F492552

General Info

Members Datasets Scaffolds Average Seq Length
1283 654 1096 181

Family's Representative Sequence

Representative Sequence 3300035410|Ga0373924_0128840|Ga0373924_0128840_17_622
Length 201
Sequence MREVDRQSKYNRRVFLQGAATTVPAVAIATSAGLSIEDAWADDAKTLTPATLKTLVKVARDIYPHDFLGDSYYITAIKPWDGKAAKDPAVKSMIDDGVSRLDQDASDHHKVPYAQVQWEADRVALLQRIEQTAFFQKIRGDLVVSLYNQKELWPKFGYEGSSAEHGGIYQTRLRRHRLAPEGLGPGQREFRRKPNGKIRSE

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
8 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
9 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
12 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
13 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
14 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
15 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
16 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
17 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
18 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
19 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
20 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
21 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
22 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
23 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
24 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
25 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
26 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
27 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
28 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
29 2791355199
30 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
31 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
32 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
33 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
34 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
35 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
36 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
37 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
38 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
39 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
40 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
41 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
42 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
43 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
44 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
45 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
46 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
47 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
48 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
49 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
50 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
51 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
52 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
53 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
54 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
55 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
56 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
57 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
58 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
59 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
60 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
61 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
62 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
63 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
64 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
65 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
66 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
67 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
68 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
69 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
70 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
71 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
72 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
73 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
74 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
75 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
76 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
77 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
78 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
79 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
80 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
81 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
82 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
83 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
84 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
85 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
86 2904699407
87 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
88 2906610324
89 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
90 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
91 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
92 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
93 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
94 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
95 2922368715
96 2922425934
97 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
98 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
99 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
100 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
101 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
102 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
103 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
104 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
105 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
106 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
107 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
108 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
109 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
110 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
111 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
112 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
113 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
114 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
115 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
116 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
117 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
118 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
119 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
120 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
121 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
122 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
123 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
124 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
125 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
126 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
127 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
128 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
129 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
130 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
131 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
132 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
133 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
134 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
135 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
136 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
137 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
138 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
139 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
140 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
141 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
142 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
143 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
144 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
145 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
146 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
147 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
148 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
149 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
150 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
151 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
152 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
153 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
154 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
155 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
156 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
157 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
158 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
159 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
160 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
161 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
162 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
163 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
164 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
165 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
166 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
167 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
168 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
169 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
170 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
171 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
172 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
173 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
174 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
175 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
176 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
177 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
178 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
179 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
180 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
184 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
185 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
186 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
187 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
188 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
189 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
190 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
191 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
192 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
193 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
194 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
195 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
196 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
197 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
198 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
199 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
200 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
201 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
202 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
203 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
204 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
205 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
206 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
207 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
208 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
209 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
210 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
211 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
212 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
213 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
214 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
215 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
216 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
217 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
218 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
219 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
220 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
221 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
222 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
223 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
224 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
225 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
226 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
227 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
228 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
229 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
230 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
231 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
232 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
233 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
234 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
235 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
236 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
237 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
238 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
239 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
240 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
241 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
242 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
243 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
244 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
245 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
246 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
247 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
248 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
249 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
250 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
251 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
252 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
253 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
254 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
255 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
256 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
257 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
258 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
259 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
260 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
261 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
262 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
263 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
264 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
265 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
266 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
267 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
268 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
269 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
270 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
271 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
272 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
273 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
274 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
275 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
276 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
277 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
278 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
279 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
280 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
281 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
282 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
284 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
287 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
288 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
289 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
290 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
291 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
357 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
358 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
359 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
360 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
362 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
366 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
367 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
369 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
370 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
371 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
372 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
373 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
374 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
375 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
376 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
377 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
378 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
379 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
380 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
381 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
382 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
383 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
384 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
385 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
386 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
387 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
388 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
389 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
390 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
391 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
392 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
393 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
394 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
395 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
396 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
397 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
398 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
399 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
400 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
401 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
402 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
403 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
404 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
405 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
406 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
407 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
408 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
409 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
410 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
411 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
412 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
413 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
414 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
415 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
416 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
417 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
418 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
419 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
420 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
421 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
422 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
423 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
424 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
425 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
426 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
427 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
428 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
429 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
430 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
431 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
432 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
433 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
