | 182 |
| 334 | 3300005518 | Ga0070699_100180163 | Ga0070699_1001801631 | 182 |
| 335 | 3300005518 | Ga0070699_100859143 | Ga0070699_1008591432 | 182 |
| 336 | 3300005518 | Ga0070699_101301903 | Ga0070699_1013019031 | 182 |
| 337 | 3300005530 | Ga0070679_100015322 | Ga0070679_1000153224 | 182 |
| 338 | 3300005530 | Ga0070679_100034222 | Ga0070679_1000342226 | 182 |
| 339 | 3300005535 | Ga0070684_100053919 | Ga0070684_1000539192 | 182 |
| 340 | 3300005535 | Ga0070684_100323388 | Ga0070684_1003233882 | 182 |
| 341 | 3300005536 | Ga0070697_100292726 | Ga0070697_1002927262 | 182 |
| 342 | 3300005539 | Ga0068853_101077338 | Ga0068853_1010773381 | 182 |
| 343 | 3300005543 | Ga0070672_100140100 | Ga0070672_1001401002 | 182 |
| 344 | 3300005543 | Ga0070672_100422703 | Ga0070672_1004227032 | 182 |
| 345 | 3300005543 | Ga0070672_100713267 | Ga0070672_1007132671 | 182 |
| 346 | 3300005544 | Ga0070686_100023188 | Ga0070686_1000231883 | 182 |
| 347 | 3300005545 | Ga0070695_100323813 | Ga0070695_1003238132 | 182 |
| 348 | 3300005546 | Ga0070696_100400603 | Ga0070696_1004006032 | 182 |
| 349 | 3300005546 | Ga0070696_100405459 | Ga0070696_1004054592 | 182 |
| 350 | 3300005546 | Ga0070696_100597977 | Ga0070696_1005979771 | 182 |
| 351 | 3300005548 | Ga0070665_100019999 | Ga0070665_1000199995 | 182 |
| 352 | 3300005548 | Ga0070665_100091696 | Ga0070665_1000916965 | 182 |
| 353 | 3300005548 | Ga0070665_100118504 | Ga0070665_1001185042 | 182 |
| 354 | 3300005548 | Ga0070665_100196813 | Ga0070665_1001968132 | 182 |
| 355 | 3300005548 | Ga0070665_100388257 | Ga0070665_1003882572 | 182 |
| 356 | 3300005548 | Ga0070665_100458678 | Ga0070665_1004586782 | 182 |
| 357 | 3300005563 | Ga0068855_100225014 | Ga0068855_1002250141 | 182 |
| 358 | 3300005563 | Ga0068855_100779440 | Ga0068855_1007794402 | 182 |
| 359 | 3300005563 | Ga0068855_101059062 | Ga0068855_1010590622 | 182 |
| 360 | 3300005564 | Ga0070664_100162208 | Ga0070664_1001622083 | 182 |
| 361 | 3300005564 | Ga0070664_100229394 | Ga0070664_1002293942 | 182 |
| 362 | 3300005564 | Ga0070664_100525264 | Ga0070664_1005252641 | 182 |
| 363 | 3300005577 | Ga0068857_100071359 | Ga0068857_1000713595 | 182 |
| 364 | 3300005577 | Ga0068857_100202935 | Ga0068857_1002029352 | 182 |
| 365 | 3300005614 | Ga0068856_100093327 | Ga0068856_1000933272 | 182 |
| 366 | 3300005614 | Ga0068856_100919513 | Ga0068856_1009195132 | 182 |
| 367 | 3300005616 | Ga0068852_100112958 | Ga0068852_1001129582 | 182 |
| 368 | 3300005616 | Ga0068852_100542038 | Ga0068852_1005420383 | 182 |
| 369 | 3300005616 | Ga0068852_100562511 | Ga0068852_1005625112 | 182 |
| 370 | 3300005617 | Ga0068859_100268917 | Ga0068859_1002689173 | 182 |
| 371 | 3300005617 | Ga0068859_100474242 | Ga0068859_1004742422 | 182 |
| 372 | 3300005617 | Ga0068859_100902022 | Ga0068859_1009020222 | 182 |
| 373 | 3300005618 | Ga0068864_100013398 | Ga0068864_1000133985 | 182 |
| 374 | 3300005618 | Ga0068864_100161872 | Ga0068864_1001618722 | 182 |
| 375 | 3300005718 | Ga0068866_10075702 | Ga0068866_100757023 | 182 |
| 376 | 3300005719 | Ga0068861_100076323 | Ga0068861_1000763235 | 182 |
| 377 | 3300005719 | Ga0068861_100120266 | Ga0068861_1001202662 | 182 |
| 378 | 3300005840 | Ga0068870_10071748 | Ga0068870_100717482 | 182 |
| 379 | 3300005841 | Ga0068863_100082691 | Ga0068863_1000826915 | 182 |
| 380 | 3300005841 | Ga0068863_100142925 | Ga0068863_1001429252 | 182 |
| 381 | 3300005841 | Ga0068863_100278724 | Ga0068863_1002787243 | 182 |
| 382 | 3300005841 | Ga0068863_101039854 | Ga0068863_1010398541 | 182 |
| 383 | 3300005841 | Ga0068863_101072481 | Ga0068863_1010724811 | 182 |
| 384 | 3300005842 | Ga0068858_100122763 | Ga0068858_1001227632 | 182 |
| 385 | 3300005842 | Ga0068858_100142978 | Ga0068858_1001429783 | 182 |
| 386 | 3300005842 | Ga0068858_100892647 | Ga0068858_1008926472 | 182 |
| 387 | 3300005843 | Ga0068860_100000367 | Ga0068860_10000036736 | 182 |
| 388 | 3300005843 | Ga0068860_100104480 | Ga0068860_1001044802 | 182 |
| 389 | 3300005843 | Ga0068860_100238758 | Ga0068860_1002387582 | 182 |
| 390 | 3300005843 | Ga0068860_100247941 | Ga0068860_1002479412 | 182 |
| 391 | 3300005843 | Ga0068860_100311735 | Ga0068860_1003117352 | 182 |
| 392 | 3300005843 | Ga0068860_100358870 | Ga0068860_1003588702 | 182 |
| 393 | 3300005843 | Ga0068860_100361843 | Ga0068860_1003618432 | 182 |
| 394 | 3300005843 | Ga0068860_100377664 | Ga0068860_1003776642 | 182 |
| 395 | 3300005843 | Ga0068860_101271536 | Ga0068860_1012715361 | 182 |
| 396 | 3300005844 | Ga0068862_100306497 | Ga0068862_1003064972 | 182 |
| 397 | 3300005844 | Ga0068862_100374442 | Ga0068862_1003744422 | 182 |
| 398 | 3300005844 | Ga0068862_100674106 | Ga0068862_1006741062 | 182 |
| 399 | 3300005844 | Ga0068862_100824338 | Ga0068862_1008243381 | 182 |
| 400 | 3300005937 | Ga0081455_10005963 | Ga0081455_1000596310 | 182 |
| 401 | 3300005937 | Ga0081455_10019148 | Ga0081455_100191488 | 182 |
| 402 | 3300005937 | Ga0081455_10019874 | Ga0081455_100198745 | 182 |
| 403 | 3300005937 | Ga0081455_10238149 | Ga0081455_102381492 | 182 |
| 404 | 3300005983 | Ga0081540_1005978 | Ga0081540_10059782 | 182 |
| 405 | 3300005983 | Ga0081540_1007083 | Ga0081540_10070834 | 182 |
| 406 | 3300005983 | Ga0081540_1008425 | Ga0081540_10084252 | 182 |
| 407 | 3300005983 | Ga0081540_1010630 | Ga0081540_10106307 | 182 |
| 408 | 3300005983 | Ga0081540_1031564 | Ga0081540_10315645 | 182 |
| 409 | 3300005983 | Ga0081540_1042398 | Ga0081540_10423982 | 182 |
| 410 | 3300005983 | Ga0081540_1047481 | Ga0081540_10474812 | 182 |
| 411 | 3300005983 | Ga0081540_1047752 | Ga0081540_10477522 | 182 |
| 412 | 3300006028 | Ga0070717_10000254 | Ga0070717_1000025430 | 182 |
| 413 | 3300006028 | Ga0070717_10003385 | Ga0070717_100033854 | 182 |
| 414 | 3300006028 | Ga0070717_10030814 | Ga0070717_100308145 | 182 |
| 415 | 3300006038 | Ga0075365_10042633 | Ga0075365_100426335 | 182 |
| 416 | 3300006038 | Ga0075365_10151609 | Ga0075365_101516092 | 182 |
| 417 | 3300006038 | Ga0075365_10227051 | Ga0075365_102270512 | 182 |
| 418 | 3300006038 | Ga0075365_10227378 | Ga0075365_102273782 | 182 |
| 419 | 3300006038 | Ga0075365_10255577 | Ga0075365_102555771 | 182 |
| 420 | 3300006038 | Ga0075365_10453491 | Ga0075365_104534912 | 182 |
| 421 | 3300006048 | Ga0075363_100000357 | Ga0075363_1000003579 | 182 |
| 422 | 3300006048 | Ga0075363_100033478 | Ga0075363_1000334783 | 182 |
| 423 | 3300006051 | Ga0075364_10011619 | Ga0075364_100116192 | 182 |
| 424 | 3300006051 | Ga0075364_10112989 | Ga0075364_101129892 | 182 |
| 425 | 3300006163 | Ga0070715_10000467 | Ga0070715_100004675 | 182 |
| 426 | 3300006163 | Ga0070715_10136832 | Ga0070715_101368322 | 182 |
| 427 | 3300006163 | Ga0070715_10317261 | Ga0070715_103172611 | 182 |
| 428 | 3300006173 | Ga0070716_100000841 | Ga0070716_10000084110 | 182 |
| 429 | 3300006173 | Ga0070716_100107742 | Ga0070716_1001077422 | 182 |
| 430 | 3300006173 | Ga0070716_100151373 | Ga0070716_1001513732 | 182 |
| 431 | 3300006175 | Ga0070712_100002446 | Ga0070712_1000024466 | 182 |
| 432 | 3300006175 | Ga0070712_100009088 | Ga0070712_1000090884 | 182 |
| 433 | 3300006175 | Ga0070712_100136191 | Ga0070712_1001361913 | 182 |
| 434 | 3300006175 | Ga0070712_100305479 | Ga0070712_1003054792 | 182 |
| 435 | 3300006175 | Ga0070712_100927680 | Ga0070712_1009276801 | 182 |
| 436 | 3300006177 | Ga0075362_10322610 | Ga0075362_103226101 | 182 |
| 437 | 3300006177 | Ga0075362_10443784 | Ga0075362_104437841 | 182 |
| 438 | 3300006178 | Ga0075367_10016273 | Ga0075367_100162736 | 182 |
| 439 | 3300006178 | Ga0075367_10136736 | Ga0075367_101367362 | 182 |
| 440 | 3300006178 | Ga0075367_10146349 | Ga0075367_101463492 | 182 |
| 441 | 3300006178 | Ga0075367_10481996 | Ga0075367_104819961 | 182 |
| 442 | 3300006186 | Ga0075369_10036194 | Ga0075369_100361941 | 182 |
| 443 | 3300006195 | Ga0075366_10076370 | Ga0075366_100763702 | 182 |
| 444 | 3300006195 | Ga0075366_10342806 | Ga0075366_103428062 | 182 |
| 445 | 3300006237 | Ga0097621_100074771 | Ga0097621_1000747715 | 182 |
| 446 | 3300006237 | Ga0097621_100093160 | Ga0097621_1000931602 | 182 |
| 447 | 3300006237 | Ga0097621_100094777 | Ga0097621_1000947772 | 182 |
| 448 | 3300006237 | Ga0097621_101035912 | Ga0097621_1010359122 | 182 |
| 449 | 3300006353 | Ga0075370_10072587 | Ga0075370_100725872 | 182 |
| 450 | 3300006358 | Ga0068871_100070981 | Ga0068871_1000709812 | 182 |
| 451 | 3300006358 | Ga0068871_100964353 | Ga0068871_1009643531 | 182 |
| 452 | 3300006871 | Ga0075434_100085607 | Ga0075434_1000856072 | 182 |
| 453 | 3300006881 | Ga0068865_100072578 | Ga0068865_1000725782 | 182 |
| 454 | 3300006881 | Ga0068865_100132105 | Ga0068865_1001321053 | 182 |
| 455 | 3300006931 | Ga0097620_100268898 | Ga0097620_1002688983 | 182 |
| 456 | 3300006931 | Ga0097620_100474234 | Ga0097620_1004742342 | 182 |
| 457 | 3300006931 | Ga0097620_100902023 | Ga0097620_1009020232 | 182 |
| 458 | 3300006941 | Ga0099825_1020324 | Ga0099825_10203247 | 182 |
| 459 | 3300006942 | Ga0099824_1014791 | Ga0099824_10147915 | 182 |
