F492524

General Info

Members Datasets Scaffolds Average Seq Length
1281 401 1237 691

Family's Representative Sequence

Representative Sequence 3300025321|Ga0207656_10009665|Ga0207656_100096652
Length 766
Sequence MRPNKRQSAIHPFPQTLSCSFSGSTLTHHRHNARSPLPPPNIRYPRAKADAKDVSMTDPAQMTEAEAANRLMRLAREIARHNRLYHDQDAPEITDAAYDALIRENNALEAAFPHLVRSDSPNALVGAASTSALRKVQHAVRMMSLDNGFSDEDIAEFVARVRRFLALPEDASVALTAEPKIDGLSCSLRYEMGELVLAATRGDGTTGEDVTANVRTIADIPQRLTGSAIPDLFEVRGEVYMAKADFVALNARLLAEAEDPEKARQFANPRNAAAGSLRQKDAAVTASRPLRFLAHGWGEVSAVPAETQLGVMQAIASWGLPVSDRLACVDTLEALIAHYRAIEAARADLPFDIDGVVYKVDRLDWQQRLGFVAKAPRWAIAHKFPAERAQTTLEAIDIQVGRTGKLTPVGRLTPVTVGGVVVSNVTLHNADEIARLGVRPGDRVIVQRAGDVIPQVVDNLTRDEPRAPFAFPDHCPVCQSEAVREEGEVDIRCTGGLICPAQRFERLRHFVSRAALDIEGLGEKSIEEFLDLGWIAEPADIFRLKSRRADLLGREGWKEKSVDNLLAAIEAKRQPDAARLLFGLGIRHVGAVTARDLLKRYTTLEGVRALAVGIIALRDAAAPAEGEEESRFRNRLDKAIAEHIGVENVGSAVGHALADFFHEPHNVDVWNDLLNEVSPPDYVVETTASAVTGKTVVFTGKLETMSRDEAKAQAERLGAKAAGSVSAKTDLVVAGPGAGSKLKQAAALGIDVIDEAAWAEIVKAAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
6 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
7 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
8 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
11 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
12 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
13 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
14 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
15 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
16 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
17 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
18 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
19 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
20 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
21 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
22 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
23 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
24 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
25 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
26 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
27 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
28 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
29 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
30 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
31 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
32 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
33 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
34 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
35 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
36 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
37 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
38 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
39 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
40 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
41 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
42 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
43 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
44 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
45 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
46 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
47 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
48 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
49 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
50 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
51 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
52 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
53 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
54 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
55 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
58 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
59 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
60 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
65 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
67 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
68 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
69 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
70 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
71 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
72 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
73 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
74 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
75 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
76 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
77 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
78 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
79 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
80 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
81 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
82 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
83 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
84 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
87 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
88 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
89 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
92 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
93 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
94 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
95 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
96 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
100 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
101 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
112 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
118 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
119 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
120 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
121 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
122 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
123 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
126 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
127 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
129 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
130 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
135 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
151 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
152 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
153 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
159 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
165 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
166 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
170 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
171 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
172 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
174 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
175 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
178 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
180 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
236 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
240 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
241 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
242 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
243 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
244 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
245 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
246 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
247 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
248 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
249 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
250 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
251 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
252 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
253 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
256 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
257 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
258 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
259 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
263 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
266 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
267 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
268 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
269 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
270 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
271 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
272 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
279 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
280 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
286 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
289 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
290 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
291 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
294 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
295 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
296 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
299 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
300 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
303 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
304 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
305 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
306 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
309 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
313 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
316 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
317 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
318 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
319 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
320 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
321 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
322 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
339 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
340 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
341 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
342 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
343 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
344 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
345 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
346 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
347 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
348 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
349 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
350 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
355 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
356 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
357 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
358 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
359 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
362 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
369 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
370 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
371 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
372 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
373 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
374 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
375 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
376 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
377 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
378 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
379 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
380 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
381 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
382 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
383 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
384 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
385 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
386 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
387 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
388 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
391 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
392 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
393 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
394 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
395 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
396 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
397 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
398 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
399 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
400 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
401 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 0.23
Isolates 3.43