434 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
435 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
436 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
437 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
438 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
439 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
440 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
441 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
442 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
443 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
444 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
445 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
446 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
447 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
448 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
449 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
450 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
451 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
452 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
453 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
454 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
455 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
456 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
457 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
458 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
459 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
460 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
461 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
462 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
463 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
464 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
465 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
466 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
467 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
468 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
469 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
470 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
471 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
472 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
473 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
474 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
475 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
476 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
477 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
478 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
479 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
480 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
481 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
482 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
483 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
484 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
485 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
486 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
487 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
488 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
489 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
490 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
491 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
492 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
493 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
494 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
495 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
496 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
497 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
498 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
499 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
500 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
501 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
502 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
503 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
504 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
505 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
506 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
507 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
508 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
509 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
510 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
511 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
512 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
513 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
514 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
515 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
516 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
517 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
518 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
519 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
520 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
521 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
522 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
523 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
524 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
525 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
526 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
527 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
528 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
529 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
530 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
531 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
532 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
533 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
534 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
535 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
536 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
537 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
538 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
539 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
540 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
541 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
542 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
543 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
544 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
545 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
546 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
547 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
548 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
549 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
550 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
551 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
552 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
553 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
554 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
555 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
556 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
557 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
558 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
559 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
560 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
561 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
562 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
563 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
564 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
565 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
566 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
567 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
568 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
569 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
570 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
571 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
572 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
573 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
574 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
575 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
576 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
577 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
578 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
579 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
580 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
581 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
582 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
583 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
584 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
585 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
586 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
587 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
588 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
589 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
590 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
591 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
592 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
593 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
594 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
595 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
596 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
597 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
598 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
599 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
600 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
601 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
602 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
603 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
604 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
605 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
606 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
607 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
608 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
609 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
610 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
611 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
612 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
613 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
614 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
615 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
616 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
617 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
618 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
619 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
620 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
621 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
622 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
623 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
624 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
625 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
626 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
627 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
628 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
629 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
630 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
631 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
632 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
633 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
634 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
635 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
636 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
637 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
638 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
639 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
640 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
641 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
642 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
643 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
644 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
645 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
646 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
647 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
648 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
649 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
650 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
651 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
652 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
653 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
654 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.13
Metatranscriptomes 0.63
Isolates 14.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 12
Rhizoplane 5.77
Rhizosphere 61.81
Stem 0
Stem Tuber 0
Unclassified 9.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C399 2010549000 Bacteria 1198
2 JGI24739J22299_10153398 3300001989 Bacteria 681
3 JGI24749J21850_1028922 3300002076 Bacteria 793
4 JGI25153J46596_10003712 3300003215 Bacteria 8429
5 JGI25153J46596_10003975 3300003215 Bacteria 8089
6 JGI25153J46596_10039108 3300003215 Bacteria 1486
7 JGI25404J52841_10017956 3300003659 Bacteria 1533
8 Ga0055531_10008928 3300003794 Bacteria 5196
9 JGI25405J52794_10012119 3300003911 Bacteria 1656
10 Ga0055543_1001247 3300004625 Bacteria 10557
11 Ga0065165_1001238 3300005262 Bacteria 29152
12 Ga0065165_1004821 3300005262 Bacteria 8028
13 Ga0065165_1012948 3300005262 Bacteria 3352
14 Ga0065165_1016813 3300005262 Bacteria 2722
15 Ga0070658_10080672 3300005327 Bacteria 2672
16 Ga0070683_100015748 3300005329 Bacteria 6647
17 Ga0070683_100436837 3300005329 Bacteria 1249
18 Ga0070690_100962839 3300005330 Bacteria 671
19 Ga0070670_100327092 3300005331 Bacteria 1344
20 Ga0070670_101252150 3300005331 Bacteria 679
21 Ga0068869_100216708 3300005334 Bacteria 1516
22 Ga0070680_100033950 3300005336 Bacteria 4114
23 Ga0070682_100165238 3300005337 Bacteria 1533
24 Ga0070682_100219358 3300005337 Bacteria 1352
25 Ga0068868_100011625 3300005338 Bacteria 6412
26 Ga0068868_100058807 3300005338 Bacteria 3039
27 Ga0068868_100176891 3300005338 Bacteria 1769
28 Ga0068868_100306128 3300005338 Bacteria 1351
29 Ga0070660_100197657 3300005339 Bacteria 1631
30 Ga0070660_100860512 3300005339 Bacteria 764
31 Ga0070689_100502858 3300005340 Bacteria 1039
32 Ga0070691_10174128 3300005341 Bacteria 1117
33 Ga0070687_100128942 3300005343 Bacteria 1458
34 Ga0070692_10134771 3300005345 Bacteria 1392
35 Ga0070668_100016271 3300005347 Bacteria 5563
36 Ga0070668_100047595 3300005347 Bacteria 3297
37 Ga0070668_100076201 3300005347 Bacteria 2620
38 Ga0070668_100542358 3300005347 Bacteria 1011
39 Ga0070668_100986721 3300005347 Bacteria 756
40 Ga0070668_101022242 3300005347 Bacteria 743
41 Ga0070668_101503618 3300005347 Bacteria 615
42 Ga0070669_100181958 3300005353 Bacteria 1645
43 Ga0070669_101229277 3300005353 Bacteria 648
44 Ga0070675_100264823 3300005354 Bacteria 1507
45 Ga0070671_100254929 3300005355 Bacteria 1490
46 Ga0070671_100465337 3300005355 Bacteria 1085
47 Ga0070671_100545542 3300005355 Bacteria 999
48 Ga0070674_100114350 3300005356 Bacteria 1987
49 Ga0070674_100416633 3300005356 Bacteria 1101
50 Ga0070673_100082174 3300005364 Bacteria 2614
51 Ga0070688_100057420 3300005365 Bacteria 2446
52 Ga0070659_100222395 3300005366 Bacteria 1559
53 Ga0070667_100064004 3300005367 Bacteria 3119
54 Ga0070667_100326035 3300005367 Bacteria 1386
55 Ga0070667_100745512 3300005367 Bacteria 908
56 Ga0070703_10024753 3300005406 Bacteria 1776
57 Ga0070709_10004421 3300005434 Bacteria 7582
58 Ga0070709_10010158 3300005434 Bacteria 5202
59 Ga0070709_10144889 3300005434 Bacteria 1635
60 Ga0070709_10353964 3300005434 Bacteria 1086
61 Ga0070714_100004999 3300005435 Bacteria 10080
62 Ga0070714_100101291 3300005435 Bacteria 2538
63 Ga0070714_100184828 3300005435 Bacteria 1899
64 Ga0070714_100259175 3300005435 Bacteria 1610
65 Ga0070714_100663262 3300005435 Bacteria 1005
66 Ga0070713_100004534 3300005436 Bacteria 9356
67 Ga0070713_100006585 3300005436 Bacteria 8073
68 Ga0070713_100011058 3300005436 Bacteria 6554
69 Ga0070713_100014000 3300005436 Bacteria 5939
70 Ga0070713_100075767 3300005436 Bacteria 2854
71 Ga0070713_100084245 3300005436 Bacteria 2720
72 Ga0070713_100212872 3300005436 Bacteria 1750
73 Ga0070710_10060807 3300005437 Bacteria 2150
74 Ga0070710_10112579 3300005437 Bacteria 1637
75 Ga0070701_10119533 3300005438 Bacteria 1483
76 Ga0070711_100006399 3300005439 Bacteria 7101
77 Ga0070711_100024840 3300005439 Bacteria 3914
78 Ga0070711_100218504 3300005439 Bacteria 1480
79 Ga0070705_100184931 3300005440 Bacteria 1415
80 Ga0070705_100415204 3300005440 Bacteria 1000
81 Ga0070700_100323113 3300005441 Bacteria 1134
82 Ga0070694_100182349 3300005444 Bacteria 1553
83 Ga0070708_100745514 3300005445 Bacteria 921
84 Ga0070663_100044479 3300005455 Bacteria 3131
85 Ga0070663_100051122 3300005455 Bacteria 2942
86 Ga0070663_100061590 3300005455 Bacteria 2702
87 Ga0070663_100183072 3300005455 Bacteria 1626
88 Ga0070663_100305159 3300005455 Bacteria 1275
89 Ga0070663_100313452 3300005455 Bacteria 1259
90 Ga0070663_100320366 3300005455 Bacteria 1246
91 Ga0070663_100644209 3300005455 Bacteria 895
92 Ga0070678_100206008 3300005456 Bacteria 1626
93 Ga0070678_100307277 3300005456 Bacteria 1350
94 Ga0070678_100313336 3300005456 Bacteria 1338
95 Ga0070662_100042613 3300005457 Bacteria 3242
96 Ga0070662_100051832 3300005457 Bacteria 2964
97 Ga0070681_10005842 3300005458 Bacteria 11917
98 Ga0070681_10046271 3300005458 Bacteria 4350
99 Ga0068867_100179243 3300005459 Bacteria 1683
100 Ga0068867_100545419 3300005459 Bacteria 1004
101 Ga0068867_100568483 3300005459 Bacteria 984
102 Ga0070706_100155389 3300005467 Bacteria 2136
103 Ga0070706_100241729 3300005467 Bacteria 1686
104 Ga0070698_100167764 3300005471 Bacteria 2137
105 Ga0070699_100180163 3300005518 Bacteria 1875
106 Ga0070699_100859143 3300005518 Bacteria 831
107 Ga0070699_101301903 3300005518 Bacteria 667
108 Ga0070679_100015322 3300005530 Bacteria 7366
109 Ga0070679_100034222 3300005530 Bacteria 5034
110 Ga0070684_100053919 3300005535 Bacteria 3502
111 Ga0070684_100323388 3300005535 Bacteria 1417
112 Ga0070697_100292726 3300005536 Bacteria 1398
113 Ga0068853_101077338 3300005539 Bacteria 775
114 Ga0070672_100140100 3300005543 Bacteria 1994
115 Ga0070672_100422703 3300005543 Bacteria 1145
116 Ga0070672_100713267 3300005543 Bacteria 879
117 Ga0070686_100023188 3300005544 Bacteria 3706
118 Ga0070695_100323813 3300005545 Bacteria 1147
119 Ga0070696_100400603 3300005546 Bacteria 1073
120 Ga0070696_100405459 3300005546 Bacteria 1067
121 Ga0070696_100597977 3300005546 Bacteria 889
122 Ga0070665_100019999 3300005548 Bacteria 6723
123 Ga0070665_100091696 3300005548 Bacteria 3043
124 Ga0070665_100118504 3300005548 Bacteria 2649
125 Ga0070665_100196813 3300005548 Bacteria 2016
126 Ga0070665_100388257 3300005548 Bacteria 1403
127 Ga0070665_100458678 3300005548 Bacteria 1284
128 Ga0068855_100225014 3300005563 Bacteria 2102
129 Ga0068855_100779440 3300005563 Bacteria 1017
130 Ga0068855_101059062 3300005563 Bacteria 850
131 Ga0070664_100162208 3300005564 Bacteria 1978
132 Ga0070664_100229394 3300005564 Bacteria 1664
133 Ga0070664_100525264 3300005564 Bacteria 1093
134 Ga0068857_100071359 3300005577 Bacteria 3094
135 Ga0068857_100202935 3300005577 Bacteria 1807
136 Ga0068856_100093327 3300005614 Bacteria 2995
137 Ga0068856_100731315 3300005614 Bacteria 1010
138 Ga0068856_100919513 3300005614 Bacteria 894
139 Ga0068852_100112958 3300005616 Bacteria 2473
140 Ga0068852_100542038 3300005616 Bacteria 1163
141 Ga0068852_100562511 3300005616 Bacteria 1142
142 Ga0068859_100268917 3300005617 Bacteria 1796
143 Ga0068859_100474242 3300005617 Bacteria 1347
144 Ga0068859_100902022 3300005617 Bacteria 968
145 Ga0068864_100013398 3300005618 Bacteria 6795
146 Ga0068864_100161872 3300005618 Bacteria 2035
147 Ga0068866_10075702 3300005718 Bacteria 1793
148 Ga0068861_100076323 3300005719 Bacteria 2611
149 Ga0068861_100120266 3300005719 Bacteria 2117
150 Ga0068870_10071748 3300005840 Bacteria 1890
151 Ga0068863_100082691 3300005841 Bacteria 3043
152 Ga0068863_100142925 3300005841 Bacteria 2288
153 Ga0068863_100278724 3300005841 Bacteria 1620