| 460 | 3300006942 | Ga0099824_1046460 | Ga0099824_10464601 | 182 |
| 461 | 3300006944 | Ga0099823_1089075 | Ga0099823_10890752 | 182 |
| 462 | 3300007076 | Ga0075435_100088077 | Ga0075435_1000880772 | 182 |
| 463 | 3300007788 | Ga0099795_10054104 | Ga0099795_100541042 | 182 |
| 464 | 3300007788 | Ga0099795_10259631 | Ga0099795_102596311 | 182 |
| 465 | 3300009036 | Ga0105244_10211259 | Ga0105244_102112592 | 182 |
| 466 | 3300009092 | Ga0105250_10126097 | Ga0105250_101260972 | 182 |
| 467 | 3300009093 | Ga0105240_10679877 | Ga0105240_106798772 | 182 |
| 468 | 3300009093 | Ga0105240_10867830 | Ga0105240_108678302 | 182 |
| 469 | 3300009094 | Ga0111539_10313176 | Ga0111539_103131763 | 182 |
| 470 | 3300009094 | Ga0111539_10363720 | Ga0111539_103637202 | 182 |
| 471 | 3300009098 | Ga0105245_10028789 | Ga0105245_100287892 | 182 |
| 472 | 3300009098 | Ga0105245_10182260 | Ga0105245_101822602 | 182 |
| 473 | 3300009098 | Ga0105245_10276300 | Ga0105245_102763002 | 182 |
| 474 | 3300009098 | Ga0105245_11192035 | Ga0105245_111920351 | 182 |
| 475 | 3300009101 | Ga0105247_10057933 | Ga0105247_100579332 | 182 |
| 476 | 3300009101 | Ga0105247_10060291 | Ga0105247_100602911 | 182 |
| 477 | 3300009101 | Ga0105247_10221345 | Ga0105247_102213453 | 182 |
| 478 | 3300009101 | Ga0105247_10253332 | Ga0105247_102533322 | 182 |
| 479 | 3300009101 | Ga0105247_10300555 | Ga0105247_103005552 | 182 |
| 480 | 3300009148 | Ga0105243_10281547 | Ga0105243_102815472 | 182 |
| 481 | 3300009148 | Ga0105243_11621434 | Ga0105243_116214342 | 182 |
| 482 | 3300009148 | Ga0105243_12031488 | Ga0105243_120314881 | 182 |
| 483 | 3300009174 | Ga0105241_10016637 | Ga0105241_100166375 | 182 |
| 484 | 3300009174 | Ga0105241_10042053 | Ga0105241_100420536 | 182 |
| 485 | 3300009174 | Ga0105241_10585759 | Ga0105241_105857592 | 182 |
| 486 | 3300009176 | Ga0105242_10915942 | Ga0105242_109159422 | 182 |
| 487 | 3300009176 | Ga0105242_11194547 | Ga0105242_111945472 | 182 |
| 488 | 3300009177 | Ga0105248_10292121 | Ga0105248_102921211 | 182 |
| 489 | 3300009177 | Ga0105248_11098099 | Ga0105248_110980992 | 182 |
| 490 | 3300009177 | Ga0105248_11497591 | Ga0105248_114975912 | 182 |
| 491 | 3300009545 | Ga0105237_10126837 | Ga0105237_101268371 | 182 |
| 492 | 3300009545 | Ga0105237_10333372 | Ga0105237_103333723 | 182 |
| 493 | 3300009545 | Ga0105237_10672703 | Ga0105237_106727032 | 182 |
| 494 | 3300009545 | Ga0105237_11289100 | Ga0105237_112891001 | 182 |
| 495 | 3300009551 | Ga0105238_10309954 | Ga0105238_103099541 | 182 |
| 496 | 3300009551 | Ga0105238_10637142 | Ga0105238_106371422 | 182 |
| 497 | 3300009551 | Ga0105238_10768623 | Ga0105238_107686231 | 182 |
| 498 | 3300009551 | Ga0105238_10958028 | Ga0105238_109580282 | 182 |
| 499 | 3300009551 | Ga0105238_11219444 | Ga0105238_112194441 | 182 |
| 500 | 3300009553 | Ga0105249_10298478 | Ga0105249_102984782 | 182 |
| 501 | 3300009553 | Ga0105249_10354663 | Ga0105249_103546632 | 182 |
| 502 | 3300009553 | Ga0105249_10703451 | Ga0105249_107034512 | 182 |
| 503 | 3300009553 | Ga0105249_11024961 | Ga0105249_110249612 | 182 |
| 504 | 3300010159 | Ga0099796_10015205 | Ga0099796_100152053 | 182 |
| 505 | 3300010159 | Ga0099796_10182110 | Ga0099796_101821102 | 182 |
| 506 | 3300010375 | Ga0105239_10184727 | Ga0105239_101847273 | 182 |
| 507 | 3300010375 | Ga0105239_10337343 | Ga0105239_103373431 | 182 |
| 508 | 3300010375 | Ga0105239_10341586 | Ga0105239_103415862 | 182 |
| 509 | 3300010375 | Ga0105239_10568705 | Ga0105239_105687052 | 182 |
| 510 | 3300011119 | Ga0105246_10162306 | Ga0105246_101623062 | 182 |
| 511 | 3300011119 | Ga0105246_11011435 | Ga0105246_110114351 | 182 |
| 512 | 3300013105 | Ga0157369_10020020 | Ga0157369_100200204 | 182 |
| 513 | 3300013105 | Ga0157369_10490873 | Ga0157369_104908732 | 182 |
| 514 | 3300013296 | Ga0157374_10036491 | Ga0157374_100364912 | 182 |
| 515 | 3300013296 | Ga0157374_10091944 | Ga0157374_100919443 | 182 |
| 516 | 3300013297 | Ga0157378_10235465 | Ga0157378_102354653 | 182 |
| 517 | 3300013297 | Ga0157378_10297752 | Ga0157378_102977522 | 182 |
| 518 | 3300013306 | Ga0163162_10033688 | Ga0163162_100336885 | 182 |
| 519 | 3300013306 | Ga0163162_10192615 | Ga0163162_101926153 | 182 |
| 520 | 3300013306 | Ga0163162_10196746 | Ga0163162_101967463 | 182 |
| 521 | 3300013306 | Ga0163162_10905989 | Ga0163162_109059892 | 182 |
| 522 | 3300013306 | Ga0163162_11615165 | Ga0163162_116151652 | 182 |
| 523 | 3300013306 | Ga0163162_11734292 | Ga0163162_117342921 | 182 |
| 524 | 3300013307 | Ga0157372_10255072 | Ga0157372_102550721 | 182 |
| 525 | 3300013308 | Ga0157375_10042135 | Ga0157375_100421354 | 182 |
| 526 | 3300013308 | Ga0157375_10088435 | Ga0157375_100884352 | 182 |
| 527 | 3300013308 | Ga0157375_10316195 | Ga0157375_103161952 | 182 |
| 528 | 3300013308 | Ga0157375_10437699 | Ga0157375_104376993 | 182 |
| 529 | 3300013308 | Ga0157375_11124440 | Ga0157375_111244402 | 182 |
| 530 | 3300013308 | Ga0157375_11373761 | Ga0157375_113737612 | 182 |
| 531 | 3300013308 | Ga0157375_11772664 | Ga0157375_117726642 | 182 |
| 532 | 3300014325 | Ga0163163_10050507 | Ga0163163_100505072 | 182 |
| 533 | 3300014325 | Ga0163163_10141356 | Ga0163163_101413563 | 182 |
| 534 | 3300014325 | Ga0163163_10221492 | Ga0163163_102214922 | 182 |
| 535 | 3300014325 | Ga0163163_10294188 | Ga0163163_102941882 | 182 |
| 536 | 3300014325 | Ga0163163_10948135 | Ga0163163_109481351 | 182 |
| 537 | 3300014326 | Ga0157380_10165577 | Ga0157380_101655772 | 182 |
| 538 | 3300014326 | Ga0157380_10497827 | Ga0157380_104978272 | 182 |
| 539 | 3300014745 | Ga0157377_10282611 | Ga0157377_102826112 | 182 |
| 540 | 3300014745 | Ga0157377_10341276 | Ga0157377_103412762 | 182 |
| 541 | 3300014968 | Ga0157379_10107522 | Ga0157379_101075222 | 182 |
| 542 | 3300014968 | Ga0157379_10138478 | Ga0157379_101384782 | 182 |
| 543 | 3300014968 | Ga0157379_10227748 | Ga0157379_102277485 | 182 |
| 544 | 3300014969 | Ga0157376_10004272 | Ga0157376_100042722 | 182 |
| 545 | 3300014969 | Ga0157376_10041292 | Ga0157376_100412925 | 182 |
| 546 | 3300014969 | Ga0157376_10074244 | Ga0157376_100742446 | 182 |
| 547 | 3300014969 | Ga0157376_10214414 | Ga0157376_102144142 | 182 |
| 548 | 3300014969 | Ga0157376_10929481 | Ga0157376_109294811 | 182 |
| 549 | 3300017792 | Ga0163161_10314640 | Ga0163161_103146402 | 182 |
| 550 | 3300020069 | Ga0197907_10173837 | Ga0197907_101738373 | 182 |
| 551 | 3300020070 | Ga0206356_10315111 | Ga0206356_103151111 | 182 |
| 552 | 3300020070 | Ga0206356_10644697 | Ga0206356_106446973 | 182 |
| 553 | 3300020078 | Ga0206352_11357288 | Ga0206352_113572881 | 182 |
| 554 | 3300020082 | Ga0206353_10982674 | Ga0206353_109826742 | 182 |
| 555 | 3300020610 | Ga0154015_1039217 | Ga0154015_10392171 | 182 |
| 556 | 3300025230 | Ga0209563_103469 | Ga0209563_1034694 | 182 |
| 557 | 3300025253 | Ga0209677_102593 | Ga0209677_1025932 | 182 |
| 558 | 3300025261 | Ga0209233_1027116 | Ga0209233_10271162 | 182 |
| 559 | 3300025284 | Ga0209130_1038983 | Ga0209130_10389832 | 182 |
| 560 | 3300025297 | Ga0209758_1000595 | Ga0209758_100059517 | 182 |
| 561 | 3300025297 | Ga0209758_1000604 | Ga0209758_100060443 | 182 |
| 562 | 3300025297 | Ga0209758_1001332 | Ga0209758_100133212 | 182 |
| 563 | 3300025297 | Ga0209758_1025154 | Ga0209758_10251542 | 182 |
| 564 | 3300025297 | Ga0209758_1049382 | Ga0209758_10493823 | 182 |
| 565 | 3300025297 | Ga0209758_1106602 | Ga0209758_11066022 | 182 |
| 566 | 3300025299 | Ga0209256_1008443 | Ga0209256_10084434 | 182 |
| 567 | 3300025299 | Ga0209256_1074700 | Ga0209256_10747002 | 182 |
| 568 | 3300025302 | Ga0207426_1000500 | Ga0207426_100050026 | 182 |
| 569 | 3300025302 | Ga0207426_1001477 | Ga0207426_100147716 | 182 |
| 570 | 3300025302 | Ga0207426_1007029 | Ga0207426_10070293 | 182 |
| 571 | 3300025302 | Ga0207426_1012937 | Ga0207426_10129373 | 182 |
| 572 | 3300025303 | Ga0209051_1093743 | Ga0209051_10937432 | 182 |
| 573 | 3300025304 | Ga0209257_1001217 | Ga0209257_100121710 | 182 |
| 574 | 3300025304 | Ga0209257_1039914 | Ga0209257_10399142 | 182 |
| 575 | 3300025711 | Ga0207696_1045828 | Ga0207696_10458282 | 182 |
| 576 | 3300025885 | Ga0207653_10022622 | Ga0207653_100226222 | 182 |
| 577 | 3300025898 | Ga0207692_10002241 | Ga0207692_100022412 | 182 |
| 578 | 3300025898 | Ga0207692_10343202 | Ga0207692_103432022 | 182 |
| 579 | 3300025898 | Ga0207692_10457622 | Ga0207692_104576222 | 182 |
| 580 | 3300025899 | Ga0207642_10137858 | Ga0207642_101378582 | 182 |
| 581 | 3300025899 | Ga0207642_10203052 | Ga0207642_102030522 | 182 |
| 582 | 3300025900 | Ga0207710_10031300 | Ga0207710_100313003 | 182 |
| 583 | 3300025900 | Ga0207710_10042758 | Ga0207710_100427584 | 182 |
| 584 | 3300025900 | Ga0207710_10055220 | Ga0207710_100552202 | 182 |
| 585 | 3300025900 | Ga0207710_10068167 | Ga0207710_100681672 | 182 |
| 586 | 3300025900 | Ga0207710_10121193 | Ga0207710_101211932 | 182 |
| 587 | 3300025901 | Ga0207688_10072723 | Ga0207688_100727232 | 182 |