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 9.6
Nodule 0
Rhizoplane 4.68
Rhizosphere 77.83
Stem 0
Stem Tuber 0.08
Unclassified 7.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1295667 2162886007 Bacteria 3445
2 SwRhRL2b_contig_3095957 2162886007 Bacteria 7002
3 JGI24736J21556_1000256 3300001904 Bacteria 9743
4 JGI24741J21665_1001719 3300001915 Bacteria 6037
5 JGI24740J21852_10002498 3300001979 Bacteria 8311
6 JGI24739J22299_10001027 3300001989 Bacteria 10334
7 JGI24739J22299_10011314 3300001989 Bacteria 3296
8 JGI24739J22299_10011321 3300001989 Bacteria 3295
9 JGI24737J22298_10001097 3300001990 Bacteria 9510
10 JGI24737J22298_10003655 3300001990 Bacteria 5416
11 JGI24750J21931_1000036 3300002070 Bacteria 18006
12 JGI24748J21848_1000103 3300002074 Bacteria 18872
13 JGI24738J21930_10003825 3300002075 Bacteria 3760
14 JGI24738J21930_10005720 3300002075 Bacteria 2959
15 JGI24034J26672_10000057 3300002239 Bacteria 42515
16 JGI25165J46597_1000024 3300003214 Bacteria 335150
17 JGI25165J46597_1000040 3300003214 Bacteria 277491
18 JGI25153J46596_10000083 3300003215 Bacteria 112056
19 Ga0055525_1000037 3300003759 Bacteria 297990
20 Ga0055542_1000286 3300003762 Bacteria 56470
21 Ga0055529_1000207 3300003763 Bacteria 78124
22 Ga0055537_1000506 3300003773 Bacteria 23507
23 Ga0055524_1000172 3300003775 Bacteria 73986
24 Ga0055536_1001812 3300003781 Bacteria 12554
25 Ga0055536_1004296 3300003781 Bacteria 7335
26 Ga0055530_10000012 3300003791 Bacteria 164829
27 Ga0055530_10000510 3300003791 Bacteria 33802
28 Ga0055531_10000319 3300003794 Bacteria 47189
29 Ga0055531_10000466 3300003794 Bacteria 37479
30 Ga0055531_10005767 3300003794 Bacteria 7169
31 Ga0055531_10005887 3300003794 Bacteria 7075
32 Ga0065165_1002380 3300005262 Bacteria 16208
33 Ga0065165_1007352 3300005262 Bacteria 5443
34 Ga0065704_10070339 3300005289 Bacteria 31626
35 Ga0065704_10070448 3300005289 Bacteria 24395
36 Ga0065715_10007198 3300005293 Bacteria 4171
37 Ga0065707_10081805 3300005295 Bacteria 38502
38 Ga0065707_10098895 3300005295 Bacteria 3046
39 Ga0070658_10000002 3300005327 Bacteria 637290
40 Ga0070658_10000022 3300005327 Bacteria 186706
41 Ga0070658_10000606 3300005327 Bacteria 31075
42 Ga0070658_10000711 3300005327 Bacteria 28815
43 Ga0070658_10000876 3300005327 Bacteria 25753
44 Ga0070658_10002861 3300005327 Bacteria 14332
45 Ga0070658_10002938 3300005327 Bacteria 14131
46 Ga0070658_10004481 3300005327 Bacteria 11365
47 Ga0070658_10022981 3300005327 Bacteria 5006
48 Ga0070658_10079872 3300005327 Bacteria 2686
49 Ga0070676_10000855 3300005328 Bacteria 15051
50 Ga0070676_10003403 3300005328 Bacteria 8279
51 Ga0070676_10049400 3300005328 Bacteria 2463
52 Ga0070683_100008796 3300005329 Bacteria 8587
53 Ga0070683_100012850 3300005329 Bacteria 7286
54 Ga0070683_100018957 3300005329 Bacteria 6104
55 Ga0070690_100000011 3300005330 Bacteria 95472
56 Ga0070690_100000870 3300005330 Bacteria 15367
57 Ga0070670_100000195 3300005331 Bacteria 56039
58 Ga0070670_100001616 3300005331 Bacteria 18214
59 Ga0070670_100002100 3300005331 Bacteria 16335
60 Ga0070670_100004382 3300005331 Bacteria 11817
61 Ga0070670_100006537 3300005331 Bacteria 9873
62 Ga0070670_100010492 3300005331 Bacteria 7908
63 Ga0070677_10000519 3300005333 Bacteria 13214
64 Ga0068869_100000031 3300005334 Bacteria 60884
65 Ga0070666_10000035 3300005335 Bacteria 121458
66 Ga0070666_10000182 3300005335 Bacteria 43137
67 Ga0070666_10000216 3300005335 Bacteria 39574
68 Ga0070666_10000421 3300005335 Bacteria 26263
69 Ga0070666_10003248 3300005335 Bacteria 9874
70 Ga0070680_100000404 3300005336 Bacteria 29487
71 Ga0070682_100024697 3300005337 Bacteria 3579
72 Ga0068868_100000060 3300005338 Bacteria 61952
73 Ga0068868_100000688 3300005338 Bacteria 22698
74 Ga0068868_100013170 3300005338 Bacteria 6058
75 Ga0070660_100000206 3300005339 Bacteria 39611
76 Ga0070660_100000373 3300005339 Bacteria 29732
77 Ga0070660_100000487 3300005339 Bacteria 26540
78 Ga0070660_100000568 3300005339 Bacteria 24762
79 Ga0070660_100000801 3300005339 Bacteria 20852
80 Ga0070660_100004715 3300005339 Bacteria 9437
81 Ga0070660_100013227 3300005339 Bacteria 5914
82 Ga0070660_100038715 3300005339 Bacteria 3620
83 Ga0070689_100002742 3300005340 Bacteria 11551
84 Ga0070691_10001768 3300005341 Bacteria 9399
85 Ga0070661_100000213 3300005344 Bacteria 48218
86 Ga0070661_100000783 3300005344 Bacteria 22884
87 Ga0070661_100010176 3300005344 Bacteria 6533
88 Ga0070661_100012107 3300005344 Bacteria 6031
89 Ga0070661_100015970 3300005344 Bacteria 5299
90 Ga0070668_100001440 3300005347 Bacteria 17174
91 Ga0070668_100004873 3300005347 Bacteria 9944
92 Ga0070668_100005256 3300005347 Bacteria 9604
93 Ga0070669_100000001 3300005353 Bacteria 537589
94 Ga0070669_100000453 3300005353 Bacteria 31221
95 Ga0070669_100000712 3300005353 Bacteria 24397
96 Ga0070669_100009301 3300005353 Bacteria 6996
97 Ga0070669_100010019 3300005353 Bacteria 6738
98 Ga0070669_100026611 3300005353 Bacteria 4162
99 Ga0070669_100031343 3300005353 Bacteria 3840
100 Ga0070675_100012981 3300005354 Bacteria 6541
101 Ga0070675_100067147 3300005354 Bacteria 2967
102 Ga0070671_100000002 3300005355 Bacteria 292733
103 Ga0070671_100000050 3300005355 Bacteria 80843
104 Ga0070671_100000297 3300005355 Bacteria 33662
105 Ga0070671_100001167 3300005355 Bacteria 19610
106 Ga0070671_100001670 3300005355 Bacteria 16795
107 Ga0070671_100002301 3300005355 Bacteria 14752
108 Ga0070671_100003906 3300005355 Bacteria 11723
109 Ga0070671_100005638 3300005355 Bacteria 9963
110 Ga0070671_100012902 3300005355 Bacteria 6736
111 Ga0070671_100030982 3300005355 Bacteria 4416
112 Ga0070671_100052892 3300005355 Bacteria 3376
113 Ga0070671_100064239 3300005355 Bacteria 3057
114 Ga0070674_100001269 3300005356 Bacteria 13284
115 Ga0070674_100009504 3300005356 Bacteria 5822
116 Ga0070674_100018895 3300005356 Bacteria 4368
117 Ga0070674_100028282 3300005356 Bacteria 3682
118 Ga0070674_100067998 3300005356 Bacteria 2508
119 Ga0070673_100000009 3300005364 Bacteria 155005
120 Ga0070673_100010591 3300005364 Bacteria 6249
121 Ga0070673_100045576 3300005364 Bacteria 3401
122 Ga0070673_100070938 3300005364 Bacteria 2798
123 Ga0070688_100001328 3300005365 Bacteria 12256
124 Ga0070659_100000029 3300005366 Bacteria 139518
125 Ga0070659_100000123 3300005366 Bacteria 58613
126 Ga0070659_100003053 3300005366 Bacteria 11903
127 Ga0070659_100008511 3300005366 Bacteria 7497
128 Ga0070659_100057750 3300005366 Bacteria 3060
129 Ga0070667_100000130 3300005367 Bacteria 95182
130 Ga0070667_100000166 3300005367 Bacteria 82268
131 Ga0070667_100000664 3300005367 Bacteria 33378
132 Ga0070667_100001036 3300005367 Bacteria 25394
133 Ga0070667_100001362 3300005367 Bacteria 21916
134 Ga0070667_100002673 3300005367 Bacteria 15435
135 Ga0070667_100002998 3300005367 Bacteria 14505
136 Ga0070667_100006081 3300005367 Bacteria 10021
137 Ga0070667_100006547 3300005367 Bacteria 9682
138 Ga0070667_100039551 3300005367 Bacteria 3953
139 Ga0070713_100027181 3300005436 Bacteria 4502
140 Ga0070678_100000152 3300005456 Bacteria 28847
141 Ga0070678_100000375 3300005456 Bacteria 20883
142 Ga0070678_100001009 3300005456 Bacteria 14629
143 Ga0070678_100016666 3300005456 Bacteria 4707
144 Ga0070662_100000060 3300005457 Bacteria 59430
145 Ga0070662_100002723 3300005457 Bacteria 10913
146 Ga0070662_100003052 3300005457 Bacteria 10409
147 Ga0070662_100004499 3300005457 Bacteria 8831
148 Ga0070662_100026855 3300005457 Bacteria 3991
149 Ga0070662_100034198 3300005457 Bacteria 3583
150 Ga0070662_100074136 3300005457 Bacteria 2517
151 Ga0070681_10016820 3300005458 Bacteria 7304
152 Ga0068867_100000165 3300005459 Bacteria 42939
153 Ga0068867_100018006 3300005459 Bacteria 5019
154 Ga0068867_100044067 3300005459 Bacteria 3267
155 Ga0070685_10000168 3300005466 Bacteria 43369
156 Ga0070679_100000001 3300005530 Bacteria 764811
157 Ga0070679_100050447 3300005530 Bacteria 4145
158 Ga0070679_100124482 3300005530 Bacteria 2561
159 Ga0068853_100001065 3300005539 Bacteria 19364
160 Ga0068853_100015759 3300005539 Bacteria 6207
161 Ga0068853_100016138 3300005539 Bacteria 6143
162 Ga0068853_100028804 3300005539 Bacteria 4674
163 Ga0070672_100001472 3300005543 Bacteria 14619
164 Ga0070672_100002007 3300005543 Bacteria 12789
165 Ga0070672_100007007 3300005543 Bacteria 7627
166 Ga0070672_100119762 3300005543 Bacteria 2154
167 Ga0070686_100001324 3300005544 Bacteria 14003
168 Ga0070686_100002367 3300005544 Bacteria 10391
169 Ga0070696_100004732 3300005546 Bacteria 9096
170 Ga0070665_100000024 3300005548 Bacteria 374559
171 Ga0070665_100000161 3300005548 Bacteria 122088
172 Ga0070665_100000240 3300005548 Bacteria 90915
173 Ga0070665_100000599 3300005548 Bacteria 49991
174 Ga0070665_100001304 3300005548 Bacteria 29776
175 Ga0070665_100004414 3300005548 Bacteria 14775
176 Ga0070665_100006731 3300005548 Bacteria 11683
177 Ga0070665_100014865 3300005548 Bacteria 7814
178 Ga0070665_100030138 3300005548 Bacteria 5459
179 Ga0070665_100065017 3300005548 Bacteria 3659
180 Ga0068855_100000079 3300005563 Bacteria 117264
181 Ga0068855_100000371 3300005563 Bacteria 55533
182 Ga0068855_100008087 3300005563 Bacteria 12708
183 Ga0068855_100024428 3300005563 Bacteria 7231
184 Ga0068855_100140098 3300005563 Bacteria 2758
185 Ga0070664_100000675 3300005564 Bacteria 26078
186 Ga0070664_100002321 3300005564 Bacteria 15274
187 Ga0070664_100002327 3300005564 Bacteria 15263
188 Ga0070664_100002816 3300005564 Bacteria 14064
189 Ga0070664_100003887 3300005564 Bacteria 12055
190 Ga0070664_100021951 3300005564 Bacteria 5264
191 Ga0070664_100041943 3300005564 Bacteria 3863
192 Ga0070664_100089051 3300005564 Bacteria 2669
193 Ga0068857_100035798 3300005577 Bacteria 4397
194 Ga0068857_100068882 3300005577 Bacteria 3150
195 Ga0068857_100094679 3300005577 Bacteria 2675
196 Ga0068857_100115119 3300005577 Bacteria 2418
197 Ga0068857_100132286 3300005577 Bacteria 2250
198 Ga0068854_100000359 3300005578 Bacteria 29216
199 Ga0068854_100006627 3300005578 Bacteria 7375
200 Ga0068854_100013076 3300005578 Bacteria 5442
201 Ga0068854_100029682 3300005578 Bacteria 3787
202 Ga0068856_100002727 3300005614 Bacteria 18077
203 Ga0068856_100044164 3300005614 Bacteria 4384
204 Ga0068856_100059012 3300005614 Bacteria 3790
205 Ga0068856_100076710 3300005614 Bacteria 3311
206 Ga0068852_100000619 3300005616 Bacteria 23305
207 Ga0068852_100002341 3300005616 Bacteria 13039
208 Ga0068852_100022823 3300005616 Bacteria 5025
209 Ga0068859_100000571 3300005617 Bacteria 36743
210 Ga0068859_100002802 3300005617 Bacteria 17661
211 Ga0068859_100003879 3300005617 Bacteria 15277
212 Ga0068859_100016161 3300005617 Bacteria 7495
213 Ga0068859_100019684 3300005617 Bacteria 6778
214 Ga0068859_100019739 3300005617 Bacteria 6766
215 Ga0068859_100023960 3300005617 Bacteria 6126
216 Ga0068859_100031227 3300005617 Bacteria 5347
217 Ga0068859_100031585 3300005617 Bacteria 5318
218 Ga0068859_100055433 3300005617 Bacteria 3989
219 Ga0068859_100059278 3300005617 Bacteria 3856
220 Ga0068864_100000124 3300005618 Bacteria 75383
221 Ga0068864_100000189 3300005618 Bacteria 56038
222 Ga0068864_100000445 3300005618 Bacteria 35742
223 Ga0068864_100003263 3300005618 Bacteria 13403
224 Ga0068864_100004727 3300005618 Bacteria 11154
225 Ga0068864_100011642 3300005618 Bacteria 7264
226 Ga0068864_100012479 3300005618 Bacteria 7025
227 Ga0068864_100013163 3300005618 Bacteria 6848
228 Ga0068864_100016549 3300005618 Bacteria 6138
229 Ga0068864_100021029 3300005618 Bacteria 5464
230 Ga0068861_100000004 3300005719 Bacteria 105907
231 Ga0068861_100010184 3300005719 Bacteria 6524
232 Ga0068861_100010248 3300005719 Bacteria 6506
233 Ga0068851_10003176 3300005834 Bacteria 7283
234 Ga0068851_10013423 3300005834 Bacteria 3877
235 Ga0068863_100000029 3300005841 Bacteria 177191
236 Ga0068863_100000040 3300005841 Bacteria 158465
237 Ga0068863_100000060 3300005841 Bacteria 122123
238 Ga0068863_100000073 3300005841 Bacteria 110576
239 Ga0068863_100002364 3300005841 Bacteria 18772
240 Ga0068863_100006771 3300005841 Bacteria 11237
241 Ga0068863_100007589 3300005841 Bacteria 10607
242 Ga0068863_100007847 3300005841 Bacteria 10435
243 Ga0068863_100008777 3300005841 Bacteria 9870
244 Ga0068863_100009586 3300005841 Bacteria 9446
245 Ga0068863_100013028 3300005841 Bacteria 8018
246 Ga0068863_100017296 3300005841 Bacteria 6916
247 Ga0068863_100051676 3300005841 Bacteria 3894
248 Ga0068858_100000743 3300005842 Bacteria 34160
249 Ga0068858_100000773 3300005842 Bacteria 33380
250 Ga0068858_100001226 3300005842 Bacteria 26511
251 Ga0068858_100003312 3300005842 Bacteria 16038
252 Ga0068858_100004712 3300005842 Bacteria 13354
253 Ga0068858_100006410 3300005842 Bacteria 11461
254 Ga0068858_100007977 3300005842 Bacteria 10205
255 Ga0068858_100009909 3300005842 Bacteria 9052
256 Ga0068858_100011055 3300005842 Bacteria 8533
257 Ga0068858_100011831 3300005842 Bacteria 8227
258 Ga0068858_100018332 3300005842 Bacteria 6554
259 Ga0068858_100037516 3300005842 Bacteria 4495
260 Ga0068860_100000007 3300005843 Bacteria 429329
261 Ga0068860_100000126 3300005843 Bacteria 122923
262 Ga0068860_100000245 3300005843 Bacteria 82268
263 Ga0068860_100007613 3300005843 Bacteria 10836
264 Ga0068860_100011041 3300005843 Bacteria 8906
265 Ga0068860_100024396 3300005843 Bacteria 5843
266 Ga0068860_100039444 3300005843 Bacteria 4517
267 Ga0068862_100000233 3300005844 Bacteria 62058
268 Ga0068862_100001438 3300005844 Bacteria 21993
269 Ga0068862_100001481 3300005844 Bacteria 21520
270 Ga0068862_100007818 3300005844 Bacteria 8843
271 Ga0068862_100009511 3300005844 Bacteria 8043
272 Ga0068862_100019002 3300005844 Bacteria 5730
273 Ga0068862_100019554 3300005844 Bacteria 5654
274 Ga0068862_100029048 3300005844 Bacteria 4657
275 Ga0081455_10000131 3300005937 Bacteria 87553
276 Ga0081539_10013568 3300005985 Bacteria 6128
277 Ga0070717_10002620 3300006028 Bacteria 12688
278 Ga0075368_10000247 3300006042 Bacteria 15313
279 Ga0075363_100003270 3300006048 Bacteria 6856
280 Ga0075364_10007832 3300006051 Bacteria 6360
281 Ga0075362_10000021 3300006177 Bacteria 62684
282 Ga0075367_10000114 3300006178 Bacteria 23062
283 Ga0075369_10000463 3300006186 Bacteria 12438
284 Ga0075369_10007975 3300006186 Bacteria 4057
285 Ga0075366_10000127 3300006195 Bacteria 31623
286 Ga0097621_100026348 3300006237 Bacteria 4559
287 Ga0097621_100034039 3300006237 Bacteria 4061
288 Ga0075370_10000061 3300006353 Bacteria 32363
289 Ga0068871_100011463 3300006358 Bacteria 6503
290 Ga0068871_100058406 3300006358 Bacteria 3141
291 Ga0075433_10003762 3300006852 Bacteria 11744
292 Ga0068865_100000014 3300006881 Bacteria 138727
293 Ga0068865_100002176 3300006881 Bacteria 11549
294 Ga0068865_100008257 3300006881 Bacteria 6428
295 Ga0097620_100000571 3300006931 Bacteria 36743
296 Ga0097620_100002802 3300006931 Bacteria 17661
297 Ga0097620_100003878 3300006931 Bacteria 15277
298 Ga0097620_100016161 3300006931 Bacteria 7495
299 Ga0097620_100019684 3300006931 Bacteria 6778
300 Ga0097620_100019739 3300006931 Bacteria 6766
301 Ga0097620_100023960 3300006931 Bacteria 6126
302 Ga0097620_100031225 3300006931 Bacteria 5347
303 Ga0097620_100031585 3300006931 Bacteria 5318
304 Ga0097620_100055434 3300006931 Bacteria 3989
305 Ga0097620_100059280 3300006931 Bacteria 3856
306 Ga0105251_10000468 3300009011 Bacteria 38504
307 Ga0105240_10011911 3300009093 Bacteria 12062
308 Ga0105240_10017250 3300009093 Bacteria 9739
309 Ga0105240_10030169 3300009093 Bacteria 7053
310 Ga0105240_10044710 3300009093 Bacteria 5624
311 Ga0105240_10087709 3300009093 Bacteria 3809
312 Ga0111539_10020298 3300009094 Bacteria 8185
313 Ga0111539_10036148 3300009094 Bacteria 5975
314 Ga0105245_10000160 3300009098 Bacteria 63445
315 Ga0105245_10002741 3300009098 Bacteria 15846
316 Ga0105245_10027194 3300009098 Bacteria 5040
317 Ga0105247_10000821 3300009101 Bacteria 23682
318 Ga0105247_10003393 3300009101 Bacteria 10416
319 Ga0105243_10000070 3300009148 Bacteria 120851
320 Ga0105243_10000278 3300009148 Bacteria 57245
321 Ga0105243_10013677 3300009148 Bacteria 6140
322 Ga0105242_10000722 3300009176 Bacteria 25846
323 Ga0105248_10000026 3300009177 Bacteria 257155
324 Ga0105248_10000278 3300009177 Bacteria 60305
325 Ga0105248_10000575 3300009177 Bacteria 41822
326 Ga0105248_10000621 3300009177 Bacteria 40351
327 Ga0105248_10000902 3300009177 Bacteria 33207
328 Ga0105248_10002150 3300009177 Bacteria 21793
329 Ga0105248_10006039 3300009177 Bacteria 13297
330 Ga0105248_10011427 3300009177 Bacteria 9784
331 Ga0105248_10025299 3300009177 Bacteria 6600
332 Ga0105248_10049695 3300009177 Bacteria 4703
333 Ga0105248_10093942 3300009177 Bacteria 3378
334 Ga0105237_10030898 3300009545 Bacteria 5434
335 Ga0105238_10030503 3300009551 Bacteria 5489
336 Ga0105238_10051609 3300009551 Bacteria 4137
337 Ga0105238_10056169 3300009551 Bacteria 3950
338 Ga0105249_10000094 3300009553 Bacteria 122611
339 Ga0105249_10000290 3300009553 Bacteria 51703
340 Ga0105249_10000614 3300009553 Bacteria 32520
341 Ga0105249_10015431 3300009553 Bacteria 6761
342 Ga0105249_10049567 3300009553 Bacteria 3829
343 Ga0105249_10135400 3300009553 Bacteria 2357
344 Ga0105246_10000726 3300011119 Bacteria 18694
345 Ga0157373_10005655 3300013100 Bacteria 9368
346 Ga0157373_10013959 3300013100 Bacteria 5890
347 Ga0157373_10022411 3300013100 Bacteria 4583
348 Ga0157373_10085910 3300013100 Bacteria 2217
349 Ga0157371_10000261 3300013102 Bacteria 72525
350 Ga0157371_10000285 3300013102 Bacteria 68525
351 Ga0157371_10003558 3300013102 Bacteria 14049
352 Ga0157371_10007093 3300013102 Bacteria 9110
353 Ga0157370_10000117 3300013104 Bacteria 92168
354 Ga0157370_10032699 3300013104 Bacteria 5077
355 Ga0157369_10002806 3300013105 Bacteria 20790
356 Ga0157369_10003645 3300013105 Bacteria 18271
357 Ga0157369_10007466 3300013105 Bacteria 12587
358 Ga0157369_10009165 3300013105 Bacteria 11322
359 Ga0157369_10012825 3300013105 Bacteria 9503
360 Ga0157369_10032910 3300013105 Bacteria 5698
361 Ga0157369_10038267 3300013105 Bacteria 5245
362 Ga0157369_10049343 3300013105 Bacteria 4564
363 Ga0157374_10000542 3300013296 Bacteria 33699
364 Ga0157374_10009224 3300013296 Bacteria 8458
365 Ga0157374_10012710 3300013296 Bacteria 7334
366 Ga0157374_10098747 3300013296 Bacteria 2796
367 Ga0157378_10000624 3300013297 Bacteria 33307
368 Ga0157378_10025793 3300013297 Bacteria 5178
369 Ga0157378_10061929 3300013297 Bacteria 3341
370 Ga0163162_10003182 3300013306 Bacteria 15701
371 Ga0163162_10014675 3300013306 Bacteria 7656
372 Ga0163162_10043844 3300013306 Bacteria 4479
373 Ga0163162_10054213 3300013306 Bacteria 4033
374 Ga0163162_10066959 3300013306 Bacteria 3641
375 Ga0163162_10088804 3300013306 Bacteria 3170
376 Ga0157372_10001761 3300013307 Bacteria 23472
377 Ga0157372_10035278 3300013307 Bacteria 5505
378 Ga0157375_10001639 3300013308 Bacteria 19250
379 Ga0157375_10003289 3300013308 Bacteria 13995
380 Ga0157375_10028614 3300013308 Bacteria 5227
381 Ga0163163_10001741 3300014325 Bacteria 18337
382 Ga0163163_10002576 3300014325 Bacteria 15358
383 Ga0163163_10020623 3300014325 Bacteria 6211
384 Ga0157380_10000606 3300014326 Bacteria 22069
385 Ga0157380_10005506 3300014326 Bacteria 8850
386 Ga0157380_10042557 3300014326 Bacteria 3550
387 Ga0157377_10022306 3300014745 Bacteria 3340
388 Ga0157377_10033679 3300014745 Bacteria 2798
389 Ga0157379_10002202 3300014968 Bacteria 16219
390 Ga0157379_10004525 3300014968 Bacteria 11922
391 Ga0157379_10062644 3300014968 Bacteria 3326
392 Ga0157379_10067861 3300014968 Bacteria 3188
393 Ga0157379_10117156 3300014968 Bacteria 2396
394 Ga0157376_10000096 3300014969 Bacteria 65482
395 Ga0157376_10009707 3300014969 Bacteria 7005
396 Ga0183363_1001 3300015690 Bacteria 611534
397 Ga0163161_10000716 3300017792 Bacteria 26178
398 Ga0206356_11044689 3300020070 Bacteria 6063
399 Ga0206354_10229693 3300020081 Bacteria 9840
400 Ga0206353_11805231 3300020082 Bacteria 7432
401 Ga0213876_10000801 3300021384 Bacteria 21296
402 Ga0213876_10004712 3300021384 Bacteria 7589
403 Ga0213875_10002567 3300021388 Bacteria 10819
404 Ga0207672_1000288 3300025223 Bacteria 6830
405 Ga0209147_101423 3300025229 Bacteria 8727
406 Ga0209563_100105 3300025230 Bacteria 147936