154 Ga0068863_101039854 3300005841 Bacteria 822
155 Ga0068863_101072481 3300005841 Bacteria 810
156 Ga0068858_100122763 3300005842 Bacteria 2430
157 Ga0068858_100142978 3300005842 Bacteria 2246
158 Ga0068858_100892647 3300005842 Bacteria 869
159 Ga0068860_100000367 3300005843 Bacteria 59534
160 Ga0068860_100104480 3300005843 Bacteria 2704
161 Ga0068860_100238758 3300005843 Bacteria 1767
162 Ga0068860_100247941 3300005843 Bacteria 1733
163 Ga0068860_100311735 3300005843 Bacteria 1543
164 Ga0068860_100358870 3300005843 Bacteria 1435
165 Ga0068860_100361843 3300005843 Bacteria 1429
166 Ga0068860_100377664 3300005843 Bacteria 1399
167 Ga0068860_101271536 3300005843 Bacteria 756
168 Ga0068862_100306497 3300005844 Bacteria 1462
169 Ga0068862_100374442 3300005844 Bacteria 1326
170 Ga0068862_100674106 3300005844 Bacteria 999
171 Ga0068862_100824338 3300005844 Bacteria 907
172 Ga0081455_10005963 3300005937 Bacteria 13212
173 Ga0081455_10019148 3300005937 Bacteria 6487
174 Ga0081455_10019874 3300005937 Bacteria 6342
175 Ga0081455_10238149 3300005937 Bacteria 1339
176 Ga0081540_1005978 3300005983 Bacteria 8963
177 Ga0081540_1007083 3300005983 Bacteria 8057
178 Ga0081540_1008425 3300005983 Bacteria 7208
179 Ga0081540_1010630 3300005983 Bacteria 6211
180 Ga0081540_1031564 3300005983 Bacteria 2910
181 Ga0081540_1042398 3300005983 Bacteria 2347
182 Ga0081540_1047481 3300005983 Bacteria 2159
183 Ga0081540_1047752 3300005983 Bacteria 2150
184 Ga0070717_10000254 3300006028 Bacteria 36784
185 Ga0070717_10003385 3300006028 Bacteria 11402
186 Ga0070717_10030814 3300006028 Bacteria 4310
187 Ga0075365_10042633 3300006038 Bacteria 2967
188 Ga0075365_10151609 3300006038 Bacteria 1612
189 Ga0075365_10227051 3300006038 Bacteria 1310
190 Ga0075365_10227378 3300006038 Bacteria 1309
191 Ga0075365_10255577 3300006038 Bacteria 1232
192 Ga0075365_10453491 3300006038 Bacteria 906
193 Ga0075363_100000357 3300006048 Bacteria 13719
194 Ga0075363_100033478 3300006048 Bacteria 2676
195 Ga0075363_100353894 3300006048 Bacteria 858
196 Ga0075364_10011619 3300006051 Bacteria 5353
197 Ga0075364_10112989 3300006051 Bacteria 1814
198 Ga0070715_10000467 3300006163 Bacteria 10474
199 Ga0070715_10136832 3300006163 Bacteria 1185
200 Ga0070715_10317261 3300006163 Bacteria 840
201 Ga0070716_100000841 3300006173 Bacteria 13244
202 Ga0070716_100107742 3300006173 Bacteria 1721
203 Ga0070716_100151373 3300006173 Bacteria 1493
204 Ga0070712_100002446 3300006175 Bacteria 11447
205 Ga0070712_100009088 3300006175 Bacteria 6258
206 Ga0070712_100136191 3300006175 Bacteria 1868
207 Ga0070712_100305479 3300006175 Bacteria 1289
208 Ga0070712_100927680 3300006175 Bacteria 751
209 Ga0075362_10322610 3300006177 Bacteria 769
210 Ga0075362_10443784 3300006177 Bacteria 658
211 Ga0075367_10016273 3300006178 Bacteria 4060
212 Ga0075367_10136736 3300006178 Bacteria 1516
213 Ga0075367_10146349 3300006178 Bacteria 1465
214 Ga0075367_10481996 3300006178 Bacteria 786
215 Ga0075369_10036194 3300006186 Bacteria 2100
216 Ga0075366_10076370 3300006195 Bacteria 1999
217 Ga0075366_10342806 3300006195 Bacteria 916
218 Ga0097621_100074771 3300006237 Bacteria 2807
219 Ga0097621_100093160 3300006237 Bacteria 2524
220 Ga0097621_100094777 3300006237 Bacteria 2503
221 Ga0097621_101035912 3300006237 Bacteria 769
222 Ga0075370_10072587 3300006353 Bacteria 1970
223 Ga0068871_100070981 3300006358 Bacteria 2863
224 Ga0068871_100964353 3300006358 Bacteria 793
225 Ga0075434_100085607 3300006871 Bacteria 3152
226 Ga0068865_100072578 3300006881 Bacteria 2445
227 Ga0068865_100132105 3300006881 Bacteria 1872
228 Ga0097620_100268898 3300006931 Bacteria 1796
229 Ga0097620_100474234 3300006931 Bacteria 1347
230 Ga0097620_100902023 3300006931 Bacteria 968
231 Ga0099825_1020324 3300006941 Bacteria 4748
232 Ga0099825_1039163 3300006941 Bacteria 1471
233 Ga0099824_1010512 3300006942 Bacteria 10865
234 Ga0099824_1014791 3300006942 Bacteria 7625
235 Ga0099824_1046460 3300006942 Bacteria 891
236 Ga0099822_1001984 3300006943 Bacteria 24919
237 Ga0099823_1089075 3300006944 Bacteria 1075
238 Ga0075435_100088077 3300007076 Bacteria 2559
239 Ga0099795_10054104 3300007788 Bacteria 1471
240 Ga0099795_10259631 3300007788 Bacteria 752
241 Ga0105244_10211259 3300009036 Bacteria 913
242 Ga0105250_10126097 3300009092 Bacteria 1055
243 Ga0105240_10679877 3300009093 Bacteria 1125
244 Ga0105240_10867830 3300009093 Bacteria 973
245 Ga0111539_10313176 3300009094 Bacteria 1827
246 Ga0111539_10363720 3300009094 Bacteria 1684
247 Ga0105245_10028789 3300009098 Bacteria 4902
248 Ga0105245_10182260 3300009098 Bacteria 2007
249 Ga0105245_10276300 3300009098 Bacteria 1640
250 Ga0105245_11192035 3300009098 Bacteria 809
251 Ga0105247_10057933 3300009101 Bacteria 2396
252 Ga0105247_10060291 3300009101 Bacteria 2351
253 Ga0105247_10107421 3300009101 Bacteria 1792
254 Ga0105247_10221345 3300009101 Bacteria 1281
255 Ga0105247_10253332 3300009101 Bacteria 1204
256 Ga0105247_10300555 3300009101 Bacteria 1113
257 Ga0105243_10281547 3300009148 Bacteria 1498
258 Ga0105243_11621434 3300009148 Bacteria 674
259 Ga0105243_12031488 3300009148 Bacteria 610
260 Ga0105241_10016637 3300009174 Bacteria 5397
261 Ga0105241_10042053 3300009174 Bacteria 3455
262 Ga0105241_10585759 3300009174 Bacteria 1006
263 Ga0105242_10915942 3300009176 Bacteria 878
264 Ga0105242_11194547 3300009176 Bacteria 779
265 Ga0105248_10292121 3300009177 Bacteria 1835
266 Ga0105248_11098099 3300009177 Bacteria 899
267 Ga0105248_11497591 3300009177 Bacteria 764
268 Ga0105237_10126837 3300009545 Bacteria 2546
269 Ga0105237_10333372 3300009545 Bacteria 1521
270 Ga0105237_10672703 3300009545 Bacteria 1042
271 Ga0105237_11289100 3300009545 Bacteria 737
272 Ga0105238_10309954 3300009551 Bacteria 1563
273 Ga0105238_10637142 3300009551 Bacteria 1075
274 Ga0105238_10768623 3300009551 Bacteria 978
275 Ga0105238_10958028 3300009551 Bacteria 876
276 Ga0105238_11219444 3300009551 Bacteria 777
277 Ga0105249_10298478 3300009553 Bacteria 1615
278 Ga0105249_10354663 3300009553 Bacteria 1487
279 Ga0105249_10703451 3300009553 Bacteria 1071
280 Ga0105249_11024961 3300009553 Bacteria 894
281 Ga0099796_10015205 3300010159 Bacteria 2245
282 Ga0099796_10182110 3300010159 Bacteria 844
283 Ga0105239_10184727 3300010375 Bacteria 2333
284 Ga0105239_10337343 3300010375 Bacteria 1701
285 Ga0105239_10341586 3300010375 Bacteria 1690
286 Ga0105239_10568705 3300010375 Bacteria 1292
287 Ga0105239_11131298 3300010375 Bacteria 902
288 Ga0105246_10094671 3300011119 Bacteria 2161
289 Ga0105246_10162306 3300011119 Bacteria 1703
290 Ga0105246_11011435 3300011119 Bacteria 753
291 Ga0157369_10020020 3300013105 Bacteria 7484
292 Ga0157369_10490873 3300013105 Bacteria 1271
293 Ga0157374_10036491 3300013296 Bacteria 4502
294 Ga0157374_10091944 3300013296 Bacteria 2894
295 Ga0157378_10235465 3300013297 Bacteria 1747
296 Ga0157378_10297752 3300013297 Bacteria 1560
297 Ga0163162_10033688 3300013306 Bacteria 5091
298 Ga0163162_10192615 3300013306 Bacteria 2166
299 Ga0163162_10196746 3300013306 Bacteria 2145
300 Ga0163162_10905989 3300013306 Bacteria 995
301 Ga0163162_11615165 3300013306 Bacteria 740
302 Ga0163162_11734292 3300013306 Bacteria 713
303 Ga0157372_10255072 3300013307 Bacteria 2036
304 Ga0157372_12060231 3300013307 Bacteria 656
305 Ga0157375_10042135 3300013308 Bacteria 4416
306 Ga0157375_10088435 3300013308 Bacteria 3153
307 Ga0157375_10316195 3300013308 Bacteria 1726
308 Ga0157375_10437699 3300013308 Bacteria 1473
309 Ga0157375_11124440 3300013308 Bacteria 920
310 Ga0157375_11373761 3300013308 Bacteria 832
311 Ga0157375_11772664 3300013308 Bacteria 732
312 Ga0163163_10050507 3300014325 Bacteria 4095
313 Ga0163163_10141356 3300014325 Bacteria 2449
314 Ga0163163_10221492 3300014325 Bacteria 1941
315 Ga0163163_10294188 3300014325 Bacteria 1676
316 Ga0163163_10948135 3300014325 Bacteria 924
317 Ga0157380_10165577 3300014326 Bacteria 1926
318 Ga0157380_10497827 3300014326 Bacteria 1183
319 Ga0157377_10282611 3300014745 Bacteria 1088
320 Ga0157377_10341276 3300014745 Bacteria 1002
321 Ga0157379_10079606 3300014968 Bacteria 2934
322 Ga0157379_10107522 3300014968 Bacteria 2504
323 Ga0157379_10138478 3300014968 Bacteria 2194
324 Ga0157379_10227748 3300014968 Bacteria 1689
325 Ga0157376_10004272 3300014969 Bacteria 9918
326 Ga0157376_10041292 3300014969 Bacteria 3776
327 Ga0157376_10074244 3300014969 Bacteria 2899
328 Ga0157376_10214414 3300014969 Bacteria 1779
329 Ga0157376_10929481 3300014969 Bacteria 889
330 Ga0163161_10314640 3300017792 Bacteria 1236
331 Ga0197907_10173837 3300020069 Bacteria 1745
332 Ga0206356_10315111 3300020070 Bacteria 679
333 Ga0206356_10644697 3300020070 Bacteria 1811
334 Ga0206352_11357288 3300020078 Bacteria 1744
335 Ga0206353_10982674 3300020082 Bacteria 1597
336 Ga0154015_1039217 3300020610 Bacteria 776
337 Ga0213874_10040348 3300021377 Bacteria 1393
338 Ga0209563_103469 3300025230 Bacteria 3248
339 Ga0209677_102593 3300025253 Bacteria 6606
340 Ga0209233_1016731 3300025261 Bacteria 2014
341 Ga0209233_1027116 3300025261 Bacteria 1392
342 Ga0209130_1038983 3300025284 Bacteria 928
343 Ga0209758_1000595 3300025297 Bacteria 56364
344 Ga0209758_1000604 3300025297 Bacteria 55558
345 Ga0209758_1001332 3300025297 Bacteria 29913
346 Ga0209758_1025154 3300025297 Bacteria 2621
347 Ga0209758_1049382 3300025297 Bacteria 1486
348 Ga0209758_1106602 3300025297 Bacteria 784
349 Ga0209256_1008443 3300025299 Bacteria 4774
350 Ga0209256_1074700 3300025299 Bacteria 753
351 Ga0207426_1000500 3300025302 Bacteria 58181
352 Ga0207426_1001477 3300025302 Bacteria 19322
353 Ga0207426_1007029 3300025302 Bacteria 4776
354 Ga0207426_1012937 3300025302 Bacteria 3114
355 Ga0209051_1093743 3300025303 Bacteria 827
356 Ga0209257_1001217 3300025304 Bacteria 32229
357 Ga0209257_1039914 3300025304 Bacteria 1406
358 Ga0207697_10125145 3300025315 Bacteria 1108
359 Ga0207696_1045828 3300025711 Bacteria 1263
360 Ga0207653_10022622 3300025885 Bacteria 1998
361 Ga0207692_10002241 3300025898 Bacteria 7397
362 Ga0207692_10343202 3300025898 Bacteria 919
363 Ga0207692_10457622 3300025898 Bacteria 804
364 Ga0207642_10137858 3300025899 Bacteria 1282
365 Ga0207642_10203052 3300025899 Bacteria 1096
366 Ga0207710_10031300 3300025900 Bacteria 2326
367 Ga0207710_10042758 3300025900 Bacteria 2013
368 Ga0207710_10055220 3300025900 Bacteria 1790
369 Ga0207710_10068167 3300025900 Bacteria 1627
370 Ga0207710_10121193 3300025900 Bacteria 1249
371 Ga0207688_10072723 3300025901 Bacteria 1954
372 Ga0207688_10167946 3300025901 Bacteria 1303
373 Ga0207680_10438132 3300025903 Bacteria 927
374 Ga0207680_10897925 3300025903 Bacteria 635
375 Ga0207647_10135326 3300025904 Bacteria 1446
376 Ga0207685_10000741 3300025905 Bacteria 5960
377 Ga0207685_10341978 3300025905 Bacteria 752
378 Ga0207699_10006247 3300025906 Bacteria 5752
379 Ga0207699_10008256 3300025906 Bacteria 5129
380 Ga0207699_10772660 3300025906 Bacteria 705
381 Ga0207699_10864446 3300025906 Bacteria 666
382 Ga0207645_10121320 3300025907 Bacteria 1697
383 Ga0207645_10678390 3300025907 Bacteria 700
384 Ga0207643_10178655 3300025908 Bacteria 1283
385 Ga0207643_10290527 3300025908 Bacteria 1015
386 Ga0207705_10196045 3300025909 Bacteria 1529
387 Ga0207684_10140603 3300025910 Bacteria 2075
388 Ga0207684_10658444 3300025910 Bacteria 892
389 Ga0207654_10005980 3300025911 Bacteria 6122
390 Ga0207654_10222223 3300025911 Bacteria 1253
391 Ga0207707_10000639 3300025912 Bacteria 34565
392 Ga0207695_10186767 3300025913 Bacteria 1991
393 Ga0207695_10383565 3300025913 Bacteria 1291
394 Ga0207695_10741449 3300025913 Bacteria 862
395 Ga0207671_10256048 3300025914 Bacteria 1377
396 Ga0207671_10355742 3300025914 Bacteria 1162
397 Ga0207693_10003759 3300025915 Bacteria 12937
398 Ga0207693_10102545 3300025915 Bacteria 2244
399 Ga0207693_10122223 3300025915 Bacteria 2045
400 Ga0207693_10159400 3300025915 Bacteria 1775
401 Ga0207693_10918528 3300025915 Bacteria 671
402 Ga0207663_10000502 3300025916 Bacteria 17107
403 Ga0207663_10102757 3300025916 Bacteria 1923
404 Ga0207663_10108965 3300025916 Bacteria 1876
405 Ga0207662_10120318 3300025918 Bacteria 1646
406 Ga0207657_10038451 3300025919 Bacteria 4259
407 Ga0207657_11046913 3300025919 Bacteria 625
408 Ga0207652_10010036 3300025921 Bacteria 7626
409 Ga0207646_10142063 3300025922 Bacteria 2163
410 Ga0207681_10124704 3300025923 Bacteria 1894
411 Ga0207681_11342004 3300025923 Bacteria 600
412 Ga0207694_10084505 3300025924 Bacteria 2497
413 Ga0207650_10124649 3300025925 Bacteria 2010
414 Ga0207650_10187060 3300025925 Bacteria 1653
415 Ga0207650_10588635 3300025925 Bacteria 935
416 Ga0207659_10911632 3300025926 Bacteria 756
417 Ga0207659_11316578 3300025926 Bacteria 620
418 Ga0207687_10093119 3300025927 Bacteria 2202
419 Ga0207687_10199345 3300025927 Bacteria 1563
420 Ga0207687_10654990 3300025927 Bacteria 889
421 Ga0207700_10005398 3300025928 Bacteria 7638
422 Ga0207700_10064289 3300025928 Bacteria 2794
423 Ga0207700_10090508 3300025928 Bacteria 2415
424 Ga0207700_10174803 3300025928 Bacteria 1794
425 Ga0207700_10208505 3300025928 Bacteria 1651
426 Ga0207700_10384295 3300025928 Bacteria 1228
427 Ga0207700_10778836 3300025928 Bacteria 855
428 Ga0207700_10781577 3300025928 Bacteria 854
429 Ga0207664_10043298 3300025929 Bacteria 3519
430 Ga0207664_10045215 3300025929 Bacteria 3452
431 Ga0207664_10085612 3300025929 Bacteria 2573
432 Ga0207664_10388205 3300025929 Bacteria 1240
433 Ga0207664_10622377 3300025929 Bacteria 970
434 Ga0207664_10787086 3300025929 Bacteria 856
435 Ga0207664_10978238 3300025929 Bacteria 759
436 Ga0207644_10187921 3300025931 Bacteria 1623
437 Ga0207644_10316355 3300025931 Bacteria 1261
438 Ga0207644_10543247 3300025931 Bacteria 961
439 Ga0207644_10649033 3300025931 Bacteria 878
440 Ga0207706_10055854 3300025933 Bacteria 3481
441 Ga0207706_10159120 3300025933 Bacteria 1986
442 Ga0207706_10181565 3300025933 Bacteria 1848
443 Ga0207706_10216572 3300025933 Bacteria 1678
444 Ga0207686_10131143 3300025934 Bacteria 1719
445 Ga0207686_10561627 3300025934 Bacteria 893
446 Ga0207709_10055044 3300025935 Bacteria 2456
447 Ga0207709_10347985 3300025935 Bacteria 1118
448 Ga0207709_10452824 3300025935 Bacteria 992
449 Ga0207670_10092679 3300025936 Bacteria 2139
450 Ga0207670_10333659 3300025936 Bacteria 1196
451 Ga0207669_10064377 3300025937 Bacteria 2268
452 Ga0207669_10869200 3300025937 Bacteria 751
453 Ga0207704_10042041 3300025938 Bacteria 2687
454 Ga0207704_10091861 3300025938 Bacteria 1996
455 Ga0207665_10002009 3300025939 Bacteria 13693
456 Ga0207665_10062598 3300025939 Bacteria 2525
457 Ga0207665_10091603 3300025939 Bacteria 2108
458 Ga0207665_10317582 3300025939 Bacteria 1168
459 Ga0207665_10651756 3300025939 Bacteria 825
460 Ga0207691_10018692 3300025940 Bacteria 6566
461 Ga0207691_10110689 3300025940 Bacteria 2442
462 Ga0207691_10368011 3300025940 Bacteria 1228
463 Ga0207691_10934336 3300025940 Bacteria 725
464 Ga0207711_10253859 3300025941 Bacteria 1615
465 Ga0207711_10954309 3300025941 Bacteria 796
466 Ga0207689_10048603 3300025942 Bacteria 3499
467 Ga0207689_10100307 3300025942 Bacteria 2379
468 Ga0207689_10477296 3300025942 Bacteria 1044
469 Ga0207689_10532497 3300025942 Bacteria 986
470 Ga0207689_10570017 3300025942 Bacteria 951
471 Ga0207661_10007291 3300025944 Bacteria 7866
472 Ga0207661_10054657 3300025944 Bacteria 3199
473 Ga0207679_10125519 3300025945 Bacteria 2050
474 Ga0207679_10674846 3300025945 Bacteria 936
475 Ga0207679_10805164 3300025945 Bacteria 857
476 Ga0207667_10154496 3300025949 Bacteria 2361
477 Ga0207667_10487924 3300025949 Bacteria 1250
478 Ga0207667_11066099 3300025949 Bacteria 793
479 Ga0207651_10064250 3300025960 Bacteria 2568
480 Ga0207651_10368596 3300025960 Bacteria 1214
481 Ga0207651_10823545 3300025960 Bacteria 824
482 Ga0207712_10054730 3300025961 Bacteria 2804
483 Ga0207712_10115924 3300025961 Bacteria 2018
484 Ga0207712_10216066 3300025961 Bacteria 1530
485 Ga0207712_10321796 3300025961 Bacteria 1276
486 Ga0207712_11167174 3300025961 Bacteria 686
487 Ga0207668_10030240 3300025972 Bacteria 3557
488 Ga0207668_10078317 3300025972 Bacteria 2386
489 Ga0207668_10169342 3300025972 Bacteria 1711
490 Ga0207668_10322913 3300025972 Bacteria 1281
491 Ga0207668_10508646 3300025972 Bacteria 1037
492 Ga0207668_11277806 3300025972 Bacteria 660
493 Ga0207640_10919525 3300025981 Bacteria 765
494 Ga0207658_10294509 3300025986 Bacteria 1396
495 Ga0207677_10005995 3300026023 Bacteria 6622
496 Ga0207677_10049586 3300026023 Bacteria 2834
497 Ga0207677_10181010 3300026023 Bacteria 1658
498 Ga0207677_10239123 3300026023 Bacteria 1468
499 Ga0207677_10696208 3300026023 Bacteria 901
500 Ga0207703_10228892 3300026035 Bacteria 1666
501 Ga0207703_10307145 3300026035 Bacteria 1448
502 Ga0207703_10923455 3300026035 Bacteria 836
503 Ga0207703_10982617 3300026035 Bacteria 810
504 Ga0207639_10285322 3300026041 Bacteria 1453
505 Ga0207639_10794876 3300026041 Bacteria 881
506 Ga0207678_10018446 3300026067 Bacteria 6127
507 Ga0207678_10069771 3300026067 Bacteria 3013
508 Ga0207678_10079380 3300026067 Bacteria 2810
509 Ga0207678_10109411 3300026067 Bacteria 2357
510 Ga0207678_10109881 3300026067 Bacteria 2352
511 Ga0207678_10334194 3300026067 Bacteria 1305
512 Ga0207678_10999165 3300026067 Bacteria 740
513 Ga0207708_10183920 3300026075 Bacteria 1660
514 Ga0207708_10908885 3300026075 Bacteria 762
515 Ga0207708_10925574 3300026075 Bacteria 755
516 Ga0207708_10974905 3300026075 Bacteria 736
517 Ga0207702_10079376 3300026078 Bacteria 2844
518 Ga0207641_10273614 3300026088 Bacteria 1585
519 Ga0207641_10328037 3300026088 Bacteria 1453
520 Ga0207641_10459810 3300026088 Bacteria 1231
521 Ga0207641_11832556 3300026088 Bacteria 608
522 Ga0207648_10052565 3300026089 Bacteria 3563
523 Ga0207648_10090372 3300026089 Bacteria 2675
524 Ga0207648_10932079 3300026089 Bacteria 812
525 Ga0207676_10068608 3300026095 Bacteria 2837
526 Ga0207676_10127863 3300026095 Bacteria 2155
527 Ga0207676_10452614 3300026095 Bacteria 1210
528 Ga0207676_10700932 3300026095 Bacteria 981
529 Ga0207676_11265358 3300026095 Bacteria 732
530 Ga0207675_100015313 3300026118 Bacteria 7154
531 Ga0207675_100115027 3300026118 Bacteria 2541
532 Ga0207675_100399899 3300026118 Bacteria 1353
533 Ga0207675_100680119 3300026118 Bacteria 1037
534 Ga0207675_101207895 3300026118 Bacteria 776
535 Ga0207683_10082409 3300026121 Bacteria 2858
536 Ga0207683_10111729 3300026121 Bacteria 2447
537 Ga0207683_10304582 3300026121 Bacteria 1458
538 Ga0207698_10024589 3300026142 Bacteria 4231
539 Ga0207698_10081623 3300026142 Bacteria 2611
540 Ga0207698_10208977 3300026142 Bacteria 1754
541 Ga0207698_10467902 3300026142 Bacteria 1220
542 Ga0207698_10483186 3300026142 Bacteria 1202
543 Ga0209389_1000019 3300027296 Bacteria 172067
544 Ga0209389_1000070 3300027296 Bacteria 97498
545 Ga0209589_1000005 3300027357 Bacteria 530958
546 Ga0209589_1000420 3300027357 Bacteria 58471
547 Ga0209489_100005 3300027361 Bacteria 530958
548 Ga0209489_100033 3300027361 Bacteria 172166
549 Ga0209489_100196 3300027361 Bacteria 97498
550 Ga0209700_100006 3300027363 Bacteria 530958
551 Ga0209700_100012 3300027363 Bacteria 357892
552 Ga0209588_1081802 3300027671 Bacteria 1043
553 Ga0209813_10215257 3300027866 Bacteria 717
554 Ga0268266_10001750 3300028379 Bacteria 24844
555 Ga0268266_10012580 3300028379 Bacteria 7312
556 Ga0268266_10020716 3300028379 Bacteria 5605
557 Ga0268266_10182525 3300028379 Bacteria 1911
558 Ga0268266_10440426 3300028379 Bacteria 1237
559 Ga0268266_11062369 3300028379 Bacteria 783
560 Ga0268265_10078508 3300028380 Bacteria 2596
561 Ga0268265_10098350 3300028380 Bacteria 2356
562 Ga0268265_10182067 3300028380 Bacteria 1806
563 Ga0268265_10317928 3300028380 Bacteria 1408
564 Ga0268265_11219140 3300028380 Bacteria 750
565 Ga0268265_11260766 3300028380 Bacteria 738
566 Ga0268264_10000042 3300028381 Bacteria 372069
567 Ga0268264_10157436 3300028381 Bacteria 2043
568 Ga0268264_10208538 3300028381 Bacteria 1792
569 Ga0268264_10240998 3300028381 Bacteria 1675
570 Ga0268264_10484116 3300028381 Bacteria 1204
571 Ga0268264_10999100 3300028381 Bacteria 843
572 Ga0307517_10111696 3300028786 Bacteria 2075
573 Ga0307517_10319483 3300028786 Bacteria 860
574 Ga0307511_10097830 3300030521 Bacteria 1946
575 Ga0307511_10357059 3300030521 Bacteria 624
576 Ga0265763_1003622 3300030763 Bacteria 1237
577 Ga0265330_10041534 3300031235 Bacteria 2039
578 Ga0265332_10010699 3300031238 Bacteria 4080
579 Ga0265332_10069712 3300031238 Bacteria 1498