| 588 | 3300025901 | Ga0207688_10167946 | Ga0207688_101679463 | 182 |
| 589 | 3300025903 | Ga0207680_10438132 | Ga0207680_104381321 | 182 |
| 590 | 3300025903 | Ga0207680_10897925 | Ga0207680_108979251 | 182 |
| 591 | 3300025904 | Ga0207647_10135326 | Ga0207647_101353262 | 182 |
| 592 | 3300025905 | Ga0207685_10000741 | Ga0207685_100007416 | 182 |
| 593 | 3300025905 | Ga0207685_10341978 | Ga0207685_103419781 | 182 |
| 594 | 3300025906 | Ga0207699_10006247 | Ga0207699_100062472 | 182 |
| 595 | 3300025906 | Ga0207699_10008256 | Ga0207699_100082566 | 182 |
| 596 | 3300025906 | Ga0207699_10772660 | Ga0207699_107726601 | 182 |
| 597 | 3300025906 | Ga0207699_10864446 | Ga0207699_108644461 | 182 |
| 598 | 3300025907 | Ga0207645_10121320 | Ga0207645_101213202 | 182 |
| 599 | 3300025907 | Ga0207645_10678390 | Ga0207645_106783902 | 182 |
| 600 | 3300025908 | Ga0207643_10178655 | Ga0207643_101786552 | 182 |
| 601 | 3300025908 | Ga0207643_10290527 | Ga0207643_102905272 | 182 |
| 602 | 3300025909 | Ga0207705_10196045 | Ga0207705_101960452 | 182 |
| 603 | 3300025910 | Ga0207684_10658444 | Ga0207684_106584441 | 182 |
| 604 | 3300025911 | Ga0207654_10005980 | Ga0207654_100059802 | 182 |
| 605 | 3300025911 | Ga0207654_10222223 | Ga0207654_102222232 | 182 |
| 606 | 3300025912 | Ga0207707_10000639 | Ga0207707_1000063920 | 182 |
| 607 | 3300025913 | Ga0207695_10186767 | Ga0207695_101867674 | 182 |
| 608 | 3300025913 | Ga0207695_10383565 | Ga0207695_103835652 | 182 |
| 609 | 3300025913 | Ga0207695_10741449 | Ga0207695_107414492 | 182 |
| 610 | 3300025914 | Ga0207671_10256048 | Ga0207671_102560482 | 182 |
| 611 | 3300025914 | Ga0207671_10355742 | Ga0207671_103557422 | 182 |
| 612 | 3300025915 | Ga0207693_10003759 | Ga0207693_100037594 | 182 |
| 613 | 3300025915 | Ga0207693_10102545 | Ga0207693_101025452 | 182 |
| 614 | 3300025915 | Ga0207693_10122223 | Ga0207693_101222232 | 182 |
| 615 | 3300025915 | Ga0207693_10159400 | Ga0207693_101594003 | 182 |
| 616 | 3300025915 | Ga0207693_10918528 | Ga0207693_109185281 | 182 |
| 617 | 3300025916 | Ga0207663_10000502 | Ga0207663_1000050212 | 182 |
| 618 | 3300025916 | Ga0207663_10102757 | Ga0207663_101027574 | 182 |
| 619 | 3300025916 | Ga0207663_10108965 | Ga0207663_101089652 | 182 |
| 620 | 3300025918 | Ga0207662_10120318 | Ga0207662_101203182 | 182 |
| 621 | 3300025919 | Ga0207657_10038451 | Ga0207657_100384516 | 182 |
| 622 | 3300025919 | Ga0207657_11046913 | Ga0207657_110469131 | 182 |
| 623 | 3300025921 | Ga0207652_10010036 | Ga0207652_100100366 | 182 |
| 624 | 3300025923 | Ga0207681_10124704 | Ga0207681_101247041 | 182 |
| 625 | 3300025923 | Ga0207681_11342004 | Ga0207681_113420041 | 182 |
| 626 | 3300025924 | Ga0207694_10084505 | Ga0207694_100845054 | 182 |
| 627 | 3300025925 | Ga0207650_10124649 | Ga0207650_101246492 | 182 |
| 628 | 3300025925 | Ga0207650_10187060 | Ga0207650_101870602 | 182 |
| 629 | 3300025925 | Ga0207650_10588635 | Ga0207650_105886352 | 182 |
| 630 | 3300025926 | Ga0207659_10911632 | Ga0207659_109116322 | 182 |
| 631 | 3300025926 | Ga0207659_11316578 | Ga0207659_113165781 | 182 |
| 632 | 3300025927 | Ga0207687_10093119 | Ga0207687_100931192 | 182 |
| 633 | 3300025927 | Ga0207687_10199345 | Ga0207687_101993453 | 182 |
| 634 | 3300025927 | Ga0207687_10654990 | Ga0207687_106549902 | 182 |
| 635 | 3300025928 | Ga0207700_10005398 | Ga0207700_100053987 | 182 |
| 636 | 3300025928 | Ga0207700_10064289 | Ga0207700_100642892 | 182 |
| 637 | 3300025928 | Ga0207700_10090508 | Ga0207700_100905084 | 182 |
| 638 | 3300025928 | Ga0207700_10174803 | Ga0207700_101748032 | 182 |
| 639 | 3300025928 | Ga0207700_10208505 | Ga0207700_102085052 | 182 |
| 640 | 3300025928 | Ga0207700_10384295 | Ga0207700_103842952 | 182 |
| 641 | 3300025928 | Ga0207700_10778836 | Ga0207700_107788362 | 182 |
| 642 | 3300025928 | Ga0207700_10781577 | Ga0207700_107815771 | 182 |
| 643 | 3300025929 | Ga0207664_10043298 | Ga0207664_100432983 | 182 |
| 644 | 3300025929 | Ga0207664_10045215 | Ga0207664_100452153 | 182 |
| 645 | 3300025929 | Ga0207664_10085612 | Ga0207664_100856122 | 182 |
| 646 | 3300025929 | Ga0207664_10388205 | Ga0207664_103882051 | 182 |
| 647 | 3300025929 | Ga0207664_10622377 | Ga0207664_106223772 | 182 |
| 648 | 3300025929 | Ga0207664_10787086 | Ga0207664_107870861 | 182 |
| 649 | 3300025929 | Ga0207664_10978238 | Ga0207664_109782381 | 182 |
| 650 | 3300025931 | Ga0207644_10187921 | Ga0207644_101879212 | 182 |
| 651 | 3300025931 | Ga0207644_10316355 | Ga0207644_103163552 | 182 |
| 652 | 3300025931 | Ga0207644_10543247 | Ga0207644_105432472 | 182 |
| 653 | 3300025931 | Ga0207644_10649033 | Ga0207644_106490331 | 182 |
| 654 | 3300025933 | Ga0207706_10055854 | Ga0207706_100558543 | 182 |
| 655 | 3300025933 | Ga0207706_10159120 | Ga0207706_101591203 | 182 |
| 656 | 3300025933 | Ga0207706_10181565 | Ga0207706_101815654 | 182 |
| 657 | 3300025933 | Ga0207706_10216572 | Ga0207706_102165722 | 182 |
| 658 | 3300025934 | Ga0207686_10131143 | Ga0207686_101311431 | 182 |
| 659 | 3300025934 | Ga0207686_10561627 | Ga0207686_105616272 | 182 |
| 660 | 3300025935 | Ga0207709_10055044 | Ga0207709_100550442 | 182 |
| 661 | 3300025935 | Ga0207709_10347985 | Ga0207709_103479852 | 182 |
| 662 | 3300025935 | Ga0207709_10452824 | Ga0207709_104528242 | 182 |
| 663 | 3300025936 | Ga0207670_10092679 | Ga0207670_100926792 | 182 |
| 664 | 3300025936 | Ga0207670_10333659 | Ga0207670_103336592 | 182 |
| 665 | 3300025937 | Ga0207669_10064377 | Ga0207669_100643772 | 182 |
| 666 | 3300025937 | Ga0207669_10869200 | Ga0207669_108692001 | 182 |
| 667 | 3300025938 | Ga0207704_10042041 | Ga0207704_100420414 | 182 |
| 668 | 3300025938 | Ga0207704_10091861 | Ga0207704_100918612 | 182 |
| 669 | 3300025939 | Ga0207665_10002009 | Ga0207665_100020099 | 182 |
| 670 | 3300025939 | Ga0207665_10062598 | Ga0207665_100625983 | 182 |
| 671 | 3300025939 | Ga0207665_10091603 | Ga0207665_100916034 | 182 |
| 672 | 3300025939 | Ga0207665_10317582 | Ga0207665_103175822 | 182 |
| 673 | 3300025939 | Ga0207665_10651756 | Ga0207665_106517562 | 182 |
| 674 | 3300025940 | Ga0207691_10018692 | Ga0207691_100186926 | 182 |
| 675 | 3300025940 | Ga0207691_10110689 | Ga0207691_101106892 | 182 |
| 676 | 3300025940 | Ga0207691_10368011 | Ga0207691_103680112 | 182 |
| 677 | 3300025940 | Ga0207691_10934336 | Ga0207691_109343361 | 182 |
| 678 | 3300025941 | Ga0207711_10253859 | Ga0207711_102538592 | 182 |
| 679 | 3300025941 | Ga0207711_10954309 | Ga0207711_109543092 | 182 |
| 680 | 3300025942 | Ga0207689_10048603 | Ga0207689_100486033 | 182 |
| 681 | 3300025942 | Ga0207689_10477296 | Ga0207689_104772962 | 182 |
| 682 | 3300025942 | Ga0207689_10532497 | Ga0207689_105324972 | 182 |
| 683 | 3300025942 | Ga0207689_10570017 | Ga0207689_105700171 | 182 |
| 684 | 3300025944 | Ga0207661_10007291 | Ga0207661_100072913 | 182 |
| 685 | 3300025944 | Ga0207661_10054657 | Ga0207661_100546572 | 182 |
| 686 | 3300025945 | Ga0207679_10125519 | Ga0207679_101255192 | 182 |
| 687 | 3300025945 | Ga0207679_10674846 | Ga0207679_106748462 | 182 |
| 688 | 3300025945 | Ga0207679_10805164 | Ga0207679_108051642 | 182 |
| 689 | 3300025949 | Ga0207667_10154496 | Ga0207667_101544962 | 182 |
| 690 | 3300025949 | Ga0207667_10487924 | Ga0207667_104879243 | 182 |
| 691 | 3300025949 | Ga0207667_11066099 | Ga0207667_110660992 | 182 |
| 692 | 3300025960 | Ga0207651_10064250 | Ga0207651_100642502 | 182 |
| 693 | 3300025960 | Ga0207651_10368596 | Ga0207651_103685962 | 182 |
| 694 | 3300025960 | Ga0207651_10823545 | Ga0207651_108235451 | 182 |
| 695 | 3300025961 | Ga0207712_10054730 | Ga0207712_100547302 | 182 |
| 696 | 3300025961 | Ga0207712_10115924 | Ga0207712_101159242 | 182 |
| 697 | 3300025961 | Ga0207712_10216066 | Ga0207712_102160663 | 182 |
| 698 | 3300025961 | Ga0207712_10321796 | Ga0207712_103217962 | 182 |
| 699 | 3300025961 | Ga0207712_11167174 | Ga0207712_111671741 | 182 |
| 700 | 3300025972 | Ga0207668_10030240 | Ga0207668_100302403 | 182 |
| 701 | 3300025972 | Ga0207668_10078317 | Ga0207668_100783172 | 182 |
| 702 | 3300025972 | Ga0207668_10169342 | Ga0207668_101693423 | 182 |
| 703 | 3300025972 | Ga0207668_10322913 | Ga0207668_103229131 | 182 |
| 704 | 3300025972 | Ga0207668_10508646 | Ga0207668_105086462 | 182 |
| 705 | 3300025972 | Ga0207668_11277806 | Ga0207668_112778061 | 182 |
| 706 | 3300025981 | Ga0207640_10919525 | Ga0207640_109195251 | 182 |
| 707 | 3300025986 | Ga0207658_10294509 | Ga0207658_102945092 | 182 |
| 708 | 3300026023 | Ga0207677_10005995 | Ga0207677_100059952 | 182 |
| 709 | 3300026023 | Ga0207677_10049586 | Ga0207677_100495862 | 182 |
| 710 | 3300026023 | Ga0207677_10181010 | Ga0207677_101810102 | 182 |
| 711 | 3300026023 | Ga0207677_10239123 | Ga0207677_102391232 | 182 |
| 712 | 3300026023 | Ga0207677_10696208 | Ga0207677_106962082 | 182 |
| 713 | 3300026035 | Ga0207703_10228892 | Ga0207703_102288922 | 182 |
| 714 | 3300026035 | Ga0207703_10307145 | Ga0207703_103071452 | 182 |
| 715 | 3300026035 | Ga0207703_10923455 | Ga0207703_109234552 | 182 |