407 Ga0207427_101114 3300025231 Bacteria 10741
408 Ga0207425_1002477 3300025245 Bacteria 6486
409 Ga0209026_1000641 3300025250 Bacteria 21580
410 Ga0209148_1000011 3300025254 Bacteria 1196503
411 Ga0209148_1000147 3300025254 Bacteria 160231
412 Ga0209148_1001590 3300025254 Bacteria 10697
413 Ga0209233_1000003 3300025261 Bacteria 1607366
414 Ga0209233_1000084 3300025261 Bacteria 335222
415 Ga0209565_1000007 3300025263 Bacteria 784361
416 Ga0209455_1000006 3300025272 Bacteria 1196503
417 Ga0209673_1006204 3300025273 Bacteria 5835
418 Ga0209675_1000306 3300025291 Bacteria 44321
419 Ga0209675_1009064 3300025291 Bacteria 3559
420 Ga0209676_1000081 3300025292 Bacteria 285297
421 Ga0209676_1000226 3300025292 Bacteria 124004
422 Ga0209676_1000359 3300025292 Bacteria 86410
423 Ga0209758_1000023 3300025297 Bacteria 612453
424 Ga0209758_1017116 3300025297 Bacteria 3633
425 Ga0209050_1000010 3300025298 Bacteria 980454
426 Ga0209050_1000067 3300025298 Bacteria 304206
427 Ga0209050_1006894 3300025298 Bacteria 6579
428 Ga0209256_1000008 3300025299 Bacteria 975723
429 Ga0209257_1000027 3300025304 Bacteria 703541
430 Ga0209257_1000392 3300025304 Bacteria 87104
431 Ga0209257_1001680 3300025304 Bacteria 24926
432 Ga0209257_1003766 3300025304 Bacteria 12523
433 Ga0209257_1003958 3300025304 Bacteria 12016
434 Ga0207697_10000757 3300025315 Bacteria 18294
435 Ga0207697_10002575 3300025315 Bacteria 9336
436 Ga0207656_10005855 3300025321 Bacteria 4381
437 Ga0207656_10009665 3300025321 Bacteria 3585
438 Ga0207713_1006269 3300025735 Bacteria 7276
439 Ga0207710_10001291 3300025900 Bacteria 12662
440 Ga0207688_10022035 3300025901 Bacteria 3485
441 Ga0207680_10000007 3300025903 Bacteria 623574
442 Ga0207680_10000033 3300025903 Bacteria 77177
443 Ga0207680_10000396 3300025903 Bacteria 20730
444 Ga0207680_10000727 3300025903 Bacteria 15483
445 Ga0207647_10000389 3300025904 Bacteria 35906
446 Ga0207647_10004623 3300025904 Bacteria 10194
447 Ga0207647_10006807 3300025904 Bacteria 8289
448 Ga0207647_10008471 3300025904 Bacteria 7370
449 Ga0207647_10019114 3300025904 Bacteria 4613
450 Ga0207645_10002599 3300025907 Bacteria 14084
451 Ga0207645_10002952 3300025907 Bacteria 13131
452 Ga0207645_10012375 3300025907 Bacteria 5788
453 Ga0207705_10000003 3300025909 Bacteria 709270
454 Ga0207705_10000004 3300025909 Bacteria 705756
455 Ga0207705_10000008 3300025909 Bacteria 589717
456 Ga0207705_10000125 3300025909 Bacteria 84812
457 Ga0207705_10000236 3300025909 Bacteria 54788
458 Ga0207705_10000275 3300025909 Bacteria 49216
459 Ga0207705_10000410 3300025909 Bacteria 37699
460 Ga0207705_10000535 3300025909 Bacteria 32032
461 Ga0207705_10000749 3300025909 Bacteria 26722
462 Ga0207705_10002164 3300025909 Bacteria 15215
463 Ga0207705_10002469 3300025909 Bacteria 14250
464 Ga0207705_10006301 3300025909 Bacteria 8805
465 Ga0207705_10006763 3300025909 Bacteria 8476
466 Ga0207705_10011218 3300025909 Bacteria 6496
467 Ga0207705_10016928 3300025909 Bacteria 5221
468 Ga0207705_10034286 3300025909 Bacteria 3628
469 Ga0207705_10045306 3300025909 Bacteria 3162
470 Ga0207705_10048942 3300025909 Bacteria 3042
471 Ga0207705_10050804 3300025909 Bacteria 2985
472 Ga0207695_10006228 3300025913 Bacteria 15537
473 Ga0207695_10007952 3300025913 Bacteria 13377
474 Ga0207695_10020519 3300025913 Bacteria 7565
475 Ga0207695_10020530 3300025913 Bacteria 7563
476 Ga0207695_10022589 3300025913 Bacteria 7136
477 Ga0207695_10022925 3300025913 Bacteria 7072
478 Ga0207695_10027764 3300025913 Bacteria 6297
479 Ga0207671_10006263 3300025914 Bacteria 10656
480 Ga0207671_10011491 3300025914 Bacteria 7197
481 Ga0207671_10011941 3300025914 Bacteria 7022
482 Ga0207660_10000021 3300025917 Bacteria 73652
483 Ga0207660_10008242 3300025917 Bacteria 6743
484 Ga0207660_10027792 3300025917 Bacteria 3864
485 Ga0207662_10068132 3300025918 Bacteria 2148
486 Ga0207657_10000167 3300025919 Bacteria 67075
487 Ga0207657_10000259 3300025919 Bacteria 56194
488 Ga0207657_10000431 3300025919 Bacteria 44557
489 Ga0207657_10000538 3300025919 Bacteria 40382
490 Ga0207657_10000837 3300025919 Bacteria 32516
491 Ga0207657_10001115 3300025919 Bacteria 28496
492 Ga0207657_10001189 3300025919 Bacteria 27647
493 Ga0207657_10005911 3300025919 Bacteria 12734
494 Ga0207657_10008482 3300025919 Bacteria 10425
495 Ga0207657_10008530 3300025919 Bacteria 10392
496 Ga0207657_10011633 3300025919 Bacteria 8727
497 Ga0207657_10017834 3300025919 Bacteria 6795
498 Ga0207657_10023306 3300025919 Bacteria 5767
499 Ga0207657_10031135 3300025919 Bacteria 4837
500 Ga0207657_10049088 3300025919 Bacteria 3680
501 Ga0207657_10052126 3300025919 Bacteria 3553
502 Ga0207657_10088374 3300025919 Bacteria 2590
503 Ga0207657_10107517 3300025919 Bacteria 2307
504 Ga0207649_10000211 3300025920 Bacteria 48545
505 Ga0207649_10006038 3300025920 Bacteria 6572
506 Ga0207649_10008642 3300025920 Bacteria 5561
507 Ga0207652_10000003 3300025921 Bacteria 502441
508 Ga0207652_10002493 3300025921 Bacteria 15495
509 Ga0207652_10038596 3300025921 Bacteria 4050
510 Ga0207681_10000002 3300025923 Bacteria 985597
511 Ga0207681_10000089 3300025923 Bacteria 79526
512 Ga0207681_10000353 3300025923 Bacteria 32847
513 Ga0207681_10001327 3300025923 Bacteria 15971
514 Ga0207681_10020484 3300025923 Bacteria 4192
515 Ga0207681_10035580 3300025923 Bacteria 3282
516 Ga0207681_10054162 3300025923 Bacteria 2726
517 Ga0207694_10005329 3300025924 Bacteria 9909
518 Ga0207694_10005621 3300025924 Bacteria 9610
519 Ga0207694_10007616 3300025924 Bacteria 8210
520 Ga0207694_10059810 3300025924 Bacteria 2964
521 Ga0207650_10000243 3300025925 Bacteria 59507
522 Ga0207650_10003982 3300025925 Bacteria 10109
523 Ga0207659_10022088 3300025926 Bacteria 4234
524 Ga0207659_10053154 3300025926 Bacteria 2889
525 Ga0207687_10004601 3300025927 Bacteria 9184
526 Ga0207687_10005530 3300025927 Bacteria 8356
527 Ga0207687_10042826 3300025927 Bacteria 3117
528 Ga0207644_10000002 3300025931 Bacteria 942221
529 Ga0207644_10000003 3300025931 Bacteria 585905
530 Ga0207644_10000090 3300025931 Bacteria 65122
531 Ga0207644_10000595 3300025931 Bacteria 23038
532 Ga0207644_10000771 3300025931 Bacteria 20267
533 Ga0207644_10002049 3300025931 Bacteria 13050
534 Ga0207644_10003050 3300025931 Bacteria 10773
535 Ga0207644_10003216 3300025931 Bacteria 10526
536 Ga0207644_10004166 3300025931 Bacteria 9377
537 Ga0207644_10004373 3300025931 Bacteria 9169
538 Ga0207644_10007330 3300025931 Bacteria 7180
539 Ga0207644_10011510 3300025931 Bacteria 5856
540 Ga0207644_10013594 3300025931 Bacteria 5432
541 Ga0207690_10000004 3300025932 Bacteria 746138
542 Ga0207690_10000182 3300025932 Bacteria 48302
543 Ga0207690_10004108 3300025932 Bacteria 8598
544 Ga0207690_10005471 3300025932 Bacteria 7490
545 Ga0207706_10000028 3300025933 Bacteria 149092
546 Ga0207706_10002426 3300025933 Bacteria 18188
547 Ga0207706_10002443 3300025933 Bacteria 18135
548 Ga0207706_10004050 3300025933 Bacteria 13863
549 Ga0207706_10007744 3300025933 Bacteria 9915
550 Ga0207706_10008705 3300025933 Bacteria 9347
551 Ga0207706_10008803 3300025933 Bacteria 9291
552 Ga0207706_10010944 3300025933 Bacteria 8274
553 Ga0207706_10012319 3300025933 Bacteria 7789
554 Ga0207706_10045540 3300025933 Bacteria 3886
555 Ga0207706_10057043 3300025933 Bacteria 3441
556 Ga0207686_10000489 3300025934 Bacteria 26020
557 Ga0207686_10032639 3300025934 Bacteria 3100
558 Ga0207709_10000039 3300025935 Bacteria 260127
559 Ga0207709_10000066 3300025935 Bacteria 189194
560 Ga0207670_10006073 3300025936 Bacteria 6673
561 Ga0207669_10000171 3300025937 Bacteria 30352
562 Ga0207669_10001692 3300025937 Bacteria 9377
563 Ga0207669_10004093 3300025937 Bacteria 6390
564 Ga0207669_10008277 3300025937 Bacteria 4872
565 Ga0207669_10042871 3300025937 Bacteria 2645
566 Ga0207704_10000002 3300025938 Bacteria 303025
567 Ga0207704_10000007 3300025938 Bacteria 211230
568 Ga0207704_10003419 3300025938 Bacteria 7213
569 Ga0207704_10005553 3300025938 Bacteria 5813
570 Ga0207691_10000916 3300025940 Bacteria 29221
571 Ga0207691_10002544 3300025940 Bacteria 17820
572 Ga0207691_10009043 3300025940 Bacteria 9558
573 Ga0207691_10036524 3300025940 Bacteria 4553
574 Ga0207691_10050203 3300025940 Bacteria 3820
575 Ga0207691_10081488 3300025940 Bacteria 2909
576 Ga0207691_10110315 3300025940 Bacteria 2447
577 Ga0207711_10000004 3300025941 Bacteria 870636
578 Ga0207711_10000496 3300025941 Bacteria 40666
579 Ga0207711_10000536 3300025941 Bacteria 38861
580 Ga0207711_10000719 3300025941 Bacteria 32614
581 Ga0207711_10001043 3300025941 Bacteria 26500
582 Ga0207711_10001268 3300025941 Bacteria 23928
583 Ga0207711_10007276 3300025941 Bacteria 9275
584 Ga0207711_10007329 3300025941 Bacteria 9235
585 Ga0207711_10018596 3300025941 Bacteria 5777
586 Ga0207711_10021704 3300025941 Bacteria 5364
587 Ga0207711_10032928 3300025941 Bacteria 4383
588 Ga0207711_10042308 3300025941 Bacteria 3882
589 Ga0207711_10049552 3300025941 Bacteria 3596
590 Ga0207689_10000060 3300025942 Bacteria 85326
591 Ga0207661_10001388 3300025944 Bacteria 16263
592 Ga0207679_10000293 3300025945 Bacteria 37744
593 Ga0207679_10001267 3300025945 Bacteria 16008
594 Ga0207679_10001973 3300025945 Bacteria 12721
595 Ga0207679_10065430 3300025945 Bacteria 2720
596 Ga0207667_10000006 3300025949 Bacteria 679876
597 Ga0207667_10000017 3300025949 Bacteria 390654
598 Ga0207667_10003195 3300025949 Bacteria 20251
599 Ga0207667_10004465 3300025949 Bacteria 17125
600 Ga0207667_10008229 3300025949 Bacteria 12408
601 Ga0207667_10016077 3300025949 Bacteria 8470
602 Ga0207667_10022792 3300025949 Bacteria 6908
603 Ga0207667_10023576 3300025949 Bacteria 6776
604 Ga0207667_10048638 3300025949 Bacteria 4483
605 Ga0207651_10000004 3300025960 Bacteria 290191
606 Ga0207651_10000221 3300025960 Bacteria 24397
607 Ga0207651_10001349 3300025960 Bacteria 11099
608 Ga0207651_10011589 3300025960 Bacteria 4943
609 Ga0207651_10013368 3300025960 Bacteria 4697
610 Ga0207651_10049119 3300025960 Bacteria 2856
611 Ga0207712_10000004 3300025961 Bacteria 614655
612 Ga0207712_10000057 3300025961 Bacteria 142874
613 Ga0207712_10000974 3300025961 Bacteria 20541
614 Ga0207712_10007181 3300025961 Bacteria 7026
615 Ga0207712_10008189 3300025961 Bacteria 6607
616 Ga0207668_10000107 3300025972 Bacteria 59177
617 Ga0207668_10000213 3300025972 Bacteria 39220
618 Ga0207668_10000641 3300025972 Bacteria 21579
619 Ga0207668_10002392 3300025972 Bacteria 10970
620 Ga0207668_10006561 3300025972 Bacteria 6877
621 Ga0207668_10034702 3300025972 Bacteria 3352
622 Ga0207668_10049205 3300025972 Bacteria 2896
623 Ga0207668_10061320 3300025972 Bacteria 2644
624 Ga0207668_10077594 3300025972 Bacteria 2395
625 Ga0207640_10000518 3300025981 Bacteria 23254
626 Ga0207640_10002692 3300025981 Bacteria 9510
627 Ga0207658_10000100 3300025986 Bacteria 95179
628 Ga0207658_10000128 3300025986 Bacteria 82259
629 Ga0207658_10000381 3300025986 Bacteria 43297
630 Ga0207658_10000430 3300025986 Bacteria 39640
631 Ga0207658_10001264 3300025986 Bacteria 19972
632 Ga0207658_10001552 3300025986 Bacteria 17804
633 Ga0207658_10001593 3300025986 Bacteria 17501
634 Ga0207658_10002894 3300025986 Bacteria 12306
635 Ga0207658_10004102 3300025986 Bacteria 10162
636 Ga0207658_10004992 3300025986 Bacteria 9143
637 Ga0207658_10010410 3300025986 Bacteria 6317
638 Ga0207658_10025506 3300025986 Bacteria 4139
639 Ga0207658_10060983 3300025986 Bacteria 2816
640 Ga0207677_10000231 3300026023 Bacteria 43615
641 Ga0207677_10007991 3300026023 Bacteria 5884
642 Ga0207703_10000187 3300026035 Bacteria 72699
643 Ga0207703_10000959 3300026035 Bacteria 27891
644 Ga0207703_10001317 3300026035 Bacteria 22825
645 Ga0207703_10004443 3300026035 Bacteria 11519
646 Ga0207703_10005067 3300026035 Bacteria 10666
647 Ga0207703_10006455 3300026035 Bacteria 9368
648 Ga0207703_10023720 3300026035 Bacteria 4825
649 Ga0207639_10000202 3300026041 Bacteria 44984
650 Ga0207639_10000449 3300026041 Bacteria 28347
651 Ga0207639_10000843 3300026041 Bacteria 20838
652 Ga0207639_10003651 3300026041 Bacteria 10345
653 Ga0207639_10019178 3300026041 Bacteria 4874
654 Ga0207639_10070587 3300026041 Bacteria 2729
655 Ga0207678_10000656 3300026067 Bacteria 31806
656 Ga0207678_10000753 3300026067 Bacteria 29593
657 Ga0207678_10005573 3300026067 Bacteria 11256
658 Ga0207678_10009465 3300026067 Bacteria 8570
659 Ga0207678_10023463 3300026067 Bacteria 5395
660 Ga0207678_10027516 3300026067 Bacteria 4962
661 Ga0207678_10035219 3300026067 Bacteria 4359
662 Ga0207678_10044003 3300026067 Bacteria 3864
663 Ga0207702_10002919 3300026078 Bacteria 16002
664 Ga0207702_10007350 3300026078 Bacteria 9410
665 Ga0207702_10011171 3300026078 Bacteria 7489
666 Ga0207702_10019219 3300026078 Bacteria 5651
667 Ga0207702_10020845 3300026078 Bacteria 5422
668 Ga0207702_10023673 3300026078 Bacteria 5094
669 Ga0207641_10000018 3300026088 Bacteria 298209
670 Ga0207641_10000039 3300026088 Bacteria 199453
671 Ga0207641_10000049 3300026088 Bacteria 177222
672 Ga0207641_10000100 3300026088 Bacteria 122664
673 Ga0207641_10000179 3300026088 Bacteria 88061
674 Ga0207641_10000330 3300026088 Bacteria 58123
675 Ga0207641_10002358 3300026088 Bacteria 17443
676 Ga0207641_10002672 3300026088 Bacteria 16288
677 Ga0207641_10003331 3300026088 Bacteria 14291
678 Ga0207641_10010112 3300026088 Bacteria 7758
679 Ga0207641_10025100 3300026088 Bacteria 4913
680 Ga0207641_10034743 3300026088 Bacteria 4195
681 Ga0207648_10000003 3300026089 Bacteria 289983
682 Ga0207648_10007924 3300026089 Bacteria 10357
683 Ga0207648_10009606 3300026089 Bacteria 9252
684 Ga0207648_10011880 3300026089 Bacteria 8182
685 Ga0207676_10000027 3300026095 Bacteria 245868
686 Ga0207676_10000922 3300026095 Bacteria 22753
687 Ga0207676_10001166 3300026095 Bacteria 19777
688 Ga0207676_10002760 3300026095 Bacteria 12487
689 Ga0207676_10003119 3300026095 Bacteria 11824
690 Ga0207676_10003174 3300026095 Bacteria 11718
691 Ga0207676_10003203 3300026095 Bacteria 11656
692 Ga0207676_10006149 3300026095 Bacteria 8476
693 Ga0207676_10006606 3300026095 Bacteria 8203
694 Ga0207676_10022615 3300026095 Bacteria 4625
695 Ga0207676_10023726 3300026095 Bacteria 4531
696 Ga0207676_10112141 3300026095 Bacteria 2284
697 Ga0207674_10000065 3300026116 Bacteria 109485
698 Ga0207674_10000583 3300026116 Bacteria 48003
699 Ga0207674_10000804 3300026116 Bacteria 40816
700 Ga0207674_10004169 3300026116 Bacteria 17484
701 Ga0207674_10009520 3300026116 Bacteria 11089
702 Ga0207674_10011361 3300026116 Bacteria 10009
703 Ga0207674_10013736 3300026116 Bacteria 8964
704 Ga0207674_10022140 3300026116 Bacteria 6830
705 Ga0207674_10039109 3300026116 Bacteria 4919
706 Ga0207674_10088702 3300026116 Bacteria 3085
707 Ga0207674_10123919 3300026116 Bacteria 2550
708 Ga0207674_10151231 3300026116 Bacteria 2279
709 Ga0207675_100000032 3300026118 Bacteria 108677
710 Ga0207675_100003757 3300026118 Bacteria 14793
711 Ga0207675_100003939 3300026118 Bacteria 14410
712 Ga0207675_100004821 3300026118 Bacteria 12988
713 Ga0207683_10000976 3300026121 Bacteria 26222
714 Ga0207683_10001252 3300026121 Bacteria 23031
715 Ga0207683_10004155 3300026121 Bacteria 12535
716 Ga0207683_10005883 3300026121 Bacteria 10519
717 Ga0207683_10007844 3300026121 Bacteria 9135
718 Ga0207683_10071499 3300026121 Bacteria 3067
719 Ga0207698_10000177 3300026142 Bacteria 39133
720 Ga0207698_10001503 3300026142 Bacteria 13579
721 Ga0207698_10007111 3300026142 Bacteria 7010
722 Ga0207698_10012472 3300026142 Bacteria 5563
723 Ga0207698_10013072 3300026142 Bacteria 5465
724 Ga0207698_10016510 3300026142 Bacteria 4979
725 Ga0207698_10020653 3300026142 Bacteria 4538
726 Ga0207698_10040261 3300026142 Bacteria 3470
727 Ga0207698_10047977 3300026142 Bacteria 3239
728 Ga0207698_10077052 3300026142 Bacteria 2672
729 Ga0207698_10123336 3300026142 Bacteria 2198
730 Ga0209813_10000134 3300027866 Bacteria 25655
731 Ga0209813_10000233 3300027866 Bacteria 16787
732 Ga0268266_10000015 3300028379 Bacteria 630629
733 Ga0268266_10000019 3300028379 Bacteria 556465
734 Ga0268266_10000040 3300028379 Bacteria 323843
735 Ga0268266_10000215 3300028379 Bacteria 100801
736 Ga0268266_10001675 3300028379 Bacteria 25511
737 Ga0268266_10013056 3300028379 Bacteria 7162
738 Ga0268266_10017744 3300028379 Bacteria 6064
739 Ga0268266_10022342 3300028379 Bacteria 5392
740 Ga0268266_10032790 3300028379 Bacteria 4414
741 Ga0268266_10034233 3300028379 Bacteria 4320
742 Ga0268266_10049864 3300028379 Bacteria 3591
743 Ga0268266_10079082 3300028379 Bacteria 2862
744 Ga0268265_10000097 3300028380 Bacteria 110755
745 Ga0268265_10000116 3300028380 Bacteria 100689
746 Ga0268265_10001244 3300028380 Bacteria 22024
747 Ga0268265_10002795 3300028380 Bacteria 12867
748 Ga0268265_10010848 3300028380 Bacteria 6154
749 Ga0268265_10062843 3300028380 Bacteria 2854
750 Ga0268264_10000003 3300028381 Bacteria 1141976
751 Ga0268264_10000116 3300028381 Bacteria 198591
752 Ga0268264_10000134 3300028381 Bacteria 179475
753 Ga0268264_10000296 3300028381 Bacteria 82267
754 Ga0268264_10000546 3300028381 Bacteria 47268
755 Ga0268264_10004477 3300028381 Bacteria 11919
756 Ga0268264_10009091 3300028381 Bacteria 8239
757 Ga0268264_10011110 3300028381 Bacteria 7439
758 Ga0307408_100001363 3300031548 Bacteria 18225
759 Ga0307408_100013723 3300031548 Bacteria 5378
760 Ga0307408_100014001 3300031548 Bacteria 5327
761 Ga0307408_100083452 3300031548 Bacteria 2394
762 Ga0265313_10000913 3300031595 Bacteria 29513
763 Ga0307508_10003117 3300031616 Bacteria 16994
764 Ga0307405_10000331 3300031731 Bacteria 17554
765 Ga0307405_10014429 3300031731 Bacteria 4249
766 Ga0307405_10020265 3300031731 Bacteria 3712
767 Ga0307405_10024810 3300031731 Bacteria 3432
768 Ga0307405_10066824 3300031731 Bacteria 2294
769 Ga0307413_10010484 3300031824 Bacteria 4498
770 Ga0307413_10010863 3300031824 Bacteria 4442
771 Ga0307410_10000740 3300031852 Bacteria 13694
772 Ga0307410_10004875 3300031852 Bacteria 7020
773 Ga0307410_10023190 3300031852 Bacteria 3853
774 Ga0307406_10029393 3300031901 Bacteria 3328
775 Ga0307406_10041135 3300031901 Bacteria 2878
776 Ga0307407_10004081 3300031903 Bacteria 6136
777 Ga0307407_10016596 3300031903 Bacteria 3670
778 Ga0307407_10022579 3300031903 Bacteria 3267
779 Ga0307407_10057800 3300031903 Bacteria 2252
780 Ga0307412_10000703 3300031911 Bacteria 19258
781 Ga0307412_10011796 3300031911 Bacteria 5072
782 Ga0307412_10032778 3300031911 Bacteria 3296
783 Ga0307412_10045630 3300031911 Bacteria 2866
784 Ga0307409_100012685 3300031995 Bacteria 5383
785 Ga0307409_100018413 3300031995 Bacteria 4695
786 Ga0307409_100024798 3300031995 Bacteria 4191
787 Ga0307409_100048061 3300031995 Bacteria 3244
788 Ga0307409_100062552 3300031995 Bacteria 2914
789 Ga0307416_100011307 3300032002 Bacteria 5941
790 Ga0307416_100054387 3300032002 Bacteria 3217
791 Ga0307414_10001169 3300032004 Bacteria 13468
792 Ga0307414_10004451 3300032004 Bacteria 7608
793 Ga0307414_10008331 3300032004 Bacteria 5872
794 Ga0307414_10022720 3300032004 Bacteria 3963
795 Ga0307414_10029136 3300032004 Bacteria 3589
796 Ga0307414_10037869 3300032004 Bacteria 3233
797 Ga0307414_10082646 3300032004 Bacteria 2356
798 Ga0307414_10097729 3300032004 Bacteria 2201
799 Ga0307411_10002478 3300032005 Bacteria 8186
800 Ga0307411_10003484 3300032005 Bacteria 7308
801 Ga0307411_10008752 3300032005 Bacteria 5266
802 Ga0307411_10011163 3300032005 Bacteria 4833
803 Ga0307411_10012158 3300032005 Bacteria 4681
804 Ga0307411_10043362 3300032005 Bacteria 2877
805 Ga0307411_10049800 3300032005 Bacteria 2725
806 Ga0307411_10056302 3300032005 Bacteria 2591
807 Ga0307415_100001735 3300032126 Bacteria 10618
808 Ga0307415_100022578 3300032126 Bacteria 3886
809 Ga0307415_100040310 3300032126 Bacteria 3093
810 Ga0307510_10005453 3300033180 Bacteria 15153
811 Ga0373931_0002964 3300035691 Bacteria 7577
812 Ga0395899_0000104 3300037312 Bacteria 147238
813 Ga0395899_0000981 3300037312 Bacteria 26323
814 Ga0395899_0002137 3300037312 Bacteria 16249
815 Ga0395899_0002159 3300037312 Bacteria 16147
816 Ga0395899_0011202 3300037312 Bacteria 6869
817 Ga0395899_0017518 3300037312 Bacteria 5457
818 Ga0395899_0023777 3300037312 Bacteria 4637
819 Ga0395899_0041943 3300037312 Bacteria 3417
820 Ga0395899_0047860 3300037312 Bacteria 3183