580 Ga0265325_10006203 3300031241 Bacteria 7289
581 Ga0265340_10422145 3300031247 Bacteria 588
582 Ga0265339_10058663 3300031249 Bacteria 2078
583 Ga0307513_10661935 3300031456 Bacteria 751
584 Ga0307509_10064485 3300031507 Bacteria 3852
585 Ga0307509_10145606 3300031507 Bacteria 2295
586 Ga0307509_10236279 3300031507 Bacteria 1625
587 Ga0307408_100297561 3300031548 Bacteria 1350
588 Ga0307408_101237452 3300031548 Bacteria 698
589 Ga0265313_10128288 3300031595 Bacteria 1101
590 Ga0307508_10000019 3300031616 Bacteria 197575
591 Ga0307508_10028707 3300031616 Bacteria 5030
592 Ga0307508_10527312 3300031616 Bacteria 777
593 Ga0265314_10062912 3300031711 Bacteria 2520
594 Ga0265314_10101325 3300031711 Bacteria 1850
595 Ga0265342_10024875 3300031712 Bacteria 3773
596 Ga0307516_10031276 3300031730 Bacteria 5365
597 Ga0307516_10222211 3300031730 Bacteria 1597
598 Ga0307516_10479814 3300031730 Bacteria 898
599 Ga0307405_10404626 3300031731 Bacteria 1069
600 Ga0307413_10046074 3300031824 Bacteria 2590
601 Ga0307410_10178068 3300031852 Bacteria 1608
602 Ga0307407_11114944 3300031903 Bacteria 614
603 Ga0307416_101070613 3300032002 Bacteria 910
604 Ga0307415_100152049 3300032126 Bacteria 1783
605 Ga0307507_10027162 3300033179 Bacteria 6144
606 Ga0307510_10012956 3300033180 Bacteria 9898
607 Ga0307510_10063261 3300033180 Bacteria 3770
608 Ga0307510_10212742 3300033180 Bacteria 1454
609 Ga0315911_1000012 3300033442 Bacteria 248988
610 Ga0316215_1006075 3300033544 Bacteria 1168
611 Ga0373948_0063694 3300034817 Bacteria 814
612 Ga0373934_0032798 3300035086 Bacteria 2038
613 Ga0373952_0017318 3300035092 Bacteria 1477
614 Ga0373923_0001449 3300035111 Bacteria 6805
615 Ga0373923_0071395 3300035111 Bacteria 1491
616 Ga0373945_0274618 3300035116 Bacteria 717
617 Ga0373953_0020632 3300035117 Bacteria 2463
618 Ga0373954_0005227 3300035118 Bacteria 5609
619 Ga0373954_0024857 3300035118 Bacteria 2733
620 Ga0373956_0037950 3300035119 Bacteria 2130
621 Ga0373943_0057731 3300035170 Bacteria 1929
622 Ga0373946_0031993 3300035171 Bacteria 2110
623 Ga0373955_0018171 3300035172 Bacteria 3493
624 Ga0373955_0112026 3300035172 Bacteria 1578
625 Ga0373924_0128840 3300035410 Bacteria 1100
626 Ga0373931_0259862 3300035691 Bacteria 1059
627 Ga0373935_0731878 3300035692 Bacteria 728
628 Ga0373927_0019061 3300035695 Bacteria 4499
629 Ga0373927_0033776 3300035695 Bacteria 3329
630 Ga0373927_0226772 3300035695 Bacteria 1227
631 Ga0373933_0000063 3300035724 Bacteria 64367
632 Ga0373933_0022082 3300035724 Bacteria 3622
633 Ga0373947_0010644 3300035725 Bacteria 5278
634 Ga0373947_0356258 3300035725 Bacteria 982
635 Ga0373947_0754854 3300035725 Bacteria 664
636 Ga0373937_0015969 3300036401 Bacteria 6658
637 Ga0373937_0166920 3300036401 Bacteria 2064
638 Ga0372808_024717 3300036459 Bacteria 862
639 Ga0373925_0014564 3300037068 Bacteria 5684
640 Ga0373925_0031600 3300037068 Bacteria 3891
641 Ga0373925_0182921 3300037068 Bacteria 1660
642 Ga0373925_0663440 3300037068 Bacteria 860
643 Ga0395900_0257682 3300037418 Bacteria 1743
644 Ga0395900_0467664 3300037418 Bacteria 1215
645 Ga0395905_0036933 3300037471 Bacteria 4589
646 Ga0395905_0141495 3300037471 Bacteria 2263
647 Ga0395905_0331798 3300037471 Bacteria 1412
648 Ga0395901_0181460 3300038443 Bacteria 2208
649 Ga0395901_0791282 3300038443 Bacteria 938
650 Ga0436365_0717605 3300039437 Bacteria 7228
651 Ga0436365_1325472 3300039437 Bacteria 669
652 Ga0436360_1239273 3300039438 Bacteria 1782
653 Ga0436361_0844543 3300039447 Bacteria 5946
654 Ga0436363_0375853 3300039450 Bacteria 1141
655 Ga0436363_0392343 3300039450 Bacteria 1978
656 Ga0439465_0069580 3300041413 Bacteria 1178
657 Ga0451791_1341753 3300041451 Bacteria 692
658 Ga0451795_1660820 3300041456 Bacteria 1327
659 Ga0451802_1316910 3300041460 Bacteria 852
660 Ga0439455_0042423 3300042012 Bacteria 1169
661 Ga0466969_0037060 3300044656 Bacteria 2461
662 Ga0466965_0001649 3300044683 Bacteria 9145
663 Ga0466966_0437489 3300044684 Bacteria 786
664 Ga0466968_0177229 3300044735 Bacteria 990
665 Ga0466959_0093678 3300045049 Bacteria 2155
666 Ga0466959_0227168 3300045049 Bacteria 1293
667 Ga0466967_0006925 3300045976 Bacteria 8105
668 Ga0466967_0220271 3300045976 Bacteria 1803
669 Ga0466967_0652546 3300045976 Bacteria 1040
670 Ga0466967_0731326 3300045976 Bacteria 981
671 Ga0466967_0757066 3300045976 Bacteria 963
672 Ga0466967_1313103 3300045976 Bacteria 720
673 Ga0495617_066080 3300046452 Bacteria 1192
674 Ga0495617_075090 3300046452 Bacteria 1109
675 Ga0495592_0066237 3300046454 Bacteria 2643
676 Ga0495592_0586255 3300046454 Bacteria 681
677 Ga0495603_0046839 3300046455 Bacteria 2576
678 Ga0495603_0098426 3300046455 Bacteria 1708
679 Ga0495603_0207647 3300046455 Bacteria 1131
680 Ga0495603_0308214 3300046455 Bacteria 909
681 Ga0495603_0481901 3300046455 Bacteria 710
682 Ga0495590_0116349 3300046457 Bacteria 956
683 Ga0495590_0216556 3300046457 Bacteria 707
684 Ga0495591_072731 3300046458 Bacteria 890
685 Ga0495629_0062767 3300046459 Bacteria 2594
686 Ga0495629_0063946 3300046459 Bacteria 2569
687 Ga0495629_0292168 3300046459 Bacteria 1117
688 Ga0495638_0018594 3300046460 Bacteria 4612
689 Ga0495638_0376603 3300046460 Bacteria 742
690 Ga0495641_0168302 3300046461 Bacteria 981
691 Ga0495641_0250126 3300046461 Bacteria 797
692 Ga0495651_0008281 3300046462 Bacteria 7967
693 Ga0495651_0070262 3300046462 Bacteria 2665
694 Ga0495653_0015404 3300046463 Bacteria 6232
695 Ga0495650_0059806 3300046471 Bacteria 1533
696 Ga0495580_0136985 3300046472 Bacteria 1697
697 Ga0495580_0261951 3300046472 Bacteria 1182
698 Ga0495582_0039702 3300046473 Bacteria 2591
699 Ga0495639_0027583 3300046475 Bacteria 2514
700 Ga0495639_0172023 3300046475 Bacteria 1052
701 Ga0495662_0067305 3300046476 Bacteria 1733
702 Ga0495662_0174281 3300046476 Bacteria 1060
703 Ga0495664_0006295 3300046477 Bacteria 6554
704 Ga0495664_0007640 3300046477 Bacteria 6010
705 Ga0495664_0040645 3300046477 Bacteria 2751
706 Ga0495664_0077643 3300046477 Bacteria 1989
707 Ga0495664_0156330 3300046477 Bacteria 1383
708 Ga0495664_0411068 3300046477 Bacteria 812
709 Ga0495584_0199374 3300046491 Bacteria 1017
710 Ga0495584_0310754 3300046491 Bacteria 800
711 Ga0495584_0510450 3300046491 Bacteria 612
712 Ga0495585_0125079 3300046492 Bacteria 1357
713 Ga0495585_0295182 3300046492 Bacteria 798
714 Ga0495596_0031995 3300046500 Bacteria 2099
715 Ga0495596_0037542 3300046500 Bacteria 1915
716 Ga0495607_0079379 3300046501 Bacteria 1808
717 Ga0495607_0117166 3300046501 Bacteria 1404
718 Ga0495607_0126593 3300046501 Bacteria 1335
719 Ga0495606_0034184 3300046507 Bacteria 3492
720 Ga0495606_0062400 3300046507 Bacteria 2379
721 Ga0495606_0218832 3300046507 Bacteria 1074
722 Ga0495606_0299848 3300046507 Bacteria 871
723 Ga0495608_0030647 3300046511 Bacteria 3641
724 Ga0495608_0037928 3300046511 Bacteria 3239
725 Ga0495608_0090356 3300046511 Bacteria 1981
726 Ga0495608_0131373 3300046511 Bacteria 1602
727 Ga0495610_0114525 3300046512 Bacteria 1190
728 Ga0495618_0027210 3300046514 Bacteria 3560
729 Ga0495618_0159045 3300046514 Bacteria 1441
730 Ga0495620_0124095 3300046515 Bacteria 1016
731 Ga0495628_0012808 3300046516 Bacteria 7061
732 Ga0495628_0073069 3300046516 Bacteria 2672
733 Ga0495628_0823006 3300046516 Bacteria 648
734 Ga0495630_0025809 3300046517 Bacteria 4346
735 Ga0495631_0076240 3300046518 Bacteria 1447
736 Ga0495631_0178702 3300046518 Bacteria 909
737 Ga0495631_0278335 3300046518 Bacteria 712
738 Ga0495632_0336178 3300046519 Bacteria 665
739 Ga0495644_0106168 3300046523 Bacteria 1064
740 Ga0495648_0065044 3300046524 Bacteria 2146
741 Ga0495648_0112223 3300046524 Bacteria 1481
742 Ga0495648_0324407 3300046524 Bacteria 712
743 Ga0495666_0082498 3300046526 Bacteria 1520
744 Ga0495652_0008389 3300046529 Bacteria 9433
745 Ga0495652_0015423 3300046529 Bacteria 6843
746 Ga0495652_0298760 3300046529 Bacteria 1171
747 Ga0495665_0014869 3300046531 Bacteria 4192
748 Ga0495640_0007684 3300046533 Bacteria 8479
749 Ga0495640_0069972 3300046533 Bacteria 2359
750 Ga0495640_0122825 3300046533 Bacteria 1686
751 Ga0495586_0097950 3300046535 Bacteria 1625
752 Ga0495587_0004526 3300046536 Bacteria 9134
753 Ga0495587_0041752 3300046536 Bacteria 2736
754 Ga0495587_0150985 3300046536 Bacteria 1324
755 Ga0495598_0085115 3300046537 Bacteria 1021
756 Ga0495609_0054630 3300046538 Bacteria 1773
757 Ga0495609_0223900 3300046538 Bacteria 780
758 Ga0495621_0013631 3300046539 Bacteria 2558
759 Ga0495622_0032380 3300046557 Bacteria 2441
760 Ga0495622_0073468 3300046557 Bacteria 1577
761 Ga0495622_0088900 3300046557 Bacteria 1420
762 Ga0495633_0032239 3300046558 Bacteria 2533
763 Ga0495633_0228016 3300046558 Bacteria 852
764 Ga0495667_0066349 3300046559 Bacteria 2359
765 Ga0495656_0005186 3300046615 Bacteria 4492
766 Ga0495656_0278278 3300046615 Bacteria 852
767 Ga0495656_0407025 3300046615 Bacteria 712
768 Ga0495668_0153560 3300046616 Bacteria 1261
769 Ga0495668_0210281 3300046616 Bacteria 1065
770 Ga0495634_0042931 3300046642 Bacteria 3066
771 Ga0495634_0139915 3300046642 Bacteria 1537
772 Ga0495611_0307394 3300046648 Bacteria 730
773 Ga0495625_0181455 3300046660 Bacteria 1399
774 Ga0495625_0222170 3300046660 Bacteria 1237
775 Ga0495625_0253983 3300046660 Bacteria 1140
776 Ga0495625_0346260 3300046660 Bacteria 940
777 Ga0495625_0453145 3300046660 Bacteria 792
778 Ga0495635_0038939 3300046663 Bacteria 3291
779 Ga0495635_0066373 3300046663 Bacteria 2474
780 Ga0495635_0245259 3300046663 Bacteria 1208
781 Ga0495659_0012114 3300046664 Bacteria 2788
782 Ga0495661_0192003 3300046665 Bacteria 1075
783 Ga0495588_0002970 3300046674 Bacteria 7327
784 Ga0495657_0004660 3300046675 Bacteria 10937
785 Ga0495657_0007028 3300046675 Bacteria 8729
786 Ga0495657_0058516 3300046675 Bacteria 2559
787 Ga0495599_0003699 3300046678 Bacteria 8962
788 Ga0495599_0004338 3300046678 Bacteria 8391
789 Ga0495599_0094757 3300046678 Bacteria 1862
790 Ga0495623_0003278 3300046679 Bacteria 10685
791 Ga0495623_0003743 3300046679 Bacteria 10032
792 Ga0495623_0331496 3300046679 Bacteria 833
793 Ga0495646_0010569 3300046680 Bacteria 5864
794 Ga0495646_0028033 3300046680 Bacteria 3529
795 Ga0495647_0032616 3300046681 Bacteria 1942
796 Ga0495647_0331069 3300046681 Bacteria 691
797 Ga0495658_0007910 3300046683 Bacteria 5263
798 Ga0495669_0011303 3300046684 Bacteria 3789
799 Ga0495669_0142073 3300046684 Bacteria 1133
800 Ga0495613_0373748 3300046689 Bacteria 976
801 Ga0495624_0083074 3300046690 Bacteria 1981
802 Ga0495624_0115589 3300046690 Bacteria 1649
803 Ga0495649_0034578 3300046694 Bacteria 2780
804 Ga0495649_0230755 3300046694 Bacteria 955
805 Ga0495649_0516047 3300046694 Bacteria 593
806 Ga0495589_0393543 3300046794 Bacteria 636
807 Ga0495600_0008553 3300046809 Bacteria 6293
808 Ga0495600_0032974 3300046809 Bacteria 3361
809 Ga0495600_0207430 3300046809 Bacteria 1256
810 Ga0495660_0281799 3300046810 Bacteria 760
811 Ga0495581_0025228 3300047315 Bacteria 3447
812 Ga0495581_0151802 3300047315 Bacteria 1353
813 Ga0495604_0011018 3300047317 Bacteria 7175
814 Ga0495604_0089032 3300047317 Bacteria 2295
815 Ga0495674_0003624 3300047319 Bacteria 15031
816 Ga0495674_0026977 3300047319 Bacteria 5253
817 Ga0495674_0314800 3300047319 Bacteria 1276
818 Ga0495674_0373135 3300047319 Bacteria 1155
819 Ga0495672_0031547 3300047320 Bacteria 3307
820 Ga0495672_0077853 3300047320 Bacteria 1857
821 Ga0495676_0073366 3300047321 Bacteria 2624
822 Ga0495676_0219164 3300047321 Bacteria 1312
823 Ga0495676_0556659 3300047321 Bacteria 749
824 Ga0495680_0021316 3300047322 Bacteria 5426
825 Ga0495680_0063648 3300047322 Bacteria 2832
826 Ga0495680_0390104 3300047322 Bacteria 963
827 Ga0495683_0266808 3300047323 Bacteria 746
828 Ga0495675_0054298 3300047444 Bacteria 2542
829 Ga0495675_0167543 3300047444 Bacteria 1350
830 Ga0495677_0016237 3300047445 Bacteria 2701
831 Ga0495673_0027590 3300047469 Bacteria 2700
832 Ga0495673_0116220 3300047469 Bacteria 1064
833 Ga0495673_0162606 3300047469 Bacteria 856
834 Ga0495673_0194194 3300047469 Bacteria 762
835 Ga0495684_0144787 3300047471 Bacteria 1780
836 Ga0495686_0022800 3300047472 Bacteria 4137
837 Ga0495686_0092187 3300047472 Bacteria 1838
838 Ga0495686_0137307 3300047472 Bacteria 1445
839 Ga0495686_0205080 3300047472 Bacteria 1129
840 Ga0495593_0080074 3300047673 Bacteria 1690
841 Ga0495593_0153827 3300047673 Bacteria 1163
842 Ga0495602_0009817 3300048088 Bacteria 9933
843 Ga0495602_0030956 3300048088 Bacteria 5065
844 Ga0495615_0072732 3300048090 Bacteria 929
845 Ga0496100_0025148 3300048903 Bacteria 3639
846 Ga0496100_0073207 3300048903 Bacteria 2292
847 Ga0496100_0133391 3300048903 Bacteria 1752
848 Ga0496100_0156872 3300048903 Bacteria 1628
849 Ga0496100_0425267 3300048903 Bacteria 1015
850 Ga0496100_0522323 3300048903 Bacteria 916
851 Ga0496101_0066084 3300048904 Bacteria 2637
852 Ga0496101_0125304 3300048904 Bacteria 1946
853 Ga0496101_0129051 3300048904 Bacteria 1918
854 Ga0496101_0141529 3300048904 Bacteria 1834
855 Ga0496101_0309829 3300048904 Bacteria 1237
856 Ga0496101_0637172 3300048904 Bacteria 842
857 Ga0496102_0011346 3300048905 Bacteria 7677
858 Ga0496102_0014546 3300048905 Bacteria 6838
859 Ga0496102_0129342 3300048905 Bacteria 2362
860 Ga0496102_0160421 3300048905 Bacteria 2115
861 Ga0496102_0229966 3300048905 Bacteria 1748
862 Ga0496102_0908406 3300048905 Bacteria 802
863 Ga0496103_0047445 3300048906 Bacteria 2654
864 Ga0496103_0239888 3300048906 Bacteria 1166
865 Ga0496104_0008837 3300048907 Bacteria 8957
866 Ga0496104_0016671 3300048907 Bacteria 6677
867 Ga0496104_0053104 3300048907 Bacteria 3828
868 Ga0496104_0400116 3300048907 Bacteria 1285
869 Ga0496105_0004610 3300048908 Bacteria 10383
870 Ga0496105_0010647 3300048908 Bacteria 7236
871 Ga0496105_0157233 3300048908 Bacteria 1867
872 Ga0496105_0417425 3300048908 Bacteria 1063
873 Ga0496106_0000686 3300048909 Bacteria 24281
874 Ga0496106_0018004 3300048909 Bacteria 5224
875 Ga0496106_0045929 3300048909 Bacteria 3282
876 Ga0496106_0264207 3300048909 Bacteria 1377
877 Ga0496106_0952757 3300048909 Bacteria 676
878 Ga0496107_0002437 3300048910 Bacteria 12048
879 Ga0496107_0050506 3300048910 Bacteria 2998
880 Ga0496107_0221256 3300048910 Bacteria 1408
881 Ga0496107_0258987 3300048910 Bacteria 1294
882 Ga0496108_0025485 3300048911 Bacteria 4873
883 Ga0496108_0044102 3300048911 Bacteria 3724
884 Ga0496108_0410083 3300048911 Bacteria 1183
885 Ga0496108_0749129 3300048911 Bacteria 845
886 Ga0496108_0852258 3300048911 Bacteria 784
887 Ga0496109_0003924 3300048912 Bacteria 12429
888 Ga0496109_0045827 3300048912 Bacteria 3970
889 Ga0496109_0165052 3300048912 Bacteria 2076
890 Ga0496109_0233844 3300048912 Bacteria 1729
891 Ga0496110_0089556 3300048913 Bacteria 2750
892 Ga0496110_0209409 3300048913 Bacteria 1772
893 Ga0496111_0035774 3300048914 Bacteria 3550
894 Ga0496111_0097953 3300048914 Bacteria 2153
895 Ga0496111_0288787 3300048914 Bacteria 1216
896 Ga0496111_0340517 3300048914 Bacteria 1110
897 Ga0496111_0608327 3300048914 Bacteria 800
898 Ga0496112_0006770 3300048915 Bacteria 10100
899 Ga0496112_0051032 3300048915 Bacteria 4057
900 Ga0496112_0148125 3300048915 Bacteria 2315
901 Ga0496113_0044120 3300048916 Bacteria 3302
902 Ga0496113_0093280 3300048916 Bacteria 2323
903 Ga0496113_0260109 3300048916 Bacteria 1386
904 Ga0496114_0008237 3300048917 Bacteria 8262
905 Ga0496114_0058373 3300048917 Bacteria 3222
906 Ga0496114_0061251 3300048917 Bacteria 3147
907 Ga0496114_0453507 3300048917 Bacteria 1135
908 Ga0496115_0004137 3300048918 Bacteria 10474
909 Ga0496115_0038906 3300048918 Bacteria 3777
910 Ga0496115_0070621 3300048918 Bacteria 2831
911 Ga0496115_0073684 3300048918 Bacteria 2772
912 Ga0496115_0457806 3300048918 Bacteria 1030
913 Ga0496115_0562589 3300048918 Bacteria 910
914 Ga0496115_0909291 3300048918 Bacteria 678
915 Ga0496116_0051720 3300048919 Bacteria 2727
916 Ga0496116_0146804 3300048919 Bacteria 1317
917 Ga0496116_0349303 3300048919 Bacteria 678
918 Ga0496117_0099835 3300048920 Bacteria 1840
919 Ga0496117_0212196 3300048920 Bacteria 1084
920 Ga0496118_0002254 3300048921 Bacteria 26418
921 Ga0496118_0066683 3300048921 Bacteria 2626
922 Ga0496118_0207120 3300048921 Bacteria 1155
923 Ga0496119_0028316 3300048922 Bacteria 3825
924 Ga0496119_0060196 3300048922 Bacteria 2275
925 Ga0496119_0146391 3300048922 Bacteria 1270
926 Ga0496120_0025120 3300048923 Bacteria 3702
927 Ga0496120_0026454 3300048923 Bacteria 3582
928 Ga0496120_0252140 3300048923 Bacteria 828
929 Ga0496121_0000418 3300048924 Bacteria 84182
930 Ga0496121_0002936 3300048924 Bacteria 24924
931 Ga0496121_0069154 3300048924 Bacteria 2851
932 Ga0496121_0089141 3300048924 Bacteria 2416
933 Ga0496121_0094832 3300048924 Bacteria 2320
934 Ga0496121_0105044 3300048924 Bacteria 2168
935 Ga0496121_0165237 3300048924 Bacteria 1614
936 Ga0496121_0187326 3300048924 Bacteria 1487
937 Ga0496121_0471870 3300048924 Bacteria 803
938 Ga0496121_0490409 3300048924 Bacteria 782
939 Ga0496122_0060272 3300048925 Bacteria 2796
940 Ga0496124_0013566 3300048927 Bacteria 7945
941 Ga0496124_0352026 3300048927 Bacteria 1041
942 Ga0496124_0447110 3300048927 Bacteria 882
943 Ga0496124_0673290 3300048927 Bacteria 660
944 Ga0496125_0079515 3300048928 Bacteria 2515
945 Ga0496125_0326424 3300048928 Bacteria 928
946 Ga0496125_0556472 3300048928 Bacteria 634
947 Ga0496126_0014146 3300048929 Bacteria 8076
948 Ga0496126_0047134 3300048929 Bacteria 3946
949 Ga0496126_0059646 3300048929 Bacteria 3435
950 Ga0496126_0067084 3300048929 Bacteria 3206
951 Ga0496126_0085351 3300048929 Bacteria 2783
952 Ga0496126_0085769 3300048929 Bacteria 2775
953 Ga0496126_0112964 3300048929 Bacteria 2365
954 Ga0496126_0223051 3300048929 Bacteria 1582
955 Ga0496126_0292524 3300048929 Bacteria 1346
956 Ga0496126_0564181 3300048929 Bacteria 901
957 Ga0496126_0621626 3300048929 Bacteria 849
958 Ga0496126_0624353 3300048929 Bacteria 846
959 Ga0495678_048931 3300049459 Bacteria 1646
960 Ga0495682_0025714 3300049460 Bacteria 2190
961 Ga0495682_0183012 3300049460 Bacteria 744
962 Ga0501032_0147452 3300049569 Bacteria 1548
963 Ga0501033_0046533 3300049570 Bacteria 3225
964 Ga0501033_0528186 3300049570 Bacteria 814
965 Ga0501036_0280472 3300049572 Bacteria 1394
966 Ga0501038_0492247 3300049574 Bacteria 938
967 Ga0501038_0833650 3300049574 Bacteria 684
968 Ga0501042_0204330 3300049578 Bacteria 1425
969 Ga0501043_0217688 3300049579 Bacteria 1478
970 Ga0501046_0098652 3300049580 Bacteria 2243
971 Ga0501046_0224021 3300049580 Bacteria 1391
972 Ga0501046_0339157 3300049580 Bacteria 1093
973 Ga0501047_0016108 3300049581 Bacteria 7130
974 Ga0501047_0245365 3300049581 Bacteria 1640
975 Ga0501047_0800163 3300049581 Bacteria 757
976 Ga0501067_0376761 3300049583 Bacteria 791
977 Ga0501068_0377371 3300049584 Bacteria 913
978 Ga0501070_0023474 3300049586 Bacteria 5166
979 Ga0501073_0385148 3300049589 Bacteria 969
980 Ga0501074_0009318 3300049590 Bacteria 7132
981 Ga0501079_0587908 3300049741 Bacteria 876
982 Ga0501080_0078718 3300049742 Bacteria 3065
983 Ga0501080_0269278 3300049742 Bacteria 1551
984 Ga0501044_0021890 3300049823 Bacteria 6817
985 Ga0501045_0277812 3300049824 Bacteria 1247
986 nmdc:mga03n38_292223_c1 3300050490 Bacteria 873
987 nmdc:mga03n38_50730_c1 3300050490 Bacteria 1851
988 nmdc:mga00v17_60702_c1 3300050491 Bacteria 2323
989 nmdc:mga0yw44_127605_c1 3300050492 Bacteria 1644
990 nmdc:mga0yw44_202907_c1 3300050492 Bacteria 1310
991 nmdc:mga0yw44_58600_c1 3300050492 Bacteria 2353
992 nmdc:mga0yw44_658171_c1 3300050492 Bacteria 712
993 nmdc:mga0yw44_91492_c1 3300050492 Bacteria 1923
994 nmdc:mga0yw44_99297_c1 3300050492 Bacteria 1852
995 nmdc:mga0k408_141336_c1 3300050493 Bacteria 1432
996 nmdc:mga0k408_31373_c1 3300050493 Bacteria 3034
997 nmdc:mga0k408_423327_c1 3300050493 Bacteria 792
998 nmdc:mga0k408_447766_c1 3300050493 Bacteria 767
999 nmdc:mga06z11_118819_c1 3300050494 Bacteria 1473
1000 nmdc:mga06z11_535315_c1 3300050494 Bacteria 711
1001 nmdc:mga06z11_70679_c1 3300050494 Bacteria 1846
1002 nmdc:mga06z11_71378_c1 3300050494 Bacteria 1838
1003 nmdc:mga07m45_15195_c1 3300050496 Bacteria 4110
1004 nmdc:mga07m45_54820_c1 3300050496 Bacteria 2253
1005 nmdc:mga05p37_625615_c1 3300050507 Bacteria 1210
1006 nmdc:mga08y16_608506_c1 3300050511 Bacteria 1101
1007 nmdc:mga0n895_92585_c1 3300050512 Bacteria 3026
1008 nmdc:mga0rr50_190052_c1 3300050513 Bacteria 1682
1009 nmdc:mga08x19_226641_c1 3300050514 Bacteria 1285
1010 nmdc:mga0sz30_12995_c1 3300050516 Bacteria 3251
1011 Ga0495601_0006668 3300053077 Bacteria 6757