| 716 | 3300026035 | Ga0207703_10982617 | Ga0207703_109826171 | 182 |
| 717 | 3300026041 | Ga0207639_10285322 | Ga0207639_102853222 | 182 |
| 718 | 3300026041 | Ga0207639_10794876 | Ga0207639_107948762 | 182 |
| 719 | 3300026067 | Ga0207678_10018446 | Ga0207678_100184466 | 182 |
| 720 | 3300026067 | Ga0207678_10069771 | Ga0207678_100697711 | 182 |
| 721 | 3300026067 | Ga0207678_10079380 | Ga0207678_100793802 | 182 |
| 722 | 3300026067 | Ga0207678_10109411 | Ga0207678_101094112 | 182 |
| 723 | 3300026067 | Ga0207678_10109881 | Ga0207678_101098814 | 182 |
| 724 | 3300026067 | Ga0207678_10334194 | Ga0207678_103341942 | 182 |
| 725 | 3300026067 | Ga0207678_10999165 | Ga0207678_109991652 | 182 |
| 726 | 3300026075 | Ga0207708_10183920 | Ga0207708_101839202 | 182 |
| 727 | 3300026075 | Ga0207708_10908885 | Ga0207708_109088851 | 182 |
| 728 | 3300026075 | Ga0207708_10925574 | Ga0207708_109255741 | 182 |
| 729 | 3300026075 | Ga0207708_10974905 | Ga0207708_109749051 | 182 |
| 730 | 3300026078 | Ga0207702_10079376 | Ga0207702_100793765 | 182 |
| 731 | 3300026088 | Ga0207641_10273614 | Ga0207641_102736142 | 182 |
| 732 | 3300026088 | Ga0207641_10328037 | Ga0207641_103280373 | 182 |
| 733 | 3300026088 | Ga0207641_10459810 | Ga0207641_104598102 | 182 |
| 734 | 3300026088 | Ga0207641_11832556 | Ga0207641_118325561 | 182 |
| 735 | 3300026089 | Ga0207648_10052565 | Ga0207648_100525653 | 182 |
| 736 | 3300026089 | Ga0207648_10090372 | Ga0207648_100903724 | 182 |
| 737 | 3300026089 | Ga0207648_10932079 | Ga0207648_109320792 | 182 |
| 738 | 3300026095 | Ga0207676_10068608 | Ga0207676_100686085 | 182 |
| 739 | 3300026095 | Ga0207676_10127863 | Ga0207676_101278634 | 182 |
| 740 | 3300026095 | Ga0207676_10452614 | Ga0207676_104526142 | 182 |
| 741 | 3300026095 | Ga0207676_10700932 | Ga0207676_107009322 | 182 |
| 742 | 3300026095 | Ga0207676_11265358 | Ga0207676_112653582 | 182 |
| 743 | 3300026118 | Ga0207675_100015313 | Ga0207675_1000153138 | 182 |
| 744 | 3300026118 | Ga0207675_100115027 | Ga0207675_1001150272 | 182 |
| 745 | 3300026118 | Ga0207675_100399899 | Ga0207675_1003998992 | 182 |
| 746 | 3300026118 | Ga0207675_100680119 | Ga0207675_1006801192 | 182 |
| 747 | 3300026118 | Ga0207675_101207895 | Ga0207675_1012078952 | 182 |
| 748 | 3300026121 | Ga0207683_10082409 | Ga0207683_100824092 | 182 |
| 749 | 3300026121 | Ga0207683_10111729 | Ga0207683_101117292 | 182 |
| 750 | 3300026121 | Ga0207683_10304582 | Ga0207683_103045821 | 182 |
| 751 | 3300026142 | Ga0207698_10024589 | Ga0207698_100245895 | 182 |
| 752 | 3300026142 | Ga0207698_10081623 | Ga0207698_100816231 | 182 |
| 753 | 3300026142 | Ga0207698_10208977 | Ga0207698_102089773 | 182 |
| 754 | 3300026142 | Ga0207698_10467902 | Ga0207698_104679022 | 182 |
| 755 | 3300026142 | Ga0207698_10483186 | Ga0207698_104831861 | 182 |
| 756 | 3300027296 | Ga0209389_1000019 | Ga0209389_1000019146 | 182 |
| 757 | 3300027296 | Ga0209389_1000070 | Ga0209389_100007047 | 182 |
| 758 | 3300027357 | Ga0209589_1000420 | Ga0209589_10004203 | 182 |
| 759 | 3300027361 | Ga0209489_100033 | Ga0209489_100033145 | 182 |
| 760 | 3300027361 | Ga0209489_100196 | Ga0209489_10019665 | 182 |
| 761 | 3300027363 | Ga0209700_100012 | Ga0209700_100012223 | 182 |
| 762 | 3300027671 | Ga0209588_1081802 | Ga0209588_10818022 | 182 |
| 763 | 3300027866 | Ga0209813_10215257 | Ga0209813_102152572 | 182 |
| 764 | 3300028379 | Ga0268266_10001750 | Ga0268266_100017502 | 182 |
| 765 | 3300028379 | Ga0268266_10012580 | Ga0268266_100125808 | 182 |
| 766 | 3300028379 | Ga0268266_10020716 | Ga0268266_100207164 | 182 |
| 767 | 3300028379 | Ga0268266_10182525 | Ga0268266_101825252 | 182 |
| 768 | 3300028379 | Ga0268266_10440426 | Ga0268266_104404262 | 182 |
| 769 | 3300028379 | Ga0268266_11062369 | Ga0268266_110623691 | 182 |
| 770 | 3300028380 | Ga0268265_10078508 | Ga0268265_100785082 | 182 |
| 771 | 3300028380 | Ga0268265_10098350 | Ga0268265_100983502 | 182 |
| 772 | 3300028380 | Ga0268265_10182067 | Ga0268265_101820674 | 182 |
| 773 | 3300028380 | Ga0268265_10317928 | Ga0268265_103179282 | 182 |
| 774 | 3300028380 | Ga0268265_11219140 | Ga0268265_112191401 | 182 |
| 775 | 3300028380 | Ga0268265_11260766 | Ga0268265_112607661 | 182 |
| 776 | 3300028381 | Ga0268264_10000042 | Ga0268264_10000042297 | 182 |
| 777 | 3300028381 | Ga0268264_10157436 | Ga0268264_101574362 | 182 |
| 778 | 3300028381 | Ga0268264_10208538 | Ga0268264_102085382 | 182 |
| 779 | 3300028381 | Ga0268264_10484116 | Ga0268264_104841162 | 182 |
| 780 | 3300028381 | Ga0268264_10999100 | Ga0268264_109991002 | 182 |
| 781 | 3300028786 | Ga0307517_10111696 | Ga0307517_101116962 | 182 |
| 782 | 3300028786 | Ga0307517_10319483 | Ga0307517_103194832 | 182 |
| 783 | 3300030521 | Ga0307511_10097830 | Ga0307511_100978303 | 182 |
| 784 | 3300030521 | Ga0307511_10357059 | Ga0307511_103570591 | 182 |
| 785 | 3300030763 | Ga0265763_1003622 | Ga0265763_10036222 | 182 |
| 786 | 3300031235 | Ga0265330_10041534 | Ga0265330_100415342 | 182 |
| 787 | 3300031238 | Ga0265332_10010699 | Ga0265332_100106992 | 182 |
| 788 | 3300031238 | Ga0265332_10069712 | Ga0265332_100697123 | 182 |
| 789 | 3300031241 | Ga0265325_10006203 | Ga0265325_100062034 | 182 |
| 790 | 3300031247 | Ga0265340_10422145 | Ga0265340_104221451 | 182 |
| 791 | 3300031249 | Ga0265339_10058663 | Ga0265339_100586632 | 182 |
| 792 | 3300031456 | Ga0307513_10661935 | Ga0307513_106619352 | 182 |
| 793 | 3300031507 | Ga0307509_10064485 | Ga0307509_100644853 | 182 |
| 794 | 3300031507 | Ga0307509_10145606 | Ga0307509_101456062 | 182 |
| 795 | 3300031507 | Ga0307509_10236279 | Ga0307509_102362793 | 182 |
| 796 | 3300031548 | Ga0307408_100297561 | Ga0307408_1002975612 | 182 |
| 797 | 3300031548 | Ga0307408_101237452 | Ga0307408_1012374521 | 182 |
| 798 | 3300031595 | Ga0265313_10128288 | Ga0265313_101282882 | 182 |
| 799 | 3300031616 | Ga0307508_10000019 | Ga0307508_1000001945 | 182 |
| 800 | 3300031616 | Ga0307508_10028707 | Ga0307508_100287074 | 182 |
| 801 | 3300031616 | Ga0307508_10527312 | Ga0307508_105273121 | 182 |
| 802 | 3300031711 | Ga0265314_10062912 | Ga0265314_100629124 | 182 |
| 803 | 3300031711 | Ga0265314_10101325 | Ga0265314_101013252 | 182 |
| 804 | 3300031712 | Ga0265342_10024875 | Ga0265342_100248752 | 182 |
| 805 | 3300031730 | Ga0307516_10031276 | Ga0307516_100312762 | 182 |
| 806 | 3300031730 | Ga0307516_10222211 | Ga0307516_102222112 | 182 |
| 807 | 3300031730 | Ga0307516_10479814 | Ga0307516_104798142 | 182 |
| 808 | 3300031731 | Ga0307405_10404626 | Ga0307405_104046262 | 182 |
| 809 | 3300031824 | Ga0307413_10046074 | Ga0307413_100460741 | 182 |
| 810 | 3300031852 | Ga0307410_10178068 | Ga0307410_101780683 | 182 |
| 811 | 3300031903 | Ga0307407_11114944 | Ga0307407_111149441 | 182 |
| 812 | 3300032002 | Ga0307416_101070613 | Ga0307416_1010706132 | 182 |
| 813 | 3300032126 | Ga0307415_100152049 | Ga0307415_1001520492 | 182 |
| 814 | 3300033179 | Ga0307507_10027162 | Ga0307507_100271622 | 182 |
| 815 | 3300033180 | Ga0307510_10012956 | Ga0307510_100129567 | 182 |
| 816 | 3300033180 | Ga0307510_10063261 | Ga0307510_100632612 | 182 |
| 817 | 3300033180 | Ga0307510_10212742 | Ga0307510_102127422 | 182 |
| 818 | 3300033544 | Ga0316215_1006075 | Ga0316215_10060752 | 182 |
| 819 | 3300034817 | Ga0373948_0063694 | Ga0373948_0063694_31_579 | 182 |
| 820 | 3300035086 | Ga0373934_0032798 | Ga0373934_0032798_1234_1782 | 182 |
| 821 | 3300035092 | Ga0373952_0017318 | Ga0373952_0017318_88_636 | 182 |
| 822 | 3300035111 | Ga0373923_0001449 | Ga0373923_0001449_1607_2155 | 182 |
| 823 | 3300035111 | Ga0373923_0071395 | Ga0373923_0071395_912_1460 | 182 |
| 824 | 3300035116 | Ga0373945_0274618 | Ga0373945_0274618_150_698 | 182 |
| 825 | 3300035117 | Ga0373953_0020632 | Ga0373953_0020632_970_1518 | 182 |
| 826 | 3300035118 | Ga0373954_0005227 | Ga0373954_0005227_2370_2918 | 182 |
| 827 | 3300035118 | Ga0373954_0024857 | Ga0373954_0024857_563_1111 | 182 |
| 828 | 3300035119 | Ga0373956_0037950 | Ga0373956_0037950_691_1239 | 182 |
| 829 | 3300035170 | Ga0373943_0057731 | Ga0373943_0057731_333_881 | 182 |
| 830 | 3300035171 | Ga0373946_0031993 | Ga0373946_0031993_177_725 | 182 |
| 831 | 3300035172 | Ga0373955_0018171 | Ga0373955_0018171_1574_2122 | 182 |
| 832 | 3300035172 | Ga0373955_0112026 | Ga0373955_0112026_684_1232 | 182 |
| 833 | 3300035410 | Ga0373924_0128840 | Ga0373924_0128840_17_622 | 182 |
| 834 | 3300035691 | Ga0373931_0259862 | Ga0373931_0259862_391_939 | 182 |
| 835 | 3300035692 | Ga0373935_0731878 | Ga0373935_0731878_25_573 | 182 |
| 836 | 3300035695 | Ga0373927_0019061 | Ga0373927_0019061_289_837 | 182 |
| 837 | 3300035695 | Ga0373927_0033776 | Ga0373927_0033776_309_869 | 182 |
| 838 | 3300035724 | Ga0373933_0000063 | Ga0373933_0000063_7599_8147 | 182 |
| 839 | 3300035724 | Ga0373933_0022082 | Ga0373933_0022082_2686_3234 | 182 |
| 840 | 3300035725 | Ga0373947_0010644 | Ga0373947_0010644_3695_4243 | 182 |
| 841 | 3300035725 | Ga0373947_0356258 | Ga0373947_0356258_16_564 | 182 |