821 Ga0395900_0000547 3300037418 Bacteria 52367
822 Ga0395900_0000604 3300037418 Bacteria 49077
823 Ga0395900_0000739 3300037418 Bacteria 43430
824 Ga0395900_0000912 3300037418 Bacteria 38872
825 Ga0395900_0010212 3300037418 Bacteria 9601
826 Ga0395900_0017573 3300037418 Bacteria 7298
827 Ga0395900_0021530 3300037418 Bacteria 6592
828 Ga0395900_0024919 3300037418 Bacteria 6122
829 Ga0395900_0033889 3300037418 Bacteria 5255
830 Ga0395900_0045544 3300037418 Bacteria 4518
831 Ga0395900_0049171 3300037418 Bacteria 4344
832 Ga0395900_0054959 3300037418 Bacteria 4099
833 Ga0395900_0055572 3300037418 Bacteria 4076
834 Ga0395900_0063112 3300037418 Bacteria 3808
835 Ga0395900_0065092 3300037418 Bacteria 3744
836 Ga0395900_0067050 3300037418 Bacteria 3687
837 Ga0395900_0088866 3300037418 Bacteria 3176
838 Ga0395900_0152155 3300037418 Bacteria 2363
839 Ga0395900_0217937 3300037418 Bacteria 1925
840 Ga0395898_0000169 3300037466 Bacteria 168667
841 Ga0395898_0004616 3300037466 Bacteria 15035
842 Ga0395898_0006208 3300037466 Bacteria 12803
843 Ga0395898_0019715 3300037466 Bacteria 6859
844 Ga0395898_0034666 3300037466 Bacteria 5026
845 Ga0395898_0072114 3300037466 Bacteria 3337
846 Ga0395898_0085723 3300037466 Bacteria 3036
847 Ga0395905_0000109 3300037471 Bacteria 137754
848 Ga0395905_0000732 3300037471 Bacteria 43295
849 Ga0395905_0012127 3300037471 Bacteria 8302
850 Ga0395905_0012325 3300037471 Bacteria 8230
851 Ga0395905_0016580 3300037471 Bacteria 7003
852 Ga0395905_0028489 3300037471 Bacteria 5265
853 Ga0395905_0036725 3300037471 Bacteria 4602
854 Ga0395905_0060608 3300037471 Bacteria 3538
855 Ga0395905_0062680 3300037471 Bacteria 3478
856 Ga0395905_0109603 3300037471 Bacteria 2592
857 Ga0395905_0119980 3300037471 Bacteria 2471
858 Ga0395905_0133711 3300037471 Bacteria 2333
859 Ga0436364_1058201 3300037853 Bacteria 38676
860 Ga0436364_1537163 3300037853 Bacteria 27026
861 Ga0395901_0000390 3300038443 Bacteria 52341
862 Ga0395901_0002515 3300038443 Bacteria 18556
863 Ga0395901_0004270 3300038443 Bacteria 14412
864 Ga0395901_0004317 3300038443 Bacteria 14351
865 Ga0395901_0011441 3300038443 Bacteria 8990
866 Ga0395901_0015967 3300038443 Bacteria 7650
867 Ga0395901_0016041 3300038443 Bacteria 7632
868 Ga0395901_0032548 3300038443 Bacteria 5379
869 Ga0395901_0035276 3300038443 Bacteria 5167
870 Ga0395901_0042864 3300038443 Bacteria 4693
871 Ga0395901_0052789 3300038443 Bacteria 4225
872 Ga0395901_0055272 3300038443 Bacteria 4128
873 Ga0395901_0056957 3300038443 Bacteria 4066
874 Ga0395901_0058093 3300038443 Bacteria 4023
875 Ga0395901_0088224 3300038443 Bacteria 3244
876 Ga0395901_0090366 3300038443 Bacteria 3205
877 Ga0395901_0096222 3300038443 Bacteria 3103
878 Ga0436365_0864006 3300039437 Bacteria 4013
879 Ga0436365_1094616 3300039437 Bacteria 7416
880 Ga0436365_1189040 3300039437 Bacteria 29791
881 Ga0436365_1331544 3300039437 Bacteria 19089
882 Ga0439465_0001605 3300041413 Bacteria 7355
883 Ga0439445_0000095 3300042004 Bacteria 14106
884 Ga0439445_0008830 3300042004 Bacteria 2366
885 Ga0439448_0002713 3300042005 Bacteria 4840
886 Ga0439455_0000723 3300042012 Bacteria 4905
887 Ga0439462_0007111 3300042015 Bacteria 2798
888 Ga0450905_000246 3300042142 Bacteria 6287
889 Ga0450889_000007 3300042144 Bacteria 18930
890 Ga0439458_0000312 3300042157 Bacteria 12101
891 Ga0439458_0000394 3300042157 Bacteria 10958
892 Ga0439434_0004195 3300042435 Bacteria 4209
893 Ga0466969_0009497 3300044656 Bacteria 5158
894 Ga0466969_0009544 3300044656 Bacteria 5142
895 Ga0466972_0000559 3300044658 Bacteria 18168
896 Ga0466965_0029240 3300044683 Bacteria 2681
897 Ga0466966_0000059 3300044684 Bacteria 80975
898 Ga0466966_0001131 3300044684 Bacteria 17137
899 Ga0466961_0004715 3300044693 Bacteria 8575
900 Ga0466961_0005911 3300044693 Bacteria 7756
901 Ga0466961_0032922 3300044693 Bacteria 3330
902 Ga0466963_0000058 3300044694 Bacteria 37428
903 Ga0466963_0002122 3300044694 Bacteria 10968
904 Ga0466963_0002624 3300044694 Bacteria 10097
905 Ga0466964_0009246 3300044706 Bacteria 3707
906 Ga0466971_0002262 3300044719 Bacteria 8154
907 Ga0466971_0006257 3300044719 Bacteria 5173
908 Ga0466970_0007032 3300044765 Bacteria 5632
909 Ga0466970_0019516 3300044765 Bacteria 3515
910 Ga0466970_0029629 3300044765 Bacteria 2883
911 Ga0466957_0003295 3300044842 Bacteria 8843
912 Ga0466957_0008998 3300044842 Bacteria 5691
913 Ga0466957_0010719 3300044842 Bacteria 5270
914 Ga0466959_0001847 3300045049 Bacteria 13294
915 Ga0466959_0036827 3300045049 Bacteria 3614
916 Ga0466959_0066330 3300045049 Bacteria 2618
917 Ga0451576_0023266 3300045051 Bacteria 6711
918 Ga0466958_0001033 3300045836 Bacteria 12717
919 Ga0466958_0013964 3300045836 Bacteria 4579
920 Ga0466958_0025750 3300045836 Bacteria 3471
921 Ga0466967_0000120 3300045976 Bacteria 29412
922 Ga0466967_0008312 3300045976 Bacteria 7589
923 Ga0466967_0012529 3300045976 Bacteria 6492
924 Ga0466967_0030518 3300045976 Bacteria 4525
925 Ga0466967_0030838 3300045976 Bacteria 4504
926 Ga0495617_010845 3300046452 Bacteria 3120
927 Ga0495627_000089 3300046453 Bacteria 110113
928 Ga0495627_000124 3300046453 Bacteria 93651
929 Ga0495627_001449 3300046453 Bacteria 13902
930 Ga0495638_0000016 3300046460 Bacteria 396505
931 Ga0495638_0002615 3300046460 Bacteria 14491
932 Ga0495638_0047155 3300046460 Bacteria 2703
933 Ga0495650_0000290 3300046471 Bacteria 93004
934 Ga0495650_0000647 3300046471 Bacteria 45905
935 Ga0495650_0006220 3300046471 Bacteria 7483
936 Ga0495584_0015913 3300046491 Bacteria 3838
937 Ga0495585_0002673 3300046492 Bacteria 12490
938 Ga0495596_0000074 3300046500 Bacteria 70574
939 Ga0495596_0000553 3300046500 Bacteria 23415
940 Ga0495596_0010869 3300046500 Bacteria 3947
941 Ga0495607_0008063 3300046501 Bacteria 7231
942 Ga0495607_0010002 3300046501 Bacteria 6391
943 Ga0495583_0000023 3300046506 Bacteria 280019
944 Ga0495583_0000198 3300046506 Bacteria 101126
945 Ga0495583_0001065 3300046506 Bacteria 30658
946 Ga0495583_0005233 3300046506 Bacteria 8906
947 Ga0495583_0010578 3300046506 Bacteria 5366
948 Ga0495583_0021278 3300046506 Bacteria 3341
949 Ga0495606_0001051 3300046507 Bacteria 39880
950 Ga0495606_0001392 3300046507 Bacteria 32696
951 Ga0495606_0013419 3300046507 Bacteria 6472
952 Ga0495606_0058981 3300046507 Bacteria 2464
953 Ga0495610_0000022 3300046512 Bacteria 317107
954 Ga0495610_0000186 3300046512 Bacteria 69408
955 Ga0495610_0000377 3300046512 Bacteria 46011
956 Ga0495610_0005578 3300046512 Bacteria 8896
957 Ga0495616_0001129 3300046513 Bacteria 18934
958 Ga0495616_0038124 3300046513 Bacteria 2469
959 Ga0495631_0005510 3300046518 Bacteria 6616
960 Ga0495631_0008854 3300046518 Bacteria 5053
961 Ga0495632_0000039 3300046519 Bacteria 150268
962 Ga0495632_0000445 3300046519 Bacteria 39318
963 Ga0495632_0002580 3300046519 Bacteria 13678
964 Ga0495637_0002424 3300046520 Bacteria 10302
965 Ga0495643_0000007 3300046522 Bacteria 383435
966 Ga0495643_0000146 3300046522 Bacteria 114508
967 Ga0495643_0001713 3300046522 Bacteria 18996
968 Ga0495643_0002608 3300046522 Bacteria 14038
969 Ga0495643_0009496 3300046522 Bacteria 6043
970 Ga0495643_0028757 3300046522 Bacteria 3113
971 Ga0495648_0000101 3300046524 Bacteria 107124
972 Ga0495648_0000189 3300046524 Bacteria 70824
973 Ga0495648_0035478 3300046524 Bacteria 3233
974 Ga0495663_0000006 3300046525 Bacteria 306938
975 Ga0495663_0000961 3300046525 Bacteria 9587
976 Ga0495654_0003952 3300046530 Bacteria 8945
977 Ga0495598_0000706 3300046537 Bacteria 6360
978 Ga0495609_0005812 3300046538 Bacteria 6402
979 Ga0495621_0000052 3300046539 Bacteria 22615
980 Ga0495621_0000164 3300046539 Bacteria 14838
981 Ga0495621_0000237 3300046539 Bacteria 13009
982 Ga0495621_0001674 3300046539 Bacteria 5814
983 Ga0495622_0012740 3300046557 Bacteria 3900
984 Ga0495633_0000192 3300046558 Bacteria 78563
985 Ga0495633_0000623 3300046558 Bacteria 33278
986 Ga0495633_0000748 3300046558 Bacteria 29329
987 Ga0495633_0011361 3300046558 Bacteria 4806
988 Ga0495633_0014224 3300046558 Bacteria 4169
989 Ga0495633_0017436 3300046558 Bacteria 3671
990 Ga0495668_0000002 3300046616 Bacteria 763179
991 Ga0495668_0000181 3300046616 Bacteria 94147
992 Ga0495668_0002700 3300046616 Bacteria 14236
993 Ga0495668_0003387 3300046616 Bacteria 11999
994 Ga0495668_0013380 3300046616 Bacteria 4842
995 Ga0495611_0016872 3300046648 Bacteria 3121
996 Ga0495625_0000107 3300046660 Bacteria 125777
997 Ga0495625_0000915 3300046660 Bacteria 39689
998 Ga0495625_0001031 3300046660 Bacteria 36670
999 Ga0495625_0008172 3300046660 Bacteria 8961
1000 Ga0495625_0022549 3300046660 Bacteria 4826
1001 Ga0495661_0032523 3300046665 Bacteria 3297
1002 Ga0495669_0000727 3300046684 Bacteria 14311
1003 Ga0495669_0000848 3300046684 Bacteria 12962
1004 Ga0495669_0004376 3300046684 Bacteria 5829
1005 Ga0495670_0001858 3300046691 Bacteria 10389
1006 Ga0495670_0021593 3300046691 Bacteria 3176
1007 Ga0495671_0000063 3300046692 Bacteria 106655
1008 Ga0495671_0000499 3300046692 Bacteria 30216
1009 Ga0495671_0015070 3300046692 Bacteria 4151
1010 Ga0495671_0026804 3300046692 Bacteria 2983
1011 Ga0495683_0001719 3300047323 Bacteria 13885
1012 Ga0495687_000109 3300047443 Bacteria 125648
1013 Ga0495687_000228 3300047443 Bacteria 78882
1014 Ga0495677_0002185 3300047445 Bacteria 7748
1015 Ga0495677_0006241 3300047445 Bacteria 4500
1016 Ga0495673_0000170 3300047469 Bacteria 106688
1017 Ga0495681_0000103 3300047470 Bacteria 75088
1018 Ga0495681_0000187 3300047470 Bacteria 52995
1019 Ga0495681_0007638 3300047470 Bacteria 6877
1020 Ga0495681_0034802 3300047470 Bacteria 2506
1021 Ga0495686_0000383 3300047472 Bacteria 70528
1022 Ga0495686_0000602 3300047472 Bacteria 50008
1023 Ga0495686_0001048 3300047472 Bacteria 33188
1024 Ga0495686_0001053 3300047472 Bacteria 32974
1025 Ga0495686_0020109 3300047472 Bacteria 4455
1026 Ga0495626_0000356 3300048091 Bacteria 47831
1027 Ga0496100_0031445 3300048903 Bacteria 3300
1028 Ga0496101_0004793 3300048904 Bacteria 8581
1029 Ga0496102_0000034 3300048905 Bacteria 213826
1030 Ga0496102_0000141 3300048905 Bacteria 97499
1031 Ga0496103_0000026 3300048906 Bacteria 213826
1032 Ga0496103_0000038 3300048906 Bacteria 178822
1033 Ga0496103_0000089 3300048906 Bacteria 104353
1034 Ga0496103_0001160 3300048906 Bacteria 18172
1035 Ga0496104_0000114 3300048907 Bacteria 75253
1036 Ga0496104_0003450 3300048907 Bacteria 13624
1037 Ga0496105_0000574 3300048908 Bacteria 24332
1038 Ga0496105_0004438 3300048908 Bacteria 10564
1039 Ga0496105_0037501 3300048908 Bacteria 3991
1040 Ga0496106_0017003 3300048909 Bacteria 5382
1041 Ga0496106_0027001 3300048909 Bacteria 4275
1042 Ga0496107_0002753 3300048910 Bacteria 11567
1043 Ga0496107_0012174 3300048910 Bacteria 6001
1044 Ga0496107_0018567 3300048910 Bacteria 4898
1045 Ga0496108_0000855 3300048911 Bacteria 23752
1046 Ga0496108_0001386 3300048911 Bacteria 19059
1047 Ga0496108_0005293 3300048911 Bacteria 10415
1048 Ga0496108_0007524 3300048911 Bacteria 8832
1049 Ga0496108_0009577 3300048911 Bacteria 7850
1050 Ga0496108_0017806 3300048911 Bacteria 5811
1051 Ga0496108_0023361 3300048911 Bacteria 5086
1052 Ga0496108_0056133 3300048911 Bacteria 3308
1053 Ga0496109_0004603 3300048912 Bacteria 11513
1054 Ga0496109_0007533 3300048912 Bacteria 9225
1055 Ga0496109_0011320 3300048912 Bacteria 7662
1056 Ga0496110_0000687 3300048913 Bacteria 23304
1057 Ga0496110_0003393 3300048913 Bacteria 12176
1058 Ga0496110_0003912 3300048913 Bacteria 11457
1059 Ga0496110_0062730 3300048913 Bacteria 3283
1060 Ga0496110_0116794 3300048913 Bacteria 2402
1061 Ga0496111_0001045 3300048914 Bacteria 15238
1062 Ga0496111_0001396 3300048914 Bacteria 13716
1063 Ga0496111_0003956 3300048914 Bacteria 9299
1064 Ga0496111_0034920 3300048914 Bacteria 3591
1065 Ga0496111_0078262 3300048914 Bacteria 2411
1066 Ga0496111_0089640 3300048914 Bacteria 2253
1067 Ga0496112_0001628 3300048915 Bacteria 17393
1068 Ga0496112_0001740 3300048915 Bacteria 17049
1069 Ga0496112_0006138 3300048915 Bacteria 10502
1070 Ga0496112_0006910 3300048915 Bacteria 10014
1071 Ga0496112_0030124 3300048915 Bacteria 5251
1072 Ga0496113_0001090 3300048916 Bacteria 14704
1073 Ga0496113_0001511 3300048916 Bacteria 13038
1074 Ga0496113_0003152 3300048916 Bacteria 9817
1075 Ga0496113_0020444 3300048916 Bacteria 4653
1076 Ga0496113_0058589 3300048916 Bacteria 2898
1077 Ga0496114_0004181 3300048917 Bacteria 11179
1078 Ga0496114_0008998 3300048917 Bacteria 7915
1079 Ga0496114_0010370 3300048917 Bacteria 7415
1080 Ga0496114_0026661 3300048917 Bacteria 4733
1081 Ga0496114_0061683 3300048917 Bacteria 3137
1082 Ga0496115_0000147 3300048918 Bacteria 64872
1083 Ga0496115_0000395 3300048918 Bacteria 35926
1084 Ga0496115_0025037 3300048918 Bacteria 4643
1085 Ga0496115_0037846 3300048918 Bacteria 3825
1086 Ga0496116_0000035 3300048919 Bacteria 402424
1087 Ga0496116_0001510 3300048919 Bacteria 25820
1088 Ga0496116_0011857 3300048919 Bacteria 7171
1089 Ga0496116_0022366 3300048919 Bacteria 4739
1090 Ga0496117_0000072 3300048920 Bacteria 238366
1091 Ga0496117_0000296 3300048920 Bacteria 88277
1092 Ga0496117_0000329 3300048920 Bacteria 83691
1093 Ga0496117_0006156 3300048920 Bacteria 12260
1094 Ga0496117_0009745 3300048920 Bacteria 8864
1095 Ga0496118_0000030 3300048921 Bacteria 339946
1096 Ga0496118_0000164 3300048921 Bacteria 119381
1097 Ga0496118_0001906 3300048921 Bacteria 29700
1098 Ga0496118_0003124 3300048921 Bacteria 21219
1099 Ga0496118_0012084 3300048921 Bacteria 8334
1100 Ga0496118_0022031 3300048921 Bacteria 5587
1101 Ga0496118_0029524 3300048921 Bacteria 4596
1102 Ga0496119_0003506 3300048922 Bacteria 16215
1103 Ga0496120_0020348 3300048923 Bacteria 4220
1104 Ga0496120_0034026 3300048923 Bacteria 3056
1105 Ga0496120_0035124 3300048923 Bacteria 2997
1106 Ga0496121_0000031 3300048924 Bacteria 384119
1107 Ga0496121_0000104 3300048924 Bacteria 192186
1108 Ga0496121_0000232 3300048924 Bacteria 119519
1109 Ga0496121_0002302 3300048924 Bacteria 29625
1110 Ga0496121_0002816 3300048924 Bacteria 25715
1111 Ga0496121_0005712 3300048924 Bacteria 15799
1112 Ga0496121_0006468 3300048924 Bacteria 14526
1113 Ga0496121_0010487 3300048924 Bacteria 10446
1114 Ga0496121_0011705 3300048924 Bacteria 9687
1115 Ga0496121_0013939 3300048924 Bacteria 8590
1116 Ga0496121_0022174 3300048924 Bacteria 6178
1117 Ga0496121_0055194 3300048924 Bacteria 3312
1118 Ga0496121_0068048 3300048924 Bacteria 2883
1119 Ga0496122_0001569 3300048925 Bacteria 36021
1120 Ga0496122_0005854 3300048925 Bacteria 14421
1121 Ga0496122_0007130 3300048925 Bacteria 12537
1122 Ga0496122_0054828 3300048925 Bacteria 2989
1123 Ga0496122_0058720 3300048925 Bacteria 2845
1124 Ga0496122_0066526 3300048925 Bacteria 2603
1125 Ga0496123_0001169 3300048926 Bacteria 38781
1126 Ga0496123_0001272 3300048926 Bacteria 36131
1127 Ga0496123_0001899 3300048926 Bacteria 27259
1128 Ga0496123_0002161 3300048926 Bacteria 25100
1129 Ga0496123_0008346 3300048926 Bacteria 9530
1130 Ga0496124_0000041 3300048927 Bacteria 303887
1131 Ga0496124_0000061 3300048927 Bacteria 238225
1132 Ga0496124_0002895 3300048927 Bacteria 21652
1133 Ga0496124_0004943 3300048927 Bacteria 15278
1134 Ga0496124_0007213 3300048927 Bacteria 11877
1135 Ga0496124_0013861 3300048927 Bacteria 7841
1136 Ga0496124_0014901 3300048927 Bacteria 7491
1137 Ga0496124_0024962 3300048927 Bacteria 5422
1138 Ga0496125_0005187 3300048928 Bacteria 14639
1139 Ga0496125_0007404 3300048928 Bacteria 11675
1140 Ga0496125_0010393 3300048928 Bacteria 9417
1141 Ga0496125_0021207 3300048928 Bacteria 6068
1142 Ga0496125_0039282 3300048928 Bacteria 4078
1143 Ga0496125_0090096 3300048928 Bacteria 2303
1144 Ga0496126_0000066 3300048929 Bacteria 252188
1145 Ga0496126_0000084 3300048929 Bacteria 217111
1146 Ga0496126_0000324 3300048929 Bacteria 101936
1147 Ga0496126_0002967 3300048929 Bacteria 22043
1148 Ga0496126_0003880 3300048929 Bacteria 18417
1149 Ga0496126_0007282 3300048929 Bacteria 12162
1150 Ga0496126_0023932 3300048929 Bacteria 5906
1151 Ga0496126_0063958 3300048929 Bacteria 3296
1152 Ga0496126_0082917 3300048929 Bacteria 2831
1153 Ga0501300_000102 3300049523 Bacteria 12466
1154 Ga0501038_0005555 3300049574 Bacteria 11706
1155 Ga0501043_0019880 3300049579 Bacteria 5274
1156 Ga0501043_0031550 3300049579 Bacteria 4165
1157 Ga0501047_0071723 3300049581 Bacteria 3334
1158 Ga0501223_000022 3300049663 Bacteria 65110
1159 Ga0501223_000078 3300049663 Bacteria 29605
1160 Ga0501223_000362 3300049663 Bacteria 11165
1161 Ga0501224_000001 3300049664 Bacteria 308131
1162 Ga0501257_000044 3300049686 Bacteria 35002
1163 Ga0501225_0000179 3300049705 Bacteria 19590
1164 Ga0501225_0003753 3300049705 Bacteria 4570
1165 Ga0501280_000036 3300049776 Bacteria 38817
1166 Ga0501281_00067 3300049777 Bacteria 12000
1167 Ga0501044_0001099 3300049823 Bacteria 32196
1168 Ga0501226_000043 3300049853 Bacteria 58106
1169 nmdc:mga03683_2739_c1 3300050489 Bacteria 5527
1170 nmdc:mga03683_69_c1 3300050489 Bacteria 38507
1171 nmdc:mga03n38_2996_c1 3300050490 Bacteria 5341
1172 nmdc:mga00v17_12820_c1 3300050491 Bacteria 4635
1173 nmdc:mga00v17_37025_c1 3300050491 Bacteria 2911
1174 nmdc:mga00v17_6142_c1 3300050491 Bacteria 6365
1175 nmdc:mga0yw44_15488_c1 3300050492 Bacteria 4087
1176 nmdc:mga0k408_45_c1 3300050493 Bacteria 63055
1177 nmdc:mga06z11_179_c1 3300050494 Bacteria 25141
1178 nmdc:mga06z11_2602_c1 3300050494 Bacteria 6916
1179 nmdc:mga04h51_192_c1 3300050495 Bacteria 16730
1180 nmdc:mga04h51_315_c1 3300050495 Bacteria 12235
1181 nmdc:mga07m45_16_c1 3300050496 Bacteria 151695
1182 nmdc:mga07m45_39_c1 3300050496 Bacteria 63381
1183 nmdc:mga0a205_5138_c1 3300050515 Bacteria 11772
1184 nmdc:mga0sz30_216_c2 3300050516 Bacteria 19105
1185 nmdc:mga0sz30_40773_c1 3300050516 Bacteria 1952
1186 nmdc:mga0sz30_9424_c1 3300050516 Bacteria 3716
1187 Ga0500610_0003499 3300053079 Bacteria 6042
1188 Ga0500643_000001 3300053087 Bacteria 1440111
1189 Ga0500643_001124 3300053087 Bacteria 15971
1190 Ga0500643_001316 3300053087 Bacteria 14585
1191 Ga0500643_002298 3300053087 Bacteria 10025
1192 Ga0500643_002432 3300053087 Bacteria 9643
1193 Ga0500643_005553 3300053087 Bacteria 5414
1194 Ga0500643_015050 3300053087 Bacteria 2665
1195 Ga0500641_0001393 3300053096 Bacteria 8615
1196 Ga0500555_000537 3300053103 Bacteria 15123
1197 Ga0500556_0000234 3300053104 Bacteria 45118
1198 Ga0500595_000943 3300053119 Bacteria 16406
1199 Ga0500595_001579 3300053119 Bacteria 12024
1200 Ga0500607_000007 3300053121 Bacteria 134097
1201 Ga0500607_000122 3300053121 Bacteria 62944
1202 Ga0500614_006662 3300053123 Bacteria 2429
1203 Ga0500618_001300 3300053125 Bacteria 11446
1204 Ga0500642_0000014 3300053130 Bacteria 182110
1205 Ga0500642_0001128 3300053130 Bacteria 7636
1206 Ga0500655_000017 3300053133 Bacteria 46539
1207 Ga0500658_0000089 3300053134 Bacteria 41925
1208 Ga0500658_0003097 3300053134 Bacteria 6354
1209 Ga0500658_0005056 3300053134 Bacteria 4906
1210 Ga0500559_0000257 3300053136 Bacteria 42034
1211 Ga0500559_0001806 3300053136 Bacteria 11718
1212 Ga0500568_0002517 3300053139 Bacteria 10725
1213 Ga0500577_0003494 3300053142 Bacteria 4084
1214 Ga0500590_000082 3300053148 Bacteria 24241
1215 Ga0500604_0000065 3300053151 Bacteria 37746
1216 Ga0500616_0000265 3300053153 Bacteria 79258
1217 Ga0500616_0002941 3300053153 Bacteria 13561
1218 Ga0500616_0007393 3300053153 Bacteria 6992
1219 Ga0500616_0012693 3300053153 Bacteria 4924
1220 Ga0500622_0002918 3300053156 Bacteria 11889
1221 Ga0500624_000035 3300053157 Bacteria 97314
1222 Ga0500624_000063 3300053157 Bacteria 65333
1223 Ga0500624_000394 3300053157 Bacteria 13766
1224 Ga0500627_0000017 3300053158 Bacteria 119507
1225 Ga0500627_0000431 3300053158 Bacteria 11350
1226 Ga0500636_0002416 3300053177 Bacteria 10337
1227 Ga0500636_0012215 3300053177 Bacteria 5031
1228 Ga0500637_0000034 3300053178 Bacteria 51136
1229 Ga0500570_000324 3300053724 Bacteria 17169
1230 Ga0500645_000001 3300053730 Bacteria 455558
1231 Ga0500645_000395 3300053730 Bacteria 30555
1232 Ga0500645_000542 3300053730 Bacteria 25139
1233 Ga0500645_003062 3300053730 Bacteria 7023
1234 Ga0500596_000599 3300053735 Bacteria 6930
1235 Ga0500661_000802 3300055283 Bacteria 5844
1236 Ga0466962_0000637 3300061719 Bacteria 15609
1237 Ga0466962_0001668 3300061719 Bacteria 10415

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001989 JGI24739J22299_10001027 JGI24739J22299_100010274 534
2 3300037466 Ga0395898_0085723 Ga0395898_0085723_26_1711 549
3 3300038443 Ga0395901_0058093 Ga0395901_0058093_2318_4009 551
4 3300038443 Ga0395901_0096222 Ga0395901_0096222_1296_3092 555
5 3300005842 Ga0068858_100006410 Ga0068858_1000064101 570
6 3300026035 Ga0207703_10004443 Ga0207703_100044431 570
7 3300048913 Ga0496110_0062730 Ga0496110_0062730_1475_3259 573
8 3300037418 Ga0395900_0152155 Ga0395900_0152155_64_1893 574
9 3300025918 Ga0207662_10068132 Ga0207662_100681322 581
10 3300037418 Ga0395900_0067050 Ga0395900_0067050_1773_3557 581
11 3300037418 Ga0395900_0217937 Ga0395900_0217937_27_1811 581
12 3300045049 Ga0466959_0066330 Ga0466959_0066330_16_1890 583
13 3300053123 Ga0500614_006662 Ga0500614_006662_15_1886 589
14 3300046513 Ga0495616_0038124 Ga0495616_0038124_548_2425 590
15 3300046558 Ga0495633_0014224 Ga0495633_0014224_800_2707 595
16 3300048914 Ga0496111_0089640 Ga0496111_0089640_297_2225 596
17 3300050516 nmdc:mga0sz30_40773_c1 nmdc:mga0sz30_40773_c1_37_1863 599
18 3300050516 nmdc:mga0sz30_9424_c1 nmdc:mga0sz30_9424_c1_1854_3680 599
19 3300005339 Ga0070660_100000373 Ga0070660_10000037319 612
20 3300005366 Ga0070659_100000029 Ga0070659_10000002954 612
21 3300025919 Ga0207657_10008482 Ga0207657_100084828 612
22 3300025932 Ga0207690_10000004 Ga0207690_10000004740 612
23 3300045976 Ga0466967_0008312 Ga0466967_0008312_1797_3812 614
24 3300048928 Ga0496125_0010393 Ga0496125_0010393_5408_7462 626
25 3300042157 Ga0439458_0000394 Ga0439458_0000394_2812_4890 629
26 3300048911 Ga0496108_0017806 Ga0496108_0017806_2577_4628 629
27 3300037471 Ga0395905_0012325 Ga0395905_0012325_3319_5355 630
28 3300037312 Ga0395899_0023777 Ga0395899_0023777_359_2422 631
29 3300037418 Ga0395900_0054959 Ga0395900_0054959_899_2962 631
30 3300037471 Ga0395905_0028489 Ga0395905_0028489_386_2449 631
31 3300005355 Ga0070671_100001670 Ga0070671_10000167011 632
32 3300005456 Ga0070678_100001009 Ga0070678_10000100912 632
33 3300005530 Ga0070679_100124482 Ga0070679_1001244822 632
34 3300025931 Ga0207644_10002049 Ga0207644_1000204912 632
35 3300026121 Ga0207683_10001252 Ga0207683_100012526 632
36 3300032005 Ga0307411_10011163 Ga0307411_100111632 633
37 3300005356 Ga0070674_100067998 Ga0070674_1000679981 634
38 3300025937 Ga0207669_10042871 Ga0207669_100428712 634
39 3300049663 Ga0501223_000078 Ga0501223_000078_14110_16161 635
40 3300049664 Ga0501224_000001 Ga0501224_000001_292615_294666 635
41 3300049705 Ga0501225_0000179 Ga0501225_0000179_587_2638 635
42 3300049853 Ga0501226_000043 Ga0501226_000043_13466_15517 635
43 3300031548 Ga0307408_100083452 Ga0307408_1000834521 637
44 3300032005 Ga0307411_10049800 Ga0307411_100498001 637
45 3300021384 Ga0213876_10004712 Ga0213876_100047125 639
46 3300026067 Ga0207678_10035219 Ga0207678_100352191 639
47 3300037471 Ga0395905_0062680 Ga0395905_0062680_1438_3432 639
48 3300044765 Ga0466970_0029629 Ga0466970_0029629_870_2864 639
49 3300046539 Ga0495621_0000237 Ga0495621_0000237_8770_10764 639
50 3300046558 Ga0495633_0011361 Ga0495633_0011361_173_2167 639
51 3300046691 Ga0495670_0001858 Ga0495670_0001858_6584_8578 639
52 3300049686 Ga0501257_000044 Ga0501257_000044_13104_15173 639
53 3300046684 Ga0495669_0000727 Ga0495669_0000727_8962_10974 640
54 3300005617 Ga0068859_100023960 Ga0068859_1000239602 641
55 3300006931 Ga0097620_100023960 Ga0097620_1000239606 641
56 3300013100 Ga0157373_10085910 Ga0157373_100859102 641
57 3300048917 Ga0496114_0010370 Ga0496114_0010370_2344_4467 641
58 3300048929 Ga0496126_0002967 Ga0496126_0002967_3033_5156 641
59 3300005354 Ga0070675_100067147 Ga0070675_1000671472 642
60 3300025926 Ga0207659_10022088 Ga0207659_100220884 642
61 3300031903 Ga0307407_10022579 Ga0307407_100225793 642
62 3300005355 Ga0070671_100052892 Ga0070671_1000528923 643
63 3300005564 Ga0070664_100041943 Ga0070664_1000419432 643
64 3300005841 Ga0068863_100051676 Ga0068863_1000516762 643
65 3300005842 Ga0068858_100018332 Ga0068858_1000183323 643
66 3300014968 Ga0157379_10067861 Ga0157379_100678612 643
67 3300025919 Ga0207657_10088374 Ga0207657_100883741 643
68 3300025949 Ga0207667_10016077 Ga0207667_100160774 643
69 3300026142 Ga0207698_10040261 Ga0207698_100402612 643
70 3300037471 Ga0395905_0012127 Ga0395905_0012127_3774_5852 643
71 3300038443 Ga0395901_0056957 Ga0395901_0056957_1232_3310 643
72 3300005344 Ga0070661_100012107 Ga0070661_1000121073 644
73 3300005355 Ga0070671_100001167 Ga0070671_10000116719 644
74 3300005539 Ga0068853_100015759 Ga0068853_1000157592 644
75 3300005539 Ga0068853_100028804 Ga0068853_1000288043 644
76 3300005616 Ga0068852_100022823 Ga0068852_1000228232 644
77 3300005618 Ga0068864_100011642 Ga0068864_1000116425 644
78 3300005841 Ga0068863_100017296 Ga0068863_1000172966 644
79 3300009093 Ga0105240_10011911 Ga0105240_100119115 644
80 3300009093 Ga0105240_10087709 Ga0105240_100877092 644
81 3300013105 Ga0157369_10003645 Ga0157369_1000364518 644
82 3300013105 Ga0157369_10007466 Ga0157369_100074665 644
83 3300013105 Ga0157369_10049343 Ga0157369_100493434 644
84 3300013296 Ga0157374_10009224 Ga0157374_100092245 644
85 3300025909 Ga0207705_10000003 Ga0207705_1000000396 644
86 3300025909 Ga0207705_10000275 Ga0207705_1000027548 644
87 3300025909 Ga0207705_10002164 Ga0207705_1000216413 644
88 3300025909 Ga0207705_10006301 Ga0207705_100063013 644
89 3300025909 Ga0207705_10048942 Ga0207705_100489422 644
90 3300025913 Ga0207695_10007952 Ga0207695_100079525 644
91 3300025917 Ga0207660_10008242 Ga0207660_100082424 644
92 3300025919 Ga0207657_10001115 Ga0207657_1000111526 644
93 3300025940 Ga0207691_10081488 Ga0207691_100814881 644
94 3300025940 Ga0207691_10110315 Ga0207691_101103152 644
95 3300025941 Ga0207711_10021704 Ga0207711_100217043 644
96 3300025981 Ga0207640_10000518 Ga0207640_1000051822 644
97 3300026041 Ga0207639_10000202 Ga0207639_1000020243 644
98 3300026088 Ga0207641_10010112 Ga0207641_100101124 644
99 3300026142 Ga0207698_10012472 Ga0207698_100124724 644
100 3300037312 Ga0395899_0017518 Ga0395899_0017518_2454_4490 644
101 3300037418 Ga0395900_0065092 Ga0395900_0065092_712_2751 644
102 3300037466 Ga0395898_0019715 Ga0395898_0019715_318_2354 644
103 3300038443 Ga0395901_0042864 Ga0395901_0042864_1129_3165 644
104 3300044656 Ga0466969_0009544 Ga0466969_0009544_2168_4207 644
105 3300044684 Ga0466966_0000059 Ga0466966_0000059_11712_13859 644
106 3300044684 Ga0466966_0001131 Ga0466966_0001131_13265_15304 644
107 3300044693 Ga0466961_0004715 Ga0466961_0004715_2767_4806 644
108 3300044693 Ga0466961_0032922 Ga0466961_0032922_478_2580 644
109 3300044694 Ga0466963_0002122 Ga0466963_0002122_3491_5530 644
110 3300044719 Ga0466971_0002262 Ga0466971_0002262_881_2920 644
111 3300044765 Ga0466970_0019516 Ga0466970_0019516_817_2856 644
112 3300044842 Ga0466957_0003295 Ga0466957_0003295_5244_7283 644
113 3300045049 Ga0466959_0001847 Ga0466959_0001847_10376_12478 644
114 3300045049 Ga0466959_0036827 Ga0466959_0036827_817_2856 644
115 3300045836 Ga0466958_0001033 Ga0466958_0001033_4254_6293 644
116 3300045976 Ga0466967_0012529 Ga0466967_0012529_3592_5628 644
117 3300048911 Ga0496108_0009577 Ga0496108_0009577_2293_4329 644
118 3300048912 Ga0496109_0007533 Ga0496109_0007533_7122_9158 644
119 3300048915 Ga0496112_0001628 Ga0496112_0001628_2395_4431 644
120 3300061719 Ga0466962_0001668 Ga0466962_0001668_733_2772 644
121 iso_pu_bacteria 2885427238 2885428936 644
122 3300001990 JGI24737J22298_10003655 JGI24737J22298_100036554 645
123 3300002075 JGI24738J21930_10003825 JGI24738J21930_100038251 645
124 3300005327 Ga0070658_10000606 Ga0070658_100006065 645
125 3300005327 Ga0070658_10000876 Ga0070658_100008767 645
126 3300005327 Ga0070658_10002938 Ga0070658_100029382 645
127 3300005329 Ga0070683_100008796 Ga0070683_1000087967 645
128 3300005329 Ga0070683_100012850 Ga0070683_1000128503 645
129 3300005329 Ga0070683_100018957 Ga0070683_1000189576 645
130 3300005331 Ga0070670_100010492 Ga0070670_1000104926 645
131 3300005335 Ga0070666_10000216 Ga0070666_1000021642 645
132 3300005337 Ga0070682_100024697 Ga0070682_1000246971 645
133 3300005339 Ga0070660_100000206 Ga0070660_10000020627 645
134 3300005339 Ga0070660_100000487 Ga0070660_10000048718 645
135 3300005344 Ga0070661_100000213 Ga0070661_1000002133 645
136 3300005366 Ga0070659_100000123 Ga0070659_10000012360 645
137 3300005457 Ga0070662_100000060 Ga0070662_10000006060 645
138 3300005543 Ga0070672_100119762 Ga0070672_1001197621 645
139 3300005546 Ga0070696_100004732 Ga0070696_1000047329 645
140 3300005548 Ga0070665_100014865 Ga0070665_1000148656 645
141 3300005563 Ga0068855_100000079 Ga0068855_10000007927 645
142 3300005563 Ga0068855_100008087 Ga0068855_1000080874 645
143 3300005564 Ga0070664_100002327 Ga0070664_1000023271 645
144 3300005564 Ga0070664_100003887 Ga0070664_1000038875 645
145 3300005577 Ga0068857_100035798 Ga0068857_1000357984 645
146 3300005578 Ga0068854_100029682 Ga0068854_1000296823 645
147 3300005614 Ga0068856_100002727 Ga0068856_1000027271 645
148 3300005834 Ga0068851_10003176 Ga0068851_100031763 645
149 3300005842 Ga0068858_100037516 Ga0068858_1000375163 645
150 3300009094 Ga0111539_10020298 Ga0111539_100202987 645
151 3300009177 Ga0105248_10000278 Ga0105248_100002783 645
152 3300013100 Ga0157373_10005655 Ga0157373_100056552 645
153 3300013102 Ga0157371_10000261 Ga0157371_1000026127 645
154 3300013102 Ga0157371_10003558 Ga0157371_100035583 645
155 3300013105 Ga0157369_10038267 Ga0157369_100382673 645
156 3300014325 Ga0163163_10001741 Ga0163163_100017414 645
157 3300025903 Ga0207680_10000727 Ga0207680_1000072718 645
158 3300025909 Ga0207705_10000125 Ga0207705_1000012539 645
159 3300025909 Ga0207705_10000535 Ga0207705_1000053518 645
160 3300025909 Ga0207705_10000749 Ga0207705_1000074912 645
161 3300025909 Ga0207705_10034286 Ga0207705_100342862 645
162 3300025917 Ga0207660_10027792 Ga0207660_100277923 645
163 3300025919 Ga0207657_10000167 Ga0207657_1000016726 645
164 3300025919 Ga0207657_10000431 Ga0207657_1000043125 645
165 3300025919 Ga0207657_10008530 Ga0207657_100085303 645
166 3300025920 Ga0207649_10000211 Ga0207649_100002112 645
167 3300025921 Ga0207652_10038596 Ga0207652_100385964 645
168 3300025924 Ga0207694_10007616 Ga0207694_100076163 645
169 3300025924 Ga0207694_10059810 Ga0207694_100598101 645
170 3300025931 Ga0207644_10011510 Ga0207644_100115103 645
171 3300025932 Ga0207690_10000182 Ga0207690_1000018250 645
172 3300025933 Ga0207706_10000028 Ga0207706_100000289 645
173 3300025941 Ga0207711_10000719 Ga0207711_1000071926 645
174 3300025944 Ga0207661_10001388 Ga0207661_1000138811 645
175 3300025945 Ga0207679_10000293 Ga0207679_100002933 645
176 3300025949 Ga0207667_10003195 Ga0207667_100031953 645
177 3300025949 Ga0207667_10048638 Ga0207667_100486381 645
178 3300026035 Ga0207703_10023720 Ga0207703_100237203 645
179 3300026078 Ga0207702_10002919 Ga0207702_1000291918 645
180 3300026095 Ga0207676_10003174 Ga0207676_1000317410 645
181 3300026095 Ga0207676_10112141 Ga0207676_101121411 645
182 3300026116 Ga0207674_10009520 Ga0207674_100095209 645
183 3300026116 Ga0207674_10011361 Ga0207674_100113615 645
184 3300026116 Ga0207674_10013736 Ga0207674_100137367 645
185 3300026121 Ga0207683_10071499 Ga0207683_100714992 645
186 3300026142 Ga0207698_10016510 Ga0207698_100165104 645
187 3300026142 Ga0207698_10047977 Ga0207698_100479772 645
188 3300028379 Ga0268266_10034233 Ga0268266_100342334 645
189 3300031548 Ga0307408_100013723 Ga0307408_1000137234 645
190 3300031852 Ga0307410_10023190 Ga0307410_100231901 645
191 3300031901 Ga0307406_10041135 Ga0307406_100411351 645
192 3300031903 Ga0307407_10057800 Ga0307407_100578002 645
193 3300031995 Ga0307409_100018413 Ga0307409_1000184133 645
194 3300031995 Ga0307409_100062552 Ga0307409_1000625521 645
195 3300032004 Ga0307414_10022720 Ga0307414_100227202 645
196 3300032004 Ga0307414_10037869 Ga0307414_100378692 645
197 3300032005 Ga0307411_10012158 Ga0307411_100121582 645
198 3300032005 Ga0307411_10043362 Ga0307411_100433622 645
199 3300035691 Ga0373931_0002964 Ga0373931_0002964_1528_3564 645
200 3300037312 Ga0395899_0002137 Ga0395899_0002137_3794_5830 645
201 3300037418 Ga0395900_0000547 Ga0395900_0000547_11003_13039 645
202 3300037418 Ga0395900_0088866 Ga0395900_0088866_685_2721 645
203 3300037466 Ga0395898_0006208 Ga0395898_0006208_6569_8605 645
204 3300037471 Ga0395905_0119980 Ga0395905_0119980_182_2218 645
205 3300038443 Ga0395901_0000390 Ga0395901_0000390_39303_41339 645
206 3300038443 Ga0395901_0090366 Ga0395901_0090366_915_2951 645
207 3300042142 Ga0450905_000246 Ga0450905_000246_2035_4077 645
208 3300042144 Ga0450889_000007 Ga0450889_000007_9032_11074 645
209 3300046525 Ga0495663_0000961 Ga0495663_0000961_7396_9432 645
210 3300046537 Ga0495598_0000706 Ga0495598_0000706_2887_4923 645
211 3300046539 Ga0495621_0000164 Ga0495621_0000164_7614_9650 645
212 3300046558 Ga0495633_0017436 Ga0495633_0017436_1095_3131 645
213 3300048909 Ga0496106_0017003 Ga0496106_0017003_1159_3207 645
214 3300048910 Ga0496107_0012174 Ga0496107_0012174_2465_4513 645
215 3300048917 Ga0496114_0026661 Ga0496114_0026661_419_2467 645
216 3300048917 Ga0496114_0061683 Ga0496114_0061683_111_2147 645
217 3300048918 Ga0496115_0025037 Ga0496115_0025037_2203_4251 645
218 3300005327 Ga0070658_10079872 Ga0070658_100798721 646
219 3300005355 Ga0070671_100064239 Ga0070671_1000642393 646
220 3300005436 Ga0070713_100027181 Ga0070713_1000271814 646
221 3300005614 Ga0068856_100076710 Ga0068856_1000767103 646
222 3300009093 Ga0105240_10030169 Ga0105240_100301695 646
223 3300025913 Ga0207695_10022925 Ga0207695_100229253 646
224 3300026078 Ga0207702_10007350 Ga0207702_100073509 646
225 3300031824 Ga0307413_10010863 Ga0307413_100108632 646
226 3300031903 Ga0307407_10004081 Ga0307407_100040811 646
227 3300031911 Ga0307412_10045630 Ga0307412_100456302 646
228 3300031995 Ga0307409_100024798 Ga0307409_1000247981 646
229 3300032002 Ga0307416_100011307 Ga0307416_1000113072 646
230 3300032004 Ga0307414_10004451 Ga0307414_100044516 646
231 3300032004 Ga0307414_10082646 Ga0307414_100826462 646
232 3300032005 Ga0307411_10002478 Ga0307411_100024783 646
233 3300032126 Ga0307415_100001735 Ga0307415_1000017353 646
234 3300037418 Ga0395900_0017573 Ga0395900_0017573_2814_4853 646
235 3300037471 Ga0395905_0060608 Ga0395905_0060608_1401_3440 646
236 3300038443 Ga0395901_0016041 Ga0395901_0016041_2915_4954 646
237 3300048914 Ga0496111_0003956 Ga0496111_0003956_7183_9222 646
238 3300048914 Ga0496111_0078262 Ga0496111_0078262_25_2070 646
239 3300048918 Ga0496115_0000395 Ga0496115_0000395_3276_5315 646
240 3300005333 Ga0070677_10000519 Ga0070677_100005199 647
241 3300032004 Ga0307414_10097729 Ga0307414_100977291 647
242 3300037418 Ga0395900_0024919 Ga0395900_0024919_156_2204 647
243 3300037418 Ga0395900_0055572 Ga0395900_0055572_1220_3334 647
244 3300037466 Ga0395898_0072114 Ga0395898_0072114_1041_3086 647
245 3300037471 Ga0395905_0109603 Ga0395905_0109603_175_2223 647
246 3300038443 Ga0395901_0032548 Ga0395901_0032548_523_2568 647
247 3300048924 Ga0496121_0000104 Ga0496121_0000104_48791_50842 647
248 3300048924 Ga0496121_0010487 Ga0496121_0010487_4412_6514 647
249 3300005293 Ga0065715_10007198 Ga0065715_100071984 649
250 3300005328 Ga0070676_10049400 Ga0070676_100494002 649
251 3300005331 Ga0070670_100002100 Ga0070670_10000210011 649
252 3300005347 Ga0070668_100005256 Ga0070668_1000052568 649
253 3300005353 Ga0070669_100026611 Ga0070669_1000266114 649
254 3300005354 Ga0070675_100012981 Ga0070675_1000129812 649
255 3300005355 Ga0070671_100012902 Ga0070671_1000129028 649
256 3300005356 Ga0070674_100009504 Ga0070674_1000095046 649
257 3300005364 Ga0070673_100010591 Ga0070673_1000105915 649
258 3300005457 Ga0070662_100003052 Ga0070662_1000030524 649
259 3300005543 Ga0070672_100001472 Ga0070672_1000014728 649
260 3300005548 Ga0070665_100000240 Ga0070665_10000024074 649
261 3300005577 Ga0068857_100094679 Ga0068857_1000946792 649
262 3300005617 Ga0068859_100019739 Ga0068859_1000197398 649
263 3300005719 Ga0068861_100010248 Ga0068861_1000102484 649
264 3300005844 Ga0068862_100007818 Ga0068862_1000078185 649
265 3300006931 Ga0097620_100019739 Ga0097620_1000197398 649
266 3300009094 Ga0111539_10036148 Ga0111539_100361485 649
267 3300009553 Ga0105249_10015431 Ga0105249_100154312 649
268 3300014326 Ga0157380_10042557 Ga0157380_100425572 649
269 3300025315 Ga0207697_10002575 Ga0207697_100025755 649
270 3300025907 Ga0207645_10002599 Ga0207645_100025993 649
271 3300025923 Ga0207681_10054162 Ga0207681_100541622 649
272 3300025931 Ga0207644_10013594 Ga0207644_100135945 649
273 3300025933 Ga0207706_10002443 Ga0207706_1000244315 649
274 3300025940 Ga0207691_10002544 Ga0207691_100025448 649
275 3300025960 Ga0207651_10013368 Ga0207651_100133685 649
276 3300025972 Ga0207668_10061320 Ga0207668_100613201 649
277 3300026067 Ga0207678_10009465 Ga0207678_100094658 649
278 3300026095 Ga0207676_10006149 Ga0207676_100061493 649
279 3300026118 Ga0207675_100003939 Ga0207675_1000039398 649
280 3300028379 Ga0268266_10001675 Ga0268266_1000167520 649
281 3300031731 Ga0307405_10066824 Ga0307405_100668242 649
282 3300031852 Ga0307410_10000740 Ga0307410_1000074012 649
283 3300031995 Ga0307409_100012685 Ga0307409_1000126854 649
284 3300032126 Ga0307415_100040310 Ga0307415_1000403103 649
285 3300037418 Ga0395900_0000604 Ga0395900_0000604_30853_32964 649
286 3300037471 Ga0395905_0000732 Ga0395905_0000732_14719_16830 649
287 3300042004 Ga0439445_0000095 Ga0439445_0000095_11669_13693 649
288 3300044693 Ga0466961_0005911 Ga0466961_0005911_1022_3049 649
289 3300045051 Ga0451576_0023266 Ga0451576_0023266_165_2309 649
290 3300046539 Ga0495621_0000052 Ga0495621_0000052_9074_11098 649
291 3300046539 Ga0495621_0001674 Ga0495621_0001674_2734_4758 649
292 3300047445 Ga0495677_0006241 Ga0495677_0006241_1662_3686 649
293 3300053157 Ga0500624_000035 Ga0500624_000035_28769_30817 649
294 3300053178 Ga0500637_0000034 Ga0500637_0000034_12960_15008 649
295 3300005842 Ga0068858_100004712 Ga0068858_1000047122 650
296 3300020081 Ga0206354_10229693 Ga0206354_102296935 650
297 3300020082 Ga0206353_11805231 Ga0206353_1180523110 650
298 3300026035 Ga0207703_10006455 Ga0207703_100064558 650
299 3300032005 Ga0307411_10008752 Ga0307411_100087523 650
300 3300048921 Ga0496118_0012084 Ga0496118_0012084_890_2974 650
301 3300048923 Ga0496120_0034026 Ga0496120_0034026_22_2106 650
302 3300048924 Ga0496121_0068048 Ga0496121_0068048_142_2226 650
303 3300048928 Ga0496125_0007404 Ga0496125_0007404_6912_8996 650
304 3300001989 JGI24739J22299_10011314 JGI24739J22299_100113142 651
305 3300001989 JGI24739J22299_10011321 JGI24739J22299_100113212 651
306 3300001990 JGI24737J22298_10001097 JGI24737J22298_100010974 651
307 3300003214 JGI25165J46597_1000040 JGI25165J46597_100004087 651
308 3300005327 Ga0070658_10000022 Ga0070658_10000022106 651
309 3300005328 Ga0070676_10000855 Ga0070676_100008556 651
310 3300005334 Ga0068869_100000031 Ga0068869_10000003125 651
311 3300005338 Ga0068868_100000060 Ga0068868_10000006038 651
312 3300005339 Ga0070660_100000568 Ga0070660_10000056818 651
313 3300005339 Ga0070660_100000801 Ga0070660_10000080113 651
314 3300005356 Ga0070674_100018895 Ga0070674_1000188952 651
315 3300005364 Ga0070673_100000009 Ga0070673_10000000938 651
316 3300005367 Ga0070667_100002673 Ga0070667_1000026739 651
317 3300005457 Ga0070662_100026855 Ga0070662_1000268552 651
318 3300005457 Ga0070662_100074136 Ga0070662_1000741362 651
319 3300005459 Ga0068867_100000165 Ga0068867_1000001651 651
320 3300005539 Ga0068853_100016138 Ga0068853_1000161383 651
321 3300005543 Ga0070672_100007007 Ga0070672_1000070076 651
322 3300005548 Ga0070665_100006731 Ga0070665_1000067318 651
323 3300005563 Ga0068855_100000371 Ga0068855_10000037138 651
324 3300005563 Ga0068855_100024428 Ga0068855_1000244288 651
325 3300005577 Ga0068857_100115119 Ga0068857_1001151192 651
326 3300005614 Ga0068856_100059012 Ga0068856_1000590122 651
327 3300005616 Ga0068852_100002341 Ga0068852_1000023416 651
328 3300005843 Ga0068860_100000007 Ga0068860_100000007387 651
329 3300006881 Ga0068865_100000014 Ga0068865_100000014105 651
330 3300009093 Ga0105240_10017250 Ga0105240_100172509 651
331 3300009098 Ga0105245_10000160 Ga0105245_1000016028 651
332 3300009148 Ga0105243_10000070 Ga0105243_1000007084 651
333 3300009176 Ga0105242_10000722 Ga0105242_1000072214 651
334 3300009545 Ga0105237_10030898 Ga0105237_100308982 651
335 3300009551 Ga0105238_10051609 Ga0105238_100516094 651
336 3300013100 Ga0157373_10013959 Ga0157373_100139593 651
337 3300013104 Ga0157370_10000117 Ga0157370_1000011750 651
338 3300013105 Ga0157369_10002806 Ga0157369_1000280611 651
339 3300013296 Ga0157374_10000542 Ga0157374_1000054217 651
340 3300013297 Ga0157378_10000624 Ga0157378_1000062417 651
341 3300013307 Ga0157372_10035278 Ga0157372_100352785 651
342 3300013308 Ga0157375_10001639 Ga0157375_1000163917 651
343 3300014745 Ga0157377_10033679 Ga0157377_100336792 651
344 3300014969 Ga0157376_10000096 Ga0157376_1000009638 651
345 3300025231 Ga0207427_101114 Ga0207427_10111411 651
346 3300025250 Ga0209026_1000641 Ga0209026_100064116 651
347 3300025254 Ga0209148_1000147 Ga0209148_1000147129 651
348 3300025254 Ga0209148_1001590 Ga0209148_100159011 651
349 3300025261 Ga0209233_1000003 Ga0209233_1000003397 651
350 3300025901 Ga0207688_10022035 Ga0207688_100220354 651
351 3300025904 Ga0207647_10000389 Ga0207647_1000038939 651
352 3300025907 Ga0207645_10002952 Ga0207645_100029522 651
353 3300025909 Ga0207705_10000236 Ga0207705_1000023640 651
354 3300025909 Ga0207705_10011218 Ga0207705_100112184 651
355 3300025913 Ga0207695_10020519 Ga0207695_100205194 651
356 3300025919 Ga0207657_10000837 Ga0207657_1000083710 651
357 3300025919 Ga0207657_10001189 Ga0207657_1000118911 651
358 3300025919 Ga0207657_10107517 Ga0207657_101075172 651
359 3300025927 Ga0207687_10004601 Ga0207687_100046013 651
360 3300025932 Ga0207690_10004108 Ga0207690_100041086 651
361 3300025933 Ga0207706_10007744 Ga0207706_1000774410 651
362 3300025933 Ga0207706_10008803 Ga0207706_1000880310 651
363 3300025933 Ga0207706_10010944 Ga0207706_100109445 651
364 3300025934 Ga0207686_10000489 Ga0207686_1000048914 651
365 3300025935 Ga0207709_10000066 Ga0207709_1000006616 651
366 3300025938 Ga0207704_10000002 Ga0207704_10000002182 651
367 3300025938 Ga0207704_10000007 Ga0207704_10000007182 651
368 3300025940 Ga0207691_10050203 Ga0207691_100502032 651
369 3300025942 Ga0207689_10000060 Ga0207689_1000006049 651
370 3300025949 Ga0207667_10000017 Ga0207667_10000017308 651
371 3300025949 Ga0207667_10023576 Ga0207667_100235767 651
372 3300025960 Ga0207651_10000004 Ga0207651_10000004251 651
373 3300025986 Ga0207658_10004992 Ga0207658_100049928 651
374 3300026023 Ga0207677_10000231 Ga0207677_1000023132 651
375 3300026067 Ga0207678_10000656 Ga0207678_1000065618 651
376 3300026078 Ga0207702_10019219 Ga0207702_100192192 651
377 3300026078 Ga0207702_10023673 Ga0207702_100236736 651
378 3300026089 Ga0207648_10000003 Ga0207648_1000000338 651
379 3300026116 Ga0207674_10000065 Ga0207674_10000065108 651
380 3300026116 Ga0207674_10123919 Ga0207674_101239192 651
381 3300026142 Ga0207698_10001503 Ga0207698_1000150314 651
382 3300028379 Ga0268266_10017744 Ga0268266_100177445 651
383 3300028381 Ga0268264_10000134 Ga0268264_1000013429 651
384 3300031731 Ga0307405_10024810 Ga0307405_100248102 651
385 3300031901 Ga0307406_10029393 Ga0307406_100293933 651
386 3300037312 Ga0395899_0002159 Ga0395899_0002159_6830_8914 651
387 3300037418 Ga0395900_0033889 Ga0395900_0033889_2192_4276 651
388 3300037418 Ga0395900_0049171 Ga0395900_0049171_2143_4221 651
389 3300037471 Ga0395905_0133711 Ga0395905_0133711_134_2212 651
390 3300042005 Ga0439448_0002713 Ga0439448_0002713_1213_3291 651
391 3300042012 Ga0439455_0000723 Ga0439455_0000723_1220_3298 651
392 3300042157 Ga0439458_0000312 Ga0439458_0000312_3947_6025 651
393 3300044658 Ga0466972_0000559 Ga0466972_0000559_12285_14408 651
394 3300044706 Ga0466964_0009246 Ga0466964_0009246_80_2203 651
395 3300044765 Ga0466970_0007032 Ga0466970_0007032_2443_4521 651
396 3300045976 Ga0466967_0030518 Ga0466967_0030518_42_2120 651
397 3300048926 Ga0496123_0008346 Ga0496123_0008346_4762_6840 651
398 3300053087 Ga0500643_002432 Ga0500643_002432_945_3053 651
399 3300005353 Ga0070669_100031343 Ga0070669_1000313431 652
400 3300005366 Ga0070659_100008511 Ga0070659_1000085112 652
401 3300005457 Ga0070662_100004499 Ga0070662_1000044996 652
402 3300005617 Ga0068859_100019684 Ga0068859_1000196845 652
403 3300005843 Ga0068860_100011041 Ga0068860_1000110414 652
404 3300005844 Ga0068862_100019554 Ga0068862_1000195542 652
405 3300006852 Ga0075433_10003762 Ga0075433_100037624 652
406 3300006931 Ga0097620_100019684 Ga0097620_1000196845 652
407 3300009553 Ga0105249_10135400 Ga0105249_101354002 652
408 3300014745 Ga0157377_10022306 Ga0157377_100223063 652
409 3300025904 Ga0207647_10006807 Ga0207647_100068075 652
410 3300025909 Ga0207705_10045306 Ga0207705_100453063 652
411 3300025932 Ga0207690_10005471 Ga0207690_100054712 652
412 3300025933 Ga0207706_10008705 Ga0207706_100087052 652
413 3300025961 Ga0207712_10000974 Ga0207712_1000097417 652
414 3300026041 Ga0207639_10070587 Ga0207639_100705872 652
415 3300026067 Ga0207678_10023463 Ga0207678_100234633 652
416 3300026088 Ga0207641_10034743 Ga0207641_100347434 652
417 3300026116 Ga0207674_10000583 Ga0207674_1000058324 652
418 3300026116 Ga0207674_10039109 Ga0207674_100391092 652
419 3300028381 Ga0268264_10000546 Ga0268264_1000054629 652
420 3300031731 Ga0307405_10014429 Ga0307405_100144294 652
421 3300031903 Ga0307407_10016596 Ga0307407_100165963 652
422 3300031995 Ga0307409_100048061 Ga0307409_1000480612 652
423 3300032005 Ga0307411_10003484 Ga0307411_100034846 652
424 3300032126 Ga0307415_100022578 Ga0307415_1000225783 652
425 3300037312 Ga0395899_0011202 Ga0395899_0011202_3610_5643 652
426 3300037418 Ga0395900_0000912 Ga0395900_0000912_23757_25832 652
427 3300037418 Ga0395900_0045544 Ga0395900_0045544_2273_4390 652
428 3300037471 Ga0395905_0016580 Ga0395905_0016580_1805_3922 652
429 3300038443 Ga0395901_0088224 Ga0395901_0088224_765_2882 652
430 3300048912 Ga0496109_0011320 Ga0496109_0011320_2216_4273 652
431 3300048915 Ga0496112_0006138 Ga0496112_0006138_1961_4018 652
432 3300050515 nmdc:mga0a205_5138_c1 nmdc:mga0a205_5138_c1_1474_3567 652
433 3300005327 Ga0070658_10022981 Ga0070658_100229814 653
434 3300005328 Ga0070676_10003403 Ga0070676_100034031 653
435 3300005330 Ga0070690_100000870 Ga0070690_10000087012 653
436 3300005331 Ga0070670_100001616 Ga0070670_1000016166 653
437 3300005331 Ga0070670_100006537 Ga0070670_1000065372 653
438 3300005335 Ga0070666_10000421 Ga0070666_1000042116 653
439 3300005335 Ga0070666_10003248 Ga0070666_1000324810 653
440 3300005338 Ga0068868_100000688 Ga0068868_10000068811 653
441 3300005338 Ga0068868_100013170 Ga0068868_1000131706 653
442 3300005339 Ga0070660_100038715 Ga0070660_1000387152 653
443 3300005341 Ga0070691_10001768 Ga0070691_100017682 653
444 3300005344 Ga0070661_100010176 Ga0070661_1000101766 653
445 3300005344 Ga0070661_100015970 Ga0070661_1000159702 653
446 3300005347 Ga0070668_100004873 Ga0070668_1000048734 653
447 3300005355 Ga0070671_100000297 Ga0070671_10000029734 653
448 3300005355 Ga0070671_100002301 Ga0070671_10000230111 653
449 3300005355 Ga0070671_100030982 Ga0070671_1000309822 653
450 3300005356 Ga0070674_100028282 Ga0070674_1000282823 653
451 3300005364 Ga0070673_100045576 Ga0070673_1000455762 653
452 3300005364 Ga0070673_100070938 Ga0070673_1000709382 653
453 3300005366 Ga0070659_100057750 Ga0070659_1000577502 653
454 3300005367 Ga0070667_100001036 Ga0070667_1000010364 653
455 3300005367 Ga0070667_100002998 Ga0070667_1000029986 653
456 3300005367 Ga0070667_100006547 Ga0070667_10000654710 653
457 3300005456 Ga0070678_100000375 Ga0070678_10000037516 653
458 3300005456 Ga0070678_100016666 Ga0070678_1000166663 653
459 3300005457 Ga0070662_100002723 Ga0070662_10000272310 653
460 3300005457 Ga0070662_100034198 Ga0070662_1000341983 653
461 3300005459 Ga0068867_100018006 Ga0068867_1000180064 653
462 3300005459 Ga0068867_100044067 Ga0068867_1000440673 653
463 3300005543 Ga0070672_100002007 Ga0070672_1000020075 653
464 3300005548 Ga0070665_100004414 Ga0070665_1000044145 653
465 3300005548 Ga0070665_100030138 Ga0070665_1000301385 653
466 3300005548 Ga0070665_100065017 Ga0070665_1000650173 653
467 3300005564 Ga0070664_100000675 Ga0070664_1000006754 653
468 3300005564 Ga0070664_100002321 Ga0070664_10000232115 653
469 3300005564 Ga0070664_100002816 Ga0070664_1000028165 653
470 3300005617 Ga0068859_100002802 Ga0068859_1000028022 653
471 3300005617 Ga0068859_100031585 Ga0068859_1000315854 653
472 3300005617 Ga0068859_100059278 Ga0068859_1000592784 653
473 3300005618 Ga0068864_100000445 Ga0068864_10000044512 653
474 3300005618 Ga0068864_100012479 Ga0068864_1000124795 653
475 3300005618 Ga0068864_100016549 Ga0068864_1000165492 653
476 3300005618 Ga0068864_100021029 Ga0068864_1000210294 653
477 3300005834 Ga0068851_10013423 Ga0068851_100134234 653
478 3300005841 Ga0068863_100007589 Ga0068863_1000075893 653
479 3300005841 Ga0068863_100007847 Ga0068863_1000078472 653
480 3300005842 Ga0068858_100001226 Ga0068858_10000122626 653
481 3300005842 Ga0068858_100007977 Ga0068858_1000079779 653
482 3300005842 Ga0068858_100011055 Ga0068858_1000110554 653
483 3300005843 Ga0068860_100007613 Ga0068860_1000076133 653
484 3300005844 Ga0068862_100019002 Ga0068862_1000190024 653
485 3300006028 Ga0070717_10002620 Ga0070717_1000262010 653
486 3300006237 Ga0097621_100026348 Ga0097621_1000263483 653
487 3300006237 Ga0097621_100034039 Ga0097621_1000340392 653
488 3300006358 Ga0068871_100011463 Ga0068871_1000114634 653
489 3300006881 Ga0068865_100002176 Ga0068865_1000021767 653
490 3300006881 Ga0068865_100008257 Ga0068865_1000082576 653
491 3300006931 Ga0097620_100002802 Ga0097620_1000028022 653
492 3300006931 Ga0097620_100031585 Ga0097620_1000315852 653
493 3300006931 Ga0097620_100059280 Ga0097620_1000592802 653
494 3300009098 Ga0105245_10027194 Ga0105245_100271942 653
495 3300009177 Ga0105248_10000575 Ga0105248_1000057538 653
496 3300009177 Ga0105248_10000621 Ga0105248_1000062119 653
497 3300009177 Ga0105248_10000902 Ga0105248_1000090229 653
498 3300009177 Ga0105248_10011427 Ga0105248_100114279 653
499 3300009177 Ga0105248_10093942 Ga0105248_100939422 653
500 3300009551 Ga0105238_10030503 Ga0105238_100305032 653
501 3300009553 Ga0105249_10049567 Ga0105249_100495673 653
502 3300013296 Ga0157374_10012710 Ga0157374_100127107 653
503 3300013296 Ga0157374_10098747 Ga0157374_100987472 653
504 3300013297 Ga0157378_10025793 Ga0157378_100257932 653
505 3300013306 Ga0163162_10003182 Ga0163162_1000318216 653
506 3300013306 Ga0163162_10043844 Ga0163162_100438444 653
507 3300013308 Ga0157375_10003289 Ga0157375_100032893 653
508 3300013308 Ga0157375_10028614 Ga0157375_100286142 653
509 3300014325 Ga0163163_10002576 Ga0163163_1000257610 653
510 3300014968 Ga0157379_10002202 Ga0157379_1000220211 653
511 3300014968 Ga0157379_10117156 Ga0157379_101171562 653
512 3300014969 Ga0157376_10009707 Ga0157376_100097074 653
513 3300021388 Ga0213875_10002567 Ga0213875_100025674 653
514 3300025321 Ga0207656_10005855 Ga0207656_100058554 653
515 3300025903 Ga0207680_10000396 Ga0207680_1000039612 653
516 3300025907 Ga0207645_10012375 Ga0207645_100123757 653
517 3300025909 Ga0207705_10006763 Ga0207705_100067638 653
518 3300025909 Ga0207705_10016928 Ga0207705_100169284 653
519 3300025909 Ga0207705_10050804 Ga0207705_100508042 653
520 3300025913 Ga0207695_10006228 Ga0207695_1000622811 653
521 3300025919 Ga0207657_10017834 Ga0207657_100178345 653
522 3300025919 Ga0207657_10031135 Ga0207657_100311353 653
523 3300025919 Ga0207657_10049088 Ga0207657_100490883 653
524 3300025920 Ga0207649_10006038 Ga0207649_100060386 653
525 3300025923 Ga0207681_10035580 Ga0207681_100355802 653
526 3300025925 Ga0207650_10003982 Ga0207650_100039823 653
527 3300025926 Ga0207659_10053154 Ga0207659_100531542 653
528 3300025927 Ga0207687_10042826 Ga0207687_100428262 653
529 3300025931 Ga0207644_10000090 Ga0207644_1000009053 653
530 3300025931 Ga0207644_10000771 Ga0207644_1000077116 653
531 3300025931 Ga0207644_10003050 Ga0207644_100030502 653
532 3300025931 Ga0207644_10004166 Ga0207644_100041662 653
533 3300025933 Ga0207706_10002426 Ga0207706_1000242616 653
534 3300025933 Ga0207706_10012319 Ga0207706_100123197 653
535 3300025934 Ga0207686_10032639 Ga0207686_100326392 653
536 3300025937 Ga0207669_10004093 Ga0207669_100040933 653
537 3300025937 Ga0207669_10008277 Ga0207669_100082774 653
538 3300025938 Ga0207704_10003419 Ga0207704_100034192 653
539 3300025938 Ga0207704_10005553 Ga0207704_100055534 653
540 3300025940 Ga0207691_10000916 Ga0207691_100009165 653
541 3300025940 Ga0207691_10009043 Ga0207691_100090439 653
542 3300025940 Ga0207691_10036524 Ga0207691_100365244 653
543 3300025941 Ga0207711_10000496 Ga0207711_100004962 653
544 3300025941 Ga0207711_10000536 Ga0207711_100005361 653
545 3300025941 Ga0207711_10001043 Ga0207711_1000104319 653
546 3300025941 Ga0207711_10001268 Ga0207711_100012682 653
547 3300025941 Ga0207711_10007276 Ga0207711_100072766 653
548 3300025941 Ga0207711_10007329 Ga0207711_100073298 653
549 3300025945 Ga0207679_10001267 Ga0207679_1000126710 653
550 3300025945 Ga0207679_10001973 Ga0207679_100019734 653
551 3300025960 Ga0207651_10000221 Ga0207651_1000022126 653
552 3300025960 Ga0207651_10001349 Ga0207651_100013492 653
553 3300025960 Ga0207651_10011589 Ga0207651_100115895 653
554 3300025960 Ga0207651_10049119 Ga0207651_100491192 653
555 3300025961 Ga0207712_10007181 Ga0207712_100071812 653
556 3300025972 Ga0207668_10000107 Ga0207668_1000010751 653
557 3300025986 Ga0207658_10001264 Ga0207658_1000126413 653
558 3300025986 Ga0207658_10001593 Ga0207658_1000159314 653
559 3300025986 Ga0207658_10010410 Ga0207658_100104104 653
560 3300025986 Ga0207658_10060983 Ga0207658_100609832 653
561 3300026023 Ga0207677_10007991 Ga0207677_100079914 653
562 3300026035 Ga0207703_10000959 Ga0207703_1000095924 653
563 3300026067 Ga0207678_10005573 Ga0207678_100055739 653
564 3300026067 Ga0207678_10044003 Ga0207678_100440032 653
565 3300026088 Ga0207641_10000330 Ga0207641_1000033054 653
566 3300026089 Ga0207648_10007924 Ga0207648_100079243 653
567 3300026089 Ga0207648_10009606 Ga0207648_100096069 653
568 3300026089 Ga0207648_10011880 Ga0207648_100118802 653
569 3300026095 Ga0207676_10001166 Ga0207676_1000116619 653
570 3300026095 Ga0207676_10003203 Ga0207676_1000320310 653
571 3300026095 Ga0207676_10006606 Ga0207676_100066062 653
572 3300026095 Ga0207676_10022615 Ga0207676_100226154 653
573 3300026095 Ga0207676_10023726 Ga0207676_100237262 653
574 3300026121 Ga0207683_10000976 Ga0207683_100009767 653
575 3300026121 Ga0207683_10005883 Ga0207683_100058835 653
576 3300026121 Ga0207683_10007844 Ga0207683_100078443 653
577 3300026142 Ga0207698_10020653 Ga0207698_100206532 653
578 3300026142 Ga0207698_10077052 Ga0207698_100770521 653
579 3300026142 Ga0207698_10123336 Ga0207698_101233362 653
580 3300028379 Ga0268266_10013056 Ga0268266_100130565 653
581 3300028379 Ga0268266_10022342 Ga0268266_100223423 653
582 3300028379 Ga0268266_10032790 Ga0268266_100327904 653
583 3300028379 Ga0268266_10079082 Ga0268266_100790822 653
584 3300028380 Ga0268265_10010848 Ga0268265_100108487 653
585 3300028381 Ga0268264_10011110 Ga0268264_100111104 653
586 3300031911 Ga0307412_10000703 Ga0307412_1000070313 653
587 3300037312 Ga0395899_0041943 Ga0395899_0041943_508_2544 653
588 3300037418 Ga0395900_0010212 Ga0395900_0010212_4562_6601 653
589 3300037418 Ga0395900_0063112 Ga0395900_0063112_54_2093 653
590 3300037466 Ga0395898_0034666 Ga0395898_0034666_2531_4570 653
591 3300037471 Ga0395905_0036725 Ga0395905_0036725_1711_3750 653
592 3300037853 Ga0436364_1537163 Ga0436364_1537163_13263_15299 653
593 3300038443 Ga0395901_0004317 Ga0395901_0004317_5551_7590 653
594 3300038443 Ga0395901_0035276 Ga0395901_0035276_1653_3689 653
595 3300038443 Ga0395901_0055272 Ga0395901_0055272_1705_3744 653
596 3300039437 Ga0436365_0864006 Ga0436365_0864006_588_2666 653
597 3300039437 Ga0436365_1094616 Ga0436365_1094616_3271_5352 653
598 3300044694 Ga0466963_0000058 Ga0466963_0000058_10574_12700 653
599 3300044694 Ga0466963_0002624 Ga0466963_0002624_1170_3206 653
600 3300044719 Ga0466971_0006257 Ga0466971_0006257_1462_3498 653
601 3300044842 Ga0466957_0008998 Ga0466957_0008998_297_2423 653
602 3300044842 Ga0466957_0010719 Ga0466957_0010719_1742_3778 653
603 3300045836 Ga0466958_0013964 Ga0466958_0013964_1506_3542 653
604 3300045836 Ga0466958_0025750 Ga0466958_0025750_1343_3436 653
605 3300045976 Ga0466967_0000120 Ga0466967_0000120_7182_9308 653
606 3300045976 Ga0466967_0030838 Ga0466967_0030838_234_2270 653
607 3300046460 Ga0495638_0047155 Ga0495638_0047155_54_2117 653
608 3300046616 Ga0495668_0013380 Ga0495668_0013380_1400_3448 653
609 3300048904 Ga0496101_0004793 Ga0496101_0004793_2095_4131 653
610 3300048909 Ga0496106_0027001 Ga0496106_0027001_100_2136 653
611 3300048910 Ga0496107_0018567 Ga0496107_0018567_2613_4649 653
612 3300048911 Ga0496108_0001386 Ga0496108_0001386_13457_15505 653
613 3300048911 Ga0496108_0005293 Ga0496108_0005293_82_2127 653
614 3300048911 Ga0496108_0023361 Ga0496108_0023361_2141_4177 653
615 3300048912 Ga0496109_0004603 Ga0496109_0004603_8411_10459 653
616 3300048913 Ga0496110_0000687 Ga0496110_0000687_12259_14307 653
617 3300048913 Ga0496110_0003912 Ga0496110_0003912_8538_10574 653
618 3300048914 Ga0496111_0001396 Ga0496111_0001396_3373_5421 653
619 3300048914 Ga0496111_0034920 Ga0496111_0034920_668_2704 653
620 3300048915 Ga0496112_0001740 Ga0496112_0001740_1774_3819 653
621 3300048915 Ga0496112_0030124 Ga0496112_0030124_668_2704 653
622 3300048916 Ga0496113_0001511 Ga0496113_0001511_5614_7662 653
623 3300048916 Ga0496113_0020444 Ga0496113_0020444_281_2317 653
624 3300053134 Ga0500658_0000089 Ga0500658_0000089_32256_34304 653
625 3300061719 Ga0466962_0000637 Ga0466962_0000637_11551_13587 653
626 iso_pu_bacteria 2885429604 2885430797 653
627 3300005367 Ga0070667_100039551 Ga0070667_1000395512 654
628 3300005564 Ga0070664_100021951 Ga0070664_1000219512 654
629 3300005564 Ga0070664_100089051 Ga0070664_1000890512 654
630 3300005577 Ga0068857_100132286 Ga0068857_1001322861 654
631 3300005617 Ga0068859_100003879 Ga0068859_1000038794 654
632 3300005842 Ga0068858_100011831 Ga0068858_1000118312 654
633 3300006931 Ga0097620_100003878 Ga0097620_1000038784 654
634 3300025945 Ga0207679_10065430 Ga0207679_100654302 654
635 3300025972 Ga0207668_10034702 Ga0207668_100347023 654
636 3300025986 Ga0207658_10004102 Ga0207658_100041022 654
637 3300026116 Ga0207674_10000804 Ga0207674_1000080430 654
638 3300031548 Ga0307408_100014001 Ga0307408_1000140014 654
639 3300031731 Ga0307405_10020265 Ga0307405_100202652 654
640 3300031824 Ga0307413_10010484 Ga0307413_100104843 654
641 3300032002 Ga0307416_100054387 Ga0307416_1000543872 654
642 3300032004 Ga0307414_10029136 Ga0307414_100291362 654
643 3300044683 Ga0466965_0029240 Ga0466965_0029240_602_2644 654
644 3300046684 Ga0495669_0004376 Ga0495669_0004376_1334_3388 654
645 3300048911 Ga0496108_0000855 Ga0496108_0000855_7387_9438 654
646 3300048917 Ga0496114_0004181 Ga0496114_0004181_1690_3756 654
647 3300002075 JGI24738J21930_10005720 JGI24738J21930_100057202 655
648 3300005295 Ga0065707_10081805 Ga0065707_100818054 655
649 3300005578 Ga0068854_100006627 Ga0068854_1000066273 655
650 3300005937 Ga0081455_10000131 Ga0081455_1000013123 655
651 3300005985 Ga0081539_10013568 Ga0081539_100135683 655
652 3300006358 Ga0068871_100058406 Ga0068871_1000584063 655
653 3300013297 Ga0157378_10061929 Ga0157378_100619292 655
654 3300014326 Ga0157380_10000606 Ga0157380_100006064 655
655 3300026041 Ga0207639_10003651 Ga0207639_1000365110 655
656 3300026041 Ga0207639_10019178 Ga0207639_100191783 655
657 3300037312 Ga0395899_0000104 Ga0395899_0000104_64946_66988 655
658 3300037312 Ga0395899_0000981 Ga0395899_0000981_9732_11774 655
659 3300037418 Ga0395900_0000739 Ga0395900_0000739_34353_36395 655
660 3300037418 Ga0395900_0021530 Ga0395900_0021530_2024_4072 655
661 3300037466 Ga0395898_0000169 Ga0395898_0000169_77882_79924 655
662 3300037466 Ga0395898_0004616 Ga0395898_0004616_11500_13542 655
663 3300037471 Ga0395905_0000109 Ga0395905_0000109_128865_130907 655
664 3300038443 Ga0395901_0002515 Ga0395901_0002515_9246_11288 655
665 3300038443 Ga0395901_0004270 Ga0395901_0004270_7107_9155 655
666 3300038443 Ga0395901_0011441 Ga0395901_0011441_6555_8597 655
667 3300038443 Ga0395901_0015967 Ga0395901_0015967_1589_3637 655
668 3300038443 Ga0395901_0052789 Ga0395901_0052789_845_2893 655
669 3300044656 Ga0466969_0009497 Ga0466969_0009497_797_2887 655
670 3300046530 Ga0495654_0003952 Ga0495654_0003952_2103_4208 655
671 3300046616 Ga0495668_0002700 Ga0495668_0002700_349_2454 655
672 3300048915 Ga0496112_0006910 Ga0496112_0006910_4208_6250 655
673 3300048916 Ga0496113_0003152 Ga0496113_0003152_7504_9546 655
674 3300053158 Ga0500627_0000431 Ga0500627_0000431_6567_8672 655
675 3300001904 JGI24736J21556_1000256 JGI24736J21556_10002566 656
676 3300002070 JGI24750J21931_1000036 JGI24750J21931_10000364 656
677 3300002074 JGI24748J21848_1000103 JGI24748J21848_10001034 656
678 3300002239 JGI24034J26672_10000057 JGI24034J26672_1000005744 656
679 3300005330 Ga0070690_100000011 Ga0070690_10000001199 656
680 3300005331 Ga0070670_100004382 Ga0070670_1000043823 656
681 3300005335 Ga0070666_10000035 Ga0070666_10000035123 656
682 3300005340 Ga0070689_100002742 Ga0070689_1000027428 656
683 3300005353 Ga0070669_100000712 Ga0070669_1000007124 656
684 3300005365 Ga0070688_100001328 Ga0070688_1000013284 656
685 3300005367 Ga0070667_100006081 Ga0070667_1000060814 656
686 3300005466 Ga0070685_10000168 Ga0070685_100001684 656
687 3300005544 Ga0070686_100001324 Ga0070686_10000132410 656
688 3300005544 Ga0070686_100002367 Ga0070686_1000023679 656
689 3300005548 Ga0070665_100000161 Ga0070665_1000001614 656
690 3300005617 Ga0068859_100031227 Ga0068859_1000312272 656
691 3300005618 Ga0068864_100003263 Ga0068864_1000032633 656
692 3300005618 Ga0068864_100013163 Ga0068864_1000131632 656
693 3300005719 Ga0068861_100010184 Ga0068861_1000101842 656
694 3300005841 Ga0068863_100000060 Ga0068863_1000000604 656
695 3300005841 Ga0068863_100002364 Ga0068863_1000023649 656
696 3300005841 Ga0068863_100008777 Ga0068863_1000087772 656
697 3300005841 Ga0068863_100013028 Ga0068863_1000130287 656
698 3300005842 Ga0068858_100009909 Ga0068858_1000099094 656
699 3300005843 Ga0068860_100000126 Ga0068860_1000001264 656
700 3300005844 Ga0068862_100001438 Ga0068862_1000014387 656
701 3300005844 Ga0068862_100029048 Ga0068862_1000290483 656
702 3300006931 Ga0097620_100031225 Ga0097620_1000312252 656
703 3300009101 Ga0105247_10000821 Ga0105247_1000082111 656
704 3300009553 Ga0105249_10000094 Ga0105249_10000094125 656
705 3300009553 Ga0105249_10000290 Ga0105249_100002902 656
706 3300013100 Ga0157373_10022411 Ga0157373_100224112 656
707 3300013104 Ga0157370_10032699 Ga0157370_100326993 656
708 3300013105 Ga0157369_10032910 Ga0157369_100329103 656
709 3300013306 Ga0163162_10066959 Ga0163162_100669592 656
710 3300014326 Ga0157380_10005506 Ga0157380_100055064 656
711 3300014968 Ga0157379_10004525 Ga0157379_100045254 656
712 3300017792 Ga0163161_10000716 Ga0163161_100007162 656
713 3300020070 Ga0206356_11044689 Ga0206356_110446895 656
714 3300021384 Ga0213876_10000801 Ga0213876_100008016 656
715 3300025223 Ga0207672_1000288 Ga0207672_10002884 656
716 3300025903 Ga0207680_10000007 Ga0207680_10000007401 656
717 3300025904 Ga0207647_10004623 Ga0207647_100046235 656
718 3300025913 Ga0207695_10020530 Ga0207695_100205304 656
719 3300025914 Ga0207671_10011491 Ga0207671_100114912 656
720 3300025919 Ga0207657_10011633 Ga0207657_100116337 656
721 3300025923 Ga0207681_10000089 Ga0207681_100000898 656
722 3300025924 Ga0207694_10005621 Ga0207694_100056212 656
723 3300025931 Ga0207644_10003216 Ga0207644_100032164 656
724 3300025933 Ga0207706_10045540 Ga0207706_100455402 656
725 3300025936 Ga0207670_10006073 Ga0207670_100060732 656
726 3300025941 Ga0207711_10018596 Ga0207711_100185962 656
727 3300025949 Ga0207667_10008229 Ga0207667_100082298 656
728 3300025961 Ga0207712_10000004 Ga0207712_10000004389 656
729 3300025961 Ga0207712_10000057 Ga0207712_100000572 656
730 3300025986 Ga0207658_10002894 Ga0207658_100028944 656
731 3300026067 Ga0207678_10027516 Ga0207678_100275163 656
732 3300026078 Ga0207702_10011171 Ga0207702_100111713 656
733 3300026088 Ga0207641_10000100 Ga0207641_10000100120 656
734 3300026088 Ga0207641_10000179 Ga0207641_100001799 656
735 3300026088 Ga0207641_10003331 Ga0207641_100033318 656
736 3300026088 Ga0207641_10025100 Ga0207641_100251003 656
737 3300026095 Ga0207676_10002760 Ga0207676_100027608 656
738 3300026095 Ga0207676_10003119 Ga0207676_100031194 656
739 3300026118 Ga0207675_100003757 Ga0207675_1000037574 656
740 3300028379 Ga0268266_10000040 Ga0268266_10000040313 656
741 3300028380 Ga0268265_10001244 Ga0268265_100012447 656
742 3300028380 Ga0268265_10002795 Ga0268265_100027956 656
743 3300028381 Ga0268264_10000003 Ga0268264_10000003403 656
744 3300028381 Ga0268264_10009091 Ga0268264_100090912 656
745 3300039437 Ga0436365_1189040 Ga0436365_1189040_22165_24279 656
746 3300046692 Ga0495671_0026804 Ga0495671_0026804_665_2785 656
747 3300048906 Ga0496103_0001160 Ga0496103_0001160_1402_3510 656
748 3300048908 Ga0496105_0037501 Ga0496105_0037501_583_2691 656
749 3300048924 Ga0496121_0022174 Ga0496121_0022174_480_2549 656
750 3300048924 Ga0496121_0055194 Ga0496121_0055194_751_2859 656
751 3300053087 Ga0500643_001124 Ga0500643_001124_3125_5233 656
752 3300053087 Ga0500643_001316 Ga0500643_001316_5935_8043 656
753 iso_pu_bacteria 2946787523 2946790850 656
754 3300005327 Ga0070658_10000002 Ga0070658_10000002402 657
755 3300005841 Ga0068863_100000040 Ga0068863_100000040136 657
756 3300025909 Ga0207705_10000008 Ga0207705_10000008390 657
757 3300025919 Ga0207657_10000259 Ga0207657_1000025925 657
758 3300025931 Ga0207644_10000595 Ga0207644_100005951 657
759 3300025972 Ga0207668_10000213 Ga0207668_1000021318 657
760 3300026088 Ga0207641_10000039 Ga0207641_1000003954 657
761 3300031595 Ga0265313_10000913 Ga0265313_100009135 657
762 3300039437 Ga0436365_1331544 Ga0436365_1331544_7768_9870 657
763 3300046691 Ga0495670_0021593 Ga0495670_0021593_157_2235 657
764 3300049523 Ga0501300_000102 Ga0501300_000102_7076_9199 657
765 3300049663 Ga0501223_000362 Ga0501223_000362_251_2374 657
766 3300049776 Ga0501280_000036 Ga0501280_000036_9824_11947 657
767 3300049777 Ga0501281_00067 Ga0501281_00067_9863_11986 657
768 iso_pu_bacteria 8057101203 8057104360 657
769 3300005355 Ga0070671_100000050 Ga0070671_10000005018 658
770 3300005618 Ga0068864_100000124 Ga0068864_1000001241 658
771 3300013105 Ga0157369_10012825 Ga0157369_100128257 658
772 3300033180 Ga0307510_10005453 Ga0307510_100054537 658
773 3300046506 Ga0495583_0005233 Ga0495583_0005233_50_2185 658
774 3300049579 Ga0501043_0019880 Ga0501043_0019880_595_2721 658
775 3300053156 Ga0500622_0002918 Ga0500622_0002918_876_2993 658
776 iso_pu_bacteria 2830075706 2830077423 658
777 3300003214 JGI25165J46597_1000024 JGI25165J46597_100002483 659
778 3300005336 Ga0070680_100000404 Ga0070680_10000040427 659
779 3300005530 Ga0070679_100000001 Ga0070679_100000001714 659
780 3300005548 Ga0070665_100000024 Ga0070665_100000024358 659
781 3300005617 Ga0068859_100016161 Ga0068859_1000161612 659
782 3300005842 Ga0068858_100000743 Ga0068858_1000007436 659
783 3300005842 Ga0068858_100000773 Ga0068858_10000077333 659
784 3300006931 Ga0097620_100016161 Ga0097620_1000161617 659
785 3300009098 Ga0105245_10002741 Ga0105245_1000274111 659
786 3300009148 Ga0105243_10013677 Ga0105243_100136772 659
787 3300009177 Ga0105248_10002150 Ga0105248_1000215011 659
788 3300009177 Ga0105248_10025299 Ga0105248_100252992 659
789 3300009551 Ga0105238_10056169 Ga0105238_100561691 659
790 3300014968 Ga0157379_10062644 Ga0157379_100626442 659
791 3300025261 Ga0209233_1000084 Ga0209233_1000084227 659
792 3300025917 Ga0207660_10000021 Ga0207660_1000002161 659
793 3300025921 Ga0207652_10000003 Ga0207652_10000003310 659
794 3300025924 Ga0207694_10005329 Ga0207694_100053294 659
795 3300025927 Ga0207687_10005530 Ga0207687_100055305 659
796 3300025941 Ga0207711_10042308 Ga0207711_100423082 659
797 3300025941 Ga0207711_10049552 Ga0207711_100495523 659
798 3300026035 Ga0207703_10000187 Ga0207703_1000018713 659
799 3300026035 Ga0207703_10001317 Ga0207703_100013172 659
800 3300028379 Ga0268266_10000019 Ga0268266_1000001910 659
801 3300031616 Ga0307508_10003117 Ga0307508_100031172 659
802 3300046513 Ga0495616_0001129 Ga0495616_0001129_198_2297 659
803 3300048911 Ga0496108_0007524 Ga0496108_0007524_5322_7439 659
804 3300048918 Ga0496115_0037846 Ga0496115_0037846_1555_3648 659
805 3300048920 Ga0496117_0009745 Ga0496117_0009745_4952_7078 659
806 3300048924 Ga0496121_0006468 Ga0496121_0006468_7113_9230 659
807 3300048928 Ga0496125_0039282 Ga0496125_0039282_1758_3875 659
808 3300048929 Ga0496126_0003880 Ga0496126_0003880_8492_10609 659
809 3300053139 Ga0500568_0002517 Ga0500568_0002517_824_2929 659
810 3300053151 Ga0500604_0000065 Ga0500604_0000065_20485_22563 659
811 3300053153 Ga0500616_0000265 Ga0500616_0000265_10922_13033 659
812 iso_pu_bacteria 2928027323 2928030419 659
813 iso_pu_bacteria 2984555340 2984557345 659
814 iso_pu_bacteria 2984564862 2984568257 659
815 iso_pu_bacteria 2993356040 2993359338 659
816 3300048926 Ga0496123_0001272 Ga0496123_0001272_18081_20204 660
817 iso_pu_bacteria 2599185354 2600204018 660
818 iso_pu_bacteria 2751185897 2753766978 660
819 iso_pu_bacteria 2848297114 2848297231 660
820 iso_pu_bacteria 2895880812 2895886080 660
821 3300005331 Ga0070670_100000195 Ga0070670_10000019547 661
822 3300005367 Ga0070667_100000166 Ga0070667_10000016677 661
823 3300005367 Ga0070667_100001362 Ga0070667_1000013624 661
824 3300005618 Ga0068864_100000189 Ga0068864_10000018947 661
825 3300005719 Ga0068861_100000004 Ga0068861_10000000433 661
826 3300005841 Ga0068863_100000073 Ga0068863_10000007312 661
827 3300005843 Ga0068860_100000245 Ga0068860_10000024577 661
828 3300005844 Ga0068862_100000233 Ga0068862_10000023313 661
829 3300005844 Ga0068862_100009511 Ga0068862_1000095116 661
830 3300009011 Ga0105251_10000468 Ga0105251_1000046839 661
831 3300009101 Ga0105247_10003393 Ga0105247_100033934 661
832 3300009177 Ga0105248_10000026 Ga0105248_10000026240 661
833 3300009553 Ga0105249_10000614 Ga0105249_100006143 661
834 3300013306 Ga0163162_10088804 Ga0163162_100888042 661
835 3300025735 Ga0207713_1006269 Ga0207713_10062692 661
836 3300025914 Ga0207671_10011941 Ga0207671_100119414 661
837 3300025925 Ga0207650_10000243 Ga0207650_1000024313 661
838 3300025941 Ga0207711_10000004 Ga0207711_10000004255 661
839 3300025961 Ga0207712_10008189 Ga0207712_100081893 661
840 3300025986 Ga0207658_10000128 Ga0207658_1000012874 661
841 3300025986 Ga0207658_10000430 Ga0207658_100004307 661
842 3300026088 Ga0207641_10000018 Ga0207641_10000018102 661
843 3300026088 Ga0207641_10002672 Ga0207641_100026725 661
844 3300026095 Ga0207676_10000027 Ga0207676_1000002747 661
845 3300026118 Ga0207675_100000032 Ga0207675_10000003251 661
846 3300028380 Ga0268265_10000097 Ga0268265_1000009712 661
847 3300028381 Ga0268264_10000296 Ga0268264_1000029674 661
848 3300031911 Ga0307412_10032778 Ga0307412_100327782 661
849 3300046460 Ga0495638_0002615 Ga0495638_0002615_1924_4020 661
850 3300046501 Ga0495607_0008063 Ga0495607_0008063_1168_3294 661
851 3300046660 Ga0495625_0000107 Ga0495625_0000107_52482_54590 661
852 3300047472 Ga0495686_0020109 Ga0495686_0020109_1897_3993 661
853 3300048905 Ga0496102_0000034 Ga0496102_0000034_3223_5361 661
854 3300048906 Ga0496103_0000026 Ga0496103_0000026_3223_5361 661
855 3300048919 Ga0496116_0001510 Ga0496116_0001510_22397_24535 661
856 3300048920 Ga0496117_0000072 Ga0496117_0000072_27763_29901 661
857 3300048920 Ga0496117_0006156 Ga0496117_0006156_8678_10798 661
858 3300048921 Ga0496118_0000030 Ga0496118_0000030_208466_210604 661
859 3300048921 Ga0496118_0001906 Ga0496118_0001906_10782_12902 661
860 3300048924 Ga0496121_0005712 Ga0496121_0005712_4299_6401 661
861 3300048927 Ga0496124_0000061 Ga0496124_0000061_208466_210604 661