1012 Ga0495601_0049547 3300053077 Bacteria 2648
1013 Ga0495601_0458751 3300053077 Bacteria 824
1014 Ga0495601_0636049 3300053077 Bacteria 683
1015 Ga0495612_0017107 3300053078 Bacteria 2904
1016 Ga0495612_0020652 3300053078 Bacteria 2640
1017 Ga0495612_0047459 3300053078 Bacteria 1760
1018 Ga0495612_0057198 3300053078 Bacteria 1610
1019 Ga0500635_0008731 3300053080 Bacteria 2789
1020 Ga0500635_0027860 3300053080 Bacteria 1799
1021 Ga0495655_0032705 3300053083 Bacteria 1275
1022 Ga0495595_0003659 3300053084 Bacteria 6105
1023 Ga0495619_0127330 3300053085 Bacteria 1748
1024 Ga0500578_0225374 3300053086 Bacteria 1138
1025 Ga0500578_0374342 3300053086 Bacteria 827
1026 Ga0500578_0427379 3300053086 Bacteria 758
1027 Ga0500643_000013 3300053087 Bacteria 324296
1028 Ga0500643_031899 3300053087 Bacteria 1603
1029 Ga0500647_0025467 3300053091 Bacteria 2788
1030 Ga0500583_0021956 3300053092 Bacteria 2666
1031 Ga0500566_0001097 3300053094 Bacteria 15678
1032 Ga0500566_0165914 3300053094 Bacteria 1146
1033 Ga0500566_0201950 3300053094 Bacteria 1003
1034 Ga0500566_0253961 3300053094 Bacteria 853
1035 Ga0500640_011592 3300053095 Bacteria 3596
1036 Ga0500641_0024104 3300053096 Bacteria 2344
1037 Ga0500641_0063860 3300053096 Bacteria 1537
1038 Ga0500554_051934 3300053102 Bacteria 1293
1039 Ga0500555_002043 3300053103 Bacteria 5947
1040 Ga0500557_000030 3300053105 Bacteria 76944
1041 Ga0500562_081766 3300053108 Bacteria 874
1042 Ga0500569_000335 3300053109 Bacteria 7533
1043 Ga0500569_034409 3300053109 Bacteria 1446
1044 Ga0500572_000564 3300053111 Bacteria 12638
1045 Ga0500591_101917 3300053115 Bacteria 1225
1046 Ga0500594_0053729 3300053118 Bacteria 1142
1047 Ga0500595_004179 3300053119 Bacteria 6538
1048 Ga0500595_020224 3300053119 Bacteria 2400
1049 Ga0500595_086750 3300053119 Bacteria 910
1050 Ga0500608_043507 3300053122 Bacteria 2156
1051 Ga0500614_001304 3300053123 Bacteria 6021
1052 Ga0500626_077751 3300053128 Bacteria 1470
1053 Ga0500642_0001580 3300053130 Bacteria 6569
1054 Ga0500642_0102946 3300053130 Bacteria 1329
1055 Ga0500642_0172867 3300053130 Bacteria 1011
1056 Ga0500655_021885 3300053133 Bacteria 1201
1057 Ga0500655_081654 3300053133 Bacteria 666
1058 Ga0500658_0368940 3300053134 Bacteria 658
1059 Ga0500559_0002228 3300053136 Bacteria 10247
1060 Ga0500559_0006528 3300053136 Bacteria 5265
1061 Ga0500577_0057543 3300053142 Bacteria 1484
1062 Ga0500577_0088701 3300053142 Bacteria 1246
1063 Ga0500588_0169645 3300053146 Bacteria 798
1064 Ga0500590_042681 3300053148 Bacteria 2328
1065 Ga0500590_058776 3300053148 Bacteria 1936
1066 Ga0500603_001009 3300053150 Bacteria 6625
1067 Ga0500603_155260 3300053150 Bacteria 711
1068 Ga0500604_0055264 3300053151 Bacteria 1234
1069 Ga0500616_0050783 3300053153 Bacteria 2188
1070 Ga0500622_0006329 3300053156 Bacteria 6904
1071 Ga0500622_0180231 3300053156 Bacteria 977
1072 Ga0500624_016763 3300053157 Bacteria 1135
1073 Ga0500627_0216478 3300053158 Bacteria 856
1074 Ga0500627_0361846 3300053158 Bacteria 624
1075 Ga0500630_034670 3300053159 Bacteria 2474
1076 Ga0500634_0146500 3300053161 Bacteria 1110
1077 Ga0500638_081586 3300053162 Bacteria 1535
1078 Ga0500638_316079 3300053162 Bacteria 595
1079 Ga0500639_000006 3300053163 Bacteria 165068
1080 Ga0500639_203396 3300053163 Bacteria 848
1081 Ga0500636_0002456 3300053177 Bacteria 10275
1082 Ga0500636_0033974 3300053177 Bacteria 3018
1083 Ga0500636_0183865 3300053177 Bacteria 1120
1084 Ga0500637_0055570 3300053178 Bacteria 2261
1085 Ga0500637_0083616 3300053178 Bacteria 1845
1086 Ga0500611_015747 3300053727 Bacteria 1345
1087 Ga0500645_048655 3300053730 Bacteria 1241
1088 Ga0500645_160437 3300053730 Bacteria 617
1089 Ga0500609_019840 3300053731 Bacteria 916
1090 Ga0500552_022651 3300053733 Bacteria 909
1091 Ga0500596_002150 3300053735 Bacteria 3909
1092 Ga0500596_009653 3300053735 Bacteria 1501
1093 Ga0500601_000881 3300053737 Bacteria 3603
1094 Ga0500661_011876 3300055283 Bacteria 1575
1095 Ga0501082_0742092 3300060353 Bacteria 859
1096 Ga0466962_0035331 3300061719 Bacteria 2393

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025315 Ga0207697_10125145 Ga0207697_101251452 160
2 3300006941 Ga0099825_1039163 Ga0099825_10391632 162
3 3300006942 Ga0099824_1010512 Ga0099824_10105123 162
4 3300006943 Ga0099822_1001984 Ga0099822_10019846 162
5 3300027357 Ga0209589_1000005 Ga0209589_1000005486 162
6 3300027361 Ga0209489_100005 Ga0209489_100005486 162
7 3300027363 Ga0209700_100006 Ga0209700_100006486 162
8 3300006048 Ga0075363_100353894 Ga0075363_1003538942 166
9 3300010375 Ga0105239_11131298 Ga0105239_111312982 166
10 3300025261 Ga0209233_1016731 Ga0209233_10167314 166
11 3300048924 Ga0496121_0490409 Ga0496121_0490409_150_698 166
12 3300050490 nmdc:mga03n38_292223_c1 nmdc:mga03n38_292223_c1_49_609 166
13 3300053077 Ga0495601_0049547 Ga0495601_0049547_755_1303 166
14 3300035695 Ga0373927_0226772 Ga0373927_0226772_456_959 167
15 3300045976 Ga0466967_0757066 Ga0466967_0757066_44_592 167
16 3300048929 Ga0496126_0047134 Ga0496126_0047134_2504_3007 167
17 3300028381 Ga0268264_10240998 Ga0268264_102409982 168
18 3300046477 Ga0495664_0156330 Ga0495664_0156330_98_646 169
19 3300046535 Ga0495586_0097950 Ga0495586_0097950_1054_1563 169
20 3300046678 Ga0495599_0094757 Ga0495599_0094757_560_1108 169
21 3300049580 Ga0501046_0339157 Ga0501046_0339157_154_702 169
22 3300049581 Ga0501047_0016108 Ga0501047_0016108_135_683 169
23 3300049586 Ga0501070_0023474 Ga0501070_0023474_1654_2202 169
24 3300049590 Ga0501074_0009318 Ga0501074_0009318_637_1185 169
25 3300049742 Ga0501080_0078718 Ga0501080_0078718_394_942 169
26 3300049823 Ga0501044_0021890 Ga0501044_0021890_3786_4334 169
27 3300053078 Ga0495612_0047459 Ga0495612_0047459_858_1406 169
28 3300046477 Ga0495664_0077643 Ga0495664_0077643_513_1061 170
29 3300005436 Ga0070713_100075767 Ga0070713_1000757672 172
30 3300005467 Ga0070706_100155389 Ga0070706_1001553892 172
31 3300005471 Ga0070698_100167764 Ga0070698_1001677644 172
32 3300005614 Ga0068856_100731315 Ga0068856_1007313152 172
33 3300009101 Ga0105247_10107421 Ga0105247_101074213 172
34 3300011119 Ga0105246_10094671 Ga0105246_100946712 172
35 3300014968 Ga0157379_10079606 Ga0157379_100796064 172
36 3300021377 Ga0213874_10040348 Ga0213874_100403482 172
37 3300025910 Ga0207684_10140603 Ga0207684_101406032 172
38 3300025922 Ga0207646_10142063 Ga0207646_101420632 172
39 3300039437 Ga0436365_0717605 Ga0436365_0717605_5049_5597 172
40 3300039450 Ga0436363_0392343 Ga0436363_0392343_1205_1753 172
41 iso_pu_bacteria 8016583857 8016587881 176
42 3300033442 Ga0315911_1000012 Ga0315911_100001272 177
43 iso_pu_bacteria 2888419890 2888426705 177
44 iso_pu_bacteria 2507262055 2507511968 178
45 iso_pu_bacteria 2508501128 2509148092 178
46 iso_pu_bacteria 2511231028 2511398041 178
47 iso_pu_bacteria 2513237094 2513643220 178
48 iso_pu_bacteria 2513237095 2513651011 178
49 iso_pu_bacteria 2513237096 2513655623 178
50 iso_pu_bacteria 2513237098 2513673579 178
51 iso_pu_bacteria 2513237101 2513697841 178
52 iso_pu_bacteria 2513237102 2513699442 178
53 iso_pu_bacteria 2513237137 2513859692 178
54 iso_pu_bacteria 2513237141 2513887831 178
55 iso_pu_bacteria 2513237145 2513916299 178
56 iso_pu_bacteria 2513237161 2514017240 178
57 iso_pu_bacteria 2515154112 2515624626 178
58 iso_pu_bacteria 2517093001 2517104444 178
59 iso_pu_bacteria 2517572143 2517890087 178
60 iso_pu_bacteria 2524023205 2524438413 178
61 iso_pu_bacteria 2524023210 2524466383 178
62 iso_pu_bacteria 2524023228 2524538198 178
63 iso_pu_bacteria 2528768022 2528856756 178
64 iso_pu_bacteria 2617270735 2617349719 178
65 iso_pu_bacteria 2667528175 2671124324 178
66 iso_pu_bacteria 2721755755 2723846018 178
67 iso_pu_bacteria 2728368998 2728748999 178
68 iso_pu_bacteria 2744054633 2745078435 178
69 iso_pu_bacteria 2791355196 2793059545 178
70 iso_pu_bacteria 2791355197 2793067935 178
71 iso_pu_bacteria 2791355199 2793080409 178
72 iso_pu_bacteria 2816332527 2818242273 178
73 iso_pu_bacteria 2824600985 2824608508 178
74 iso_pu_bacteria 2824609381 2824617497 178
75 iso_pu_bacteria 2824617872 2824625770 178
76 iso_pu_bacteria 2824626560 2824633309 178
77 iso_pu_bacteria 2824635225 2824642223 178
78 iso_pu_bacteria 2824644064 2824649571 178
79 iso_pu_bacteria 2824653114 2824660487 178
80 iso_pu_bacteria 2824661429 2824671028 178
81 iso_pu_bacteria 2824671348 2824674314 178
82 iso_pu_bacteria 2824687955 2824690830 178
83 iso_pu_bacteria 2824696289 2824700260 178
84 iso_pu_bacteria 2824704595 2824713290 178
85 iso_pu_bacteria 2824714736 2824722148 178
86 iso_pu_bacteria 2824723954 2824731940 178
87 iso_pu_bacteria 2824753945 2824763267 178
88 iso_pu_bacteria 2824763712 2824771009 178
89 iso_pu_bacteria 2824773399 2824776906 178
90 iso_pu_bacteria 2838122688 2838128475 178
91 iso_pu_bacteria 2841941048 2841942335 178
92 iso_pu_bacteria 2841949485 2841955535 178
93 iso_pu_bacteria 2841957949 2841960871 178
94 iso_pu_bacteria 2841966195 2841971144 178
95 iso_pu_bacteria 2841974524 2841982262 178
96 iso_pu_bacteria 2841983080 2841984349 178
97 iso_pu_bacteria 2847930680 2847932222 178
98 iso_pu_bacteria 2847939898 2847943456 178
99 iso_pu_bacteria 2849076700 2849077175 178
100 iso_pu_bacteria 2857509624 2857515250 178
101 iso_pu_bacteria 2874590934 2874592147 178
102 iso_pu_bacteria 2874612657 2874617864 178
103 iso_pu_bacteria 2874620515 2874624095 178
104 iso_pu_bacteria 2874628541 2874630890 178
105 iso_pu_bacteria 2874645413 2874646981 178
106 iso_pu_bacteria 2876761206 2876767514 178
107 iso_pu_bacteria 2876771140 2876772358 178
108 iso_pu_bacteria 2876808645 2876814468 178
109 iso_pu_bacteria 2876818435 2876819627 178
110 iso_pu_bacteria 2879074833 2879076202 178
111 iso_pu_bacteria 2879083081 2879089371 178
112 iso_pu_bacteria 2879099564 2879106374 178
113 iso_pu_bacteria 2879110137 2879112058 178
114 iso_pu_bacteria 2879127579 2879132618 178
115 iso_pu_bacteria 2879142872 2879144672 178
116 iso_pu_bacteria 2881364244 2881371050 178
117 iso_pu_bacteria 2881665667 2881669174 178
118 iso_pu_bacteria 2885374607 2885381754 178
119 iso_pu_bacteria 2885383462 2885392498 178
120 iso_pu_bacteria 2885409591 2885412453 178
121 iso_pu_bacteria 2888378607 2888387472 178
122 iso_pu_bacteria 2888388044 2888391717 178
123 iso_pu_bacteria 2903748898 2903752141 178
124 iso_pu_bacteria 2903768456 2903777173 178
125 iso_pu_bacteria 2904666416 2904670806 178
126 iso_pu_bacteria 2904690495 2904697567 178
127 iso_pu_bacteria 2904699407 2904706771 178
128 iso_pu_bacteria 2904711408 2904713768 178
129 iso_pu_bacteria 2906610324 2906612147 178
130 iso_pu_bacteria 2906626472 2906630096 178
131 iso_pu_bacteria 2906635258 2906642557 178
132 iso_pu_bacteria 2906643746 2906651784 178
133 iso_pu_bacteria 2906660503 2906661615 178
134 iso_pu_bacteria 2908739725 2908740313 178
135 iso_pu_bacteria 2908756301 2908757952 178
136 iso_pu_bacteria 2922368715 2922370455 178
137 iso_pu_bacteria 2922425934 2922427150 178
138 iso_pu_bacteria 2929615660 2929620038 178
139 iso_pu_bacteria 2929624759 2929629351 178
140 iso_pu_bacteria 2932784394 2932789519 178
141 iso_pu_bacteria 2932809354 2932814974 178
142 iso_pu_bacteria 2932818245 2932824169 178
143 iso_pu_bacteria 2932828146 2932834103 178
144 iso_pu_bacteria 2933577622 2933581956 178
145 iso_pu_bacteria 2935608549 2935613393 178
146 iso_pu_bacteria 2935616580 2935623507 178
147 iso_pu_bacteria 2935630451 2935633299 178
148 iso_pu_bacteria 2935638405 2935644875 178
149 iso_pu_bacteria 2935665750 2935671943 178
150 iso_pu_bacteria 2935675223 2935683129 178
151 iso_pu_bacteria 2935684952 2935689297 178
152 iso_pu_bacteria 2935694250 2935697443 178
153 iso_pu_bacteria 2935703347 2935711018 178
154 iso_pu_bacteria 2935713505 2935720243 178
155 iso_pu_bacteria 2935722832 2935728140 178
156 iso_pu_bacteria 2935732158 2935737263 178
157 iso_pu_bacteria 2935741537 2935746676 178
158 iso_pu_bacteria 2935750917 2935757643 178
159 iso_pu_bacteria 2935760218 2935764019 178
160 iso_pu_bacteria 2935769743 2935776512 178
161 iso_pu_bacteria 2935777560 2935784068 178
162 iso_pu_bacteria 2935785616 2935789940 178
163 iso_pu_bacteria 2935793552 2935798294 178
164 iso_pu_bacteria 2935801545 2935808607 178
165 iso_pu_bacteria 2935810662 2935817404 178
166 iso_pu_bacteria 2935819856 2935824754 178
167 iso_pu_bacteria 2935827899 2935834279 178
168 iso_pu_bacteria 2935837841 2935844862 178
169 iso_pu_bacteria 2935847175 2935851974 178
170 iso_pu_bacteria 2935855204 2935861886 178
171 iso_pu_bacteria 2935864058 2935868479 178
172 iso_pu_bacteria 2935873716 2935879253 178
173 iso_pu_bacteria 2935908558 2935911322 178
174 iso_pu_bacteria 2935916978 2935920854 178
175 iso_pu_bacteria 2935926038 2935928351 178
176 iso_pu_bacteria 2935934488 2935937996 178
177 iso_pu_bacteria 2935942939 2935945278 178
178 iso_pu_bacteria 2935951376 2935954216 178
179 iso_pu_bacteria 2935959822 2935965712 178
180 iso_pu_bacteria 2935967501 2935971516 178
181 iso_pu_bacteria 2935975950 2935982135 178
182 iso_pu_bacteria 2935992306 2935998580 178
183 iso_pu_bacteria 2936002035 2936008959 178
184 iso_pu_bacteria 2936037263 2936044201 178
185 iso_pu_bacteria 2940556831 2940563535 178
186 iso_pu_bacteria 2941507105 2941509399 178
187 iso_pu_bacteria 2941515067 2941517228 178
188 iso_pu_bacteria 2941523033 2941529917 178
189 iso_pu_bacteria 2941531003 2941537364 178
190 iso_pu_bacteria 2941538514 2941545244 178
191 iso_pu_bacteria 3005474847 3005476323 178
192 iso_pu_bacteria 3005506211 3005506820 178
193 iso_pu_bacteria 3005594810 3005597889 178
194 iso_pu_bacteria 8006933436 8006937659 178
195 iso_pu_bacteria 8006973647 8006977691 178
196 iso_pu_bacteria 8006984368 8006989846 178
197 iso_pu_bacteria 8016511872 8016519390 178
198 iso_pu_bacteria 8016522445 8016524961 178
199 iso_pu_bacteria 8016530956 8016538536 178
200 iso_pu_bacteria 8016539877 8016542820 178
201 iso_pu_bacteria 8016548790 8016550467 178
202 iso_pu_bacteria 8016557553 8016558884 178
203 iso_pu_bacteria 8016566248 8016568209 178
204 iso_pu_bacteria 8016575299 8016580875 178
205 iso_pu_bacteria 8016595262 8016596847 178
206 iso_pu_bacteria 8016603502 8016607747 178
207 iso_pu_bacteria 8016613128 8016619536 178
208 iso_pu_bacteria 8016622563 8016630069 178
209 iso_pu_bacteria 8017057580 8017066131 178
210 iso_pu_bacteria 8019530166 8019538201 178
211 iso_pu_bacteria 8019538911 8019541781 178
212 iso_pu_bacteria 8019547302 8019549013 178
213 iso_pu_bacteria 8019555841 8019560970 178
214 iso_pu_bacteria 8019565922 8019571054 178
215 iso_pu_bacteria 8019576017 8019578499 178
216 iso_pu_bacteria 8019586578 8019596544 178
217 iso_pu_bacteria 8019597564 8019605160 178
218 iso_pu_bacteria 8019608314 8019613383 178
219 iso_pu_bacteria 8019619141 8019624059 178
220 iso_pu_bacteria 8019629233 8019637969 178
221 iso_pu_bacteria 8019638758 8019641658 178
222 iso_pu_bacteria 8019648815 8019653584 178
223 iso_pu_bacteria 8019659431 8019665899 178
224 iso_pu_bacteria 8019668869 8019675420 178
225 iso_pu_bacteria 8019687851 8019695085 178
226 iso_pu_bacteria 8055742211 8055750209 178
227 iso_pu_bacteria 8056681323 8056686109 178
228 iso_pu_bacteria 8056689827 8056695419 178
229 3300039437 Ga0436365_1325472 Ga0436365_1325472_64_606 180
230 3300046507 Ga0495606_0299848 Ga0495606_0299848_147_689 180
231 3300013307 Ga0157372_12060231 Ga0157372_120602311 181
232 3300025942 Ga0207689_10100307 Ga0207689_101003071 181
233 2010549000 RicEn_C399 RicEn_07300 182
234 3300001989 JGI24739J22299_10153398 JGI24739J22299_101533982 182
235 3300002076 JGI24749J21850_1028922 JGI24749J21850_10289221 182
236 3300003215 JGI25153J46596_10003712 JGI25153J46596_100037121 182
237 3300003215 JGI25153J46596_10003975 JGI25153J46596_100039751 182
238 3300003215 JGI25153J46596_10039108 JGI25153J46596_100391083 182
239 3300003659 JGI25404J52841_10017956 JGI25404J52841_100179562 182
240 3300003794 Ga0055531_10008928 Ga0055531_100089282 182
241 3300003911 JGI25405J52794_10012119 JGI25405J52794_100121192 182
242 3300004625 Ga0055543_1001247 Ga0055543_10012475 182
243 3300005262 Ga0065165_1001238 Ga0065165_100123821 182
244 3300005262 Ga0065165_1004821 Ga0065165_10048218 182
245 3300005262 Ga0065165_1012948 Ga0065165_10129482 182
246 3300005262 Ga0065165_1016813 Ga0065165_10168132 182
247 3300005327 Ga0070658_10080672 Ga0070658_100806722 182
248 3300005329 Ga0070683_100015748 Ga0070683_1000157482 182
249 3300005329 Ga0070683_100436837 Ga0070683_1004368373 182
250 3300005330 Ga0070690_100962839 Ga0070690_1009628391 182
251 3300005331 Ga0070670_100327092 Ga0070670_1003270921 182
252 3300005331 Ga0070670_101252150 Ga0070670_1012521501 182
253 3300005334 Ga0068869_100216708 Ga0068869_1002167082 182
254 3300005336 Ga0070680_100033950 Ga0070680_1000339505 182
255 3300005337 Ga0070682_100165238 Ga0070682_1001652382 182
256 3300005337 Ga0070682_100219358 Ga0070682_1002193582 182
257 3300005338 Ga0068868_100011625 Ga0068868_1000116256 182
258 3300005338 Ga0068868_100058807 Ga0068868_1000588072 182
259 3300005338 Ga0068868_100176891 Ga0068868_1001768912 182
260 3300005338 Ga0068868_100306128 Ga0068868_1003061281 182
261 3300005339 Ga0070660_100197657 Ga0070660_1001976573 182
262 3300005339 Ga0070660_100860512 Ga0070660_1008605121 182
263 3300005340 Ga0070689_100502858 Ga0070689_1005028582 182
264 3300005341 Ga0070691_10174128 Ga0070691_101741282 182
265 3300005343 Ga0070687_100128942 Ga0070687_1001289422 182
266 3300005345 Ga0070692_10134771 Ga0070692_101347712 182
267 3300005347 Ga0070668_100016271 Ga0070668_1000162716 182
268 3300005347 Ga0070668_100047595 Ga0070668_1000475952 182
269 3300005347 Ga0070668_100076201 Ga0070668_1000762012 182
270 3300005347 Ga0070668_100542358 Ga0070668_1005423581 182
271 3300005347 Ga0070668_100986721 Ga0070668_1009867212 182
272 3300005347 Ga0070668_101022242 Ga0070668_1010222421 182
273 3300005347 Ga0070668_101503618 Ga0070668_1015036181 182
274 3300005353 Ga0070669_100181958 Ga0070669_1001819582 182
275 3300005353 Ga0070669_101229277 Ga0070669_1012292771 182
276 3300005354 Ga0070675_100264823 Ga0070675_1002648231 182
277 3300005355 Ga0070671_100254929 Ga0070671_1002549293 182
278 3300005355 Ga0070671_100465337 Ga0070671_1004653372 182
279 3300005355 Ga0070671_100545542 Ga0070671_1005455422 182
280 3300005356 Ga0070674_100114350 Ga0070674_1001143502 182
281 3300005356 Ga0070674_100416633 Ga0070674_1004166332 182
282 3300005364 Ga0070673_100082174 Ga0070673_1000821742 182
283 3300005365 Ga0070688_100057420 Ga0070688_1000574202 182
284 3300005366 Ga0070659_100222395 Ga0070659_1002223952 182
285 3300005367 Ga0070667_100064004 Ga0070667_1000640044 182
286 3300005367 Ga0070667_100326035 Ga0070667_1003260351 182
287 3300005367 Ga0070667_100745512 Ga0070667_1007455121 182
288 3300005406 Ga0070703_10024753 Ga0070703_100247532 182
289 3300005434 Ga0070709_10004421 Ga0070709_100044216 182
290 3300005434 Ga0070709_10010158 Ga0070709_100101582 182
291 3300005434 Ga0070709_10144889 Ga0070709_101448892 182
292 3300005434 Ga0070709_10353964 Ga0070709_103539641 182
293 3300005435 Ga0070714_100004999 Ga0070714_1000049993 182
294 3300005435 Ga0070714_100101291 Ga0070714_1001012912 182
295 3300005435 Ga0070714_100184828 Ga0070714_1001848282 182
296 3300005435 Ga0070714_100259175 Ga0070714_1002591753 182
297 3300005435 Ga0070714_100663262 Ga0070714_1006632622 182
298 3300005436 Ga0070713_100004534 Ga0070713_1000045343 182
299 3300005436 Ga0070713_100006585 Ga0070713_1000065854 182
300 3300005436 Ga0070713_100011058 Ga0070713_1000110587 182
301 3300005436 Ga0070713_100014000 Ga0070713_1000140007 182
302 3300005436 Ga0070713_100084245 Ga0070713_1000842454 182
303 3300005436 Ga0070713_100212872 Ga0070713_1002128722 182
304 3300005437 Ga0070710_10060807 Ga0070710_100608074 182
305 3300005437 Ga0070710_10112579 Ga0070710_101125793 182
306 3300005438 Ga0070701_10119533 Ga0070701_101195332 182
307 3300005439 Ga0070711_100006399 Ga0070711_1000063992 182
308 3300005439 Ga0070711_100024840 Ga0070711_1000248402 182
309 3300005439 Ga0070711_100218504 Ga0070711_1002185042 182
310 3300005440 Ga0070705_100184931 Ga0070705_1001849311 182
311 3300005440 Ga0070705_100415204 Ga0070705_1004152042 182
312 3300005441 Ga0070700_100323113 Ga0070700_1003231131 182
313 3300005444 Ga0070694_100182349 Ga0070694_1001823492 182
314 3300005445 Ga0070708_100745514 Ga0070708_1007455141 182
315 3300005455 Ga0070663_100044479 Ga0070663_1000444792 182
316 3300005455 Ga0070663_100051122 Ga0070663_1000511222 182