| 842 | 3300035725 | Ga0373947_0754854 | Ga0373947_0754854_80_628 | 182 |
| 843 | 3300036401 | Ga0373937_0015969 | Ga0373937_0015969_6049_6597 | 182 |
| 844 | 3300036401 | Ga0373937_0166920 | Ga0373937_0166920_1086_1634 | 182 |
| 845 | 3300036459 | Ga0372808_024717 | Ga0372808_024717_16_564 | 182 |
| 846 | 3300037068 | Ga0373925_0014564 | Ga0373925_0014564_4175_4735 | 182 |
| 847 | 3300037068 | Ga0373925_0031600 | Ga0373925_0031600_2204_2752 | 182 |
| 848 | 3300037068 | Ga0373925_0182921 | Ga0373925_0182921_662_1210 | 182 |
| 849 | 3300037068 | Ga0373925_0663440 | Ga0373925_0663440_172_720 | 182 |
| 850 | 3300037418 | Ga0395900_0257682 | Ga0395900_0257682_107_655 | 182 |
| 851 | 3300037418 | Ga0395900_0467664 | Ga0395900_0467664_465_1013 | 182 |
| 852 | 3300037471 | Ga0395905_0036933 | Ga0395905_0036933_2834_3382 | 182 |
| 853 | 3300037471 | Ga0395905_0141495 | Ga0395905_0141495_1670_2218 | 182 |
| 854 | 3300037471 | Ga0395905_0331798 | Ga0395905_0331798_714_1262 | 182 |
| 855 | 3300038443 | Ga0395901_0181460 | Ga0395901_0181460_1610_2158 | 182 |
| 856 | 3300038443 | Ga0395901_0791282 | Ga0395901_0791282_366_914 | 182 |
| 857 | 3300039438 | Ga0436360_1239273 | Ga0436360_1239273_235_783 | 182 |
| 858 | 3300039447 | Ga0436361_0844543 | Ga0436361_0844543_500_1048 | 182 |
| 859 | 3300039450 | Ga0436363_0375853 | Ga0436363_0375853_530_1078 | 182 |
| 860 | 3300041413 | Ga0439465_0069580 | Ga0439465_0069580_458_1006 | 182 |
| 861 | 3300041451 | Ga0451791_1341753 | Ga0451791_1341753_66_614 | 182 |
| 862 | 3300041456 | Ga0451795_1660820 | Ga0451795_1660820_410_958 | 182 |
| 863 | 3300041460 | Ga0451802_1316910 | Ga0451802_1316910_36_584 | 182 |
| 864 | 3300042012 | Ga0439455_0042423 | Ga0439455_0042423_432_980 | 182 |
| 865 | 3300044656 | Ga0466969_0037060 | Ga0466969_0037060_1726_2274 | 182 |
| 866 | 3300044683 | Ga0466965_0001649 | Ga0466965_0001649_5067_5615 | 182 |
| 867 | 3300044684 | Ga0466966_0437489 | Ga0466966_0437489_146_694 | 182 |
| 868 | 3300044735 | Ga0466968_0177229 | Ga0466968_0177229_106_654 | 182 |
| 869 | 3300045049 | Ga0466959_0093678 | Ga0466959_0093678_1016_1564 | 182 |
| 870 | 3300045049 | Ga0466959_0227168 | Ga0466959_0227168_540_1088 | 182 |
| 871 | 3300045976 | Ga0466967_0006925 | Ga0466967_0006925_3749_4297 | 182 |
| 872 | 3300045976 | Ga0466967_0220271 | Ga0466967_0220271_250_798 | 182 |
| 873 | 3300045976 | Ga0466967_0652546 | Ga0466967_0652546_481_1029 | 182 |
| 874 | 3300045976 | Ga0466967_0731326 | Ga0466967_0731326_362_910 | 182 |
| 875 | 3300045976 | Ga0466967_1313103 | Ga0466967_1313103_96_644 | 182 |
| 876 | 3300046452 | Ga0495617_066080 | Ga0495617_066080_379_927 | 182 |
| 877 | 3300046452 | Ga0495617_075090 | Ga0495617_075090_374_922 | 182 |
| 878 | 3300046454 | Ga0495592_0066237 | Ga0495592_0066237_1587_2135 | 182 |
| 879 | 3300046454 | Ga0495592_0586255 | Ga0495592_0586255_110_658 | 182 |
| 880 | 3300046455 | Ga0495603_0046839 | Ga0495603_0046839_564_1112 | 182 |
| 881 | 3300046455 | Ga0495603_0098426 | Ga0495603_0098426_424_972 | 182 |
| 882 | 3300046455 | Ga0495603_0207647 | Ga0495603_0207647_477_1025 | 182 |
| 883 | 3300046455 | Ga0495603_0308214 | Ga0495603_0308214_97_645 | 182 |
| 884 | 3300046455 | Ga0495603_0481901 | Ga0495603_0481901_101_649 | 182 |
| 885 | 3300046457 | Ga0495590_0116349 | Ga0495590_0116349_29_577 | 182 |
| 886 | 3300046457 | Ga0495590_0216556 | Ga0495590_0216556_90_638 | 182 |
| 887 | 3300046458 | Ga0495591_072731 | Ga0495591_072731_158_706 | 182 |
| 888 | 3300046459 | Ga0495629_0062767 | Ga0495629_0062767_1700_2248 | 182 |
| 889 | 3300046459 | Ga0495629_0063946 | Ga0495629_0063946_1299_1847 | 182 |
| 890 | 3300046459 | Ga0495629_0292168 | Ga0495629_0292168_257_805 | 182 |
| 891 | 3300046460 | Ga0495638_0018594 | Ga0495638_0018594_327_875 | 182 |
| 892 | 3300046460 | Ga0495638_0376603 | Ga0495638_0376603_85_633 | 182 |
| 893 | 3300046461 | Ga0495641_0168302 | Ga0495641_0168302_373_921 | 182 |
| 894 | 3300046461 | Ga0495641_0250126 | Ga0495641_0250126_33_581 | 182 |
| 895 | 3300046462 | Ga0495651_0008281 | Ga0495651_0008281_2747_3295 | 182 |
| 896 | 3300046462 | Ga0495651_0070262 | Ga0495651_0070262_578_1126 | 182 |
| 897 | 3300046463 | Ga0495653_0015404 | Ga0495653_0015404_1628_2176 | 182 |
| 898 | 3300046471 | Ga0495650_0059806 | Ga0495650_0059806_121_669 | 182 |
| 899 | 3300046472 | Ga0495580_0136985 | Ga0495580_0136985_1112_1660 | 182 |
| 900 | 3300046472 | Ga0495580_0261951 | Ga0495580_0261951_338_886 | 182 |
| 901 | 3300046473 | Ga0495582_0039702 | Ga0495582_0039702_514_1062 | 182 |
| 902 | 3300046475 | Ga0495639_0027583 | Ga0495639_0027583_1828_2376 | 182 |
| 903 | 3300046475 | Ga0495639_0172023 | Ga0495639_0172023_443_991 | 182 |
| 904 | 3300046476 | Ga0495662_0067305 | Ga0495662_0067305_384_932 | 182 |
| 905 | 3300046476 | Ga0495662_0174281 | Ga0495662_0174281_184_732 | 182 |
| 906 | 3300046477 | Ga0495664_0006295 | Ga0495664_0006295_545_1093 | 182 |
| 907 | 3300046477 | Ga0495664_0007640 | Ga0495664_0007640_5093_5641 | 182 |
| 908 | 3300046477 | Ga0495664_0040645 | Ga0495664_0040645_968_1516 | 182 |
| 909 | 3300046477 | Ga0495664_0411068 | Ga0495664_0411068_242_790 | 182 |
| 910 | 3300046491 | Ga0495584_0199374 | Ga0495584_0199374_82_630 | 182 |
| 911 | 3300046491 | Ga0495584_0310754 | Ga0495584_0310754_189_737 | 182 |
| 912 | 3300046491 | Ga0495584_0510450 | Ga0495584_0510450_14_562 | 182 |
| 913 | 3300046492 | Ga0495585_0125079 | Ga0495585_0125079_12_560 | 182 |
| 914 | 3300046492 | Ga0495585_0295182 | Ga0495585_0295182_144_692 | 182 |
| 915 | 3300046500 | Ga0495596_0031995 | Ga0495596_0031995_1194_1742 | 182 |
| 916 | 3300046500 | Ga0495596_0037542 | Ga0495596_0037542_348_896 | 182 |
| 917 | 3300046501 | Ga0495607_0079379 | Ga0495607_0079379_1104_1652 | 182 |
| 918 | 3300046501 | Ga0495607_0117166 | Ga0495607_0117166_545_1093 | 182 |
| 919 | 3300046501 | Ga0495607_0126593 | Ga0495607_0126593_442_990 | 182 |
| 920 | 3300046507 | Ga0495606_0034184 | Ga0495606_0034184_786_1334 | 182 |
| 921 | 3300046507 | Ga0495606_0062400 | Ga0495606_0062400_637_1185 | 182 |
| 922 | 3300046507 | Ga0495606_0218832 | Ga0495606_0218832_116_664 | 182 |
| 923 | 3300046511 | Ga0495608_0030647 | Ga0495608_0030647_449_997 | 182 |
| 924 | 3300046511 | Ga0495608_0037928 | Ga0495608_0037928_2000_2548 | 182 |
| 925 | 3300046511 | Ga0495608_0090356 | Ga0495608_0090356_1135_1683 | 182 |
| 926 | 3300046511 | Ga0495608_0131373 | Ga0495608_0131373_603_1151 | 182 |
| 927 | 3300046512 | Ga0495610_0114525 | Ga0495610_0114525_102_650 | 182 |
| 928 | 3300046514 | Ga0495618_0027210 | Ga0495618_0027210_2281_2829 | 182 |
| 929 | 3300046514 | Ga0495618_0159045 | Ga0495618_0159045_135_683 | 182 |
| 930 | 3300046515 | Ga0495620_0124095 | Ga0495620_0124095_49_597 | 182 |
| 931 | 3300046516 | Ga0495628_0012808 | Ga0495628_0012808_1587_2135 | 182 |
| 932 | 3300046516 | Ga0495628_0073069 | Ga0495628_0073069_1151_1699 | 182 |
| 933 | 3300046516 | Ga0495628_0823006 | Ga0495628_0823006_83_631 | 182 |
| 934 | 3300046517 | Ga0495630_0025809 | Ga0495630_0025809_1631_2179 | 182 |
| 935 | 3300046518 | Ga0495631_0076240 | Ga0495631_0076240_257_805 | 182 |
| 936 | 3300046518 | Ga0495631_0178702 | Ga0495631_0178702_71_619 | 182 |
| 937 | 3300046518 | Ga0495631_0278335 | Ga0495631_0278335_34_582 | 182 |
| 938 | 3300046519 | Ga0495632_0336178 | Ga0495632_0336178_32_580 | 182 |
| 939 | 3300046523 | Ga0495644_0106168 | Ga0495644_0106168_353_901 | 182 |
| 940 | 3300046524 | Ga0495648_0065044 | Ga0495648_0065044_883_1431 | 182 |
| 941 | 3300046524 | Ga0495648_0112223 | Ga0495648_0112223_748_1296 | 182 |
| 942 | 3300046524 | Ga0495648_0324407 | Ga0495648_0324407_103_651 | 182 |
| 943 | 3300046526 | Ga0495666_0082498 | Ga0495666_0082498_942_1490 | 182 |
| 944 | 3300046529 | Ga0495652_0008389 | Ga0495652_0008389_5859_6407 | 182 |
| 945 | 3300046529 | Ga0495652_0015423 | Ga0495652_0015423_291_839 | 182 |
| 946 | 3300046529 | Ga0495652_0298760 | Ga0495652_0298760_443_991 | 182 |
| 947 | 3300046531 | Ga0495665_0014869 | Ga0495665_0014869_1047_1595 | 182 |
| 948 | 3300046533 | Ga0495640_0007684 | Ga0495640_0007684_2075_2623 | 182 |
| 949 | 3300046533 | Ga0495640_0069972 | Ga0495640_0069972_189_737 | 182 |
| 950 | 3300046533 | Ga0495640_0122825 | Ga0495640_0122825_366_926 | 182 |
| 951 | 3300046536 | Ga0495587_0004526 | Ga0495587_0004526_2619_3167 | 182 |
| 952 | 3300046536 | Ga0495587_0041752 | Ga0495587_0041752_2017_2565 | 182 |
| 953 | 3300046536 | Ga0495587_0150985 | Ga0495587_0150985_711_1259 | 182 |
| 954 | 3300046537 | Ga0495598_0085115 | Ga0495598_0085115_76_624 | 182 |
| 955 | 3300046538 | Ga0495609_0054630 | Ga0495609_0054630_1129_1677 | 182 |
| 956 | 3300046538 | Ga0495609_0223900 | Ga0495609_0223900_117_665 | 182 |
| 957 | 3300046539 | Ga0495621_0013631 | Ga0495621_0013631_717_1265 | 182 |
| 958 | 3300046557 | Ga0495622_0032380 | Ga0495622_0032380_1578_2126 | 182 |
| 959 | 3300046557 | Ga0495622_0073468 | Ga0495622_0073468_704_1252 | 182 |
| 960 | 3300046557 | Ga0495622_0088900 | Ga0495622_0088900_212_760 | 182 |