862 3300048927 Ga0496124_0014901 Ga0496124_0014901_2170_4389 661
863 3300048929 Ga0496126_0007282 Ga0496126_0007282_3908_6010 661
864 3300053134 Ga0500658_0003097 Ga0500658_0003097_2372_4468 661
865 3300053153 Ga0500616_0012693 Ga0500616_0012693_2479_4587 661
866 3300053730 Ga0500645_000542 Ga0500645_000542_10708_12834 661
867 iso_pu_bacteria 2512564014 2512642864 661
868 iso_pu_bacteria 2775507255 2778123924 661
869 iso_pu_bacteria 2852653556 2852654115 661
870 iso_pu_bacteria 2852680915 2852682558 661
871 iso_pu_bacteria 2896184354 2896185055 661
872 iso_pu_bacteria 2919709256 2919711735 661
873 3300009177 Ga0105248_10049695 Ga0105248_100496954 662
874 3300025941 Ga0207711_10032928 Ga0207711_100329283 662
875 3300025972 Ga0207668_10077594 Ga0207668_100775941 662
876 3300046491 Ga0495584_0015913 Ga0495584_0015913_1491_3599 662
877 3300046506 Ga0495583_0000023 Ga0495583_0000023_63034_65172 662
878 3300046507 Ga0495606_0058981 Ga0495606_0058981_188_2332 662
879 3300046520 Ga0495637_0002424 Ga0495637_0002424_2790_4898 662
880 3300046522 Ga0495643_0000146 Ga0495643_0000146_100434_102542 662
881 3300046648 Ga0495611_0016872 Ga0495611_0016872_403_2577 662
882 3300046665 Ga0495661_0032523 Ga0495661_0032523_386_2524 662
883 3300046692 Ga0495671_0000499 Ga0495671_0000499_16142_18250 662
884 3300047470 Ga0495681_0007638 Ga0495681_0007638_729_2837 662
885 3300047472 Ga0495686_0000383 Ga0495686_0000383_28076_30250 662
886 3300047472 Ga0495686_0000602 Ga0495686_0000602_29519_31594 662
887 3300048923 Ga0496120_0020348 Ga0496120_0020348_1419_3557 662
888 3300053103 Ga0500555_000537 Ga0500555_000537_9653_11827 662
889 iso_pu_bacteria 2582581305 2585262670 662
890 3300003773 Ga0055537_1000506 Ga0055537_100050617 663
891 3300003775 Ga0055524_1000172 Ga0055524_100017244 663
892 3300003791 Ga0055530_10000510 Ga0055530_1000051016 663
893 3300003794 Ga0055531_10000319 Ga0055531_1000031928 663
894 3300003794 Ga0055531_10005767 Ga0055531_100057672 663
895 3300005262 Ga0065165_1007352 Ga0065165_10073525 663
896 3300005617 Ga0068859_100055433 Ga0068859_1000554332 663
897 3300006931 Ga0097620_100055434 Ga0097620_1000554342 663
898 3300015690 Ga0183363_1001 Ga0183363_1001256 663
899 3300025245 Ga0207425_1002477 Ga0207425_10024773 663
900 3300025263 Ga0209565_1000007 Ga0209565_1000007424 663
901 3300025273 Ga0209673_1006204 Ga0209673_10062042 663
902 3300025291 Ga0209675_1009064 Ga0209675_10090642 663
903 3300025297 Ga0209758_1017116 Ga0209758_10171162 663
904 3300025298 Ga0209050_1000010 Ga0209050_1000010745 663
905 3300025298 Ga0209050_1006894 Ga0209050_10068942 663
906 3300025299 Ga0209256_1000008 Ga0209256_1000008266 663
907 3300025304 Ga0209257_1000027 Ga0209257_1000027387 663
908 3300025304 Ga0209257_1003958 Ga0209257_10039582 663
909 3300037853 Ga0436364_1058201 Ga0436364_1058201_6905_9013 663
910 3300041413 Ga0439465_0001605 Ga0439465_0001605_1559_3691 663
911 3300042004 Ga0439445_0008830 Ga0439445_0008830_27_2159 663
912 3300042015 Ga0439462_0007111 Ga0439462_0007111_389_2521 663
913 3300042435 Ga0439434_0004195 Ga0439434_0004195_617_2749 663
914 3300047470 Ga0495681_0034802 Ga0495681_0034802_216_2348 663
915 3300047472 Ga0495686_0001053 Ga0495686_0001053_21051_23165 663
916 3300053087 Ga0500643_005553 Ga0500643_005553_70_2202 663
917 3300053119 Ga0500595_000943 Ga0500595_000943_10383_12518 663
918 3300053125 Ga0500618_001300 Ga0500618_001300_3503_5641 663
919 3300053133 Ga0500655_000017 Ga0500655_000017_920_3058 663
920 3300053134 Ga0500658_0005056 Ga0500658_0005056_131_2263 663
921 3300053142 Ga0500577_0003494 Ga0500577_0003494_217_2355 663
922 3300053148 Ga0500590_000082 Ga0500590_000082_7973_10111 663
923 3300053724 Ga0500570_000324 Ga0500570_000324_6067_8205 663
924 iso_pu_bacteria 2643221560 2643820682 663
925 iso_pu_bacteria 2990265787 2990267045 663
926 iso_pu_bacteria 2993693658 2993693994 663
927 3300001915 JGI24741J21665_1001719 JGI24741J21665_10017192 664
928 3300001979 JGI24740J21852_10002498 JGI24740J21852_100024984 664
929 3300003215 JGI25153J46596_10000083 JGI25153J46596_1000008353 664
930 3300003759 Ga0055525_1000037 Ga0055525_1000037101 664
931 3300003762 Ga0055542_1000286 Ga0055542_100028645 664
932 3300003763 Ga0055529_1000207 Ga0055529_100020745 664
933 3300005262 Ga0065165_1002380 Ga0065165_100238012 664
934 3300005327 Ga0070658_10000711 Ga0070658_1000071119 664
935 3300005347 Ga0070668_100001440 Ga0070668_1000014403 664
936 3300005353 Ga0070669_100010019 Ga0070669_1000100194 664
937 3300005356 Ga0070674_100001269 Ga0070674_1000012693 664
938 3300005367 Ga0070667_100000130 Ga0070667_10000013055 664
939 3300005456 Ga0070678_100000152 Ga0070678_1000001526 664
940 3300005548 Ga0070665_100000599 Ga0070665_10000059936 664
941 3300005841 Ga0068863_100000029 Ga0068863_100000029124 664
942 3300009148 Ga0105243_10000278 Ga0105243_1000027822 664
943 3300013102 Ga0157371_10000285 Ga0157371_1000028514 664
944 3300025230 Ga0209563_100105 Ga0209563_10010536 664
945 3300025254 Ga0209148_1000011 Ga0209148_10000111147 664
946 3300025272 Ga0209455_1000006 Ga0209455_100000645 664
947 3300025297 Ga0209758_1000023 Ga0209758_1000023544 664
948 3300025904 Ga0207647_10008471 Ga0207647_100084714 664
949 3300025909 Ga0207705_10000410 Ga0207705_1000041022 664
950 3300025913 Ga0207695_10022589 Ga0207695_100225897 664
951 3300025914 Ga0207671_10006263 Ga0207671_100062634 664
952 3300025919 Ga0207657_10052126 Ga0207657_100521262 664
953 3300025920 Ga0207649_10008642 Ga0207649_100086422 664
954 3300025923 Ga0207681_10020484 Ga0207681_100204844 664
955 3300025935 Ga0207709_10000039 Ga0207709_1000003944 664
956 3300025937 Ga0207669_10000171 Ga0207669_1000017121 664
957 3300025937 Ga0207669_10001692 Ga0207669_100016925 664
958 3300025949 Ga0207667_10000006 Ga0207667_10000006506 664
959 3300025972 Ga0207668_10002392 Ga0207668_100023927 664
960 3300025972 Ga0207668_10006561 Ga0207668_100065615 664
961 3300025986 Ga0207658_10000100 Ga0207658_1000010040 664
962 3300026041 Ga0207639_10000843 Ga0207639_100008435 664
963 3300026088 Ga0207641_10000049 Ga0207641_10000049124 664
964 3300026121 Ga0207683_10004155 Ga0207683_100041555 664
965 3300026142 Ga0207698_10007111 Ga0207698_100071111 664
966 3300028379 Ga0268266_10000015 Ga0268266_1000001538 664
967 3300032004 Ga0307414_10001169 Ga0307414_1000116911 664
968 3300037312 Ga0395899_0047860 Ga0395899_0047860_777_2912 664
969 3300046460 Ga0495638_0000016 Ga0495638_0000016_99323_101461 664
970 3300046471 Ga0495650_0000290 Ga0495650_0000290_26605_28776 664
971 3300046471 Ga0495650_0006220 Ga0495650_0006220_3452_5584 664
972 3300046506 Ga0495583_0000198 Ga0495583_0000198_94051_96189 664
973 3300046506 Ga0495583_0001065 Ga0495583_0001065_3329_5476 664
974 3300046506 Ga0495583_0010578 Ga0495583_0010578_2998_5136 664
975 3300046506 Ga0495583_0021278 Ga0495583_0021278_1178_3313 664
976 3300046507 Ga0495606_0001051 Ga0495606_0001051_33358_35499 664
977 3300046507 Ga0495606_0001392 Ga0495606_0001392_29026_31161 664
978 3300046518 Ga0495631_0005510 Ga0495631_0005510_2852_4990 664
979 3300046518 Ga0495631_0008854 Ga0495631_0008854_189_2324 664
980 3300046519 Ga0495632_0002580 Ga0495632_0002580_5322_7460 664
981 3300046522 Ga0495643_0001713 Ga0495643_0001713_6110_8245 664
982 3300046522 Ga0495643_0002608 Ga0495643_0002608_3943_6078 664
983 3300046522 Ga0495643_0009496 Ga0495643_0009496_3010_5145 664
984 3300046524 Ga0495648_0000101 Ga0495648_0000101_99069_101207 664
985 3300046524 Ga0495648_0000189 Ga0495648_0000189_2925_5081 664
986 3300046524 Ga0495648_0035478 Ga0495648_0035478_628_2763 664
987 3300046558 Ga0495633_0000623 Ga0495633_0000623_30259_32397 664
988 3300046616 Ga0495668_0000181 Ga0495668_0000181_7577_9712 664
989 3300046616 Ga0495668_0003387 Ga0495668_0003387_9689_11833 664
990 3300046684 Ga0495669_0000848 Ga0495669_0000848_9867_12002 664
991 3300046692 Ga0495671_0000063 Ga0495671_0000063_5137_7275 664
992 3300047323 Ga0495683_0001719 Ga0495683_0001719_11234_13369 664
993 3300047443 Ga0495687_000109 Ga0495687_000109_71456_73591 664
994 3300047443 Ga0495687_000228 Ga0495687_000228_42784_44919 664
995 3300047445 Ga0495677_0002185 Ga0495677_0002185_5134_7269 664
996 3300047469 Ga0495673_0000170 Ga0495673_0000170_5227_7365 664
997 3300048924 Ga0496121_0000031 Ga0496121_0000031_239465_241627 664
998 3300053079 Ga0500610_0003499 Ga0500610_0003499_858_2993 664
999 3300053096 Ga0500641_0001393 Ga0500641_0001393_6315_8450 664
1000 3300053119 Ga0500595_001579 Ga0500595_001579_6742_8913 664
1001 3300053130 Ga0500642_0001128 Ga0500642_0001128_2700_4835 664
1002 3300053153 Ga0500616_0007393 Ga0500616_0007393_4086_6218 664
1003 3300053157 Ga0500624_000063 Ga0500624_000063_55427_57559 664
1004 3300053177 Ga0500636_0012215 Ga0500636_0012215_492_2627 664
1005 3300053730 Ga0500645_000001 Ga0500645_000001_379593_381728 664
1006 3300053735 Ga0500596_000599 Ga0500596_000599_1764_3899 664
1007 3300005530 Ga0070679_100050447 Ga0070679_1000504472 665
1008 3300005577 Ga0068857_100068882 Ga0068857_1000688822 665
1009 3300005578 Ga0068854_100013076 Ga0068854_1000130763 665
1010 3300006178 Ga0075367_10000114 Ga0075367_100001145 665
1011 3300025229 Ga0209147_101423 Ga0209147_1014234 665
1012 3300025321 Ga0207656_10009665 Ga0207656_100096652 665
1013 3300025919 Ga0207657_10023306 Ga0207657_100233063 665
1014 3300025921 Ga0207652_10002493 Ga0207652_100024936 665
1015 3300025933 Ga0207706_10057043 Ga0207706_100570431 665
1016 3300026067 Ga0207678_10000753 Ga0207678_1000075324 665
1017 3300026078 Ga0207702_10020845 Ga0207702_100208452 665
1018 3300026116 Ga0207674_10088702 Ga0207674_100887022 665
1019 3300027866 Ga0209813_10000134 Ga0209813_100001349 665
1020 3300031548 Ga0307408_100001363 Ga0307408_10000136310 665
1021 3300031852 Ga0307410_10004875 Ga0307410_100048753 665
1022 3300031911 Ga0307412_10011796 Ga0307412_100117963 665
1023 3300032005 Ga0307411_10056302 Ga0307411_100563022 665
1024 3300046452 Ga0495617_010845 Ga0495617_010845_570_2687 665
1025 3300046453 Ga0495627_000089 Ga0495627_000089_5425_7542 665
1026 3300046453 Ga0495627_001449 Ga0495627_001449_5202_7319 665
1027 3300046492 Ga0495585_0002673 Ga0495585_0002673_3985_6129 665
1028 3300046500 Ga0495596_0010869 Ga0495596_0010869_22_2166 665
1029 3300046512 Ga0495610_0000186 Ga0495610_0000186_22010_24127 665
1030 3300046519 Ga0495632_0000039 Ga0495632_0000039_132072_134189 665
1031 3300046525 Ga0495663_0000006 Ga0495663_0000006_132155_134272 665
1032 3300046558 Ga0495633_0000192 Ga0495633_0000192_37274_39391 665
1033 3300046558 Ga0495633_0000748 Ga0495633_0000748_16230_18347 665
1034 3300046616 Ga0495668_0000002 Ga0495668_0000002_733958_736117 665
1035 3300046660 Ga0495625_0000915 Ga0495625_0000915_9711_11855 665
1036 3300047470 Ga0495681_0000103 Ga0495681_0000103_55941_58058 665
1037 3300047472 Ga0495686_0001048 Ga0495686_0001048_14703_16847 665
1038 3300048906 Ga0496103_0000089 Ga0496103_0000089_48664_50889 665
1039 3300048907 Ga0496104_0003450 Ga0496104_0003450_4231_6456 665
1040 3300048908 Ga0496105_0000574 Ga0496105_0000574_4465_6690 665
1041 3300048913 Ga0496110_0003393 Ga0496110_0003393_9044_11269 665
1042 3300048913 Ga0496110_0116794 Ga0496110_0116794_65_2200 665
1043 3300048914 Ga0496111_0001045 Ga0496111_0001045_10617_12842 665
1044 3300048917 Ga0496114_0008998 Ga0496114_0008998_4788_7013 665
1045 3300048918 Ga0496115_0000147 Ga0496115_0000147_53368_55593 665
1046 3300048919 Ga0496116_0011857 Ga0496116_0011857_3966_6191 665
1047 3300048919 Ga0496116_0022366 Ga0496116_0022366_481_2598 665
1048 3300048920 Ga0496117_0000329 Ga0496117_0000329_46480_48705 665
1049 3300048921 Ga0496118_0000164 Ga0496118_0000164_83666_85891 665
1050 3300048924 Ga0496121_0000232 Ga0496121_0000232_33518_35743 665
1051 3300048924 Ga0496121_0013939 Ga0496121_0013939_14_2149 665
1052 3300048925 Ga0496122_0058720 Ga0496122_0058720_167_2302 665
1053 3300048925 Ga0496122_0066526 Ga0496122_0066526_55_2190 665
1054 3300048927 Ga0496124_0000041 Ga0496124_0000041_255415_257640 665
1055 3300048927 Ga0496124_0007213 Ga0496124_0007213_203_2338 665
1056 3300048929 Ga0496126_0000324 Ga0496126_0000324_46330_48555 665
1057 3300048929 Ga0496126_0023932 Ga0496126_0023932_774_2909 665
1058 3300049663 Ga0501223_000022 Ga0501223_000022_4365_6500 665
1059 3300049705 Ga0501225_0003753 Ga0501225_0003753_2066_4201 665
1060 3300049823 Ga0501044_0001099 Ga0501044_0001099_14168_16225 665
1061 3300050494 nmdc:mga06z11_179_c1 nmdc:mga06z11_179_c1_6068_8179 665
1062 3300050495 nmdc:mga04h51_315_c1 nmdc:mga04h51_315_c1_7889_10000 665
1063 3300053158 Ga0500627_0000017 Ga0500627_0000017_25169_27313 665
1064 3300055283 Ga0500661_000802 Ga0500661_000802_1333_3492 665
1065 iso_pu_bacteria 2643221588 2643949053 665
1066 iso_pu_bacteria 2808606401 2809062834 665
1067 iso_pu_bacteria 2808606404 2809078798 665
1068 iso_pu_bacteria 2808606405 2809085858 665
1069 iso_pu_bacteria 2880518877 2880520113 665
1070 iso_pu_bacteria 2896253425 2896255437 665
1071 3300005335 Ga0070666_10000182 Ga0070666_1000018217 666
1072 3300005353 Ga0070669_100000001 Ga0070669_100000001513 666
1073 3300005355 Ga0070671_100000002 Ga0070671_100000002103 666
1074 3300005539 Ga0068853_100001065 Ga0068853_10000106519 666
1075 3300005617 Ga0068859_100000571 Ga0068859_10000057126 666
1076 3300005618 Ga0068864_100004727 Ga0068864_1000047276 666
1077 3300005841 Ga0068863_100009586 Ga0068863_1000095868 666
1078 3300005842 Ga0068858_100003312 Ga0068858_10000331213 666
1079 3300005843 Ga0068860_100039444 Ga0068860_1000394443 666
1080 3300005844 Ga0068862_100001481 Ga0068862_1000014813 666
1081 3300006048 Ga0075363_100003270 Ga0075363_1000032705 666
1082 3300006177 Ga0075362_10000021 Ga0075362_1000002124 666
1083 3300006186 Ga0075369_10000463 Ga0075369_100004636 666
1084 3300006195 Ga0075366_10000127 Ga0075366_100001276 666
1085 3300006931 Ga0097620_100000571 Ga0097620_10000057126 666
1086 3300014325 Ga0163163_10020623 Ga0163163_100206235 666
1087 3300025315 Ga0207697_10000757 Ga0207697_100007574 666
1088 3300025900 Ga0207710_10001291 Ga0207710_100012915 666
1089 3300025903 Ga0207680_10000033 Ga0207680_1000003376 666
1090 3300025923 Ga0207681_10000002 Ga0207681_10000002490 666
1091 3300025931 Ga0207644_10000002 Ga0207644_10000002495 666
1092 3300025972 Ga0207668_10000641 Ga0207668_1000064113 666
1093 3300025986 Ga0207658_10025506 Ga0207658_100255062 666
1094 3300026035 Ga0207703_10005067 Ga0207703_100050674 666
1095 3300026041 Ga0207639_10000449 Ga0207639_1000044928 666
1096 3300026095 Ga0207676_10000922 Ga0207676_1000092221 666
1097 3300026118 Ga0207675_100004821 Ga0207675_10000482111 666
1098 3300028379 Ga0268266_10049864 Ga0268266_100498642 666
1099 3300028380 Ga0268265_10000116 Ga0268265_1000011657 666
1100 3300028381 Ga0268264_10000116 Ga0268264_10000116106 666
1101 3300050489 nmdc:mga03683_69_c1 nmdc:mga03683_69_c1_17462_19636 666
1102 3300050490 nmdc:mga03n38_2996_c1 nmdc:mga03n38_2996_c1_2430_4604 666
1103 3300050493 nmdc:mga0k408_45_c1 nmdc:mga0k408_45_c1_42195_44369 666
1104 3300050516 nmdc:mga0sz30_216_c2 nmdc:mga0sz30_216_c2_10876_13050 666
1105 3300053087 Ga0500643_015050 Ga0500643_015050_178_2376 666
1106 3300005327 Ga0070658_10002861 Ga0070658_100028612 667
1107 3300005563 Ga0068855_100140098 Ga0068855_1001400982 667
1108 3300005578 Ga0068854_100000359 Ga0068854_10000035926 667
1109 3300005616 Ga0068852_100000619 Ga0068852_10000061918 667
1110 3300009093 Ga0105240_10044710 Ga0105240_100447105 667
1111 3300025904 Ga0207647_10019114 Ga0207647_100191142 667
1112 3300025909 Ga0207705_10000004 Ga0207705_10000004354 667
1113 3300025913 Ga0207695_10027764 Ga0207695_100277645 667
1114 3300025981 Ga0207640_10002692 Ga0207640_100026927 667
1115 3300026142 Ga0207698_10000177 Ga0207698_1000017733 667
1116 3300053136 Ga0500559_0001806 Ga0500559_0001806_5506_7635 667
1117 iso_pu_bacteria 2919138771 2919141691 667
1118 3300005339 Ga0070660_100013227 Ga0070660_1000132274 668
1119 3300005355 Ga0070671_100005638 Ga0070671_1000056389 668
1120 3300005548 Ga0070665_100001304 Ga0070665_10000130430 668
1121 3300006042 Ga0075368_10000247 Ga0075368_100002476 668
1122 3300006186 Ga0075369_10007975 Ga0075369_100079751 668
1123 3300009177 Ga0105248_10006039 Ga0105248_100060393 668
1124 3300025909 Ga0207705_10002469 Ga0207705_100024694 668
1125 3300025919 Ga0207657_10005911 Ga0207657_1000591112 668
1126 3300025931 Ga0207644_10007330 Ga0207644_100073309 668
1127 3300025972 Ga0207668_10049205 Ga0207668_100492052 668
1128 3300027866 Ga0209813_10000233 Ga0209813_100002339 668
1129 3300028379 Ga0268266_10000215 Ga0268266_1000021510 668
1130 3300028381 Ga0268264_10004477 Ga0268264_100044779 668
1131 3300046512 Ga0495610_0000377 Ga0495610_0000377_4477_6627 668
1132 3300046522 Ga0495643_0000007 Ga0495643_0000007_355531_357666 668
1133 3300048921 Ga0496118_0022031 Ga0496118_0022031_612_2723 668
1134 3300048924 Ga0496121_0011705 Ga0496121_0011705_3584_5695 668
1135 3300048928 Ga0496125_0021207 Ga0496125_0021207_542_2653 668
1136 3300049581 Ga0501047_0071723 Ga0501047_0071723_160_2223 668
1137 3300050489 nmdc:mga03683_2739_c1 nmdc:mga03683_2739_c1_283_2364 668
1138 3300050491 nmdc:mga00v17_12820_c1 nmdc:mga00v17_12820_c1_1854_3935 668
1139 3300050491 nmdc:mga00v17_37025_c1 nmdc:mga00v17_37025_c1_709_2790 668
1140 3300050492 nmdc:mga0yw44_15488_c1 nmdc:mga0yw44_15488_c1_181_2262 668
1141 3300050494 nmdc:mga06z11_2602_c1 nmdc:mga06z11_2602_c1_3010_5091 668
1142 3300050495 nmdc:mga04h51_192_c1 nmdc:mga04h51_192_c1_6924_9005 668
1143 3300050496 nmdc:mga07m45_16_c1 nmdc:mga07m45_16_c1_6840_8921 668
1144 iso_pu_bacteria 2643221563 2643833163 668
1145 iso_pu_bacteria 2643221608 2644053042 668
1146 iso_pu_bacteria 2882806704 2882808310 668
1147 3300005367 Ga0070667_100000664 Ga0070667_10000066412 669
1148 3300005841 Ga0068863_100006771 Ga0068863_1000067718 669
1149 3300006051 Ga0075364_10007832 Ga0075364_100078324 669
1150 3300025931 Ga0207644_10000003 Ga0207644_1000000318 669
1151 3300025986 Ga0207658_10000381 Ga0207658_100003812 669
1152 3300026142 Ga0207698_10013072 Ga0207698_100130724 669
1153 3300050491 nmdc:mga00v17_6142_c1 nmdc:mga00v17_6142_c1_2594_4681 669
1154 iso_pu_bacteria 2738541275 2738711690 669
1155 iso_pu_bacteria 2738541301 2738850115 669
1156 iso_pu_bacteria 2738541304 2738865844 669
1157 iso_pu_bacteria 2738543022 2739298362 669
1158 iso_pu_bacteria 2738543033 2739360040 669
1159 iso_pu_bacteria 2818991438 2819552594 669
1160 iso_pu_bacteria 3000865235 3000865791 669
1161 2162886007 SwRhRL2b_contig_3095957 SwRhRL2b_0972.00005730 670
1162 3300005289 Ga0065704_10070448 Ga0065704_100704482 670
1163 3300005327 Ga0070658_10004481 Ga0070658_100044813 670
1164 3300005339 Ga0070660_100004715 Ga0070660_1000047156 670
1165 3300005344 Ga0070661_100000783 Ga0070661_10000078316 670
1166 3300005366 Ga0070659_100003053 Ga0070659_1000030535 670
1167 3300005458 Ga0070681_10016820 Ga0070681_100168202 670
1168 3300005614 Ga0068856_100044164 Ga0068856_1000441643 670
1169 3300006353 Ga0075370_10000061 Ga0075370_1000006122 670
1170 3300011119 Ga0105246_10000726 Ga0105246_100007266 670
1171 3300013102 Ga0157371_10007093 Ga0157371_100070933 670
1172 3300013105 Ga0157369_10009165 Ga0157369_100091658 670
1173 3300013307 Ga0157372_10001761 Ga0157372_100017612 670
1174 3300025919 Ga0207657_10000538 Ga0207657_100005386 670
1175 3300025933 Ga0207706_10004050 Ga0207706_100040501 670
1176 3300025949 Ga0207667_10022792 Ga0207667_100227925 670
1177 3300026116 Ga0207674_10022140 Ga0207674_100221402 670
1178 3300026116 Ga0207674_10151231 Ga0207674_101512311 670
1179 3300031731 Ga0307405_10000331 Ga0307405_1000033113 670
1180 3300032004 Ga0307414_10008331 Ga0307414_100083313 670
1181 3300046500 Ga0495596_0000553 Ga0495596_0000553_9617_11752 670
1182 3300046512 Ga0495610_0005578 Ga0495610_0005578_1643_3778 670
1183 3300048091 Ga0495626_0000356 Ga0495626_0000356_41812_43947 670
1184 3300048903 Ga0496100_0031445 Ga0496100_0031445_476_2668 670
1185 3300048910 Ga0496107_0002753 Ga0496107_0002753_4337_6529 670
1186 3300048919 Ga0496116_0000035 Ga0496116_0000035_140039_142177 670
1187 3300048921 Ga0496118_0029524 Ga0496118_0029524_65_2203 670
1188 3300048924 Ga0496121_0002302 Ga0496121_0002302_19972_22107 670
1189 3300048925 Ga0496122_0054828 Ga0496122_0054828_455_2593 670
1190 3300048926 Ga0496123_0001169 Ga0496123_0001169_35267_37405 670
1191 3300048927 Ga0496124_0004943 Ga0496124_0004943_9369_11507 670
1192 3300048927 Ga0496124_0013861 Ga0496124_0013861_3701_5836 670
1193 3300048928 Ga0496125_0005187 Ga0496125_0005187_4085_6223 670
1194 3300048929 Ga0496126_0000084 Ga0496126_0000084_91880_94018 670
1195 3300050496 nmdc:mga07m45_39_c1 nmdc:mga07m45_39_c1_43889_45973 670
1196 3300053087 Ga0500643_000001 Ga0500643_000001_1190261_1192375 670
1197 3300053153 Ga0500616_0002941 Ga0500616_0002941_2309_4423 670
1198 iso_pu_bacteria 2510917021 2511129653 670
1199 3300048911 Ga0496108_0056133 Ga0496108_0056133_151_2358 671
1200 3300048916 Ga0496113_0001090 Ga0496113_0001090_4587_6794 671
1201 3300053121 Ga0500607_000007 Ga0500607_000007_9248_11323 671
1202 3300053136 Ga0500559_0000257 Ga0500559_0000257_5697_7772 671
1203 3300053730 Ga0500645_003062 Ga0500645_003062_1799_3874 671
1204 3300003781 Ga0055536_1001812 Ga0055536_10018124 672
1205 3300003781 Ga0055536_1004296 Ga0055536_10042966 672
1206 3300003791 Ga0055530_10000012 Ga0055530_1000001273 672
1207 3300003794 Ga0055531_10000466 Ga0055531_1000046614 672
1208 3300003794 Ga0055531_10005887 Ga0055531_100058872 672
1209 3300005295 Ga0065707_10098895 Ga0065707_100988954 672
1210 3300025291 Ga0209675_1000306 Ga0209675_100030637 672
1211 3300025292 Ga0209676_1000081 Ga0209676_1000081226 672
1212 3300025292 Ga0209676_1000226 Ga0209676_100022645 672
1213 3300025292 Ga0209676_1000359 Ga0209676_100035975 672
1214 3300025298 Ga0209050_1000067 Ga0209050_1000067295 672
1215 3300025304 Ga0209257_1000392 Ga0209257_100039241 672
1216 3300025304 Ga0209257_1001680 Ga0209257_100168014 672
1217 3300025304 Ga0209257_1003766 Ga0209257_10037664 672
1218 3300025949 Ga0207667_10004465 Ga0207667_1000446511 672
1219 3300026116 Ga0207674_10004169 Ga0207674_1000416913 672
1220 3300046501 Ga0495607_0010002 Ga0495607_0010002_3602_5740 672
1221 3300046557 Ga0495622_0012740 Ga0495622_0012740_1138_3252 672
1222 3300046660 Ga0495625_0001031 Ga0495625_0001031_18982_21156 672
1223 3300046660 Ga0495625_0022549 Ga0495625_0022549_463_2577 672
1224 3300046692 Ga0495671_0015070 Ga0495671_0015070_1995_4109 672
1225 3300048925 Ga0496122_0005854 Ga0496122_0005854_5419_7533 672
1226 3300048926 Ga0496123_0001899 Ga0496123_0001899_18926_21040 672
1227 3300048929 Ga0496126_0063958 Ga0496126_0063958_32_2200 672
1228 3300048929 Ga0496126_0082917 Ga0496126_0082917_126_2243 672
1229 3300049574 Ga0501038_0005555 Ga0501038_0005555_560_2752 672
1230 3300049579 Ga0501043_0031550 Ga0501043_0031550_603_2777 672
1231 3300053087 Ga0500643_002298 Ga0500643_002298_3096_5291 672
1232 3300053104 Ga0500556_0000234 Ga0500556_0000234_18638_20854 672
1233 3300053130 Ga0500642_0000014 Ga0500642_0000014_18420_20534 672
1234 3300053157 Ga0500624_000394 Ga0500624_000394_1363_3483 672
1235 3300053177 Ga0500636_0002416 Ga0500636_0002416_840_2960 672
1236 3300053730 Ga0500645_000395 Ga0500645_000395_22218_24437 672
1237 3300046453 Ga0495627_000124 Ga0495627_000124_16140_18275 673
1238 3300046471 Ga0495650_0000647 Ga0495650_0000647_29636_31771 673
1239 3300046512 Ga0495610_0000022 Ga0495610_0000022_289965_292100 673
1240 3300046519 Ga0495632_0000445 Ga0495632_0000445_31469_33604 673
1241 3300047470 Ga0495681_0000187 Ga0495681_0000187_16109_18244 673
1242 3300048925 Ga0496122_0007130 Ga0496122_0007130_4878_7013 673
1243 3300048926 Ga0496123_0002161 Ga0496123_0002161_14333_16468 673
1244 3300048927 Ga0496124_0024962 Ga0496124_0024962_1028_3163 673
1245 3300053121 Ga0500607_000122 Ga0500607_000122_28973_31108 673
1246 iso_pu_bacteria 8054302542 8054302740 673
1247 3300005353 Ga0070669_100009301 Ga0070669_1000093013 674
1248 3300025923 Ga0207681_10000353 Ga0207681_100003533 674
1249 3300026088 Ga0207641_10002358 Ga0207641_100023589 674
1250 3300046500 Ga0495596_0000074 Ga0495596_0000074_63870_66008 674
1251 3300046507 Ga0495606_0013419 Ga0495606_0013419_125_2275 674
1252 3300046522 Ga0495643_0028757 Ga0495643_0028757_671_2809 674
1253 3300046538 Ga0495609_0005812 Ga0495609_0005812_4236_6374 674
1254 3300046660 Ga0495625_0008172 Ga0495625_0008172_5589_7727 674
1255 3300013306 Ga0163162_10054213 Ga0163162_100542133 675
1256 2162886007 SwRhRL2b_contig_1295667 SwRhRL2b_0963.00002820 679
1257 3300005289 Ga0065704_10070339 Ga0065704_100703392 679
1258 3300005353 Ga0070669_100000453 Ga0070669_10000045316 679
1259 3300005355 Ga0070671_100003906 Ga0070671_1000039067 679
1260 3300005843 Ga0068860_100024396 Ga0068860_1000243962 679
1261 3300013306 Ga0163162_10014675 Ga0163162_100146757 679
1262 3300025923 Ga0207681_10001327 Ga0207681_100013272 679
1263 3300025931 Ga0207644_10004373 Ga0207644_100043736 679
1264 3300025986 Ga0207658_10001552 Ga0207658_100015522 679
1265 3300028380 Ga0268265_10062843 Ga0268265_100628432 679
1266 3300048905 Ga0496102_0000141 Ga0496102_0000141_3863_5941 679
1267 3300048906 Ga0496103_0000038 Ga0496103_0000038_4572_6650 679
1268 3300048907 Ga0496104_0000114 Ga0496104_0000114_71351_73429 679
1269 3300048908 Ga0496105_0004438 Ga0496105_0004438_1889_3967 679
1270 3300048916 Ga0496113_0058589 Ga0496113_0058589_489_2567 679
1271 3300048920 Ga0496117_0000296 Ga0496117_0000296_53532_55610 679
1272 3300048921 Ga0496118_0003124 Ga0496118_0003124_5277_7355 679
1273 3300048922 Ga0496119_0003506 Ga0496119_0003506_605_2683 679
1274 3300048923 Ga0496120_0035124 Ga0496120_0035124_588_2666 679
1275 3300048924 Ga0496121_0002816 Ga0496121_0002816_22716_24794 679
1276 3300048925 Ga0496122_0001569 Ga0496122_0001569_21204_23282 679
1277 3300048927 Ga0496124_0002895 Ga0496124_0002895_646_2724 679
1278 3300048928 Ga0496125_0090096 Ga0496125_0090096_70_2148 679
1279 3300048929 Ga0496126_0000066 Ga0496126_0000066_214557_216635 679
1280 iso_pu_bacteria 2928100450 2928101658 679
1281 iso_pu_bacteria 2928959182 2928959748 679

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03119

DNA_ligase_ZBD

NAD-dependent DNA ligase C4 zinc finger domain

474

501

0.99

PF03120

DNA_ligase_OB

NAD-dependent DNA ligase OB-fold domain

390

468

0.96

PF00533

BRCT

BRCA1 C Terminus (BRCT) domain

689

761

0.95

PF01653

DNA_ligase_aden

NAD-dependent DNA ligase adenylation domain

130

387

0.94

PF12826

HHH_2

Helix-hairpin-helix motif

579

613

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bac-assembly1.cif.gz_A-2 structural basis for the inhibition of bacterial nad+ dependent dna ligase 0.897 76 318
4bu1-assembly1.cif.gz_B crystal structure of rad4 brct1,2 in complex with a crb2 phosphopeptide 0.8793 604 679
4bu1-assembly2.cif.gz_A crystal structure of rad4 brct1,2 in complex with a crb2 phosphopeptide 0.8776 604 679
6hm4-assembly1.cif.gz_A crystal structure of rad4 brct1,2 in complex with a mdb1 phosphopeptide 0.874 604 679
6l30-assembly1.cif.gz_A crystal structure of the epithelial cell transforming 2 (ect2) 0.8631 603 679
ID Description Score Start End Superfamily
af_P15042_588_670_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.9866 602 675 3.40.50.10190
af_Q2G1Y0_587_666_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.9732 604 673 3.40.50.10190
4lh7A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9673 6 68 1.10.287.610
af_P15042_317_390_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9644 319 389 2.40.50.140
3uq8A01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9576 12 68 1.10.287.610
ID Description Score Start End GO Terms
AF-A0A258JVS1-F1-model_v4 BRCT domain-containing protein 0.9913 604 675
AF-A0A7K1IP74-F1-model_v4 deleted 0.9785 165 280
AF-R9LI56-F1-model_v4 BRCT domain-containing protein 0.978 604 674
AF-A0A2H0YMB0-F1-model_v4 NAD-dependent DNA ligase LigA 0.9763 604 674 GO:0016874
AF-A0A521Y1Q6-F1-model_v4 NAD-dependent DNA ligase LigA (EC 6.5.1.2) 0.9753 605 678 GO:0003911

Feature Viewer

pLDDT pTM Quality
88.98 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map