317 3300005455 Ga0070663_100061590 Ga0070663_1000615904 182
318 3300005455 Ga0070663_100183072 Ga0070663_1001830723 182
319 3300005455 Ga0070663_100305159 Ga0070663_1003051591 182
320 3300005455 Ga0070663_100313452 Ga0070663_1003134522 182
321 3300005455 Ga0070663_100320366 Ga0070663_1003203663 182
322 3300005455 Ga0070663_100644209 Ga0070663_1006442092 182
323 3300005456 Ga0070678_100206008 Ga0070678_1002060082 182
324 3300005456 Ga0070678_100307277 Ga0070678_1003072772 182
325 3300005456 Ga0070678_100313336 Ga0070678_1003133362 182
326 3300005457 Ga0070662_100042613 Ga0070662_1000426131 182
327 3300005457 Ga0070662_100051832 Ga0070662_1000518324 182
328 3300005458 Ga0070681_10005842 Ga0070681_100058426 182
329 3300005458 Ga0070681_10046271 Ga0070681_100462712 182
330 3300005459 Ga0068867_100179243 Ga0068867_1001792432 182
331 3300005459 Ga0068867_100545419 Ga0068867_1005454191 182
332 3300005459 Ga0068867_100568483 Ga0068867_1005684832 182
333 3300005467 Ga0070706_100241729 Ga0070706_1002417293 182
334 3300005518 Ga0070699_100180163 Ga0070699_1001801631 182
335 3300005518 Ga0070699_100859143 Ga0070699_1008591432 182
336 3300005518 Ga0070699_101301903 Ga0070699_1013019031 182
337 3300005530 Ga0070679_100015322 Ga0070679_1000153224 182
338 3300005530 Ga0070679_100034222 Ga0070679_1000342226 182
339 3300005535 Ga0070684_100053919 Ga0070684_1000539192 182
340 3300005535 Ga0070684_100323388 Ga0070684_1003233882 182
341 3300005536 Ga0070697_100292726 Ga0070697_1002927262 182
342 3300005539 Ga0068853_101077338 Ga0068853_1010773381 182
343 3300005543 Ga0070672_100140100 Ga0070672_1001401002 182
344 3300005543 Ga0070672_100422703 Ga0070672_1004227032 182
345 3300005543 Ga0070672_100713267 Ga0070672_1007132671 182
346 3300005544 Ga0070686_100023188 Ga0070686_1000231883 182
347 3300005545 Ga0070695_100323813 Ga0070695_1003238132 182
348 3300005546 Ga0070696_100400603 Ga0070696_1004006032 182
349 3300005546 Ga0070696_100405459 Ga0070696_1004054592 182
350 3300005546 Ga0070696_100597977 Ga0070696_1005979771 182
351 3300005548 Ga0070665_100019999 Ga0070665_1000199995 182
352 3300005548 Ga0070665_100091696 Ga0070665_1000916965 182
353 3300005548 Ga0070665_100118504 Ga0070665_1001185042 182
354 3300005548 Ga0070665_100196813 Ga0070665_1001968132 182
355 3300005548 Ga0070665_100388257 Ga0070665_1003882572 182
356 3300005548 Ga0070665_100458678 Ga0070665_1004586782 182
357 3300005563 Ga0068855_100225014 Ga0068855_1002250141 182
358 3300005563 Ga0068855_100779440 Ga0068855_1007794402 182
359 3300005563 Ga0068855_101059062 Ga0068855_1010590622 182
360 3300005564 Ga0070664_100162208 Ga0070664_1001622083 182
361 3300005564 Ga0070664_100229394 Ga0070664_1002293942 182
362 3300005564 Ga0070664_100525264 Ga0070664_1005252641 182
363 3300005577 Ga0068857_100071359 Ga0068857_1000713595 182
364 3300005577 Ga0068857_100202935 Ga0068857_1002029352 182
365 3300005614 Ga0068856_100093327 Ga0068856_1000933272 182
366 3300005614 Ga0068856_100919513 Ga0068856_1009195132 182
367 3300005616 Ga0068852_100112958 Ga0068852_1001129582 182
368 3300005616 Ga0068852_100542038 Ga0068852_1005420383 182
369 3300005616 Ga0068852_100562511 Ga0068852_1005625112 182
370 3300005617 Ga0068859_100268917 Ga0068859_1002689173 182
371 3300005617 Ga0068859_100474242 Ga0068859_1004742422 182
372 3300005617 Ga0068859_100902022 Ga0068859_1009020222 182
373 3300005618 Ga0068864_100013398 Ga0068864_1000133985 182
374 3300005618 Ga0068864_100161872 Ga0068864_1001618722 182
375 3300005718 Ga0068866_10075702 Ga0068866_100757023 182
376 3300005719 Ga0068861_100076323 Ga0068861_1000763235 182
377 3300005719 Ga0068861_100120266 Ga0068861_1001202662 182
378 3300005840 Ga0068870_10071748 Ga0068870_100717482 182
379 3300005841 Ga0068863_100082691 Ga0068863_1000826915 182
380 3300005841 Ga0068863_100142925 Ga0068863_1001429252 182
381 3300005841 Ga0068863_100278724 Ga0068863_1002787243 182
382 3300005841 Ga0068863_101039854 Ga0068863_1010398541 182
383 3300005841 Ga0068863_101072481 Ga0068863_1010724811 182
384 3300005842 Ga0068858_100122763 Ga0068858_1001227632 182
385 3300005842 Ga0068858_100142978 Ga0068858_1001429783 182
386 3300005842 Ga0068858_100892647 Ga0068858_1008926472 182
387 3300005843 Ga0068860_100000367 Ga0068860_10000036736 182
388 3300005843 Ga0068860_100104480 Ga0068860_1001044802 182
389 3300005843 Ga0068860_100238758 Ga0068860_1002387582 182
390 3300005843 Ga0068860_100247941 Ga0068860_1002479412 182
391 3300005843 Ga0068860_100311735 Ga0068860_1003117352 182
392 3300005843 Ga0068860_100358870 Ga0068860_1003588702 182
393 3300005843 Ga0068860_100361843 Ga0068860_1003618432 182
394 3300005843 Ga0068860_100377664 Ga0068860_1003776642 182
395 3300005843 Ga0068860_101271536 Ga0068860_1012715361 182
396 3300005844 Ga0068862_100306497 Ga0068862_1003064972 182
397 3300005844 Ga0068862_100374442 Ga0068862_1003744422 182
398 3300005844 Ga0068862_100674106 Ga0068862_1006741062 182
399 3300005844 Ga0068862_100824338 Ga0068862_1008243381 182
400 3300005937 Ga0081455_10005963 Ga0081455_1000596310 182
401 3300005937 Ga0081455_10019148 Ga0081455_100191488 182
402 3300005937 Ga0081455_10019874 Ga0081455_100198745 182
403 3300005937 Ga0081455_10238149 Ga0081455_102381492 182
404 3300005983 Ga0081540_1005978 Ga0081540_10059782 182
405 3300005983 Ga0081540_1007083 Ga0081540_10070834 182
406 3300005983 Ga0081540_1008425 Ga0081540_10084252 182
407 3300005983 Ga0081540_1010630 Ga0081540_10106307 182
408 3300005983 Ga0081540_1031564 Ga0081540_10315645 182
409 3300005983 Ga0081540_1042398 Ga0081540_10423982 182
410 3300005983 Ga0081540_1047481 Ga0081540_10474812 182
411 3300005983 Ga0081540_1047752 Ga0081540_10477522 182
412 3300006028 Ga0070717_10000254 Ga0070717_1000025430 182
413 3300006028 Ga0070717_10003385 Ga0070717_100033854 182
414 3300006028 Ga0070717_10030814 Ga0070717_100308145 182
415 3300006038 Ga0075365_10042633 Ga0075365_100426335 182
416 3300006038 Ga0075365_10151609 Ga0075365_101516092 182
417 3300006038 Ga0075365_10227051 Ga0075365_102270512 182
418 3300006038 Ga0075365_10227378 Ga0075365_102273782 182
419 3300006038 Ga0075365_10255577 Ga0075365_102555771 182
420 3300006038 Ga0075365_10453491 Ga0075365_104534912 182
421 3300006048 Ga0075363_100000357 Ga0075363_1000003579 182
422 3300006048 Ga0075363_100033478 Ga0075363_1000334783 182
423 3300006051 Ga0075364_10011619 Ga0075364_100116192 182
424 3300006051 Ga0075364_10112989 Ga0075364_101129892 182
425 3300006163 Ga0070715_10000467 Ga0070715_100004675 182
426 3300006163 Ga0070715_10136832 Ga0070715_101368322 182
427 3300006163 Ga0070715_10317261 Ga0070715_103172611 182
428 3300006173 Ga0070716_100000841 Ga0070716_10000084110 182
429 3300006173 Ga0070716_100107742 Ga0070716_1001077422 182
430 3300006173 Ga0070716_100151373 Ga0070716_1001513732 182
431 3300006175 Ga0070712_100002446 Ga0070712_1000024466 182
432 3300006175 Ga0070712_100009088 Ga0070712_1000090884 182
433 3300006175 Ga0070712_100136191 Ga0070712_1001361913 182
434 3300006175 Ga0070712_100305479 Ga0070712_1003054792 182
435 3300006175 Ga0070712_100927680 Ga0070712_1009276801 182
436 3300006177 Ga0075362_10322610 Ga0075362_103226101 182
437 3300006177 Ga0075362_10443784 Ga0075362_104437841 182
438 3300006178 Ga0075367_10016273 Ga0075367_100162736 182
439 3300006178 Ga0075367_10136736 Ga0075367_101367362 182
440 3300006178 Ga0075367_10146349 Ga0075367_101463492 182
441 3300006178 Ga0075367_10481996 Ga0075367_104819961 182
442 3300006186 Ga0075369_10036194 Ga0075369_100361941 182
443 3300006195 Ga0075366_10076370 Ga0075366_100763702 182
444 3300006195 Ga0075366_10342806 Ga0075366_103428062 182
445 3300006237 Ga0097621_100074771 Ga0097621_1000747715 182
446 3300006237 Ga0097621_100093160 Ga0097621_1000931602 182
447 3300006237 Ga0097621_100094777 Ga0097621_1000947772 182
448 3300006237 Ga0097621_101035912 Ga0097621_1010359122 182
449 3300006353 Ga0075370_10072587 Ga0075370_100725872 182
450 3300006358 Ga0068871_100070981 Ga0068871_1000709812 182
451 3300006358 Ga0068871_100964353 Ga0068871_1009643531 182
452 3300006871 Ga0075434_100085607 Ga0075434_1000856072 182
453 3300006881 Ga0068865_100072578 Ga0068865_1000725782 182
454 3300006881 Ga0068865_100132105 Ga0068865_1001321053 182
455 3300006931 Ga0097620_100268898 Ga0097620_1002688983 182
456 3300006931 Ga0097620_100474234 Ga0097620_1004742342 182
457 3300006931 Ga0097620_100902023 Ga0097620_1009020232 182
458 3300006941 Ga0099825_1020324 Ga0099825_10203247 182
459 3300006942 Ga0099824_1014791 Ga0099824_10147915 182
460 3300006942 Ga0099824_1046460 Ga0099824_10464601 182
461 3300006944 Ga0099823_1089075 Ga0099823_10890752 182
462 3300007076 Ga0075435_100088077 Ga0075435_1000880772 182
463 3300007788 Ga0099795_10054104 Ga0099795_100541042 182
464 3300007788 Ga0099795_10259631 Ga0099795_102596311 182
465 3300009036 Ga0105244_10211259 Ga0105244_102112592 182
466 3300009092 Ga0105250_10126097 Ga0105250_101260972 182
467 3300009093 Ga0105240_10679877 Ga0105240_106798772 182
468 3300009093 Ga0105240_10867830 Ga0105240_108678302 182
469 3300009094 Ga0111539_10313176 Ga0111539_103131763 182
470 3300009094 Ga0111539_10363720 Ga0111539_103637202 182
471 3300009098 Ga0105245_10028789 Ga0105245_100287892 182
472 3300009098 Ga0105245_10182260 Ga0105245_101822602 182
473 3300009098 Ga0105245_10276300 Ga0105245_102763002 182
474 3300009098 Ga0105245_11192035 Ga0105245_111920351 182
475 3300009101 Ga0105247_10057933 Ga0105247_100579332 182
476 3300009101 Ga0105247_10060291 Ga0105247_100602911 182
477 3300009101 Ga0105247_10221345 Ga0105247_102213453 182
478 3300009101 Ga0105247_10253332 Ga0105247_102533322 182
479 3300009101 Ga0105247_10300555 Ga0105247_103005552 182
480 3300009148 Ga0105243_10281547 Ga0105243_102815472 182
481 3300009148 Ga0105243_11621434 Ga0105243_116214342 182
482 3300009148 Ga0105243_12031488 Ga0105243_120314881 182
483 3300009174 Ga0105241_10016637 Ga0105241_100166375 182
484 3300009174 Ga0105241_10042053 Ga0105241_100420536 182
485 3300009174 Ga0105241_10585759 Ga0105241_105857592 182
486 3300009176 Ga0105242_10915942 Ga0105242_109159422 182
487 3300009176 Ga0105242_11194547 Ga0105242_111945472 182
488 3300009177 Ga0105248_10292121 Ga0105248_102921211 182
489 3300009177 Ga0105248_11098099 Ga0105248_110980992 182
490 3300009177 Ga0105248_11497591 Ga0105248_114975912 182
491 3300009545 Ga0105237_10126837 Ga0105237_101268371 182
492 3300009545 Ga0105237_10333372 Ga0105237_103333723 182
493 3300009545 Ga0105237_10672703 Ga0105237_106727032 182
494 3300009545 Ga0105237_11289100 Ga0105237_112891001 182
495 3300009551 Ga0105238_10309954 Ga0105238_103099541 182
496 3300009551 Ga0105238_10637142 Ga0105238_106371422 182
497 3300009551 Ga0105238_10768623 Ga0105238_107686231 182
498 3300009551 Ga0105238_10958028 Ga0105238_109580282 182
499 3300009551 Ga0105238_11219444 Ga0105238_112194441 182
500 3300009553 Ga0105249_10298478 Ga0105249_102984782 182
501 3300009553 Ga0105249_10354663 Ga0105249_103546632 182
502 3300009553 Ga0105249_10703451 Ga0105249_107034512 182
503 3300009553 Ga0105249_11024961 Ga0105249_110249612 182
504 3300010159 Ga0099796_10015205 Ga0099796_100152053 182
505 3300010159 Ga0099796_10182110 Ga0099796_101821102 182
506 3300010375 Ga0105239_10184727 Ga0105239_101847273 182
507 3300010375 Ga0105239_10337343 Ga0105239_103373431 182
508 3300010375 Ga0105239_10341586 Ga0105239_103415862 182
509 3300010375 Ga0105239_10568705 Ga0105239_105687052 182
510 3300011119 Ga0105246_10162306 Ga0105246_101623062 182
511 3300011119 Ga0105246_11011435 Ga0105246_110114351 182
512 3300013105 Ga0157369_10020020 Ga0157369_100200204 182
513 3300013105 Ga0157369_10490873 Ga0157369_104908732 182
514 3300013296 Ga0157374_10036491 Ga0157374_100364912 182
515 3300013296 Ga0157374_10091944 Ga0157374_100919443 182
516 3300013297 Ga0157378_10235465 Ga0157378_102354653 182
517 3300013297 Ga0157378_10297752 Ga0157378_102977522 182
518 3300013306 Ga0163162_10033688 Ga0163162_100336885 182
519 3300013306 Ga0163162_10192615 Ga0163162_101926153 182
520 3300013306 Ga0163162_10196746 Ga0163162_101967463 182
521 3300013306 Ga0163162_10905989 Ga0163162_109059892 182
522 3300013306 Ga0163162_11615165 Ga0163162_116151652 182
523 3300013306 Ga0163162_11734292 Ga0163162_117342921 182
524 3300013307 Ga0157372_10255072 Ga0157372_102550721 182
525 3300013308 Ga0157375_10042135 Ga0157375_100421354 182
526 3300013308 Ga0157375_10088435 Ga0157375_100884352 182
527 3300013308 Ga0157375_10316195 Ga0157375_103161952 182
528 3300013308 Ga0157375_10437699 Ga0157375_104376993 182
529 3300013308 Ga0157375_11124440 Ga0157375_111244402 182
530 3300013308 Ga0157375_11373761 Ga0157375_113737612 182
531 3300013308 Ga0157375_11772664 Ga0157375_117726642 182
532 3300014325 Ga0163163_10050507 Ga0163163_100505072 182
533 3300014325 Ga0163163_10141356 Ga0163163_101413563 182
534 3300014325 Ga0163163_10221492 Ga0163163_102214922 182
535 3300014325 Ga0163163_10294188 Ga0163163_102941882 182
536 3300014325 Ga0163163_10948135 Ga0163163_109481351 182
537 3300014326 Ga0157380_10165577 Ga0157380_101655772 182
538 3300014326 Ga0157380_10497827 Ga0157380_104978272 182
539 3300014745 Ga0157377_10282611 Ga0157377_102826112 182
540 3300014745 Ga0157377_10341276 Ga0157377_103412762 182
541 3300014968 Ga0157379_10107522 Ga0157379_101075222 182
542 3300014968 Ga0157379_10138478 Ga0157379_101384782 182
543 3300014968 Ga0157379_10227748 Ga0157379_102277485 182
544 3300014969 Ga0157376_10004272 Ga0157376_100042722 182
545 3300014969 Ga0157376_10041292 Ga0157376_100412925 182
546 3300014969 Ga0157376_10074244 Ga0157376_100742446 182
547 3300014969 Ga0157376_10214414 Ga0157376_102144142 182
548 3300014969 Ga0157376_10929481 Ga0157376_109294811 182
549 3300017792 Ga0163161_10314640 Ga0163161_103146402 182
550 3300020069 Ga0197907_10173837 Ga0197907_101738373 182
551 3300020070 Ga0206356_10315111 Ga0206356_103151111 182
552 3300020070 Ga0206356_10644697 Ga0206356_106446973 182
553 3300020078 Ga0206352_11357288 Ga0206352_113572881 182
554 3300020082 Ga0206353_10982674 Ga0206353_109826742 182
555 3300020610 Ga0154015_1039217 Ga0154015_10392171 182
556 3300025230 Ga0209563_103469 Ga0209563_1034694 182
557 3300025253 Ga0209677_102593 Ga0209677_1025932 182
558 3300025261 Ga0209233_1027116 Ga0209233_10271162 182
559 3300025284 Ga0209130_1038983 Ga0209130_10389832 182
560 3300025297 Ga0209758_1000595 Ga0209758_100059517 182
561 3300025297 Ga0209758_1000604 Ga0209758_100060443 182
562 3300025297 Ga0209758_1001332 Ga0209758_100133212 182
563 3300025297 Ga0209758_1025154 Ga0209758_10251542 182
564 3300025297 Ga0209758_1049382 Ga0209758_10493823 182
565 3300025297 Ga0209758_1106602 Ga0209758_11066022 182
566 3300025299 Ga0209256_1008443 Ga0209256_10084434 182
567 3300025299 Ga0209256_1074700 Ga0209256_10747002 182
568 3300025302 Ga0207426_1000500 Ga0207426_100050026 182
569 3300025302 Ga0207426_1001477 Ga0207426_100147716 182
570 3300025302 Ga0207426_1007029 Ga0207426_10070293 182
571 3300025302 Ga0207426_1012937 Ga0207426_10129373 182
572 3300025303 Ga0209051_1093743 Ga0209051_10937432 182
573 3300025304 Ga0209257_1001217 Ga0209257_100121710 182
574 3300025304 Ga0209257_1039914 Ga0209257_10399142 182
575 3300025711 Ga0207696_1045828 Ga0207696_10458282 182
576 3300025885 Ga0207653_10022622 Ga0207653_100226222 182
577 3300025898 Ga0207692_10002241 Ga0207692_100022412 182
578 3300025898 Ga0207692_10343202 Ga0207692_103432022 182
579 3300025898 Ga0207692_10457622 Ga0207692_104576222 182
580 3300025899 Ga0207642_10137858 Ga0207642_101378582 182
581 3300025899 Ga0207642_10203052 Ga0207642_102030522 182
582 3300025900 Ga0207710_10031300 Ga0207710_100313003 182
583 3300025900 Ga0207710_10042758 Ga0207710_100427584 182
584 3300025900 Ga0207710_10055220 Ga0207710_100552202 182
585 3300025900 Ga0207710_10068167 Ga0207710_100681672 182
586 3300025900 Ga0207710_10121193 Ga0207710_101211932 182
587 3300025901 Ga0207688_10072723 Ga0207688_100727232 182
588 3300025901 Ga0207688_10167946 Ga0207688_101679463 182
589 3300025903 Ga0207680_10438132 Ga0207680_104381321 182
590 3300025903 Ga0207680_10897925 Ga0207680_108979251 182
591 3300025904 Ga0207647_10135326 Ga0207647_101353262 182
592 3300025905 Ga0207685_10000741 Ga0207685_100007416 182
593 3300025905 Ga0207685_10341978 Ga0207685_103419781 182
594 3300025906 Ga0207699_10006247 Ga0207699_100062472 182
595 3300025906 Ga0207699_10008256 Ga0207699_100082566 182
596 3300025906 Ga0207699_10772660 Ga0207699_107726601 182
597 3300025906 Ga0207699_10864446 Ga0207699_108644461 182
598 3300025907 Ga0207645_10121320 Ga0207645_101213202 182
599 3300025907 Ga0207645_10678390 Ga0207645_106783902 182
600 3300025908 Ga0207643_10178655 Ga0207643_101786552 182
601 3300025908 Ga0207643_10290527 Ga0207643_102905272 182
602 3300025909 Ga0207705_10196045 Ga0207705_101960452 182
603 3300025910 Ga0207684_10658444 Ga0207684_106584441 182
604 3300025911 Ga0207654_10005980 Ga0207654_100059802 182
605 3300025911 Ga0207654_10222223 Ga0207654_102222232 182
606 3300025912 Ga0207707_10000639 Ga0207707_1000063920 182
607 3300025913 Ga0207695_10186767 Ga0207695_101867674 182
608 3300025913 Ga0207695_10383565 Ga0207695_103835652 182
609 3300025913 Ga0207695_10741449 Ga0207695_107414492 182
610 3300025914 Ga0207671_10256048 Ga0207671_102560482 182
611 3300025914 Ga0207671_10355742 Ga0207671_103557422 182
612 3300025915 Ga0207693_10003759 Ga0207693_100037594 182
613 3300025915 Ga0207693_10102545 Ga0207693_101025452 182
614 3300025915 Ga0207693_10122223 Ga0207693_101222232 182
615 3300025915 Ga0207693_10159400 Ga0207693_101594003 182
616 3300025915 Ga0207693_10918528 Ga0207693_109185281 182
617 3300025916 Ga0207663_10000502 Ga0207663_1000050212 182
618 3300025916 Ga0207663_10102757 Ga0207663_101027574 182
619 3300025916 Ga0207663_10108965 Ga0207663_101089652 182
620 3300025918 Ga0207662_10120318 Ga0207662_101203182 182
621 3300025919 Ga0207657_10038451 Ga0207657_100384516 182
622 3300025919 Ga0207657_11046913 Ga0207657_110469131 182
623 3300025921 Ga0207652_10010036 Ga0207652_100100366 182
624 3300025923 Ga0207681_10124704 Ga0207681_101247041 182
625 3300025923 Ga0207681_11342004 Ga0207681_113420041 182
626 3300025924 Ga0207694_10084505 Ga0207694_100845054 182
627 3300025925 Ga0207650_10124649 Ga0207650_101246492 182
628 3300025925 Ga0207650_10187060 Ga0207650_101870602 182
629 3300025925 Ga0207650_10588635 Ga0207650_105886352 182
630 3300025926 Ga0207659_10911632 Ga0207659_109116322 182
631 3300025926 Ga0207659_11316578 Ga0207659_113165781 182
632 3300025927 Ga0207687_10093119 Ga0207687_100931192 182
633 3300025927 Ga0207687_10199345 Ga0207687_101993453 182
634 3300025927 Ga0207687_10654990 Ga0207687_106549902 182
635 3300025928 Ga0207700_10005398 Ga0207700_100053987 182
636 3300025928 Ga0207700_10064289 Ga0207700_100642892 182
637 3300025928 Ga0207700_10090508 Ga0207700_100905084 182
638 3300025928 Ga0207700_10174803 Ga0207700_101748032 182
639 3300025928 Ga0207700_10208505 Ga0207700_102085052 182
640 3300025928 Ga0207700_10384295 Ga0207700_103842952 182
641 3300025928 Ga0207700_10778836 Ga0207700_107788362 182
642 3300025928 Ga0207700_10781577 Ga0207700_107815771 182
643 3300025929 Ga0207664_10043298 Ga0207664_100432983 182
644 3300025929 Ga0207664_10045215 Ga0207664_100452153 182
645 3300025929 Ga0207664_10085612 Ga0207664_100856122 182
646 3300025929 Ga0207664_10388205 Ga0207664_103882051 182
647 3300025929 Ga0207664_10622377 Ga0207664_106223772 182
648 3300025929 Ga0207664_10787086 Ga0207664_107870861 182
649 3300025929 Ga0207664_10978238 Ga0207664_109782381 182
650 3300025931 Ga0207644_10187921 Ga0207644_101879212 182
651 3300025931 Ga0207644_10316355 Ga0207644_103163552 182
652 3300025931 Ga0207644_10543247 Ga0207644_105432472 182
653 3300025931 Ga0207644_10649033 Ga0207644_106490331 182
654 3300025933 Ga0207706_10055854 Ga0207706_100558543 182
655 3300025933 Ga0207706_10159120 Ga0207706_101591203 182
656 3300025933 Ga0207706_10181565 Ga0207706_101815654 182
657 3300025933 Ga0207706_10216572 Ga0207706_102165722 182
658 3300025934 Ga0207686_10131143 Ga0207686_101311431 182
659 3300025934 Ga0207686_10561627 Ga0207686_105616272 182
660 3300025935 Ga0207709_10055044 Ga0207709_100550442 182
661 3300025935 Ga0207709_10347985 Ga0207709_103479852 182
662 3300025935 Ga0207709_10452824 Ga0207709_104528242 182
663 3300025936 Ga0207670_10092679 Ga0207670_100926792 182
664 3300025936 Ga0207670_10333659 Ga0207670_103336592 182
665 3300025937 Ga0207669_10064377 Ga0207669_100643772 182