| 961 | 3300046558 | Ga0495633_0032239 | Ga0495633_0032239_1367_1915 | 182 |
| 962 | 3300046558 | Ga0495633_0228016 | Ga0495633_0228016_191_739 | 182 |
| 963 | 3300046559 | Ga0495667_0066349 | Ga0495667_0066349_28_576 | 182 |
| 964 | 3300046615 | Ga0495656_0005186 | Ga0495656_0005186_452_1000 | 182 |
| 965 | 3300046615 | Ga0495656_0278278 | Ga0495656_0278278_79_627 | 182 |
| 966 | 3300046615 | Ga0495656_0407025 | Ga0495656_0407025_65_613 | 182 |
| 967 | 3300046616 | Ga0495668_0153560 | Ga0495668_0153560_47_595 | 182 |
| 968 | 3300046616 | Ga0495668_0210281 | Ga0495668_0210281_480_1028 | 182 |
| 969 | 3300046642 | Ga0495634_0042931 | Ga0495634_0042931_515_1063 | 182 |
| 970 | 3300046642 | Ga0495634_0139915 | Ga0495634_0139915_855_1403 | 182 |
| 971 | 3300046648 | Ga0495611_0307394 | Ga0495611_0307394_161_709 | 182 |
| 972 | 3300046660 | Ga0495625_0181455 | Ga0495625_0181455_708_1256 | 182 |
| 973 | 3300046660 | Ga0495625_0222170 | Ga0495625_0222170_400_948 | 182 |
| 974 | 3300046660 | Ga0495625_0253983 | Ga0495625_0253983_440_988 | 182 |
| 975 | 3300046660 | Ga0495625_0346260 | Ga0495625_0346260_378_926 | 182 |
| 976 | 3300046660 | Ga0495625_0453145 | Ga0495625_0453145_148_696 | 182 |
| 977 | 3300046663 | Ga0495635_0038939 | Ga0495635_0038939_1894_2442 | 182 |
| 978 | 3300046663 | Ga0495635_0066373 | Ga0495635_0066373_1368_1916 | 182 |
| 979 | 3300046663 | Ga0495635_0245259 | Ga0495635_0245259_643_1191 | 182 |
| 980 | 3300046664 | Ga0495659_0012114 | Ga0495659_0012114_1843_2391 | 182 |
| 981 | 3300046665 | Ga0495661_0192003 | Ga0495661_0192003_436_984 | 182 |
| 982 | 3300046674 | Ga0495588_0002970 | Ga0495588_0002970_1125_1673 | 182 |
| 983 | 3300046675 | Ga0495657_0004660 | Ga0495657_0004660_8691_9239 | 182 |
| 984 | 3300046675 | Ga0495657_0007028 | Ga0495657_0007028_5153_5701 | 182 |
| 985 | 3300046675 | Ga0495657_0058516 | Ga0495657_0058516_1562_2110 | 182 |
| 986 | 3300046678 | Ga0495599_0003699 | Ga0495599_0003699_6740_7288 | 182 |
| 987 | 3300046678 | Ga0495599_0004338 | Ga0495599_0004338_7527_8075 | 182 |
| 988 | 3300046679 | Ga0495623_0003278 | Ga0495623_0003278_5459_6007 | 182 |
| 989 | 3300046679 | Ga0495623_0003743 | Ga0495623_0003743_2670_3218 | 182 |
| 990 | 3300046679 | Ga0495623_0331496 | Ga0495623_0331496_69_617 | 182 |
| 991 | 3300046680 | Ga0495646_0010569 | Ga0495646_0010569_1543_2091 | 182 |
| 992 | 3300046680 | Ga0495646_0028033 | Ga0495646_0028033_1989_2537 | 182 |
| 993 | 3300046681 | Ga0495647_0032616 | Ga0495647_0032616_146_694 | 182 |
| 994 | 3300046681 | Ga0495647_0331069 | Ga0495647_0331069_129_677 | 182 |
| 995 | 3300046683 | Ga0495658_0007910 | Ga0495658_0007910_1168_1716 | 182 |
| 996 | 3300046684 | Ga0495669_0011303 | Ga0495669_0011303_1667_2215 | 182 |
| 997 | 3300046684 | Ga0495669_0142073 | Ga0495669_0142073_200_748 | 182 |
| 998 | 3300046689 | Ga0495613_0373748 | Ga0495613_0373748_324_872 | 182 |
| 999 | 3300046690 | Ga0495624_0083074 | Ga0495624_0083074_956_1504 | 182 |
| 1000 | 3300046690 | Ga0495624_0115589 | Ga0495624_0115589_177_725 | 182 |
| 1001 | 3300046694 | Ga0495649_0034578 | Ga0495649_0034578_1103_1651 | 182 |
| 1002 | 3300046694 | Ga0495649_0230755 | Ga0495649_0230755_29_577 | 182 |
| 1003 | 3300046694 | Ga0495649_0516047 | Ga0495649_0516047_35_583 | 182 |
| 1004 | 3300046794 | Ga0495589_0393543 | Ga0495589_0393543_16_564 | 182 |
| 1005 | 3300046809 | Ga0495600_0008553 | Ga0495600_0008553_4663_5211 | 182 |
| 1006 | 3300046809 | Ga0495600_0032974 | Ga0495600_0032974_1693_2241 | 182 |
| 1007 | 3300046809 | Ga0495600_0207430 | Ga0495600_0207430_169_717 | 182 |
| 1008 | 3300046810 | Ga0495660_0281799 | Ga0495660_0281799_113_661 | 182 |
| 1009 | 3300047315 | Ga0495581_0025228 | Ga0495581_0025228_1620_2168 | 182 |
| 1010 | 3300047315 | Ga0495581_0151802 | Ga0495581_0151802_37_585 | 182 |
| 1011 | 3300047317 | Ga0495604_0011018 | Ga0495604_0011018_1235_1783 | 182 |
| 1012 | 3300047317 | Ga0495604_0089032 | Ga0495604_0089032_1629_2177 | 182 |
| 1013 | 3300047319 | Ga0495674_0003624 | Ga0495674_0003624_5932_6480 | 182 |
| 1014 | 3300047319 | Ga0495674_0026977 | Ga0495674_0026977_1171_1719 | 182 |
| 1015 | 3300047319 | Ga0495674_0314800 | Ga0495674_0314800_221_769 | 182 |
| 1016 | 3300047319 | Ga0495674_0373135 | Ga0495674_0373135_423_971 | 182 |
| 1017 | 3300047320 | Ga0495672_0031547 | Ga0495672_0031547_1689_2237 | 182 |
| 1018 | 3300047320 | Ga0495672_0077853 | Ga0495672_0077853_1105_1653 | 182 |
| 1019 | 3300047321 | Ga0495676_0073366 | Ga0495676_0073366_1052_1600 | 182 |
| 1020 | 3300047321 | Ga0495676_0219164 | Ga0495676_0219164_181_729 | 182 |
| 1021 | 3300047321 | Ga0495676_0556659 | Ga0495676_0556659_185_733 | 182 |
| 1022 | 3300047322 | Ga0495680_0021316 | Ga0495680_0021316_1436_1984 | 182 |
| 1023 | 3300047322 | Ga0495680_0063648 | Ga0495680_0063648_1682_2230 | 182 |
| 1024 | 3300047322 | Ga0495680_0390104 | Ga0495680_0390104_98_658 | 182 |
| 1025 | 3300047323 | Ga0495683_0266808 | Ga0495683_0266808_49_597 | 182 |
| 1026 | 3300047444 | Ga0495675_0054298 | Ga0495675_0054298_325_873 | 182 |
| 1027 | 3300047444 | Ga0495675_0167543 | Ga0495675_0167543_741_1289 | 182 |
| 1028 | 3300047445 | Ga0495677_0016237 | Ga0495677_0016237_1260_1808 | 182 |
| 1029 | 3300047469 | Ga0495673_0027590 | Ga0495673_0027590_1998_2546 | 182 |
| 1030 | 3300047469 | Ga0495673_0116220 | Ga0495673_0116220_436_984 | 182 |
| 1031 | 3300047469 | Ga0495673_0162606 | Ga0495673_0162606_230_778 | 182 |
| 1032 | 3300047469 | Ga0495673_0194194 | Ga0495673_0194194_101_649 | 182 |
| 1033 | 3300047471 | Ga0495684_0144787 | Ga0495684_0144787_142_690 | 182 |
| 1034 | 3300047472 | Ga0495686_0022800 | Ga0495686_0022800_3146_3694 | 182 |
| 1035 | 3300047472 | Ga0495686_0092187 | Ga0495686_0092187_788_1336 | 182 |
| 1036 | 3300047472 | Ga0495686_0137307 | Ga0495686_0137307_866_1414 | 182 |
| 1037 | 3300047472 | Ga0495686_0205080 | Ga0495686_0205080_61_609 | 182 |
| 1038 | 3300047673 | Ga0495593_0080074 | Ga0495593_0080074_1093_1641 | 182 |
| 1039 | 3300047673 | Ga0495593_0153827 | Ga0495593_0153827_86_634 | 182 |
| 1040 | 3300048088 | Ga0495602_0009817 | Ga0495602_0009817_7236_7784 | 182 |
| 1041 | 3300048088 | Ga0495602_0030956 | Ga0495602_0030956_4306_4854 | 182 |
| 1042 | 3300048090 | Ga0495615_0072732 | Ga0495615_0072732_291_839 | 182 |
| 1043 | 3300048903 | Ga0496100_0025148 | Ga0496100_0025148_1745_2293 | 182 |
| 1044 | 3300048903 | Ga0496100_0073207 | Ga0496100_0073207_728_1276 | 182 |
| 1045 | 3300048903 | Ga0496100_0133391 | Ga0496100_0133391_929_1477 | 182 |
| 1046 | 3300048903 | Ga0496100_0156872 | Ga0496100_0156872_695_1243 | 182 |
| 1047 | 3300048903 | Ga0496100_0425267 | Ga0496100_0425267_70_618 | 182 |
| 1048 | 3300048903 | Ga0496100_0522323 | Ga0496100_0522323_265_813 | 182 |
| 1049 | 3300048904 | Ga0496101_0066084 | Ga0496101_0066084_527_1075 | 182 |
| 1050 | 3300048904 | Ga0496101_0125304 | Ga0496101_0125304_734_1282 | 182 |
| 1051 | 3300048904 | Ga0496101_0129051 | Ga0496101_0129051_1317_1865 | 182 |
| 1052 | 3300048904 | Ga0496101_0141529 | Ga0496101_0141529_442_990 | 182 |
| 1053 | 3300048904 | Ga0496101_0309829 | Ga0496101_0309829_459_1007 | 182 |
| 1054 | 3300048904 | Ga0496101_0637172 | Ga0496101_0637172_110_658 | 182 |
| 1055 | 3300048905 | Ga0496102_0011346 | Ga0496102_0011346_5827_6375 | 182 |
| 1056 | 3300048905 | Ga0496102_0014546 | Ga0496102_0014546_1708_2256 | 182 |
| 1057 | 3300048905 | Ga0496102_0129342 | Ga0496102_0129342_727_1275 | 182 |
| 1058 | 3300048905 | Ga0496102_0160421 | Ga0496102_0160421_400_948 | 182 |
| 1059 | 3300048905 | Ga0496102_0229966 | Ga0496102_0229966_475_1023 | 182 |
| 1060 | 3300048905 | Ga0496102_0908406 | Ga0496102_0908406_228_776 | 182 |
| 1061 | 3300048906 | Ga0496103_0047445 | Ga0496103_0047445_837_1385 | 182 |
| 1062 | 3300048906 | Ga0496103_0239888 | Ga0496103_0239888_134_682 | 182 |
| 1063 | 3300048907 | Ga0496104_0008837 | Ga0496104_0008837_1598_2146 | 182 |
| 1064 | 3300048907 | Ga0496104_0016671 | Ga0496104_0016671_2406_2954 | 182 |
| 1065 | 3300048907 | Ga0496104_0053104 | Ga0496104_0053104_2063_2611 | 182 |
| 1066 | 3300048907 | Ga0496104_0400116 | Ga0496104_0400116_372_920 | 182 |
| 1067 | 3300048908 | Ga0496105_0004610 | Ga0496105_0004610_1192_1740 | 182 |
| 1068 | 3300048908 | Ga0496105_0010647 | Ga0496105_0010647_3446_3994 | 182 |
| 1069 | 3300048908 | Ga0496105_0157233 | Ga0496105_0157233_1080_1628 | 182 |
| 1070 | 3300048908 | Ga0496105_0417425 | Ga0496105_0417425_236_784 | 182 |
| 1071 | 3300048909 | Ga0496106_0000686 | Ga0496106_0000686_20975_21523 | 182 |
| 1072 | 3300048909 | Ga0496106_0018004 | Ga0496106_0018004_1844_2392 | 182 |
| 1073 | 3300048909 | Ga0496106_0045929 | Ga0496106_0045929_693_1241 | 182 |
| 1074 | 3300048909 | Ga0496106_0264207 | Ga0496106_0264207_174_722 | 182 |
| 1075 | 3300048909 | Ga0496106_0952757 | Ga0496106_0952757_108_656 | 182 |
| 1076 | 3300048910 | Ga0496107_0002437 | Ga0496107_0002437_1414_1962 | 182 |
| 1077 | 3300048910 | Ga0496107_0050506 | Ga0496107_0050506_422_970 | 182 |