666 3300025937 Ga0207669_10869200 Ga0207669_108692001 182
667 3300025938 Ga0207704_10042041 Ga0207704_100420414 182
668 3300025938 Ga0207704_10091861 Ga0207704_100918612 182
669 3300025939 Ga0207665_10002009 Ga0207665_100020099 182
670 3300025939 Ga0207665_10062598 Ga0207665_100625983 182
671 3300025939 Ga0207665_10091603 Ga0207665_100916034 182
672 3300025939 Ga0207665_10317582 Ga0207665_103175822 182
673 3300025939 Ga0207665_10651756 Ga0207665_106517562 182
674 3300025940 Ga0207691_10018692 Ga0207691_100186926 182
675 3300025940 Ga0207691_10110689 Ga0207691_101106892 182
676 3300025940 Ga0207691_10368011 Ga0207691_103680112 182
677 3300025940 Ga0207691_10934336 Ga0207691_109343361 182
678 3300025941 Ga0207711_10253859 Ga0207711_102538592 182
679 3300025941 Ga0207711_10954309 Ga0207711_109543092 182
680 3300025942 Ga0207689_10048603 Ga0207689_100486033 182
681 3300025942 Ga0207689_10477296 Ga0207689_104772962 182
682 3300025942 Ga0207689_10532497 Ga0207689_105324972 182
683 3300025942 Ga0207689_10570017 Ga0207689_105700171 182
684 3300025944 Ga0207661_10007291 Ga0207661_100072913 182
685 3300025944 Ga0207661_10054657 Ga0207661_100546572 182
686 3300025945 Ga0207679_10125519 Ga0207679_101255192 182
687 3300025945 Ga0207679_10674846 Ga0207679_106748462 182
688 3300025945 Ga0207679_10805164 Ga0207679_108051642 182
689 3300025949 Ga0207667_10154496 Ga0207667_101544962 182
690 3300025949 Ga0207667_10487924 Ga0207667_104879243 182
691 3300025949 Ga0207667_11066099 Ga0207667_110660992 182
692 3300025960 Ga0207651_10064250 Ga0207651_100642502 182
693 3300025960 Ga0207651_10368596 Ga0207651_103685962 182
694 3300025960 Ga0207651_10823545 Ga0207651_108235451 182
695 3300025961 Ga0207712_10054730 Ga0207712_100547302 182
696 3300025961 Ga0207712_10115924 Ga0207712_101159242 182
697 3300025961 Ga0207712_10216066 Ga0207712_102160663 182
698 3300025961 Ga0207712_10321796 Ga0207712_103217962 182
699 3300025961 Ga0207712_11167174 Ga0207712_111671741 182
700 3300025972 Ga0207668_10030240 Ga0207668_100302403 182
701 3300025972 Ga0207668_10078317 Ga0207668_100783172 182
702 3300025972 Ga0207668_10169342 Ga0207668_101693423 182
703 3300025972 Ga0207668_10322913 Ga0207668_103229131 182
704 3300025972 Ga0207668_10508646 Ga0207668_105086462 182
705 3300025972 Ga0207668_11277806 Ga0207668_112778061 182
706 3300025981 Ga0207640_10919525 Ga0207640_109195251 182
707 3300025986 Ga0207658_10294509 Ga0207658_102945092 182
708 3300026023 Ga0207677_10005995 Ga0207677_100059952 182
709 3300026023 Ga0207677_10049586 Ga0207677_100495862 182
710 3300026023 Ga0207677_10181010 Ga0207677_101810102 182
711 3300026023 Ga0207677_10239123 Ga0207677_102391232 182
712 3300026023 Ga0207677_10696208 Ga0207677_106962082 182
713 3300026035 Ga0207703_10228892 Ga0207703_102288922 182
714 3300026035 Ga0207703_10307145 Ga0207703_103071452 182
715 3300026035 Ga0207703_10923455 Ga0207703_109234552 182
716 3300026035 Ga0207703_10982617 Ga0207703_109826171 182
717 3300026041 Ga0207639_10285322 Ga0207639_102853222 182
718 3300026041 Ga0207639_10794876 Ga0207639_107948762 182
719 3300026067 Ga0207678_10018446 Ga0207678_100184466 182
720 3300026067 Ga0207678_10069771 Ga0207678_100697711 182
721 3300026067 Ga0207678_10079380 Ga0207678_100793802 182
722 3300026067 Ga0207678_10109411 Ga0207678_101094112 182
723 3300026067 Ga0207678_10109881 Ga0207678_101098814 182
724 3300026067 Ga0207678_10334194 Ga0207678_103341942 182
725 3300026067 Ga0207678_10999165 Ga0207678_109991652 182
726 3300026075 Ga0207708_10183920 Ga0207708_101839202 182
727 3300026075 Ga0207708_10908885 Ga0207708_109088851 182
728 3300026075 Ga0207708_10925574 Ga0207708_109255741 182
729 3300026075 Ga0207708_10974905 Ga0207708_109749051 182
730 3300026078 Ga0207702_10079376 Ga0207702_100793765 182
731 3300026088 Ga0207641_10273614 Ga0207641_102736142 182
732 3300026088 Ga0207641_10328037 Ga0207641_103280373 182
733 3300026088 Ga0207641_10459810 Ga0207641_104598102 182
734 3300026088 Ga0207641_11832556 Ga0207641_118325561 182
735 3300026089 Ga0207648_10052565 Ga0207648_100525653 182
736 3300026089 Ga0207648_10090372 Ga0207648_100903724 182
737 3300026089 Ga0207648_10932079 Ga0207648_109320792 182
738 3300026095 Ga0207676_10068608 Ga0207676_100686085 182
739 3300026095 Ga0207676_10127863 Ga0207676_101278634 182
740 3300026095 Ga0207676_10452614 Ga0207676_104526142 182
741 3300026095 Ga0207676_10700932 Ga0207676_107009322 182
742 3300026095 Ga0207676_11265358 Ga0207676_112653582 182
743 3300026118 Ga0207675_100015313 Ga0207675_1000153138 182
744 3300026118 Ga0207675_100115027 Ga0207675_1001150272 182
745 3300026118 Ga0207675_100399899 Ga0207675_1003998992 182
746 3300026118 Ga0207675_100680119 Ga0207675_1006801192 182
747 3300026118 Ga0207675_101207895 Ga0207675_1012078952 182
748 3300026121 Ga0207683_10082409 Ga0207683_100824092 182
749 3300026121 Ga0207683_10111729 Ga0207683_101117292 182
750 3300026121 Ga0207683_10304582 Ga0207683_103045821 182
751 3300026142 Ga0207698_10024589 Ga0207698_100245895 182
752 3300026142 Ga0207698_10081623 Ga0207698_100816231 182
753 3300026142 Ga0207698_10208977 Ga0207698_102089773 182
754 3300026142 Ga0207698_10467902 Ga0207698_104679022 182
755 3300026142 Ga0207698_10483186 Ga0207698_104831861 182
756 3300027296 Ga0209389_1000019 Ga0209389_1000019146 182
757 3300027296 Ga0209389_1000070 Ga0209389_100007047 182
758 3300027357 Ga0209589_1000420 Ga0209589_10004203 182
759 3300027361 Ga0209489_100033 Ga0209489_100033145 182
760 3300027361 Ga0209489_100196 Ga0209489_10019665 182
761 3300027363 Ga0209700_100012 Ga0209700_100012223 182
762 3300027671 Ga0209588_1081802 Ga0209588_10818022 182
763 3300027866 Ga0209813_10215257 Ga0209813_102152572 182
764 3300028379 Ga0268266_10001750 Ga0268266_100017502 182
765 3300028379 Ga0268266_10012580 Ga0268266_100125808 182
766 3300028379 Ga0268266_10020716 Ga0268266_100207164 182
767 3300028379 Ga0268266_10182525 Ga0268266_101825252 182
768 3300028379 Ga0268266_10440426 Ga0268266_104404262 182
769 3300028379 Ga0268266_11062369 Ga0268266_110623691 182
770 3300028380 Ga0268265_10078508 Ga0268265_100785082 182
771 3300028380 Ga0268265_10098350 Ga0268265_100983502 182
772 3300028380 Ga0268265_10182067 Ga0268265_101820674 182
773 3300028380 Ga0268265_10317928 Ga0268265_103179282 182
774 3300028380 Ga0268265_11219140 Ga0268265_112191401 182
775 3300028380 Ga0268265_11260766 Ga0268265_112607661 182
776 3300028381 Ga0268264_10000042 Ga0268264_10000042297 182
777 3300028381 Ga0268264_10157436 Ga0268264_101574362 182
778 3300028381 Ga0268264_10208538 Ga0268264_102085382 182
779 3300028381 Ga0268264_10484116 Ga0268264_104841162 182
780 3300028381 Ga0268264_10999100 Ga0268264_109991002 182
781 3300028786 Ga0307517_10111696 Ga0307517_101116962 182
782 3300028786 Ga0307517_10319483 Ga0307517_103194832 182
783 3300030521 Ga0307511_10097830 Ga0307511_100978303 182
784 3300030521 Ga0307511_10357059 Ga0307511_103570591 182
785 3300030763 Ga0265763_1003622 Ga0265763_10036222 182
786 3300031235 Ga0265330_10041534 Ga0265330_100415342 182
787 3300031238 Ga0265332_10010699 Ga0265332_100106992 182
788 3300031238 Ga0265332_10069712 Ga0265332_100697123 182
789 3300031241 Ga0265325_10006203 Ga0265325_100062034 182
790 3300031247 Ga0265340_10422145 Ga0265340_104221451 182
791 3300031249 Ga0265339_10058663 Ga0265339_100586632 182
792 3300031456 Ga0307513_10661935 Ga0307513_106619352 182
793 3300031507 Ga0307509_10064485 Ga0307509_100644853 182
794 3300031507 Ga0307509_10145606 Ga0307509_101456062 182
795 3300031507 Ga0307509_10236279 Ga0307509_102362793 182
796 3300031548 Ga0307408_100297561 Ga0307408_1002975612 182
797 3300031548 Ga0307408_101237452 Ga0307408_1012374521 182
798 3300031595 Ga0265313_10128288 Ga0265313_101282882 182
799 3300031616 Ga0307508_10000019 Ga0307508_1000001945 182
800 3300031616 Ga0307508_10028707 Ga0307508_100287074 182
801 3300031616 Ga0307508_10527312 Ga0307508_105273121 182
802 3300031711 Ga0265314_10062912 Ga0265314_100629124 182
803 3300031711 Ga0265314_10101325 Ga0265314_101013252 182
804 3300031712 Ga0265342_10024875 Ga0265342_100248752 182
805 3300031730 Ga0307516_10031276 Ga0307516_100312762 182
806 3300031730 Ga0307516_10222211 Ga0307516_102222112 182
807 3300031730 Ga0307516_10479814 Ga0307516_104798142 182
808 3300031731 Ga0307405_10404626 Ga0307405_104046262 182
809 3300031824 Ga0307413_10046074 Ga0307413_100460741 182
810 3300031852 Ga0307410_10178068 Ga0307410_101780683 182
811 3300031903 Ga0307407_11114944 Ga0307407_111149441 182
812 3300032002 Ga0307416_101070613 Ga0307416_1010706132 182
813 3300032126 Ga0307415_100152049 Ga0307415_1001520492 182
814 3300033179 Ga0307507_10027162 Ga0307507_100271622 182
815 3300033180 Ga0307510_10012956 Ga0307510_100129567 182
816 3300033180 Ga0307510_10063261 Ga0307510_100632612 182
817 3300033180 Ga0307510_10212742 Ga0307510_102127422 182
818 3300033544 Ga0316215_1006075 Ga0316215_10060752 182
819 3300034817 Ga0373948_0063694 Ga0373948_0063694_31_579 182
820 3300035086 Ga0373934_0032798 Ga0373934_0032798_1234_1782 182
821 3300035092 Ga0373952_0017318 Ga0373952_0017318_88_636 182
822 3300035111 Ga0373923_0001449 Ga0373923_0001449_1607_2155 182
823 3300035111 Ga0373923_0071395 Ga0373923_0071395_912_1460 182
824 3300035116 Ga0373945_0274618 Ga0373945_0274618_150_698 182
825 3300035117 Ga0373953_0020632 Ga0373953_0020632_970_1518 182
826 3300035118 Ga0373954_0005227 Ga0373954_0005227_2370_2918 182
827 3300035118 Ga0373954_0024857 Ga0373954_0024857_563_1111 182
828 3300035119 Ga0373956_0037950 Ga0373956_0037950_691_1239 182
829 3300035170 Ga0373943_0057731 Ga0373943_0057731_333_881 182
830 3300035171 Ga0373946_0031993 Ga0373946_0031993_177_725 182
831 3300035172 Ga0373955_0018171 Ga0373955_0018171_1574_2122 182
832 3300035172 Ga0373955_0112026 Ga0373955_0112026_684_1232 182
833 3300035410 Ga0373924_0128840 Ga0373924_0128840_17_622 182
834 3300035691 Ga0373931_0259862 Ga0373931_0259862_391_939 182
835 3300035692 Ga0373935_0731878 Ga0373935_0731878_25_573 182
836 3300035695 Ga0373927_0019061 Ga0373927_0019061_289_837 182
837 3300035695 Ga0373927_0033776 Ga0373927_0033776_309_869 182
838 3300035724 Ga0373933_0000063 Ga0373933_0000063_7599_8147 182
839 3300035724 Ga0373933_0022082 Ga0373933_0022082_2686_3234 182
840 3300035725 Ga0373947_0010644 Ga0373947_0010644_3695_4243 182
841 3300035725 Ga0373947_0356258 Ga0373947_0356258_16_564 182
842 3300035725 Ga0373947_0754854 Ga0373947_0754854_80_628 182
843 3300036401 Ga0373937_0015969 Ga0373937_0015969_6049_6597 182
844 3300036401 Ga0373937_0166920 Ga0373937_0166920_1086_1634 182
845 3300036459 Ga0372808_024717 Ga0372808_024717_16_564 182
846 3300037068 Ga0373925_0014564 Ga0373925_0014564_4175_4735 182
847 3300037068 Ga0373925_0031600 Ga0373925_0031600_2204_2752 182
848 3300037068 Ga0373925_0182921 Ga0373925_0182921_662_1210 182
849 3300037068 Ga0373925_0663440 Ga0373925_0663440_172_720 182
850 3300037418 Ga0395900_0257682 Ga0395900_0257682_107_655 182
851 3300037418 Ga0395900_0467664 Ga0395900_0467664_465_1013 182
852 3300037471 Ga0395905_0036933 Ga0395905_0036933_2834_3382 182
853 3300037471 Ga0395905_0141495 Ga0395905_0141495_1670_2218 182
854 3300037471 Ga0395905_0331798 Ga0395905_0331798_714_1262 182
855 3300038443 Ga0395901_0181460 Ga0395901_0181460_1610_2158 182
856 3300038443 Ga0395901_0791282 Ga0395901_0791282_366_914 182
857 3300039438 Ga0436360_1239273 Ga0436360_1239273_235_783 182
858 3300039447 Ga0436361_0844543 Ga0436361_0844543_500_1048 182
859 3300039450 Ga0436363_0375853 Ga0436363_0375853_530_1078 182
860 3300041413 Ga0439465_0069580 Ga0439465_0069580_458_1006 182
861 3300041451 Ga0451791_1341753 Ga0451791_1341753_66_614 182
862 3300041456 Ga0451795_1660820 Ga0451795_1660820_410_958 182
863 3300041460 Ga0451802_1316910 Ga0451802_1316910_36_584 182
864 3300042012 Ga0439455_0042423 Ga0439455_0042423_432_980 182
865 3300044656 Ga0466969_0037060 Ga0466969_0037060_1726_2274 182
866 3300044683 Ga0466965_0001649 Ga0466965_0001649_5067_5615 182
867 3300044684 Ga0466966_0437489 Ga0466966_0437489_146_694 182
868 3300044735 Ga0466968_0177229 Ga0466968_0177229_106_654 182
869 3300045049 Ga0466959_0093678 Ga0466959_0093678_1016_1564 182
870 3300045049 Ga0466959_0227168 Ga0466959_0227168_540_1088 182
871 3300045976 Ga0466967_0006925 Ga0466967_0006925_3749_4297 182
872 3300045976 Ga0466967_0220271 Ga0466967_0220271_250_798 182
873 3300045976 Ga0466967_0652546 Ga0466967_0652546_481_1029 182
874 3300045976 Ga0466967_0731326 Ga0466967_0731326_362_910 182
875 3300045976 Ga0466967_1313103 Ga0466967_1313103_96_644 182
876 3300046452 Ga0495617_066080 Ga0495617_066080_379_927 182
877 3300046452 Ga0495617_075090 Ga0495617_075090_374_922 182
878 3300046454 Ga0495592_0066237 Ga0495592_0066237_1587_2135 182
879 3300046454 Ga0495592_0586255 Ga0495592_0586255_110_658 182
880 3300046455 Ga0495603_0046839 Ga0495603_0046839_564_1112 182
881 3300046455 Ga0495603_0098426 Ga0495603_0098426_424_972 182
882 3300046455 Ga0495603_0207647 Ga0495603_0207647_477_1025 182
883 3300046455 Ga0495603_0308214 Ga0495603_0308214_97_645 182
884 3300046455 Ga0495603_0481901 Ga0495603_0481901_101_649 182
885 3300046457 Ga0495590_0116349 Ga0495590_0116349_29_577 182
886 3300046457 Ga0495590_0216556 Ga0495590_0216556_90_638 182
887 3300046458 Ga0495591_072731 Ga0495591_072731_158_706 182
888 3300046459 Ga0495629_0062767 Ga0495629_0062767_1700_2248 182
889 3300046459 Ga0495629_0063946 Ga0495629_0063946_1299_1847 182
890 3300046459 Ga0495629_0292168 Ga0495629_0292168_257_805 182
891 3300046460 Ga0495638_0018594 Ga0495638_0018594_327_875 182
892 3300046460 Ga0495638_0376603 Ga0495638_0376603_85_633 182
893 3300046461 Ga0495641_0168302 Ga0495641_0168302_373_921 182
894 3300046461 Ga0495641_0250126 Ga0495641_0250126_33_581 182
895 3300046462 Ga0495651_0008281 Ga0495651_0008281_2747_3295 182
896 3300046462 Ga0495651_0070262 Ga0495651_0070262_578_1126 182
897 3300046463 Ga0495653_0015404 Ga0495653_0015404_1628_2176 182
898 3300046471 Ga0495650_0059806 Ga0495650_0059806_121_669 182
899 3300046472 Ga0495580_0136985 Ga0495580_0136985_1112_1660 182
900 3300046472 Ga0495580_0261951 Ga0495580_0261951_338_886 182
901 3300046473 Ga0495582_0039702 Ga0495582_0039702_514_1062 182
902 3300046475 Ga0495639_0027583 Ga0495639_0027583_1828_2376 182
903 3300046475 Ga0495639_0172023 Ga0495639_0172023_443_991 182
904 3300046476 Ga0495662_0067305 Ga0495662_0067305_384_932 182
905 3300046476 Ga0495662_0174281 Ga0495662_0174281_184_732 182
906 3300046477 Ga0495664_0006295 Ga0495664_0006295_545_1093 182
907 3300046477 Ga0495664_0007640 Ga0495664_0007640_5093_5641 182
908 3300046477 Ga0495664_0040645 Ga0495664_0040645_968_1516 182
909 3300046477 Ga0495664_0411068 Ga0495664_0411068_242_790 182
910 3300046491 Ga0495584_0199374 Ga0495584_0199374_82_630 182
911 3300046491 Ga0495584_0310754 Ga0495584_0310754_189_737 182
912 3300046491 Ga0495584_0510450 Ga0495584_0510450_14_562 182
913 3300046492 Ga0495585_0125079 Ga0495585_0125079_12_560 182
914 3300046492 Ga0495585_0295182 Ga0495585_0295182_144_692 182
915 3300046500 Ga0495596_0031995 Ga0495596_0031995_1194_1742 182
916 3300046500 Ga0495596_0037542 Ga0495596_0037542_348_896 182
917 3300046501 Ga0495607_0079379 Ga0495607_0079379_1104_1652 182
918 3300046501 Ga0495607_0117166 Ga0495607_0117166_545_1093 182
919 3300046501 Ga0495607_0126593 Ga0495607_0126593_442_990 182
920 3300046507 Ga0495606_0034184 Ga0495606_0034184_786_1334 182
921 3300046507 Ga0495606_0062400 Ga0495606_0062400_637_1185 182
922 3300046507 Ga0495606_0218832 Ga0495606_0218832_116_664 182
923 3300046511 Ga0495608_0030647 Ga0495608_0030647_449_997 182
924 3300046511 Ga0495608_0037928 Ga0495608_0037928_2000_2548 182
925 3300046511 Ga0495608_0090356 Ga0495608_0090356_1135_1683 182
926 3300046511 Ga0495608_0131373 Ga0495608_0131373_603_1151 182
927 3300046512 Ga0495610_0114525 Ga0495610_0114525_102_650 182
928 3300046514 Ga0495618_0027210 Ga0495618_0027210_2281_2829 182
929 3300046514 Ga0495618_0159045 Ga0495618_0159045_135_683 182
930 3300046515 Ga0495620_0124095 Ga0495620_0124095_49_597 182
931 3300046516 Ga0495628_0012808 Ga0495628_0012808_1587_2135 182
932 3300046516 Ga0495628_0073069 Ga0495628_0073069_1151_1699 182
933 3300046516 Ga0495628_0823006 Ga0495628_0823006_83_631 182
934 3300046517 Ga0495630_0025809 Ga0495630_0025809_1631_2179 182
935 3300046518 Ga0495631_0076240 Ga0495631_0076240_257_805 182
936 3300046518 Ga0495631_0178702 Ga0495631_0178702_71_619 182
937 3300046518 Ga0495631_0278335 Ga0495631_0278335_34_582 182
938 3300046519 Ga0495632_0336178 Ga0495632_0336178_32_580 182
939 3300046523 Ga0495644_0106168 Ga0495644_0106168_353_901 182
940 3300046524 Ga0495648_0065044 Ga0495648_0065044_883_1431 182
941 3300046524 Ga0495648_0112223 Ga0495648_0112223_748_1296 182
942 3300046524 Ga0495648_0324407 Ga0495648_0324407_103_651 182
943 3300046526 Ga0495666_0082498 Ga0495666_0082498_942_1490 182
944 3300046529 Ga0495652_0008389 Ga0495652_0008389_5859_6407 182
945 3300046529 Ga0495652_0015423 Ga0495652_0015423_291_839 182
946 3300046529 Ga0495652_0298760 Ga0495652_0298760_443_991 182
947 3300046531 Ga0495665_0014869 Ga0495665_0014869_1047_1595 182
948 3300046533 Ga0495640_0007684 Ga0495640_0007684_2075_2623 182
949 3300046533 Ga0495640_0069972 Ga0495640_0069972_189_737 182
950 3300046533 Ga0495640_0122825 Ga0495640_0122825_366_926 182
951 3300046536 Ga0495587_0004526 Ga0495587_0004526_2619_3167 182
952 3300046536 Ga0495587_0041752 Ga0495587_0041752_2017_2565 182
953 3300046536 Ga0495587_0150985 Ga0495587_0150985_711_1259 182
954 3300046537 Ga0495598_0085115 Ga0495598_0085115_76_624 182
955 3300046538 Ga0495609_0054630 Ga0495609_0054630_1129_1677 182
956 3300046538 Ga0495609_0223900 Ga0495609_0223900_117_665 182
957 3300046539 Ga0495621_0013631 Ga0495621_0013631_717_1265 182
958 3300046557 Ga0495622_0032380 Ga0495622_0032380_1578_2126 182
959 3300046557 Ga0495622_0073468 Ga0495622_0073468_704_1252 182
960 3300046557 Ga0495622_0088900 Ga0495622_0088900_212_760 182
961 3300046558 Ga0495633_0032239 Ga0495633_0032239_1367_1915 182
962 3300046558 Ga0495633_0228016 Ga0495633_0228016_191_739 182
963 3300046559 Ga0495667_0066349 Ga0495667_0066349_28_576 182
964 3300046615 Ga0495656_0005186 Ga0495656_0005186_452_1000 182
965 3300046615 Ga0495656_0278278 Ga0495656_0278278_79_627 182
966 3300046615 Ga0495656_0407025 Ga0495656_0407025_65_613 182
967 3300046616 Ga0495668_0153560 Ga0495668_0153560_47_595 182
968 3300046616 Ga0495668_0210281 Ga0495668_0210281_480_1028 182
969 3300046642 Ga0495634_0042931 Ga0495634_0042931_515_1063 182
970 3300046642 Ga0495634_0139915 Ga0495634_0139915_855_1403 182
971 3300046648 Ga0495611_0307394 Ga0495611_0307394_161_709 182
972 3300046660 Ga0495625_0181455 Ga0495625_0181455_708_1256 182
973 3300046660 Ga0495625_0222170 Ga0495625_0222170_400_948 182
974 3300046660 Ga0495625_0253983 Ga0495625_0253983_440_988 182
975 3300046660 Ga0495625_0346260 Ga0495625_0346260_378_926 182
976 3300046660 Ga0495625_0453145 Ga0495625_0453145_148_696 182
977 3300046663 Ga0495635_0038939 Ga0495635_0038939_1894_2442 182
978 3300046663 Ga0495635_0066373 Ga0495635_0066373_1368_1916 182
979 3300046663 Ga0495635_0245259 Ga0495635_0245259_643_1191 182
980 3300046664 Ga0495659_0012114 Ga0495659_0012114_1843_2391 182
981 3300046665 Ga0495661_0192003 Ga0495661_0192003_436_984 182
982 3300046674 Ga0495588_0002970 Ga0495588_0002970_1125_1673 182
983 3300046675 Ga0495657_0004660 Ga0495657_0004660_8691_9239 182
984 3300046675 Ga0495657_0007028 Ga0495657_0007028_5153_5701 182
985 3300046675 Ga0495657_0058516 Ga0495657_0058516_1562_2110 182
986 3300046678 Ga0495599_0003699 Ga0495599_0003699_6740_7288 182
987 3300046678 Ga0495599_0004338 Ga0495599_0004338_7527_8075 182
988 3300046679 Ga0495623_0003278 Ga0495623_0003278_5459_6007 182
989 3300046679 Ga0495623_0003743 Ga0495623_0003743_2670_3218 182
990 3300046679 Ga0495623_0331496 Ga0495623_0331496_69_617 182
991 3300046680 Ga0495646_0010569 Ga0495646_0010569_1543_2091 182
992 3300046680 Ga0495646_0028033 Ga0495646_0028033_1989_2537 182
993 3300046681 Ga0495647_0032616 Ga0495647_0032616_146_694 182
994 3300046681 Ga0495647_0331069 Ga0495647_0331069_129_677 182
995 3300046683 Ga0495658_0007910 Ga0495658_0007910_1168_1716 182
996 3300046684 Ga0495669_0011303 Ga0495669_0011303_1667_2215 182
997 3300046684 Ga0495669_0142073 Ga0495669_0142073_200_748 182
998 3300046689 Ga0495613_0373748 Ga0495613_0373748_324_872 182
999 3300046690 Ga0495624_0083074 Ga0495624_0083074_956_1504 182
1000 3300046690 Ga0495624_0115589 Ga0495624_0115589_177_725 182
1001 3300046694 Ga0495649_0034578 Ga0495649_0034578_1103_1651 182
1002 3300046694 Ga0495649_0230755 Ga0495649_0230755_29_577 182
1003 3300046694 Ga0495649_0516047 Ga0495649_0516047_35_583 182
1004 3300046794 Ga0495589_0393543 Ga0495589_0393543_16_564 182
1005 3300046809 Ga0495600_0008553 Ga0495600_0008553_4663_5211 182
1006 3300046809 Ga0495600_0032974 Ga0495600_0032974_1693_2241 182
1007 3300046809 Ga0495600_0207430 Ga0495600_0207430_169_717 182
1008 3300046810 Ga0495660_0281799 Ga0495660_0281799_113_661 182
1009 3300047315 Ga0495581_0025228 Ga0495581_0025228_1620_2168 182
1010 3300047315 Ga0495581_0151802 Ga0495581_0151802_37_585 182
1011 3300047317 Ga0495604_0011018 Ga0495604_0011018_1235_1783 182
1012 3300047317 Ga0495604_0089032 Ga0495604_0089032_1629_2177 182
1013 3300047319 Ga0495674_0003624 Ga0495674_0003624_5932_6480 182
1014 3300047319 Ga0495674_0026977 Ga0495674_0026977_1171_1719 182
1015 3300047319 Ga0495674_0314800 Ga0495674_0314800_221_769 182
1016 3300047319 Ga0495674_0373135 Ga0495674_0373135_423_971 182
1017 3300047320 Ga0495672_0031547 Ga0495672_0031547_1689_2237 182
1018 3300047320 Ga0495672_0077853 Ga0495672_0077853_1105_1653 182
1019 3300047321 Ga0495676_0073366 Ga0495676_0073366_1052_1600 182
1020 3300047321 Ga0495676_0219164 Ga0495676_0219164_181_729 182
1021 3300047321 Ga0495676_0556659 Ga0495676_0556659_185_733 182
1022 3300047322 Ga0495680_0021316 Ga0495680_0021316_1436_1984 182
1023 3300047322 Ga0495680_0063648 Ga0495680_0063648_1682_2230 182
1024 3300047322 Ga0495680_0390104 Ga0495680_0390104_98_658 182
1025 3300047323 Ga0495683_0266808 Ga0495683_0266808_49_597 182
1026 3300047444 Ga0495675_0054298 Ga0495675_0054298_325_873 182
1027 3300047444 Ga0495675_0167543 Ga0495675_0167543_741_1289 182
1028 3300047445 Ga0495677_0016237 Ga0495677_0016237_1260_1808 182
1029 3300047469 Ga0495673_0027590 Ga0495673_0027590_1998_2546 182
1030 3300047469 Ga0495673_0116220 Ga0495673_0116220_436_984 182
1031 3300047469 Ga0495673_0162606 Ga0495673_0162606_230_778 182
1032 3300047469 Ga0495673_0194194 Ga0495673_0194194_101_649 182
1033 3300047471 Ga0495684_0144787 Ga0495684_0144787_142_690 182
1034 3300047472 Ga0495686_0022800 Ga0495686_0022800_3146_3694 182
1035 3300047472 Ga0495686_0092187 Ga0495686_0092187_788_1336 182
1036 3300047472 Ga0495686_0137307 Ga0495686_0137307_866_1414 182
1037 3300047472 Ga0495686_0205080 Ga0495686_0205080_61_609 182
1038 3300047673 Ga0495593_0080074 Ga0495593_0080074_1093_1641 182
1039 3300047673 Ga0495593_0153827 Ga0495593_0153827_86_634 182
1040 3300048088 Ga0495602_0009817 Ga0495602_0009817_7236_7784 182
1041 3300048088 Ga0495602_0030956 Ga0495602_0030956_4306_4854 182
1042 3300048090 Ga0495615_0072732 Ga0495615_0072732_291_839 182
1043 3300048903 Ga0496100_0025148 Ga0496100_0025148_1745_2293 182
1044 3300048903 Ga0496100_0073207 Ga0496100_0073207_728_1276 182
1045 3300048903 Ga0496100_0133391 Ga0496100_0133391_929_1477 182
1046 3300048903 Ga0496100_0156872 Ga0496100_0156872_695_1243 182
1047 3300048903 Ga0496100_0425267 Ga0496100_0425267_70_618 182
1048 3300048903 Ga0496100_0522323 Ga0496100_0522323_265_813 182
1049 3300048904 Ga0496101_0066084 Ga0496101_0066084_527_1075 182
1050 3300048904 Ga0496101_0125304 Ga0496101_0125304_734_1282 182
1051 3300048904 Ga0496101_0129051 Ga0496101_0129051_1317_1865 182
1052 3300048904 Ga0496101_0141529 Ga0496101_0141529_442_990 182
1053 3300048904 Ga0496101_0309829 Ga0496101_0309829_459_1007 182
1054 3300048904 Ga0496101_0637172 Ga0496101_0637172_110_658 182
1055 3300048905 Ga0496102_0011346 Ga0496102_0011346_5827_6375 182
1056 3300048905 Ga0496102_0014546 Ga0496102_0014546_1708_2256 182
1057 3300048905 Ga0496102_0129342 Ga0496102_0129342_727_1275 182
1058 3300048905 Ga0496102_0160421 Ga0496102_0160421_400_948 182
1059 3300048905 Ga0496102_0229966 Ga0496102_0229966_475_1023 182
1060 3300048905 Ga0496102_0908406 Ga0496102_0908406_228_776 182
1061 3300048906 Ga0496103_0047445 Ga0496103_0047445_837_1385 182
1062 3300048906 Ga0496103_0239888 Ga0496103_0239888_134_682 182
1063 3300048907 Ga0496104_0008837 Ga0496104_0008837_1598_2146 182
1064 3300048907 Ga0496104_0016671 Ga0496104_0016671_2406_2954 182
1065 3300048907 Ga0496104_0053104 Ga0496104_0053104_2063_2611 182
1066 3300048907 Ga0496104_0400116 Ga0496104_0400116_372_920 182
1067 3300048908 Ga0496105_0004610 Ga0496105_0004610_1192_1740 182
1068 3300048908 Ga0496105_0010647 Ga0496105_0010647_3446_3994 182
1069 3300048908 Ga0496105_0157233 Ga0496105_0157233_1080_1628 182
1070 3300048908 Ga0496105_0417425 Ga0496105_0417425_236_784 182
1071 3300048909 Ga0496106_0000686 Ga0496106_0000686_20975_21523 182
1072 3300048909 Ga0496106_0018004 Ga0496106_0018004_1844_2392 182
1073 3300048909 Ga0496106_0045929 Ga0496106_0045929_693_1241 182
1074 3300048909 Ga0496106_0264207 Ga0496106_0264207_174_722 182
1075 3300048909 Ga0496106_0952757 Ga0496106_0952757_108_656 182
1076 3300048910 Ga0496107_0002437 Ga0496107_0002437_1414_1962 182
1077 3300048910 Ga0496107_0050506 Ga0496107_0050506_422_970 182
1078 3300048910 Ga0496107_0221256 Ga0496107_0221256_43_591 182
1079 3300048910 Ga0496107_0258987 Ga0496107_0258987_503_1051 182
1080 3300048911 Ga0496108_0025485 Ga0496108_0025485_3154_3702 182
1081 3300048911 Ga0496108_0044102 Ga0496108_0044102_778_1326 182
1082 3300048911 Ga0496108_0410083 Ga0496108_0410083_451_999 182
1083 3300048911 Ga0496108_0749129 Ga0496108_0749129_112_660 182
1084 3300048911 Ga0496108_0852258 Ga0496108_0852258_131_679 182
1085 3300048912 Ga0496109_0003924 Ga0496109_0003924_384_932 182
1086 3300048912 Ga0496109_0045827 Ga0496109_0045827_1830_2378 182
1087 3300048912 Ga0496109_0165052 Ga0496109_0165052_1048_1596 182
1088 3300048912 Ga0496109_0233844 Ga0496109_0233844_928_1476 182
1089 3300048913 Ga0496110_0089556 Ga0496110_0089556_363_911 182
1090 3300048913 Ga0496110_0209409 Ga0496110_0209409_740_1288 182
1091 3300048914 Ga0496111_0035774 Ga0496111_0035774_964_1512 182
1092 3300048914 Ga0496111_0097953 Ga0496111_0097953_883_1431 182
1093 3300048914 Ga0496111_0288787 Ga0496111_0288787_299_847 182
1094 3300048914 Ga0496111_0340517 Ga0496111_0340517_398_946 182
1095 3300048914 Ga0496111_0608327 Ga0496111_0608327_205_753 182
1096 3300048915 Ga0496112_0006770 Ga0496112_0006770_7742_8290 182
1097 3300048915 Ga0496112_0051032 Ga0496112_0051032_1790_2338 182
1098 3300048915 Ga0496112_0148125 Ga0496112_0148125_1255_1803 182
1099 3300048916 Ga0496113_0044120 Ga0496113_0044120_2023_2571 182
1100 3300048916 Ga0496113_0093280 Ga0496113_0093280_1124_1672 182
1101 3300048916 Ga0496113_0260109 Ga0496113_0260109_731_1279 182
1102 3300048917 Ga0496114_0008237 Ga0496114_0008237_5745_6293 182
1103 3300048917 Ga0496114_0058373 Ga0496114_0058373_1336_1884 182
1104 3300048917 Ga0496114_0061251 Ga0496114_0061251_913_1461 182
1105 3300048917 Ga0496114_0453507 Ga0496114_0453507_559_1107 182
1106 3300048918 Ga0496115_0004137 Ga0496115_0004137_5907_6455 182
1107 3300048918 Ga0496115_0038906 Ga0496115_0038906_1344_1892 182
1108 3300048918 Ga0496115_0070621 Ga0496115_0070621_1692_2240 182
1109 3300048918 Ga0496115_0073684 Ga0496115_0073684_1254_1802 182
1110 3300048918 Ga0496115_0457806 Ga0496115_0457806_307_855 182
1111 3300048918 Ga0496115_0562589 Ga0496115_0562589_11_559 182
1112 3300048918 Ga0496115_0909291 Ga0496115_0909291_74_622 182
1113 3300048919 Ga0496116_0051720 Ga0496116_0051720_1042_1590 182
1114 3300048919 Ga0496116_0146804 Ga0496116_0146804_730_1278 182
1115 3300048919 Ga0496116_0349303 Ga0496116_0349303_41_589 182
1116 3300048920 Ga0496117_0099835 Ga0496117_0099835_976_1524 182
1117 3300048920 Ga0496117_0212196 Ga0496117_0212196_457_1005 182
1118 3300048921 Ga0496118_0002254 Ga0496118_0002254_21004_21552 182
1119 3300048921 Ga0496118_0066683 Ga0496118_0066683_131_679 182
1120 3300048921 Ga0496118_0207120 Ga0496118_0207120_578_1126 182
1121 3300048922 Ga0496119_0028316 Ga0496119_0028316_1571_2119 182
1122 3300048922 Ga0496119_0060196 Ga0496119_0060196_818_1366 182
1123 3300048922 Ga0496119_0146391 Ga0496119_0146391_524_1072 182
1124 3300048923 Ga0496120_0025120 Ga0496120_0025120_2452_3000 182
1125 3300048923 Ga0496120_0026454 Ga0496120_0026454_1403_1951 182
1126 3300048923 Ga0496120_0252140 Ga0496120_0252140_217_765 182
1127 3300048924 Ga0496121_0000418 Ga0496121_0000418_65348_65896 182
1128 3300048924 Ga0496121_0002936 Ga0496121_0002936_3181_3729 182
1129 3300048924 Ga0496121_0069154 Ga0496121_0069154_391_939 182
1130 3300048924 Ga0496121_0089141 Ga0496121_0089141_1623_2171 182
1131 3300048924 Ga0496121_0094832 Ga0496121_0094832_1758_2306 182
1132 3300048924 Ga0496121_0105044 Ga0496121_0105044_646_1194 182
1133 3300048924 Ga0496121_0165237 Ga0496121_0165237_778_1326 182
1134 3300048924 Ga0496121_0187326 Ga0496121_0187326_825_1385 182
1135 3300048924 Ga0496121_0471870 Ga0496121_0471870_134_682 182
1136 3300048925 Ga0496122_0060272 Ga0496122_0060272_698_1246 182
1137 3300048927 Ga0496124_0013566 Ga0496124_0013566_2551_3099 182
1138 3300048927 Ga0496124_0352026 Ga0496124_0352026_116_664 182
1139 3300048927 Ga0496124_0447110 Ga0496124_0447110_283_831 182
1140 3300048927 Ga0496124_0673290 Ga0496124_0673290_79_627 182
1141 3300048928 Ga0496125_0079515 Ga0496125_0079515_1600_2148 182
1142 3300048928 Ga0496125_0326424 Ga0496125_0326424_20_568 182
1143 3300048928 Ga0496125_0556472 Ga0496125_0556472_57_605 182
1144 3300048929 Ga0496126_0014146 Ga0496126_0014146_5385_5933 182
1145 3300048929 Ga0496126_0059646 Ga0496126_0059646_1360_1908 182
1146 3300048929 Ga0496126_0067084 Ga0496126_0067084_1185_1733 182
1147 3300048929 Ga0496126_0085351 Ga0496126_0085351_570_1118 182
1148 3300048929 Ga0496126_0085769 Ga0496126_0085769_85_645 182
1149 3300048929 Ga0496126_0112964 Ga0496126_0112964_504_1052 182
1150 3300048929 Ga0496126_0223051 Ga0496126_0223051_1021_1569 182
1151 3300048929 Ga0496126_0292524 Ga0496126_0292524_597_1145 182
1152 3300048929 Ga0496126_0564181 Ga0496126_0564181_193_741 182
1153 3300048929 Ga0496126_0621626 Ga0496126_0621626_61_621 182
1154 3300048929 Ga0496126_0624353 Ga0496126_0624353_151_699 182
1155 3300049459 Ga0495678_048931 Ga0495678_048931_1055_1603 182
1156 3300049460 Ga0495682_0025714 Ga0495682_0025714_213_761 182
1157 3300049460 Ga0495682_0183012 Ga0495682_0183012_181_729 182
1158 3300049569 Ga0501032_0147452 Ga0501032_0147452_960_1508 182
1159 3300049570 Ga0501033_0046533 Ga0501033_0046533_2087_2635 182
1160 3300049570 Ga0501033_0528186 Ga0501033_0528186_162_710 182
1161 3300049572 Ga0501036_0280472 Ga0501036_0280472_47_595 182
1162 3300049574 Ga0501038_0492247 Ga0501038_0492247_302_850 182
1163 3300049574 Ga0501038_0833650 Ga0501038_0833650_26_574 182
1164 3300049578 Ga0501042_0204330 Ga0501042_0204330_164_712 182
1165 3300049579 Ga0501043_0217688 Ga0501043_0217688_40_588 182
1166 3300049580 Ga0501046_0098652 Ga0501046_0098652_445_993 182
1167 3300049580 Ga0501046_0224021 Ga0501046_0224021_220_768 182
1168 3300049581 Ga0501047_0245365 Ga0501047_0245365_823_1371 182
1169 3300049581 Ga0501047_0800163 Ga0501047_0800163_129_677 182
1170 3300049583 Ga0501067_0376761 Ga0501067_0376761_92_640 182
1171 3300049584 Ga0501068_0377371 Ga0501068_0377371_268_816 182
1172 3300049589 Ga0501073_0385148 Ga0501073_0385148_47_595 182
1173 3300049741 Ga0501079_0587908 Ga0501079_0587908_283_831 182
1174 3300049742 Ga0501080_0269278 Ga0501080_0269278_401_949 182
1175 3300049824 Ga0501045_0277812 Ga0501045_0277812_560_1108 182
1176 3300050490 nmdc:mga03n38_50730_c1 nmdc:mga03n38_50730_c1_969_1517 182
1177 3300050491 nmdc:mga00v17_60702_c1 nmdc:mga00v17_60702_c1_1610_2158 182
1178 3300050492 nmdc:mga0yw44_127605_c1 nmdc:mga0yw44_127605_c1_585_1133 182
1179 3300050492 nmdc:mga0yw44_202907_c1 nmdc:mga0yw44_202907_c1_677_1225 182
1180 3300050492 nmdc:mga0yw44_58600_c1 nmdc:mga0yw44_58600_c1_570_1118 182
1181 3300050492 nmdc:mga0yw44_658171_c1 nmdc:mga0yw44_658171_c1_143_691 182
1182 3300050492 nmdc:mga0yw44_91492_c1 nmdc:mga0yw44_91492_c1_1200_1748 182
1183 3300050492 nmdc:mga0yw44_99297_c1 nmdc:mga0yw44_99297_c1_61_609 182
1184 3300050493 nmdc:mga0k408_141336_c1 nmdc:mga0k408_141336_c1_160_708 182
1185 3300050493 nmdc:mga0k408_31373_c1 nmdc:mga0k408_31373_c1_1937_2485 182
1186 3300050493 nmdc:mga0k408_423327_c1 nmdc:mga0k408_423327_c1_105_653 182
1187 3300050493 nmdc:mga0k408_447766_c1 nmdc:mga0k408_447766_c1_157_705 182
1188 3300050494 nmdc:mga06z11_118819_c1 nmdc:mga06z11_118819_c1_744_1292 182
1189 3300050494 nmdc:mga06z11_535315_c1 nmdc:mga06z11_535315_c1_137_685 182
1190 3300050494 nmdc:mga06z11_70679_c1 nmdc:mga06z11_70679_c1_443_991 182
1191 3300050494 nmdc:mga06z11_71378_c1 nmdc:mga06z11_71378_c1_402_950 182
1192 3300050496 nmdc:mga07m45_15195_c1 nmdc:mga07m45_15195_c1_2221_2769 182
1193 3300050496 nmdc:mga07m45_54820_c1 nmdc:mga07m45_54820_c1_1107_1655 182
1194 3300050507 nmdc:mga05p37_625615_c1 nmdc:mga05p37_625615_c1_40_588 182
1195 3300050511 nmdc:mga08y16_608506_c1 nmdc:mga08y16_608506_c1_157_705 182
1196 3300050512 nmdc:mga0n895_92585_c1 nmdc:mga0n895_92585_c1_1416_1964 182
1197 3300050513 nmdc:mga0rr50_190052_c1 nmdc:mga0rr50_190052_c1_680_1228 182
1198 3300050514 nmdc:mga08x19_226641_c1 nmdc:mga08x19_226641_c1_422_970 182
1199 3300050516 nmdc:mga0sz30_12995_c1 nmdc:mga0sz30_12995_c1_775_1323 182
1200 3300053077 Ga0495601_0006668 Ga0495601_0006668_1815_2363 182
1201 3300053077 Ga0495601_0458751 Ga0495601_0458751_95_643 182
1202 3300053077 Ga0495601_0636049 Ga0495601_0636049_81_629 182
1203 3300053078 Ga0495612_0017107 Ga0495612_0017107_1112_1660 182
1204 3300053078 Ga0495612_0020652 Ga0495612_0020652_242_790 182
1205 3300053078 Ga0495612_0057198 Ga0495612_0057198_884_1432 182
1206 3300053080 Ga0500635_0008731 Ga0500635_0008731_330_878 182
1207 3300053080 Ga0500635_0027860 Ga0500635_0027860_877_1425 182
1208 3300053083 Ga0495655_0032705 Ga0495655_0032705_332_880 182
1209 3300053084 Ga0495595_0003659 Ga0495595_0003659_5496_6044 182
1210 3300053085 Ga0495619_0127330 Ga0495619_0127330_479_1027 182
1211 3300053086 Ga0500578_0225374 Ga0500578_0225374_365_913 182
1212 3300053086 Ga0500578_0374342 Ga0500578_0374342_262_810 182
1213 3300053086 Ga0500578_0427379 Ga0500578_0427379_188_736 182
1214 3300053087 Ga0500643_000013 Ga0500643_000013_290214_290762 182
1215 3300053087 Ga0500643_031899 Ga0500643_031899_850_1398 182
1216 3300053091 Ga0500647_0025467 Ga0500647_0025467_2123_2671 182
1217 3300053092 Ga0500583_0021956 Ga0500583_0021956_1484_2032 182
1218 3300053094 Ga0500566_0001097 Ga0500566_0001097_9953_10501 182
1219 3300053094 Ga0500566_0165914 Ga0500566_0165914_558_1118 182
1220 3300053094 Ga0500566_0201950 Ga0500566_0201950_55_603 182
1221 3300053094 Ga0500566_0253961 Ga0500566_0253961_43_591 182
1222 3300053095 Ga0500640_011592 Ga0500640_011592_1026_1619 182
1223 3300053096 Ga0500641_0024104 Ga0500641_0024104_952_1500 182
1224 3300053096 Ga0500641_0063860 Ga0500641_0063860_914_1462 182
1225 3300053102 Ga0500554_051934 Ga0500554_051934_43_591 182
1226 3300053103 Ga0500555_002043 Ga0500555_002043_1437_1985 182
1227 3300053105 Ga0500557_000030 Ga0500557_000030_36062_36610 182
1228 3300053108 Ga0500562_081766 Ga0500562_081766_147_695 182
1229 3300053109 Ga0500569_000335 Ga0500569_000335_3709_4257 182
1230 3300053109 Ga0500569_034409 Ga0500569_034409_180_728 182
1231 3300053111 Ga0500572_000564 Ga0500572_000564_2271_2864 182
1232 3300053115 Ga0500591_101917 Ga0500591_101917_447_1040 182
1233 3300053118 Ga0500594_0053729 Ga0500594_0053729_547_1095 182
1234 3300053119 Ga0500595_004179 Ga0500595_004179_2997_3545 182
1235 3300053119 Ga0500595_020224 Ga0500595_020224_1415_1975 182
1236 3300053119 Ga0500595_086750 Ga0500595_086750_11_559 182
1237 3300053122 Ga0500608_043507 Ga0500608_043507_665_1258 182
1238 3300053123 Ga0500614_001304 Ga0500614_001304_402_995 182
1239 3300053128 Ga0500626_077751 Ga0500626_077751_737_1285 182
1240 3300053130 Ga0500642_0001580 Ga0500642_0001580_4381_4929 182
1241 3300053130 Ga0500642_0102946 Ga0500642_0102946_510_1058 182
1242 3300053130 Ga0500642_0172867 Ga0500642_0172867_183_731 182
1243 3300053133 Ga0500655_021885 Ga0500655_021885_448_996 182
1244 3300053133 Ga0500655_081654 Ga0500655_081654_35_583 182
1245 3300053134 Ga0500658_0368940 Ga0500658_0368940_38_586 182
1246 3300053136 Ga0500559_0002228 Ga0500559_0002228_7069_7662 182
1247 3300053136 Ga0500559_0006528 Ga0500559_0006528_2521_3069 182
1248 3300053142 Ga0500577_0057543 Ga0500577_0057543_493_1041 182
1249 3300053142 Ga0500577_0088701 Ga0500577_0088701_554_1102 182
1250 3300053146 Ga0500588_0169645 Ga0500588_0169645_206_754 182
1251 3300053148 Ga0500590_042681 Ga0500590_042681_867_1460 182
1252 3300053148 Ga0500590_058776 Ga0500590_058776_238_786 182
1253 3300053150 Ga0500603_001009 Ga0500603_001009_993_1586 182
1254 3300053150 Ga0500603_155260 Ga0500603_155260_87_647 182
1255 3300053151 Ga0500604_0055264 Ga0500604_0055264_484_1032 182
1256 3300053153 Ga0500616_0050783 Ga0500616_0050783_1618_2166 182
1257 3300053156 Ga0500622_0006329 Ga0500622_0006329_1802_2350 182
1258 3300053156 Ga0500622_0180231 Ga0500622_0180231_371_919 182
1259 3300053157 Ga0500624_016763 Ga0500624_016763_365_958 182
1260 3300053158 Ga0500627_0216478 Ga0500627_0216478_135_683 182
1261 3300053158 Ga0500627_0361846 Ga0500627_0361846_12_560 182
1262 3300053159 Ga0500630_034670 Ga0500630_034670_156_749 182
1263 3300053161 Ga0500634_0146500 Ga0500634_0146500_454_1002 182
1264 3300053162 Ga0500638_081586 Ga0500638_081586_366_926 182
1265 3300053162 Ga0500638_316079 Ga0500638_316079_19_567 182
1266 3300053163 Ga0500639_000006 Ga0500639_000006_35418_36011 182
1267 3300053163 Ga0500639_203396 Ga0500639_203396_212_760 182
1268 3300053177 Ga0500636_0002456 Ga0500636_0002456_7775_8323 182
1269 3300053177 Ga0500636_0033974 Ga0500636_0033974_1237_1785 182
1270 3300053177 Ga0500636_0183865 Ga0500636_0183865_277_825 182
1271 3300053178 Ga0500637_0055570 Ga0500637_0055570_876_1424 182
1272 3300053178 Ga0500637_0083616 Ga0500637_0083616_744_1292 182
1273 3300053727 Ga0500611_015747 Ga0500611_015747_439_987 182
1274 3300053730 Ga0500645_048655 Ga0500645_048655_519_1067 182
1275 3300053730 Ga0500645_160437 Ga0500645_160437_19_567 182
1276 3300053731 Ga0500609_019840 Ga0500609_019840_23_571 182
1277 3300053733 Ga0500552_022651 Ga0500552_022651_275_835 182
1278 3300053735 Ga0500596_002150 Ga0500596_002150_1332_1925 182
1279 3300053735 Ga0500596_009653 Ga0500596_009653_547_1095 182
1280 3300053737 Ga0500601_000881 Ga0500601_000881_1052_1600 182
1281 3300055283 Ga0500661_011876 Ga0500661_011876_375_923 182
1282 3300060353 Ga0501082_0742092 Ga0501082_0742092_204_752 182
1283 3300061719 Ga0466962_0035331 Ga0466962_0035331_1296_1844 182

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k0u-assembly1.cif.gz_A pilotin/secretin peptide complex 0.4316 47 143
4rcv-assembly1.cif.gz_B m. tuberculosis 1-deoxy-d-xylulose-5-phosphate reductoisomerase bound to 1-deoxy-l-erythrulose 0.4244 49 149
4k0u-assembly1.cif.gz_A pilotin/secretin peptide complex 0.4184 47 143
2y1e-assembly1.cif.gz_A x-ray structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase, dxr, rv2870c, from mycobacterium tuberculosis, in complex with manganese. 0.3722 49 149
4aic-assembly1.cif.gz_A x-ray structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase, dxr, rv2870c, from mycobacterium tuberculosis, in complex with fosmidomycin, manganese and nadph 0.3709 49 149
ID Description Score Start End Superfamily
af_Q5A4M2_319_627_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.4407 48 150 3.40.50.720
af_Q14094_32_136_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.3949 47 148 1.10.472.10
4akiA13 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.3933 50 156 1.10.8.740
af_Q8QZR8_12_138_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.39 36 157 1.10.472.10
af_Q9VE72_9_143_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.3835 49 149 1.10.472.10
ID Description Score Start End GO Terms
AF-A0A6N8YZB0-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8451 46 157
AF-A0A2V7A2F2-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8415 50 157
AF-A0A3M1RAH9-F1-model_v4 Twin-arginine translocation signal domain-containing protein 0.8394 44 167
AF-A0A2E6XEZ0-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8342 46 157
AF-A0A3D1YFG1-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8306 44 157

Feature Viewer

pLDDT pTM Quality
72.02 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map