| 1078 | 3300048910 | Ga0496107_0221256 | Ga0496107_0221256_43_591 | 182 |
| 1079 | 3300048910 | Ga0496107_0258987 | Ga0496107_0258987_503_1051 | 182 |
| 1080 | 3300048911 | Ga0496108_0025485 | Ga0496108_0025485_3154_3702 | 182 |
| 1081 | 3300048911 | Ga0496108_0044102 | Ga0496108_0044102_778_1326 | 182 |
| 1082 | 3300048911 | Ga0496108_0410083 | Ga0496108_0410083_451_999 | 182 |
| 1083 | 3300048911 | Ga0496108_0749129 | Ga0496108_0749129_112_660 | 182 |
| 1084 | 3300048911 | Ga0496108_0852258 | Ga0496108_0852258_131_679 | 182 |
| 1085 | 3300048912 | Ga0496109_0003924 | Ga0496109_0003924_384_932 | 182 |
| 1086 | 3300048912 | Ga0496109_0045827 | Ga0496109_0045827_1830_2378 | 182 |
| 1087 | 3300048912 | Ga0496109_0165052 | Ga0496109_0165052_1048_1596 | 182 |
| 1088 | 3300048912 | Ga0496109_0233844 | Ga0496109_0233844_928_1476 | 182 |
| 1089 | 3300048913 | Ga0496110_0089556 | Ga0496110_0089556_363_911 | 182 |
| 1090 | 3300048913 | Ga0496110_0209409 | Ga0496110_0209409_740_1288 | 182 |
| 1091 | 3300048914 | Ga0496111_0035774 | Ga0496111_0035774_964_1512 | 182 |
| 1092 | 3300048914 | Ga0496111_0097953 | Ga0496111_0097953_883_1431 | 182 |
| 1093 | 3300048914 | Ga0496111_0288787 | Ga0496111_0288787_299_847 | 182 |
| 1094 | 3300048914 | Ga0496111_0340517 | Ga0496111_0340517_398_946 | 182 |
| 1095 | 3300048914 | Ga0496111_0608327 | Ga0496111_0608327_205_753 | 182 |
| 1096 | 3300048915 | Ga0496112_0006770 | Ga0496112_0006770_7742_8290 | 182 |
| 1097 | 3300048915 | Ga0496112_0051032 | Ga0496112_0051032_1790_2338 | 182 |
| 1098 | 3300048915 | Ga0496112_0148125 | Ga0496112_0148125_1255_1803 | 182 |
| 1099 | 3300048916 | Ga0496113_0044120 | Ga0496113_0044120_2023_2571 | 182 |
| 1100 | 3300048916 | Ga0496113_0093280 | Ga0496113_0093280_1124_1672 | 182 |
| 1101 | 3300048916 | Ga0496113_0260109 | Ga0496113_0260109_731_1279 | 182 |
| 1102 | 3300048917 | Ga0496114_0008237 | Ga0496114_0008237_5745_6293 | 182 |
| 1103 | 3300048917 | Ga0496114_0058373 | Ga0496114_0058373_1336_1884 | 182 |
| 1104 | 3300048917 | Ga0496114_0061251 | Ga0496114_0061251_913_1461 | 182 |
| 1105 | 3300048917 | Ga0496114_0453507 | Ga0496114_0453507_559_1107 | 182 |
| 1106 | 3300048918 | Ga0496115_0004137 | Ga0496115_0004137_5907_6455 | 182 |
| 1107 | 3300048918 | Ga0496115_0038906 | Ga0496115_0038906_1344_1892 | 182 |
| 1108 | 3300048918 | Ga0496115_0070621 | Ga0496115_0070621_1692_2240 | 182 |
| 1109 | 3300048918 | Ga0496115_0073684 | Ga0496115_0073684_1254_1802 | 182 |
| 1110 | 3300048918 | Ga0496115_0457806 | Ga0496115_0457806_307_855 | 182 |
| 1111 | 3300048918 | Ga0496115_0562589 | Ga0496115_0562589_11_559 | 182 |
| 1112 | 3300048918 | Ga0496115_0909291 | Ga0496115_0909291_74_622 | 182 |
| 1113 | 3300048919 | Ga0496116_0051720 | Ga0496116_0051720_1042_1590 | 182 |
| 1114 | 3300048919 | Ga0496116_0146804 | Ga0496116_0146804_730_1278 | 182 |
| 1115 | 3300048919 | Ga0496116_0349303 | Ga0496116_0349303_41_589 | 182 |
| 1116 | 3300048920 | Ga0496117_0099835 | Ga0496117_0099835_976_1524 | 182 |
| 1117 | 3300048920 | Ga0496117_0212196 | Ga0496117_0212196_457_1005 | 182 |
| 1118 | 3300048921 | Ga0496118_0002254 | Ga0496118_0002254_21004_21552 | 182 |
| 1119 | 3300048921 | Ga0496118_0066683 | Ga0496118_0066683_131_679 | 182 |
| 1120 | 3300048921 | Ga0496118_0207120 | Ga0496118_0207120_578_1126 | 182 |
| 1121 | 3300048922 | Ga0496119_0028316 | Ga0496119_0028316_1571_2119 | 182 |
| 1122 | 3300048922 | Ga0496119_0060196 | Ga0496119_0060196_818_1366 | 182 |
| 1123 | 3300048922 | Ga0496119_0146391 | Ga0496119_0146391_524_1072 | 182 |
| 1124 | 3300048923 | Ga0496120_0025120 | Ga0496120_0025120_2452_3000 | 182 |
| 1125 | 3300048923 | Ga0496120_0026454 | Ga0496120_0026454_1403_1951 | 182 |
| 1126 | 3300048923 | Ga0496120_0252140 | Ga0496120_0252140_217_765 | 182 |
| 1127 | 3300048924 | Ga0496121_0000418 | Ga0496121_0000418_65348_65896 | 182 |
| 1128 | 3300048924 | Ga0496121_0002936 | Ga0496121_0002936_3181_3729 | 182 |
| 1129 | 3300048924 | Ga0496121_0069154 | Ga0496121_0069154_391_939 | 182 |
| 1130 | 3300048924 | Ga0496121_0089141 | Ga0496121_0089141_1623_2171 | 182 |
| 1131 | 3300048924 | Ga0496121_0094832 | Ga0496121_0094832_1758_2306 | 182 |
| 1132 | 3300048924 | Ga0496121_0105044 | Ga0496121_0105044_646_1194 | 182 |
| 1133 | 3300048924 | Ga0496121_0165237 | Ga0496121_0165237_778_1326 | 182 |
| 1134 | 3300048924 | Ga0496121_0187326 | Ga0496121_0187326_825_1385 | 182 |
| 1135 | 3300048924 | Ga0496121_0471870 | Ga0496121_0471870_134_682 | 182 |
| 1136 | 3300048925 | Ga0496122_0060272 | Ga0496122_0060272_698_1246 | 182 |
| 1137 | 3300048927 | Ga0496124_0013566 | Ga0496124_0013566_2551_3099 | 182 |
| 1138 | 3300048927 | Ga0496124_0352026 | Ga0496124_0352026_116_664 | 182 |
| 1139 | 3300048927 | Ga0496124_0447110 | Ga0496124_0447110_283_831 | 182 |
| 1140 | 3300048927 | Ga0496124_0673290 | Ga0496124_0673290_79_627 | 182 |
| 1141 | 3300048928 | Ga0496125_0079515 | Ga0496125_0079515_1600_2148 | 182 |
| 1142 | 3300048928 | Ga0496125_0326424 | Ga0496125_0326424_20_568 | 182 |
| 1143 | 3300048928 | Ga0496125_0556472 | Ga0496125_0556472_57_605 | 182 |
| 1144 | 3300048929 | Ga0496126_0014146 | Ga0496126_0014146_5385_5933 | 182 |
| 1145 | 3300048929 | Ga0496126_0059646 | Ga0496126_0059646_1360_1908 | 182 |
| 1146 | 3300048929 | Ga0496126_0067084 | Ga0496126_0067084_1185_1733 | 182 |
| 1147 | 3300048929 | Ga0496126_0085351 | Ga0496126_0085351_570_1118 | 182 |
| 1148 | 3300048929 | Ga0496126_0085769 | Ga0496126_0085769_85_645 | 182 |
| 1149 | 3300048929 | Ga0496126_0112964 | Ga0496126_0112964_504_1052 | 182 |
| 1150 | 3300048929 | Ga0496126_0223051 | Ga0496126_0223051_1021_1569 | 182 |
| 1151 | 3300048929 | Ga0496126_0292524 | Ga0496126_0292524_597_1145 | 182 |
| 1152 | 3300048929 | Ga0496126_0564181 | Ga0496126_0564181_193_741 | 182 |
| 1153 | 3300048929 | Ga0496126_0621626 | Ga0496126_0621626_61_621 | 182 |
| 1154 | 3300048929 | Ga0496126_0624353 | Ga0496126_0624353_151_699 | 182 |
| 1155 | 3300049459 | Ga0495678_048931 | Ga0495678_048931_1055_1603 | 182 |
| 1156 | 3300049460 | Ga0495682_0025714 | Ga0495682_0025714_213_761 | 182 |
| 1157 | 3300049460 | Ga0495682_0183012 | Ga0495682_0183012_181_729 | 182 |
| 1158 | 3300049569 | Ga0501032_0147452 | Ga0501032_0147452_960_1508 | 182 |
| 1159 | 3300049570 | Ga0501033_0046533 | Ga0501033_0046533_2087_2635 | 182 |
| 1160 | 3300049570 | Ga0501033_0528186 | Ga0501033_0528186_162_710 | 182 |
| 1161 | 3300049572 | Ga0501036_0280472 | Ga0501036_0280472_47_595 | 182 |
| 1162 | 3300049574 | Ga0501038_0492247 | Ga0501038_0492247_302_850 | 182 |
| 1163 | 3300049574 | Ga0501038_0833650 | Ga0501038_0833650_26_574 | 182 |
| 1164 | 3300049578 | Ga0501042_0204330 | Ga0501042_0204330_164_712 | 182 |
| 1165 | 3300049579 | Ga0501043_0217688 | Ga0501043_0217688_40_588 | 182 |
| 1166 | 3300049580 | Ga0501046_0098652 | Ga0501046_0098652_445_993 | 182 |
| 1167 | 3300049580 | Ga0501046_0224021 | Ga0501046_0224021_220_768 | 182 |
| 1168 | 3300049581 | Ga0501047_0245365 | Ga0501047_0245365_823_1371 | 182 |
| 1169 | 3300049581 | Ga0501047_0800163 | Ga0501047_0800163_129_677 | 182 |
| 1170 | 3300049583 | Ga0501067_0376761 | Ga0501067_0376761_92_640 | 182 |
| 1171 | 3300049584 | Ga0501068_0377371 | Ga0501068_0377371_268_816 | 182 |
| 1172 | 3300049589 | Ga0501073_0385148 | Ga0501073_0385148_47_595 | 182 |
| 1173 | 3300049741 | Ga0501079_0587908 | Ga0501079_0587908_283_831 | 182 |
| 1174 | 3300049742 | Ga0501080_0269278 | Ga0501080_0269278_401_949 | 182 |
| 1175 | 3300049824 | Ga0501045_0277812 | Ga0501045_0277812_560_1108 | 182 |
| 1176 | 3300050490 | nmdc:mga03n38_50730_c1 | nmdc:mga03n38_50730_c1_969_1517 | 182 |
| 1177 | 3300050491 | nmdc:mga00v17_60702_c1 | nmdc:mga00v17_60702_c1_1610_2158 | 182 |
| 1178 | 3300050492 | nmdc:mga0yw44_127605_c1 | nmdc:mga0yw44_127605_c1_585_1133 | 182 |
| 1179 | 3300050492 | nmdc:mga0yw44_202907_c1 | nmdc:mga0yw44_202907_c1_677_1225 | 182 |
| 1180 | 3300050492 | nmdc:mga0yw44_58600_c1 | nmdc:mga0yw44_58600_c1_570_1118 | 182 |
| 1181 | 3300050492 | nmdc:mga0yw44_658171_c1 | nmdc:mga0yw44_658171_c1_143_691 | 182 |
| 1182 | 3300050492 | nmdc:mga0yw44_91492_c1 | nmdc:mga0yw44_91492_c1_1200_1748 | 182 |
| 1183 | 3300050492 | nmdc:mga0yw44_99297_c1 | nmdc:mga0yw44_99297_c1_61_609 | 182 |
| 1184 | 3300050493 | nmdc:mga0k408_141336_c1 | nmdc:mga0k408_141336_c1_160_708 | 182 |
| 1185 | 3300050493 | nmdc:mga0k408_31373_c1 | nmdc:mga0k408_31373_c1_1937_2485 | 182 |
| 1186 | 3300050493 | nmdc:mga0k408_423327_c1 | nmdc:mga0k408_423327_c1_105_653 | 182 |
| 1187 | 3300050493 | nmdc:mga0k408_447766_c1 | nmdc:mga0k408_447766_c1_157_705 | 182 |
| 1188 | 3300050494 | nmdc:mga06z11_118819_c1 | nmdc:mga06z11_118819_c1_744_1292 | 182 |
| 1189 | 3300050494 | nmdc:mga06z11_535315_c1 | nmdc:mga06z11_535315_c1_137_685 | 182 |
| 1190 | 3300050494 | nmdc:mga06z11_70679_c1 | nmdc:mga06z11_70679_c1_443_991 | 182 |
| 1191 | 3300050494 | nmdc:mga06z11_71378_c1 | nmdc:mga06z11_71378_c1_402_950 | 182 |
| 1192 | 3300050496 | nmdc:mga07m45_15195_c1 | nmdc:mga07m45_15195_c1_2221_2769 | 182 |
| 1193 | 3300050496 | nmdc:mga07m45_54820_c1 | nmdc:mga07m45_54820_c1_1107_1655 | 182 |
| 1194 | 3300050507 | nmdc:mga05p37_625615_c1 | nmdc:mga05p37_625615_c1_40_588 | 182 |
| 1195 | 3300050511 | nmdc:mga08y16_608506_c1 | nmdc:mga08y16_608506_c1_157_705 | 182 |
| 1196 | 3300050512 | nmdc:mga0n895_92585_c1 | nmdc:mga0n895_92585_c1_1416_1964 | 182 |
| 1197 | 3300050513 | nmdc:mga0rr50_190052_c1 | nmdc:mga0rr50_190052_c1_680_1228 | 182 |
| 1198 | 3300050514 | nmdc:mga08x19_226641_c1 | nmdc:mga08x19_226641_c1_422_970 | 182 |
| 1199 | 3300050516 | nmdc:mga0sz30_12995_c1 | nmdc:mga0sz30_12995_c1_775_1323 | 182 |
| 1200 | 3300053077 | Ga0495601_0006668 | Ga0495601_0006668_1815_2363 | 182 |
| 1201 | 3300053077 | Ga0495601_0458751 | Ga0495601_0458751_95_643 | 182 |
| 1202 | 3300053077 | Ga0495601_0636049 | Ga0495601_0636049_81_629 | 182 |
| 1203 | 3300053078 | Ga0495612_0017107 | Ga0495612_0017107_1112_1660 | 182 |
| 1204 | 3300053078 | Ga0495612_0020652 | Ga0495612_0020652_242_790 | 182 |
| 1205 | 3300053078 | Ga0495612_0057198 | Ga0495612_0057198_884_1432 | 182 |
| 1206 | 3300053080 | Ga0500635_0008731 | Ga0500635_0008731_330_878 | 182 |
| 1207 | 3300053080 | Ga0500635_0027860 | Ga0500635_0027860_877_1425 | 182 |
| 1208 | 3300053083 | Ga0495655_0032705 | Ga0495655_0032705_332_880 | 182 |
| 1209 | 3300053084 | Ga0495595_0003659 | Ga0495595_0003659_5496_6044 | 182 |
| 1210 | 3300053085 | Ga0495619_0127330 | Ga0495619_0127330_479_1027 | 182 |
| 1211 | 3300053086 | Ga0500578_0225374 | Ga0500578_0225374_365_913 | 182 |
| 1212 | 3300053086 | Ga0500578_0374342 | Ga0500578_0374342_262_810 | 182 |
| 1213 | 3300053086 | Ga0500578_0427379 | Ga0500578_0427379_188_736 | 182 |
| 1214 | 3300053087 | Ga0500643_000013 | Ga0500643_000013_290214_290762 | 182 |
| 1215 | 3300053087 | Ga0500643_031899 | Ga0500643_031899_850_1398 | 182 |
| 1216 | 3300053091 | Ga0500647_0025467 | Ga0500647_0025467_2123_2671 | 182 |
| 1217 | 3300053092 | Ga0500583_0021956 | Ga0500583_0021956_1484_2032 | 182 |
| 1218 | 3300053094 | Ga0500566_0001097 | Ga0500566_0001097_9953_10501 | 182 |
| 1219 | 3300053094 | Ga0500566_0165914 | Ga0500566_0165914_558_1118 | 182 |
| 1220 | 3300053094 | Ga0500566_0201950 | Ga0500566_0201950_55_603 | 182 |
| 1221 | 3300053094 | Ga0500566_0253961 | Ga0500566_0253961_43_591 | 182 |
| 1222 | 3300053095 | Ga0500640_011592 | Ga0500640_011592_1026_1619 | 182 |
| 1223 | 3300053096 | Ga0500641_0024104 | Ga0500641_0024104_952_1500 | 182 |
| 1224 | 3300053096 | Ga0500641_0063860 | Ga0500641_0063860_914_1462 | 182 |
| 1225 | 3300053102 | Ga0500554_051934 | Ga0500554_051934_43_591 | 182 |
| 1226 | 3300053103 | Ga0500555_002043 | Ga0500555_002043_1437_1985 | 182 |
| 1227 | 3300053105 | Ga0500557_000030 | Ga0500557_000030_36062_36610 | 182 |
| 1228 | 3300053108 | Ga0500562_081766 | Ga0500562_081766_147_695 | 182 |
| 1229 | 3300053109 | Ga0500569_000335 | Ga0500569_000335_3709_4257 | 182 |
| 1230 | 3300053109 | Ga0500569_034409 | Ga0500569_034409_180_728 | 182 |
| 1231 | 3300053111 | Ga0500572_000564 | Ga0500572_000564_2271_2864 | 182 |
| 1232 | 3300053115 | Ga0500591_101917 | Ga0500591_101917_447_1040 | 182 |
| 1233 | 3300053118 | Ga0500594_0053729 | Ga0500594_0053729_547_1095 | 182 |
| 1234 | 3300053119 | Ga0500595_004179 | Ga0500595_004179_2997_3545 | 182 |
| 1235 | 3300053119 | Ga0500595_020224 | Ga0500595_020224_1415_1975 | 182 |
| 1236 | 3300053119 | Ga0500595_086750 | Ga0500595_086750_11_559 | 182 |
| 1237 | 3300053122 | Ga0500608_043507 | Ga0500608_043507_665_1258 | 182 |
| 1238 | 3300053123 | Ga0500614_001304 | Ga0500614_001304_402_995 | 182 |
| 1239 | 3300053128 | Ga0500626_077751 | Ga0500626_077751_737_1285 | 182 |
| 1240 | 3300053130 | Ga0500642_0001580 | Ga0500642_0001580_4381_4929 | 182 |
| 1241 | 3300053130 | Ga0500642_0102946 | Ga0500642_0102946_510_1058 | 182 |
| 1242 | 3300053130 | Ga0500642_0172867 | Ga0500642_0172867_183_731 | 182 |
| 1243 | 3300053133 | Ga0500655_021885 | Ga0500655_021885_448_996 | 182 |
| 1244 | 3300053133 | Ga0500655_081654 | Ga0500655_081654_35_583 | 182 |
| 1245 | 3300053134 | Ga0500658_0368940 | Ga0500658_0368940_38_586 | 182 |
| 1246 | 3300053136 | Ga0500559_0002228 | Ga0500559_0002228_7069_7662 | 182 |
| 1247 | 3300053136 | Ga0500559_0006528 | Ga0500559_0006528_2521_3069 | 182 |
| 1248 | 3300053142 | Ga0500577_0057543 | Ga0500577_0057543_493_1041 | 182 |
| 1249 | 3300053142 | Ga0500577_0088701 | Ga0500577_0088701_554_1102 | 182 |
| 1250 | 3300053146 | Ga0500588_0169645 | Ga0500588_0169645_206_754 | 182 |
| 1251 | 3300053148 | Ga0500590_042681 | Ga0500590_042681_867_1460 | 182 |
| 1252 | 3300053148 | Ga0500590_058776 | Ga0500590_058776_238_786 | 182 |
| 1253 | 3300053150 | Ga0500603_001009 | Ga0500603_001009_993_1586 | 182 |
| 1254 | 3300053150 | Ga0500603_155260 | Ga0500603_155260_87_647 | 182 |
| 1255 | 3300053151 | Ga0500604_0055264 | Ga0500604_0055264_484_1032 | 182 |
| 1256 | 3300053153 | Ga0500616_0050783 | Ga0500616_0050783_1618_2166 | 182 |
| 1257 | 3300053156 | Ga0500622_0006329 | Ga0500622_0006329_1802_2350 | 182 |
| 1258 | 3300053156 | Ga0500622_0180231 | Ga0500622_0180231_371_919 | 182 |
| 1259 | 3300053157 | Ga0500624_016763 | Ga0500624_016763_365_958 | 182 |
| 1260 | 3300053158 | Ga0500627_0216478 | Ga0500627_0216478_135_683 | 182 |
| 1261 | 3300053158 | Ga0500627_0361846 | Ga0500627_0361846_12_560 | 182 |
| 1262 | 3300053159 | Ga0500630_034670 | Ga0500630_034670_156_749 | 182 |
| 1263 | 3300053161 | Ga0500634_0146500 | Ga0500634_0146500_454_1002 | 182 |
| 1264 | 3300053162 | Ga0500638_081586 | Ga0500638_081586_366_926 | 182 |
| 1265 | 3300053162 | Ga0500638_316079 | Ga0500638_316079_19_567 | 182 |
| 1266 | 3300053163 | Ga0500639_000006 | Ga0500639_000006_35418_36011 | 182 |
| 1267 | 3300053163 | Ga0500639_203396 | Ga0500639_203396_212_760 | 182 |
| 1268 | 3300053177 | Ga0500636_0002456 | Ga0500636_0002456_7775_8323 | 182 |
| 1269 | 3300053177 | Ga0500636_0033974 | Ga0500636_0033974_1237_1785 | 182 |
| 1270 | 3300053177 | Ga0500636_0183865 | Ga0500636_0183865_277_825 | 182 |
| 1271 | 3300053178 | Ga0500637_0055570 | Ga0500637_0055570_876_1424 | 182 |
| 1272 | 3300053178 | Ga0500637_0083616 | Ga0500637_0083616_744_1292 | 182 |
| 1273 | 3300053727 | Ga0500611_015747 | Ga0500611_015747_439_987 | 182 |
| 1274 | 3300053730 | Ga0500645_048655 | Ga0500645_048655_519_1067 | 182 |
| 1275 | 3300053730 | Ga0500645_160437 | Ga0500645_160437_19_567 | 182 |
| 1276 | 3300053731 | Ga0500609_019840 | Ga0500609_019840_23_571 | 182 |
| 1277 | 3300053733 | Ga0500552_022651 | Ga0500552_022651_275_835 | 182 |
| 1278 | 3300053735 | Ga0500596_002150 | Ga0500596_002150_1332_1925 | 182 |
| 1279 | 3300053735 | Ga0500596_009653 | Ga0500596_009653_547_1095 | 182 |
| 1280 | 3300053737 | Ga0500601_000881 | Ga0500601_000881_1052_1600 | 182 |
| 1281 | 3300055283 | Ga0500661_011876 | Ga0500661_011876_375_923 | 182 |
| 1282 | 3300060353 | Ga0501082_0742092 | Ga0501082_0742092_204_752 | 182 |
| 1283 | 3300061719 | Ga0466962_0035331 | Ga0466962_0035331_1296_1844 | 182 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4k0u-assembly1.cif.gz_A | pilotin/secretin peptide complex | 0.4316 | 47 | 143 |
| 4rcv-assembly1.cif.gz_B | m. tuberculosis 1-deoxy-d-xylulose-5-phosphate reductoisomerase bound to 1-deoxy-l-erythrulose | 0.4244 | 49 | 149 |
| 4k0u-assembly1.cif.gz_A | pilotin/secretin peptide complex | 0.4184 | 47 | 143 |
| 2y1e-assembly1.cif.gz_A | x-ray structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase, dxr, rv2870c, from mycobacterium tuberculosis, in complex with manganese. | 0.3722 | 49 | 149 |
| 4aic-assembly1.cif.gz_A | x-ray structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase, dxr, rv2870c, from mycobacterium tuberculosis, in complex with fosmidomycin, manganese and nadph | 0.3709 | 49 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5A4M2_319_627_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.4407 | 48 | 150 | 3.40.50.720 |
| af_Q14094_32_136_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.3949 | 47 | 148 | 1.10.472.10 |
| 4akiA13 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.3933 | 50 | 156 | 1.10.8.740 |
| af_Q8QZR8_12_138_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.39 | 36 | 157 | 1.10.472.10 |
| af_Q9VE72_9_143_1.10.472.10 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.3835 | 49 | 149 | 1.10.472.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8YZB0-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.8451 | 46 | 157 |
|
| AF-A0A2V7A2F2-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.8415 | 50 | 157 |
|
| AF-A0A3M1RAH9-F1-model_v4 | Twin-arginine translocation signal domain-containing protein | 0.8394 | 44 | 167 |
|
| AF-A0A2E6XEZ0-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.8342 | 46 | 157 |
|
| AF-A0A3D1YFG1-F1-model_v4 | Gluconate 2-dehydrogenase subunit 3 family protein | 0.8306 | 44 | 157 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar