F492462

General Info

Members Datasets Scaffolds Average Seq Length
1275 278 2550 129

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100152947|Ga0068871_1001529473
Length 158
Sequence MDSAVKKAFLLLDLTGACCAPRGVQREIDLAQPRLLLIDDEPALAAFLADAARECGFEPIVTSNDSEFRETFLGDLPDMVALDLGMPGMDGVELLRFLAEEAYGSPVLIVSGFDRRVLESAFRLGEALGLKMAGPVEKPVRLEALEQVLGQLRANLAI

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
205 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
208 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
211 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
214 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
215 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
216 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
217 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
218 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
219 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
236 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
262 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
263 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
264 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
267 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
268 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
269 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
270 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
275 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
276 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 2.67
Rhizosphere 96.86
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100152947 3300006358 Bacteria 1968
2 MRS1b_contig_533257 2162886011 Unclassified 814
3 JGI24736J21556_1026976 3300001904 Bacteria 891
4 JGI24741J21665_1005635 3300001915 Bacteria 2596
5 JGI24741J21665_1005772 3300001915 Bacteria 2545
6 JGI24741J21665_1013845 3300001915 Bacteria 1360
7 JGI24746J21847_1019206 3300001977 Unclassified 964
8 JGI24740J21852_10004553 3300001979 Bacteria 5963
9 JGI24740J21852_10034405 3300001979 Bacteria 1596
10 JGI24740J21852_10073746 3300001979 Unclassified 908
11 JGI24739J22299_10008998 3300001989 Bacteria 3727
12 JGI24739J22299_10014811 3300001989 Bacteria 2836
13 JGI24737J22298_10010644 3300001990 Bacteria 3031
14 JGI24737J22298_10057973 3300001990 Bacteria 1168
15 JGI24737J22298_10143936 3300001990 Bacteria 704
16 JGI24737J22298_10155028 3300001990 Bacteria 676
17 JGI24735J21928_10003922 3300002067 Bacteria 5034
18 JGI24735J21928_10005033 3300002067 Bacteria 4399
19 JGI24735J21928_10046983 3300002067 Bacteria 1252
20 JGI24735J21928_10059043 3300002067 Bacteria 1103
21 JGI24745J21846_1010379 3300002073 Bacteria 1058
22 JGI24738J21930_10015179 3300002075 Bacteria 1643
23 JGI24749J21850_1000468 3300002076 Bacteria 5985
24 rootH1_10190186 3300003316 Unclassified 1053
25 rootH1_10036968 3300003323 Bacteria 2126
26 rootH1_10313897 3300003323 Bacteria 1440
27 Ga0065704_10538470 3300005289 Unclassified 642
28 Ga0065712_10189202 3300005290 Unclassified 1156
29 Ga0065712_10258104 3300005290 Bacteria 943
30 Ga0065715_10037128 3300005293 Bacteria 1180
31 Ga0065715_10089302 3300005293 Bacteria 11347
32 Ga0065715_10209169 3300005293 Bacteria 1317
33 Ga0065715_10358220 3300005293 Unclassified 940
34 Ga0065707_10532745 3300005295 Bacteria 733
35 Ga0070658_10007543 3300005327 Bacteria 8777
36 Ga0070658_10020274 3300005327 Bacteria 5327
37 Ga0070658_10034596 3300005327 Bacteria 4065
38 Ga0070658_10039920 3300005327 Bacteria 3787
39 Ga0070658_10062241 3300005327 Bacteria 3041
40 Ga0070658_10110092 3300005327 Bacteria 2281
41 Ga0070658_10125696 3300005327 Bacteria 2134
42 Ga0070658_10246727 3300005327 Bacteria 1514
43 Ga0070658_10296291 3300005327 Bacteria 1379
44 Ga0070658_10594667 3300005327 Bacteria 959
45 Ga0070658_11181670 3300005327 Bacteria 665
46 Ga0070658_11252924 3300005327 Unclassified 644
47 Ga0070658_11256597 3300005327 Bacteria 643
48 Ga0070676_10033432 3300005328 Bacteria 2951
49 Ga0070676_10204737 3300005328 Bacteria 1295
50 Ga0070676_10350338 3300005328 Bacteria 1015
51 Ga0070676_10514144 3300005328 Bacteria 852
52 Ga0070683_100005870 3300005329 Bacteria 10274
53 Ga0070683_100032150 3300005329 Bacteria 4776
54 Ga0070683_100059930 3300005329 Bacteria 3536
55 Ga0070683_100092153 3300005329 Bacteria 2846
56 Ga0070683_100197177 3300005329 Bacteria 1912
57 Ga0070683_100201665 3300005329 Bacteria 1889
58 Ga0070690_100314181 3300005330 Bacteria 1127
59 Ga0070670_100001315 3300005331 Bacteria 19824
60 Ga0070670_100006142 3300005331 Bacteria 10155
61 Ga0070670_100012634 3300005331 Bacteria 7230
62 Ga0070670_100051186 3300005331 Bacteria 3548
63 Ga0070670_100106797 3300005331 Bacteria 2413
64 Ga0070670_100140792 3300005331 Bacteria 2086
65 Ga0070677_10002184 3300005333 Bacteria 6252
66 Ga0070677_10023594 3300005333 Bacteria 2279
67 Ga0070677_10107976 3300005333 Bacteria 1238
68 Ga0070677_10391486 3300005333 Unclassified 730
69 Ga0068869_100059475 3300005334 Bacteria 2798
70 Ga0068869_100067006 3300005334 Bacteria 2647
71 Ga0068869_100253019 3300005334 Bacteria 1408
72 Ga0068869_100404467 3300005334 Bacteria 1123
73 Ga0068869_100664942 3300005334 Bacteria 885
74 Ga0070666_10029572 3300005335 Bacteria 3602
75 Ga0070666_10133723 3300005335 Bacteria 1724
76 Ga0070666_10242957 3300005335 Bacteria 1273
77 Ga0070666_10247068 3300005335 Bacteria 1263
78 Ga0070666_10270239 3300005335 Bacteria 1206
79 Ga0070666_10784535 3300005335 Unclassified 701
80 Ga0070680_100001836 3300005336 Bacteria 15602
81 Ga0070680_100003369 3300005336 Bacteria 11927
82 Ga0070680_100009885 3300005336 Bacteria 7343
83 Ga0070680_100038411 3300005336 Bacteria 3872
84 Ga0070680_100076250 3300005336 Bacteria 2760
85 Ga0070680_100125064 3300005336 Bacteria 2148
86 Ga0070680_100126387 3300005336 Bacteria 2136
87 Ga0070680_100134853 3300005336 Bacteria 2067
88 Ga0070680_100212514 3300005336 Bacteria 1632
89 Ga0070680_100298933 3300005336 Bacteria 1365
90 Ga0070680_100458884 3300005336 Bacteria 1088
91 Ga0070680_100590985 3300005336 Bacteria 953
92 Ga0070682_100035741 3300005337 Bacteria 3034
93 Ga0070682_100076755 3300005337 Bacteria 2152
94 Ga0070682_100091549 3300005337 Bacteria 1990
95 Ga0070682_100273251 3300005337 Bacteria 1229
96 Ga0068868_100012105 3300005338 Bacteria 6299
97 Ga0068868_100012499 3300005338 Bacteria 6207
98 Ga0068868_100055450 3300005338 Bacteria 3127
99 Ga0068868_100141673 3300005338 Bacteria 1974
100 Ga0068868_100509575 3300005338 Bacteria 1055
101 Ga0068868_100651354 3300005338 Bacteria 938
102 Ga0068868_100796086 3300005338 Bacteria 852
103 Ga0070660_100000039 3300005339 Bacteria 76157
104 Ga0070660_100004919 3300005339 Bacteria 9241
105 Ga0070660_100019326 3300005339 Bacteria 4990
106 Ga0070660_100019583 3300005339 Bacteria 4961
107 Ga0070660_100023245 3300005339 Bacteria 4592
108 Ga0070660_100041255 3300005339 Bacteria 3517
109 Ga0070660_100094564 3300005339 Bacteria 2361
110 Ga0070660_100128367 3300005339 Bacteria 2027
111 Ga0070660_100222071 3300005339 Bacteria 1536
112 Ga0070660_100262169 3300005339 Bacteria 1411
113 Ga0070660_100271790 3300005339 Bacteria 1385
114 Ga0070660_100354091 3300005339 Bacteria 1209
115 Ga0070660_100553854 3300005339 Bacteria 959
116 Ga0070689_100346345 3300005340 Bacteria 1245
117 Ga0070689_101461514 3300005340 Bacteria 618
118 Ga0070691_10004396 3300005341 Bacteria 6402
119 Ga0070691_10149364 3300005341 Bacteria 1197
120 Ga0070691_10322647 3300005341 Bacteria 850
121 Ga0070687_100096232 3300005343 Bacteria 1648
122 Ga0070687_100540494 3300005343 Unclassified 791
123 Ga0070661_100040947 3300005344 Bacteria 3380
124 Ga0070661_100044510 3300005344 Bacteria 3243
125 Ga0070661_100046877 3300005344 Bacteria 3162
126 Ga0070661_100056312 3300005344 Bacteria 2880
127 Ga0070661_100072441 3300005344 Bacteria 2535
128 Ga0070661_100090700 3300005344 Bacteria 2263
129 Ga0070661_100095553 3300005344 Bacteria 2204
130 Ga0070661_100222721 3300005344 Bacteria 1447
131 Ga0070661_100224296 3300005344 Bacteria 1442
132 Ga0070661_100224310 3300005344 Bacteria 1442
133 Ga0070661_100271995 3300005344 Bacteria 1312
134 Ga0070661_100282749 3300005344 Unclassified 1287
135 Ga0070661_100319888 3300005344 Bacteria 1212
136 Ga0070661_100508134 3300005344 Unclassified 965
137 Ga0070661_100552216 3300005344 Bacteria 927
138 Ga0070661_100899075 3300005344 Bacteria 731
139 Ga0070661_101787325 3300005344 Bacteria 521
140 Ga0070692_10002594 3300005345 Bacteria 7046
141 Ga0070692_10017920 3300005345 Bacteria 3395
142 Ga0070692_10050058 3300005345 Bacteria 2169
143 Ga0070692_10076732 3300005345 Bacteria 1791
144 Ga0070668_100001463 3300005347 Bacteria 17064
145 Ga0070668_100003995 3300005347 Bacteria 10919
146 Ga0070668_100005678 3300005347 Bacteria 9249
147 Ga0070668_100067019 3300005347 Bacteria 2787
148 Ga0070668_100215657 3300005347 Bacteria 1581
149 Ga0070668_100297354 3300005347 Bacteria 1353
150 Ga0070668_100370449 3300005347 Bacteria 1217
151 Ga0070668_101065343 3300005347 Bacteria 728
152 Ga0070668_101628264 3300005347 Bacteria 592
153 Ga0070669_100005485 3300005353 Bacteria 9157
154 Ga0070669_100075508 3300005353 Bacteria 2500
155 Ga0070669_100101965 3300005353 Bacteria 2166
156 Ga0070669_100137341 3300005353 Bacteria 1881
157 Ga0070669_100304124 3300005353 Bacteria 1283
158 Ga0070669_100345251 3300005353 Bacteria 1207
159 Ga0070669_100404743 3300005353 Bacteria 1117
160 Ga0070669_100489101 3300005353 Bacteria 1019
161 Ga0070669_100905050 3300005353 Unclassified 754
162 Ga0070669_101000723 3300005353 Unclassified 717
163 Ga0070675_100003732 3300005354 Bacteria 11581
164 Ga0070675_100041977 3300005354 Bacteria 3737
165 Ga0070675_100165305 3300005354 Bacteria 1905
166 Ga0070675_100397963 3300005354 Bacteria 1228
167 Ga0070675_100433252 3300005354 Bacteria 1177
168 Ga0070675_100524848 3300005354 Bacteria 1069
169 Ga0070675_101805848 3300005354 Bacteria 564
170 Ga0070671_100006378 3300005355 Bacteria 9420
171 Ga0070671_100007905 3300005355 Bacteria 8502
172 Ga0070671_100020554 3300005355 Bacteria 5385
173 Ga0070671_100111805 3300005355 Bacteria 2294
174 Ga0070671_100150719 3300005355 Bacteria 1964
175 Ga0070671_100203542 3300005355 Bacteria 1679
176 Ga0070671_100226914 3300005355 Bacteria 1585
177 Ga0070671_100266924 3300005355 Bacteria 1455
178 Ga0070671_100761451 3300005355 Bacteria 842
179 Ga0070674_100001916 3300005356 Bacteria 11325
180 Ga0070674_100006554 3300005356 Bacteria 6804
181 Ga0070674_100162917 3300005356 Bacteria 1693
182 Ga0070674_100331105 3300005356 Bacteria 1224
183 Ga0070674_100672424 3300005356 Bacteria 882
184 Ga0070674_101928256 3300005356 Unclassified 537
185 Ga0070674_101957288 3300005356 Bacteria 533
186 Ga0070673_100013721 3300005364 Bacteria 5618
187 Ga0070673_100041827 3300005364 Bacteria 3528
188 Ga0070673_100093106 3300005364 Bacteria 2467
189 Ga0070673_100093289 3300005364 Bacteria 2465
190 Ga0070673_100138558 3300005364 Bacteria 2050
191 Ga0070673_100263458 3300005364 Bacteria 1506
192 Ga0070673_100912859 3300005364 Bacteria 815
193 Ga0070673_100924128 3300005364 Bacteria 810
194 Ga0070673_101013212 3300005364 Unclassified 773
195 Ga0070688_101064657 3300005365 Unclassified 645
196 Ga0070659_100004539 3300005366 Bacteria 9916
197 Ga0070659_100020207 3300005366 Bacteria 5057
198 Ga0070659_100049380 3300005366 Bacteria 3308
199 Ga0070659_100050846 3300005366 Bacteria 3258
200 Ga0070659_100061071 3300005366 Bacteria 2978
201 Ga0070659_100120651 3300005366 Bacteria 2123
202 Ga0070659_100150101 3300005366 Bacteria 1901
203 Ga0070659_100153538 3300005366 Bacteria 1879
204 Ga0070659_100625820 3300005366 Bacteria 926
205 Ga0070659_102092137 3300005366 Bacteria 509
206 Ga0070667_100004542 3300005367 Bacteria 11680
207 Ga0070667_100005869 3300005367 Bacteria 10238
208 Ga0070667_100007896 3300005367 Bacteria 8827
209 Ga0070667_100018041 3300005367 Bacteria 5849
210 Ga0070667_100058152 3300005367 Bacteria 3268
211 Ga0070667_100127304 3300005367 Bacteria 2220
212 Ga0070667_100257179 3300005367 Bacteria 1562
213 Ga0070667_100299595 3300005367 Bacteria 1447
214 Ga0070667_100319490 3300005367 Bacteria 1401
215 Ga0070667_100397517 3300005367 Bacteria 1254
216 Ga0070667_100480224 3300005367 Unclassified 1138
217 Ga0070667_100984117 3300005367 Bacteria 787
218 Ga0070714_100112267 3300005435 Bacteria 2415
219 Ga0070701_10084829 3300005438 Bacteria 1723
220 Ga0070701_10256861 3300005438 Bacteria 1057
221 Ga0070705_101841420 3300005440 Bacteria 514
222 Ga0070700_100014633 3300005441 Bacteria 4433
223 Ga0070694_100173630 3300005444 Bacteria 1589
224 Ga0070663_100009038 3300005455 Bacteria 6156
225 Ga0070663_100015085 3300005455 Bacteria 4975
226 Ga0070663_100030785 3300005455 Bacteria 3682
227 Ga0070663_100070715 3300005455 Bacteria 2538
228 Ga0070663_100214271 3300005455 Bacteria 1509
229 Ga0070663_100231522 3300005455 Bacteria 1455
230 Ga0070663_100461978 3300005455 Bacteria 1048
231 Ga0070663_100592055 3300005455 Unclassified 932
232 Ga0070663_100691622 3300005455 Bacteria 866
233 Ga0070678_100006804 3300005456 Bacteria 6739
234 Ga0070678_100015288 3300005456 Bacteria 4874
235 Ga0070678_100129045 3300005456 Bacteria 2006
236 Ga0070678_101102559 3300005456 Bacteria 733
237 Ga0070662_100003714 3300005457 Bacteria 9548
238 Ga0070662_100010824 3300005457 Bacteria 6005
239 Ga0070662_100013265 3300005457 Bacteria 5480
240 Ga0070662_100025367 3300005457 Bacteria 4092
241 Ga0070662_100075506 3300005457 Bacteria 2496
242 Ga0070662_100186032 3300005457 Bacteria 1640
243 Ga0070662_100254061 3300005457 Bacteria 1414
244 Ga0070662_100267722 3300005457 Bacteria 1379
245 Ga0070662_100273490 3300005457 Bacteria 1364
246 Ga0070662_100275700 3300005457 Bacteria 1359
247 Ga0070662_100392791 3300005457 Bacteria 1143
248 Ga0070662_100499205 3300005457 Bacteria 1015
249 Ga0070662_100767165 3300005457 Bacteria 818
250 Ga0070662_101132275 3300005457 Bacteria 672
251 Ga0070662_101376179 3300005457 Bacteria 608
252 Ga0070662_101916292 3300005457 Bacteria 512
253 Ga0070681_10069291 3300005458 Bacteria 3494
254 Ga0070681_10107741 3300005458 Bacteria 2727
255 Ga0070681_10144489 3300005458 Bacteria 2308
256 Ga0070681_10154891 3300005458 Bacteria 2217
257 Ga0070681_10175751 3300005458 Bacteria 2063
258 Ga0070681_10561239 3300005458 Bacteria 1055
259 Ga0070681_10735413 3300005458 Unclassified 903
260 Ga0070681_10977268 3300005458 Bacteria 766
261 Ga0068867_100006233 3300005459 Bacteria 8441
262 Ga0068867_100009574 3300005459 Bacteria 6832
263 Ga0068867_100094198 3300005459 Bacteria 2277
264 Ga0068867_100109910 3300005459 Bacteria 2117
265 Ga0068867_100197153 3300005459 Bacteria 1610
266 Ga0068867_100390124 3300005459 Bacteria 1172
267 Ga0070685_10830461 3300005466 Bacteria 683
268 Ga0070685_11088270 3300005466 Bacteria 603
269 Ga0070685_11124171 3300005466 Bacteria 594
270 Ga0070685_11187737 3300005466 Unclassified 579
271 Ga0070679_100021063 3300005530 Bacteria 6361
272 Ga0070679_100030314 3300005530 Bacteria 5341
273 Ga0070679_100039777 3300005530 Bacteria 4675
274 Ga0070679_100042192 3300005530 Bacteria 4543
275 Ga0070679_100118290 3300005530 Bacteria 2634
276 Ga0070679_100367618 3300005530 Bacteria 1385
277 Ga0070679_100489224 3300005530 Bacteria 1174
278 Ga0070679_100689193 3300005530 Bacteria 964
279 Ga0070679_101397484 3300005530 Unclassified 646
280 Ga0070679_101411791 3300005530 Unclassified 642
281 Ga0070684_100049962 3300005535 Bacteria 3631
282 Ga0070684_100100583 3300005535 Bacteria 2582
283 Ga0070684_100402659 3300005535 Bacteria 1262
284 Ga0070684_100557561 3300005535 Bacteria 1064
285 Ga0070684_100671908 3300005535 Bacteria 965
286 Ga0068853_100091049 3300005539 Bacteria 2681
287 Ga0068853_100135865 3300005539 Bacteria 2204
288 Ga0068853_100221589 3300005539 Bacteria 1728
289 Ga0068853_100417476 3300005539 Bacteria 1258
290 Ga0068853_100434494 3300005539 Bacteria 1233
291 Ga0070672_100003248 3300005543 Bacteria 10527
292 Ga0070672_100033069 3300005543 Bacteria 3913
293 Ga0070672_100065229 3300005543 Bacteria 2880
294 Ga0070672_100137434 3300005543 Bacteria 2013
295 Ga0070672_100282601 3300005543 Bacteria 1403
296 Ga0070672_100638659 3300005543 Bacteria 929
297 Ga0070672_100719176 3300005543 Bacteria 875
298 Ga0070672_101119520 3300005543 Bacteria 700
299 Ga0070686_100009625 3300005544 Bacteria 5434
300 Ga0070695_100387988 3300005545 Bacteria 1055
301 Ga0070696_100549847 3300005546 Bacteria 925
302 Ga0070696_100779876 3300005546 Bacteria 785
303 Ga0070696_100914700 3300005546 Unclassified 728
304 Ga0070693_100065916 3300005547 Bacteria 2118
305 Ga0070693_100116241 3300005547 Bacteria 1653
306 Ga0070693_101102718 3300005547 Bacteria 605
307 Ga0070665_100015013 3300005548 Bacteria 7773
308 Ga0070665_100015126 3300005548 Bacteria 7745
309 Ga0070665_100066009 3300005548 Bacteria 3630
310 Ga0070665_100365963 3300005548 Bacteria 1448
311 Ga0070665_100416306 3300005548 Bacteria 1352
312 Ga0070665_100713179 3300005548 Bacteria 1016
313 Ga0070665_100861389 3300005548 Unclassified 919
314 Ga0070704_100116020 3300005549 Bacteria 2047
315 Ga0070704_101857081 3300005549 Bacteria 558
316 Ga0068855_100000135 3300005563 Bacteria 94502
317 Ga0068855_100007630 3300005563 Bacteria 13083
318 Ga0068855_100099732 3300005563 Bacteria 3345
319 Ga0068855_100207398 3300005563 Bacteria 2204
320 Ga0068855_100452993 3300005563 Bacteria 1400
321 Ga0068855_100507085 3300005563 Bacteria 1310
322 Ga0068855_100717954 3300005563 Bacteria 1068
323 Ga0068855_100718166 3300005563 Bacteria 1068
324 Ga0068855_101128092 3300005563 Bacteria 818
325 Ga0068855_101153628 3300005563 Bacteria 808
326 Ga0068855_101466393 3300005563 Bacteria 701
327 Ga0070664_100006486 3300005564 Bacteria 9431
328 Ga0070664_100025708 3300005564 Bacteria 4882
329 Ga0070664_100031368 3300005564 Bacteria 4440
330 Ga0070664_100081264 3300005564 Bacteria 2793
331 Ga0070664_100090002 3300005564 Bacteria 2655
332 Ga0070664_100097919 3300005564 Bacteria 2547
333 Ga0070664_100316599 3300005564 Bacteria 1413
334 Ga0070664_100528439 3300005564 Bacteria 1089
335 Ga0070664_100851788 3300005564 Unclassified 854
336 Ga0070664_102083931 3300005564 Bacteria 538
337 Ga0068857_100014654 3300005577 Bacteria 6837
338 Ga0068857_100037507 3300005577 Bacteria 4294
339 Ga0068857_100176691 3300005577 Bacteria 1942
340 Ga0068857_100934483 3300005577 Bacteria 833
341 Ga0068854_100000126 3300005578 Bacteria 52604
342 Ga0068854_100027685 3300005578 Bacteria 3909
343 Ga0068854_100029890 3300005578 Bacteria 3776
344 Ga0068854_100114552 3300005578 Bacteria 2038
345 Ga0068854_100203569 3300005578 Bacteria 1557
346 Ga0068854_100360167 3300005578 Bacteria 1193
347 Ga0068854_100505783 3300005578 Bacteria 1018
348 Ga0068854_100844039 3300005578 Bacteria 801
349 Ga0068854_100926156 3300005578 Bacteria 767
350 Ga0068856_100006459 3300005614 Bacteria 11500
351 Ga0068856_100013705 3300005614 Bacteria 7838
352 Ga0068856_100051897 3300005614 Bacteria 4043
353 Ga0068856_100080444 3300005614 Bacteria 3232
354 Ga0068856_100290270 3300005614 Bacteria 1652
355 Ga0068856_100323108 3300005614 Bacteria 1560
356 Ga0068856_100686819 3300005614 Bacteria 1044
357 Ga0068856_100688765 3300005614 Bacteria 1042
358 Ga0068856_100740984 3300005614 Bacteria 1003
359 Ga0068856_102551105 3300005614 Bacteria 517
360 Ga0068852_100006802 3300005616 Bacteria 8300
361 Ga0068852_100016531 3300005616 Bacteria 5758
362 Ga0068852_100026484 3300005616 Bacteria 4714
363 Ga0068852_100034043 3300005616 Bacteria 4237
364 Ga0068852_100039498 3300005616 Bacteria 3973
365 Ga0068852_100081404 3300005616 Bacteria 2874
366 Ga0068852_100105338 3300005616 Bacteria 2555
367 Ga0068852_100263265 3300005616 Bacteria 1656
368 Ga0068852_100315053 3300005616 Bacteria 1518
369 Ga0068852_100365225 3300005616 Bacteria 1413
370 Ga0068852_100414422 3300005616 Bacteria 1328
371 Ga0068852_100457208 3300005616 Bacteria 1265
372 Ga0068852_100499780 3300005616 Bacteria 1211
373 Ga0068852_100696084 3300005616 Bacteria 1026
374 Ga0068852_101320064 3300005616 Bacteria 743
375 Ga0068852_102386009 3300005616 Unclassified 550
376 Ga0068859_100001731 3300005617 Bacteria 22254
377 Ga0068859_100162075 3300005617 Bacteria 2315
378 Ga0068859_100331316 3300005617 Bacteria 1616
379 Ga0068859_100515150 3300005617 Bacteria 1291
380 Ga0068859_100523950 3300005617 Bacteria 1280
381 Ga0068859_100524014 3300005617 Bacteria 1280
382 Ga0068864_100014661 3300005618 Bacteria 6511
383 Ga0068864_100255877 3300005618 Bacteria 1627
384 Ga0068864_100328761 3300005618 Bacteria 1437
385 Ga0068864_100351886 3300005618 Bacteria 1390
386 Ga0068866_10042109 3300005718 Bacteria 2271
387 Ga0068866_10251089 3300005718 Bacteria 1082
388 Ga0068861_100004724 3300005719 Bacteria 9157
389 Ga0068861_100068594 3300005719 Bacteria 2741
390 Ga0068851_10009825 3300005834 Bacteria 4457
391 Ga0068851_10336566 3300005834 Bacteria 875
392 Ga0068851_10545734 3300005834 Bacteria 700
393 Ga0068851_10840327 3300005834 Unclassified 572
394 Ga0068870_10021698 3300005840 Bacteria 3146
395 Ga0068870_10205754 3300005840 Bacteria 1196
396 Ga0068870_10549563 3300005840 Bacteria 777
397 Ga0068863_100052246 3300005841 Bacteria 3873
398 Ga0068863_100062786 3300005841 Bacteria 3513
399 Ga0068863_100110662 3300005841 Bacteria 2616
400 Ga0068863_100124004 3300005841 Bacteria 2465
401 Ga0068863_100282462 3300005841 Bacteria 1608
402 Ga0068863_101700737 3300005841 Unclassified 640
403 Ga0068863_102582696 3300005841 Bacteria 517
404 Ga0068858_100016457 3300005842 Bacteria 6943
405 Ga0068858_100027958 3300005842 Bacteria 5240
406 Ga0068858_100079908 3300005842 Bacteria 3038
407 Ga0068858_100108259 3300005842 Bacteria 2594
408 Ga0068858_100126851 3300005842 Bacteria 2390
409 Ga0068858_100745323 3300005842 Bacteria 954
410 Ga0068858_101585407 3300005842 Unclassified 646
411 Ga0068858_102325114 3300005842 Bacteria 530
412 Ga0068860_100002719 3300005843 Bacteria 18396
413 Ga0068860_100010737 3300005843 Bacteria 9043
414 Ga0068860_100243779 3300005843 Bacteria 1748
415 Ga0068860_100289726 3300005843 Bacteria 1602
416 Ga0068860_100371936 3300005843 Bacteria 1409
417 Ga0068860_100478267 3300005843 Bacteria 1241
418 Ga0068862_100005184 3300005844 Bacteria 10951
419 Ga0068862_100008143 3300005844 Bacteria 8665
420 Ga0068862_100017537 3300005844 Bacteria 5963
421 Ga0068862_100056361 3300005844 Bacteria 3367
422 Ga0068862_100084288 3300005844 Bacteria 2761
423 Ga0068862_100122738 3300005844 Bacteria 2291
424 Ga0068862_100297562 3300005844 Bacteria 1484
425 Ga0068862_100654722 3300005844 Bacteria 1013
426 Ga0068862_100945329 3300005844 Bacteria 850
427 Ga0068862_101506331 3300005844 Unclassified 678
428 Ga0070712_100155418 3300006175 Bacteria 1761
429 Ga0070712_100175530 3300006175 Bacteria 1666
430 Ga0097621_100014653 3300006237 Bacteria 5874
431 Ga0097621_100033135 3300006237 Bacteria 4112
432 Ga0097621_100174474 3300006237 Bacteria 1855
433 Ga0097621_100435104 3300006237 Bacteria 1179
434 Ga0097621_100506016 3300006237 Bacteria 1095
435 Ga0097621_101078168 3300006237 Bacteria 753
436 Ga0075370_10864897 3300006353 Bacteria 552
437 Ga0068871_100020901 3300006358 Bacteria 5021
438 Ga0068871_100036121 3300006358 Bacteria 3932
439 Ga0068871_100287309 3300006358 Bacteria 1440
440 Ga0068871_100701193 3300006358 Unclassified 927
441 Ga0068871_101702639 3300006358 Bacteria 598
442 Ga0075428_101068151 3300006844 Bacteria 853
443 Ga0075431_100306760 3300006847 Bacteria 1603
444 Ga0075433_10025826 3300006852 Bacteria 4967
445 Ga0075434_100194392 3300006871 Bacteria 2049
446 Ga0075434_100274963 3300006871 Bacteria 1704
447 Ga0075429_100604207 3300006880 Bacteria 961
448 Ga0068865_100012058 3300006881 Bacteria 5431
449 Ga0068865_100167073 3300006881 Bacteria 1683
450 Ga0068865_100245191 3300006881 Bacteria 1411
451 Ga0068865_101210596 3300006881 Bacteria 669
452 Ga0097620_100001731 3300006931 Bacteria 22254
453 Ga0097620_100162098 3300006931 Bacteria 2315
454 Ga0097620_100331313 3300006931 Bacteria 1616
455 Ga0097620_100515126 3300006931 Bacteria 1291
456 Ga0097620_100523945 3300006931 Bacteria 1280
457 Ga0097620_100524039 3300006931 Bacteria 1280
458 Ga0105240_10005847 3300009093 Bacteria 18237
459 Ga0105240_10078416 3300009093 Bacteria 4068
460 Ga0105240_10273038 3300009093 Bacteria 1945
461 Ga0105240_10848248 3300009093 Bacteria 986
462 Ga0105240_11668656 3300009093 Bacteria 666
463 Ga0111539_10011004 3300009094 Bacteria 11388
464 Ga0111539_10232692 3300009094 Bacteria 2146
465 Ga0105245_10042689 3300009098 Bacteria 4046
466 Ga0105245_10284396 3300009098 Bacteria 1618
467 Ga0105245_10341587 3300009098 Bacteria 1481
468 Ga0105245_11272798 3300009098 Bacteria 784
469 Ga0105247_10748761 3300009101 Bacteria 740
470 Ga0105247_10754032 3300009101 Bacteria 738
471 Ga0105243_10195542 3300009148 Bacteria 1770
472 Ga0105243_10257635 3300009148 Bacteria 1561
473 Ga0105243_10432367 3300009148 Bacteria 1231
474 Ga0105243_10807932 3300009148 Bacteria 925
475 Ga0105241_10193231 3300009174 Bacteria 1695
476 Ga0105241_10456027 3300009174 Bacteria 1132
477 Ga0105241_10510246 3300009174 Unclassified 1074
478 Ga0105241_10598425 3300009174 Unclassified 996
479 Ga0105241_11587518 3300009174 Bacteria 632
480 Ga0105242_10118482 3300009176 Bacteria 2268
481 Ga0105242_10698689 3300009176 Bacteria 992
482 Ga0105242_12583851 3300009176 Bacteria 557
483 Ga0105248_10022148 3300009177 Bacteria 7043
484 Ga0105248_10096279 3300009177 Bacteria 3334
485 Ga0105248_10105650 3300009177 Bacteria 3175
486 Ga0105248_10142031 3300009177 Bacteria 2709
487 Ga0105248_10536681 3300009177 Bacteria 1319
488 Ga0105248_10646425 3300009177 Bacteria 1193
489 Ga0105248_11619222 3300009177 Unclassified 734
490 Ga0105237_10006949 3300009545 Bacteria 12479
491 Ga0105238_10016954 3300009551 Bacteria 7391
492 Ga0105238_10072864 3300009551 Bacteria 3429
493 Ga0105238_10278434 3300009551 Bacteria 1654
494 Ga0105249_10002721 3300009553 Bacteria 15283
495 Ga0105249_10136833 3300009553 Bacteria 2345
496 Ga0105249_10143357 3300009553 Bacteria 2293
497 Ga0105249_10261680 3300009553 Bacteria 1719
498 Ga0105249_11416239 3300009553 Bacteria 767
499 Ga0105239_10352736 3300010375 Bacteria 1661
500 Ga0105239_10575766 3300010375 Bacteria 1283
501 Ga0105239_11345146 3300010375 Bacteria 824
502 Ga0105246_10154155 3300011119 Bacteria 1743
503 Ga0105246_10273816 3300011119 Bacteria 1351
504 Ga0105246_11001800 3300011119 Bacteria 756
505 Ga0105246_11141654 3300011119 Bacteria 714
506 Ga0157327_1011930 3300012512 Unclassified 848
507 Ga0157373_10002119 3300013100 Bacteria 15020
508 Ga0157373_10035549 3300013100 Bacteria 3577
509 Ga0157373_10046948 3300013100 Bacteria 3081
510 Ga0157373_10056534 3300013100 Bacteria 2786
511 Ga0157373_10060446 3300013100 Bacteria 2685
512 Ga0157373_10070142 3300013100 Bacteria 2477
513 Ga0157373_10075171 3300013100 Bacteria 2384
514 Ga0157373_10122626 3300013100 Bacteria 1827
515 Ga0157373_10155213 3300013100 Bacteria 1610
516 Ga0157373_10209963 3300013100 Unclassified 1373
517 Ga0157373_10238484 3300013100 Unclassified 1285
518 Ga0157373_10344569 3300013100 Bacteria 1062
519 Ga0157373_10383948 3300013100 Bacteria 1005
520 Ga0157373_11307979 3300013100 Bacteria 549
521 Ga0157371_10002495 3300013102 Bacteria 17488
522 Ga0157371_10014711 3300013102 Bacteria 5889
523 Ga0157371_10019728 3300013102 Bacteria 4965
524 Ga0157371_10020129 3300013102 Bacteria 4911
525 Ga0157371_10031491 3300013102 Bacteria 3821
526 Ga0157371_10038566 3300013102 Bacteria 3418
527 Ga0157371_10049084 3300013102 Bacteria 2999
528 Ga0157371_10084600 3300013102 Bacteria 2247
529 Ga0157371_10118177 3300013102 Bacteria 1885
530 Ga0157371_10139863 3300013102 Bacteria 1725
531 Ga0157371_10172498 3300013102 Bacteria 1546
532 Ga0157371_10189256 3300013102 Bacteria 1473
533 Ga0157371_10332470 3300013102 Bacteria 1104
534 Ga0157371_10369985 3300013102 Bacteria 1045
535 Ga0157371_10488040 3300013102 Bacteria 909
536 Ga0157371_10613188 3300013102 Bacteria 810
537 Ga0157370_10003030 3300013104 Bacteria 19939
538 Ga0157370_10041207 3300013104 Bacteria 4457
539 Ga0157370_10052675 3300013104 Bacteria 3885
540 Ga0157370_10084124 3300013104 Bacteria 2991
541 Ga0157370_10153171 3300013104 Bacteria 2145
542 Ga0157370_10378622 3300013104 Bacteria 1304
543 Ga0157370_10713486 3300013104 Bacteria 915
544 Ga0157370_10776410 3300013104 Archaea 872
545 Ga0157370_11051720 3300013104 Unclassified 736
546 Ga0157369_10006058 3300013105 Bacteria 14033
547 Ga0157369_10014079 3300013105 Bacteria 9038
548 Ga0157369_10101060 3300013105 Bacteria 3074
549 Ga0157369_10105327 3300013105 Bacteria 3003
550 Ga0157369_10154510 3300013105 Bacteria 2424
551 Ga0157369_10160829 3300013105 Bacteria 2370
552 Ga0157369_10420521 3300013105 Bacteria 1385
553 Ga0157374_10002970 3300013296 Bacteria 14201
554 Ga0157374_10116962 3300013296 Bacteria 2569
555 Ga0157374_11572092 3300013296 Bacteria 681
556 Ga0157374_11776964 3300013296 Unclassified 642
557 Ga0157378_10169314 3300013297 Bacteria 2048
558 Ga0157378_10241364 3300013297 Bacteria 1726
559 Ga0157378_10422051 3300013297 Bacteria 1318
560 Ga0157378_12083694 3300013297 Unclassified 618
561 Ga0163162_10026961 3300013306 Bacteria 5682
562 Ga0163162_10071926 3300013306 Bacteria 3512
563 Ga0163162_10181727 3300013306 Bacteria 2229
564 Ga0163162_10252818 3300013306 Bacteria 1894
565 Ga0163162_10349476 3300013306 Bacteria 1611
566 Ga0157372_10084269 3300013307 Bacteria 3602
567 Ga0157372_10169656 3300013307 Bacteria 2524
568 Ga0157372_10329250 3300013307 Bacteria 1779
569 Ga0157372_10364339 3300013307 Bacteria 1684
570 Ga0157372_10370324 3300013307 Bacteria 1669
571 Ga0157372_10656094 3300013307 Bacteria 1222
572 Ga0157372_10665933 3300013307 Bacteria 1212
573 Ga0157375_10007791 3300013308 Bacteria 9370
574 Ga0157375_10111770 3300013308 Bacteria 2831
575 Ga0157375_10157812 3300013308 Bacteria 2409
576 Ga0157375_10218371 3300013308 Bacteria 2064
577 Ga0157375_10293950 3300013308 Bacteria 1788
578 Ga0157375_10372560 3300013308 Bacteria 1594
579 Ga0157375_10627275 3300013308 Bacteria 1233
580 Ga0157375_10701300 3300013308 Unclassified 1166
581 Ga0157375_10834928 3300013308 Unclassified 1069
582 Ga0157375_11469067 3300013308 Bacteria 804
583 Ga0163163_10014909 3300014325 Bacteria 7160
584 Ga0163163_10032667 3300014325 Bacteria 5028
585 Ga0163163_10046892 3300014325 Bacteria 4245
586 Ga0163163_10248080 3300014325 Bacteria 1831
587 Ga0163163_12117751 3300014325 Unclassified 622
588 Ga0157380_10001874 3300014326 Bacteria 13928
589 Ga0157380_10102664 3300014326 Bacteria 2384
590 Ga0157380_10469056 3300014326 Bacteria 1214
591 Ga0157380_10701516 3300014326 Bacteria 1017
592 Ga0157380_13164161 3300014326 Bacteria 525
593 Ga0157377_10068051 3300014745 Bacteria 2051
594 Ga0157379_10066503 3300014968 Bacteria 3222
595 Ga0157379_10387372 3300014968 Bacteria 1283
596 Ga0157376_10734961 3300014969 Unclassified 995
597 Ga0163161_10043368 3300017792 Bacteria 3239
598 Ga0163161_10192874 3300017792 Bacteria 1567
599 Ga0163161_10542661 3300017792 Bacteria 952
600 Ga0207666_1004772 3300025271 Bacteria 1711
601 Ga0207697_10000125 3300025315 Bacteria 36703
602 Ga0207697_10024331 3300025315 Bacteria 2479
603 Ga0207697_10052006 3300025315 Bacteria 1694
604 Ga0207697_10315493 3300025315 Bacteria 694
605 Ga0207656_10039715 3300025321 Bacteria 1992
606 Ga0207656_10090555 3300025321 Bacteria 1388
607 Ga0207656_10140724 3300025321 Bacteria 1137
608 Ga0207682_10029197 3300025893 Bacteria 2204
609 Ga0207682_10029229 3300025893 Bacteria 2203
610 Ga0207682_10153943 3300025893 Bacteria 1038
611 Ga0207642_10052227 3300025899 Bacteria 1853
612 Ga0207642_10109659 3300025899 Bacteria 1403
613 Ga0207688_10062268 3300025901 Bacteria 2103
614 Ga0207688_10272336 3300025901 Bacteria 1030
615 Ga0207688_10416103 3300025901 Bacteria 835
616 Ga0207688_10731433 3300025901 Bacteria 626
617 Ga0207680_10070685 3300025903 Bacteria 2161
618 Ga0207680_10120442 3300025903 Bacteria 1715
619 Ga0207680_10239311 3300025903 Bacteria 1250
620 Ga0207680_10395261 3300025903 Bacteria 976
621 Ga0207680_10808881 3300025903 Unclassified 672
622 Ga0207680_11093120 3300025903 Unclassified 570
623 Ga0207647_10005235 3300025904 Bacteria 9550
624 Ga0207647_10011896 3300025904 Bacteria 6080
625 Ga0207647_10021521 3300025904 Bacteria 4303
626 Ga0207647_10028174 3300025904 Bacteria 3652
627 Ga0207647_10030798 3300025904 Bacteria 3458
628 Ga0207647_10048121 3300025904 Bacteria 2649
629 Ga0207647_10064675 3300025904 Bacteria 2222
630 Ga0207647_10070020 3300025904 Bacteria 2120
631 Ga0207647_10192341 3300025904 Unclassified 1182
632 Ga0207647_10330489 3300025904 Bacteria 865
633 Ga0207647_10488299 3300025904 Bacteria 687
634 Ga0207699_10050902 3300025906 Bacteria 2445
635 Ga0207645_10002197 3300025907 Bacteria 15580
636 Ga0207645_10017940 3300025907 Bacteria 4667
637 Ga0207645_10029921 3300025907 Bacteria 3510
638 Ga0207645_10041107 3300025907 Bacteria 2961
639 Ga0207645_10058158 3300025907 Bacteria 2468
640 Ga0207645_10512243 3300025907 Bacteria 813
641 Ga0207643_10041314 3300025908 Bacteria 2598
642 Ga0207643_10167946 3300025908 Bacteria 1323
643 Ga0207705_10000050 3300025909 Bacteria 170078
644 Ga0207705_10000096 3300025909 Bacteria 105775
645 Ga0207705_10000427 3300025909 Bacteria 36755
646 Ga0207705_10009681 3300025909 Bacteria 7009
647 Ga0207705_10021471 3300025909 Bacteria 4608
648 Ga0207705_10028455 3300025909 Bacteria 3984
649 Ga0207705_10065813 3300025909 Bacteria 2621
650 Ga0207705_10072837 3300025909 Bacteria 2492
651 Ga0207705_10098595 3300025909 Bacteria 2147
652 Ga0207705_10122836 3300025909 Bacteria 1928
653 Ga0207705_10194836 3300025909 Bacteria 1534
654 Ga0207705_10238915 3300025909 Bacteria 1383
655 Ga0207705_10247132 3300025909 Bacteria 1360
656 Ga0207705_10261261 3300025909 Bacteria 1322
657 Ga0207705_10772189 3300025909 Unclassified 746
658 Ga0207654_10104871 3300025911 Bacteria 1748
659 Ga0207654_10412535 3300025911 Bacteria 941
660 Ga0207654_10836401 3300025911 Bacteria 666
661 Ga0207654_11030757 3300025911 Bacteria 599
662 Ga0207707_10042493 3300025912 Bacteria 3966
663 Ga0207707_10452038 3300025912 Unclassified 1099
664 Ga0207707_10505580 3300025912 Bacteria 1030
665 Ga0207707_10618613 3300025912 Bacteria 915
666 Ga0207695_10008871 3300025913 Bacteria 12520
667 Ga0207695_10023987 3300025913 Bacteria 6879
668 Ga0207695_10430823 3300025913 Bacteria 1203
669 Ga0207671_10080019 3300025914 Bacteria 2449
670 Ga0207693_10114470 3300025915 Bacteria 2116
671 Ga0207693_10134864 3300025915 Bacteria 1941
672 Ga0207663_10511877 3300025916 Bacteria 934
673 Ga0207660_10013211 3300025917 Bacteria 5408
674 Ga0207660_10032646 3300025917 Bacteria 3594
675 Ga0207660_10060550 3300025917 Bacteria 2722
676 Ga0207660_10221708 3300025917 Bacteria 1484
677 Ga0207660_10337692 3300025917 Bacteria 1205
678 Ga0207660_11008757 3300025917 Unclassified 679
679 Ga0207662_10123538 3300025918 Bacteria 1625
680 Ga0207657_10000020 3300025919 Bacteria 157826
681 Ga0207657_10000121 3300025919 Bacteria 78211
682 Ga0207657_10004865 3300025919 Bacteria 14135
683 Ga0207657_10007083 3300025919 Bacteria 11521
684 Ga0207657_10007573 3300025919 Bacteria 11129
685 Ga0207657_10009128 3300025919 Bacteria 10007
686 Ga0207657_10012711 3300025919 Bacteria 8294
687 Ga0207657_10014993 3300025919 Bacteria 7528
688 Ga0207657_10025734 3300025919 Bacteria 5420
689 Ga0207657_10047702 3300025919 Bacteria 3743
690 Ga0207657_10058337 3300025919 Bacteria 3322
691 Ga0207657_10069445 3300025919 Bacteria 2989
692 Ga0207657_10091621 3300025919 Bacteria 2534
693 Ga0207657_10196417 3300025919 Bacteria 1625
694 Ga0207657_10234437 3300025919 Bacteria 1467
695 Ga0207657_10516075 3300025919 Bacteria 935
696 Ga0207657_10578451 3300025919 Bacteria 877
697 Ga0207657_10585987 3300025919 Bacteria 871
698 Ga0207657_11297325 3300025919 Bacteria 550
699 Ga0207649_10000506 3300025920 Bacteria 27465
700 Ga0207649_10007579 3300025920 Bacteria 5900
701 Ga0207649_10017878 3300025920 Bacteria 4021
702 Ga0207649_10037806 3300025920 Bacteria 2918
703 Ga0207649_10040028 3300025920 Bacteria 2845
704 Ga0207649_10139619 3300025920 Bacteria 1656
705 Ga0207649_10569901 3300025920 Unclassified 868
706 Ga0207649_10586771 3300025920 Unclassified 856
707 Ga0207652_10028238 3300025921 Bacteria 4680
708 Ga0207652_10085106 3300025921 Bacteria 2771
709 Ga0207652_10110231 3300025921 Bacteria 2440
710 Ga0207652_10168694 3300025921 Bacteria 1963
711 Ga0207652_10240141 3300025921 Bacteria 1633
712 Ga0207652_10257174 3300025921 Bacteria 1575
713 Ga0207681_10002579 3300025923 Bacteria 11483
714 Ga0207681_10002864 3300025923 Bacteria 10902
715 Ga0207681_10291361 3300025923 Bacteria 1288
716 Ga0207681_10542823 3300025923 Bacteria 956
717 Ga0207681_10815145 3300025923 Bacteria 780
718 Ga0207681_11783801 3300025923 Bacteria 513
719 Ga0207694_10087083 3300025924 Bacteria 2460
720 Ga0207694_10093562 3300025924 Bacteria 2374
721 Ga0207694_10417669 3300025924 Unclassified 1117
722 Ga0207650_10002017 3300025925 Bacteria 14217
723 Ga0207650_10019270 3300025925 Bacteria 4791
724 Ga0207650_10090597 3300025925 Bacteria 2336
725 Ga0207650_10119202 3300025925 Bacteria 2052
726 Ga0207650_10141653 3300025925 Bacteria 1891
727 Ga0207650_10154555 3300025925 Bacteria 1813
728 Ga0207650_10505457 3300025925 Bacteria 1010
729 Ga0207659_10001571 3300025926 Bacteria 13556
730 Ga0207659_10225787 3300025926 Bacteria 1508
731 Ga0207659_10427802 3300025926 Unclassified 1111
732 Ga0207659_10583705 3300025926 Bacteria 952
733 Ga0207687_10079060 3300025927 Bacteria 2370
734 Ga0207687_10088266 3300025927 Bacteria 2255
735 Ga0207687_10158717 3300025927 Bacteria 1733
736 Ga0207700_10088334 3300025928 Bacteria 2440
737 Ga0207664_10041480 3300025929 Bacteria 3585
738 Ga0207664_10189873 3300025929 Bacteria 1768
739 Ga0207644_10003740 3300025931 Bacteria 9861
740 Ga0207644_10005380 3300025931 Bacteria 8347
741 Ga0207644_10007254 3300025931 Bacteria 7216
742 Ga0207644_10030297 3300025931 Bacteria 3762
743 Ga0207644_10257048 3300025931 Bacteria 1395
744 Ga0207644_10267265 3300025931 Bacteria 1369
745 Ga0207644_10280429 3300025931 Bacteria 1338
746 Ga0207690_10006299 3300025932 Bacteria 7031
747 Ga0207690_10012501 3300025932 Bacteria 5079
748 Ga0207690_10027712 3300025932 Bacteria 3582
749 Ga0207690_10100348 3300025932 Bacteria 2066
750 Ga0207690_10116712 3300025932 Bacteria 1931
751 Ga0207690_10116798 3300025932 Bacteria 1930
752 Ga0207690_10206733 3300025932 Unclassified 1494
753 Ga0207690_10348918 3300025932 Bacteria 1170
754 Ga0207690_10469787 3300025932 Bacteria 1014
755 Ga0207706_10000227 3300025933 Bacteria 61528
756 Ga0207706_10001553 3300025933 Bacteria 22757
757 Ga0207706_10004783 3300025933 Bacteria 12682
758 Ga0207706_10014733 3300025933 Bacteria 7082
759 Ga0207706_10016841 3300025933 Bacteria 6596
760 Ga0207706_10094756 3300025933 Bacteria 2626
761 Ga0207706_10095124 3300025933 Bacteria 2620
762 Ga0207706_10105146 3300025933 Bacteria 2484
763 Ga0207706_10119525 3300025933 Bacteria 2317
764 Ga0207706_10156703 3300025933 Bacteria 2002
765 Ga0207706_10359222 3300025933 Bacteria 1266
766 Ga0207706_10486726 3300025933 Bacteria 1066
767 Ga0207706_10803896 3300025933 Bacteria 799
768 Ga0207706_11079470 3300025933 Bacteria 672
769 Ga0207686_10272670 3300025934 Unclassified 1245
770 Ga0207709_10051225 3300025935 Bacteria 2530
771 Ga0207709_10210826 3300025935 Bacteria 1394
772 Ga0207709_10880335 3300025935 Bacteria 727
773 Ga0207670_10636141 3300025936 Bacteria 879
774 Ga0207670_10875807 3300025936 Bacteria 751
775 Ga0207669_10025946 3300025937 Bacteria 3178
776 Ga0207669_10050642 3300025937 Bacteria 2484
777 Ga0207669_10304651 3300025937 Bacteria 1212
778 Ga0207669_10418488 3300025937 Bacteria 1054
779 Ga0207669_10535739 3300025937 Bacteria 942
780 Ga0207704_10057256 3300025938 Bacteria 2393
781 Ga0207704_10133841 3300025938 Unclassified 1722
782 Ga0207704_10134842 3300025938 Bacteria 1717
783 Ga0207704_11121900 3300025938 Bacteria 669
784 Ga0207665_10136296 3300025939 Bacteria 1747
785 Ga0207691_10019020 3300025940 Bacteria 6505
786 Ga0207691_10028391 3300025940 Bacteria 5239
787 Ga0207691_10045805 3300025940 Bacteria 4020
788 Ga0207691_10075505 3300025940 Bacteria 3039
789 Ga0207691_10175443 3300025940 Bacteria 1875
790 Ga0207691_10253030 3300025940 Bacteria 1520
791 Ga0207691_10656691 3300025940 Unclassified 886
792 Ga0207711_10009897 3300025941 Bacteria 7927
793 Ga0207711_10037328 3300025941 Bacteria 4126
794 Ga0207711_10045198 3300025941 Bacteria 3763
795 Ga0207711_10046296 3300025941 Bacteria 3717
796 Ga0207711_10109342 3300025941 Bacteria 2456
797 Ga0207711_10121282 3300025941 Bacteria 2334
798 Ga0207711_10145897 3300025941 Bacteria 2132
799 Ga0207711_10311613 3300025941 Bacteria 1453
800 Ga0207689_10032793 3300025942 Bacteria 4318
801 Ga0207689_10055263 3300025942 Bacteria 3268
802 Ga0207689_10071979 3300025942 Bacteria 2840
803 Ga0207689_10232523 3300025942 Bacteria 1523
804 Ga0207689_10251073 3300025942 Bacteria 1463
805 Ga0207661_10012590 3300025944 Bacteria 6154
806 Ga0207661_10109388 3300025944 Bacteria 2335
807 Ga0207661_10109729 3300025944 Bacteria 2331
808 Ga0207661_10617809 3300025944 Bacteria 995
809 Ga0207661_10635694 3300025944 Unclassified 980
810 Ga0207679_10003062 3300025945 Bacteria 10354
811 Ga0207679_10067031 3300025945 Bacteria 2692
812 Ga0207679_10080128 3300025945 Bacteria 2492
813 Ga0207679_10083852 3300025945 Bacteria 2444
814 Ga0207679_10372568 3300025945 Bacteria 1250
815 Ga0207679_10488446 3300025945 Bacteria 1097
816 Ga0207679_10927883 3300025945 Unclassified 797
817 Ga0207667_10000569 3300025949 Bacteria 48202
818 Ga0207667_10014067 3300025949 Bacteria 9135
819 Ga0207667_10018650 3300025949 Bacteria 7775
820 Ga0207667_10039122 3300025949 Bacteria 5056
821 Ga0207667_10084959 3300025949 Bacteria 3276
822 Ga0207667_10132413 3300025949 Bacteria 2568
823 Ga0207667_10151675 3300025949 Bacteria 2385
824 Ga0207667_10197996 3300025949 Bacteria 2061
825 Ga0207667_11396986 3300025949 Unclassified 674
826 Ga0207651_10025332 3300025960 Bacteria 3685
827 Ga0207651_10059926 3300025960 Bacteria 2639
828 Ga0207651_10099404 3300025960 Bacteria 2154
829 Ga0207651_10273382 3300025960 Bacteria 1392
830 Ga0207651_10304534 3300025960 Bacteria 1326
831 Ga0207651_10472357 3300025960 Bacteria 1079
832 Ga0207651_10509721 3300025960 Bacteria 1041
833 Ga0207651_10897479 3300025960 Bacteria 789
834 Ga0207712_10007493 3300025961 Bacteria 6891
835 Ga0207712_10007951 3300025961 Bacteria 6701
836 Ga0207712_10767621 3300025961 Bacteria 846
837 Ga0207712_11009852 3300025961 Unclassified 738
838 Ga0207668_10000825 3300025972 Bacteria 18837
839 Ga0207668_10001859 3300025972 Bacteria 12319
840 Ga0207668_10005359 3300025972 Bacteria 7545
841 Ga0207668_10112547 3300025972 Bacteria 2045
842 Ga0207668_10426226 3300025972 Bacteria 1127
843 Ga0207668_10468477 3300025972 Bacteria 1078
844 Ga0207668_10595569 3300025972 Bacteria 962
845 Ga0207668_10945605 3300025972 Bacteria 768
846 Ga0207668_11110602 3300025972 Bacteria 709
847 Ga0207640_10000150 3300025981 Bacteria 50663
848 Ga0207640_10001724 3300025981 Bacteria 11732
849 Ga0207640_10008931 3300025981 Bacteria 5585
850 Ga0207640_10051180 3300025981 Bacteria 2684
851 Ga0207640_10130657 3300025981 Bacteria 1815
852 Ga0207640_10158826 3300025981 Bacteria 1670
853 Ga0207640_10206750 3300025981 Bacteria 1492
854 Ga0207640_10571312 3300025981 Bacteria 953
855 Ga0207640_10609238 3300025981 Bacteria 925
856 Ga0207640_11814685 3300025981 Bacteria 551
857 Ga0207658_10008032 3300025986 Bacteria 7188
858 Ga0207658_10015973 3300025986 Bacteria 5157
859 Ga0207658_10027403 3300025986 Bacteria 4002
860 Ga0207658_10035436 3300025986 Bacteria 3574
861 Ga0207658_10042508 3300025986 Bacteria 3297
862 Ga0207658_10265209 3300025986 Bacteria 1465
863 Ga0207658_10285156 3300025986 Bacteria 1417
864 Ga0207658_10333101 3300025986 Bacteria 1317
865 Ga0207658_10377617 3300025986 Bacteria 1240
866 Ga0207658_10499207 3300025986 Bacteria 1083
867 Ga0207658_10783228 3300025986 Bacteria 865
868 Ga0207677_10001255 3300026023 Bacteria 13664
869 Ga0207677_10011783 3300026023 Bacteria 4999
870 Ga0207677_10197396 3300026023 Bacteria 1596
871 Ga0207677_10568208 3300026023 Bacteria 991
872 Ga0207677_10755699 3300026023 Bacteria 867
873 Ga0207703_10003718 3300026035 Bacteria 12695
874 Ga0207703_10104334 3300026035 Bacteria 2408
875 Ga0207703_10152558 3300026035 Bacteria 2016
876 Ga0207703_10181545 3300026035 Bacteria 1857
877 Ga0207703_10531311 3300026035 Bacteria 1107
878 Ga0207703_10640933 3300026035 Unclassified 1007
879 Ga0207703_10697816 3300026035 Bacteria 965
880 Ga0207703_11199754 3300026035 Unclassified 729
881 Ga0207639_10006803 3300026041 Bacteria 7782
882 Ga0207639_10017178 3300026041 Bacteria 5128
883 Ga0207639_10176747 3300026041 Bacteria 1813
884 Ga0207639_10402154 3300026041 Bacteria 1234
885 Ga0207639_10434778 3300026041 Bacteria 1189
886 Ga0207639_10480570 3300026041 Bacteria 1132
887 Ga0207639_10728369 3300026041 Bacteria 921
888 Ga0207678_10001002 3300026067 Bacteria 25724
889 Ga0207678_10010787 3300026067 Bacteria 8028
890 Ga0207678_10016130 3300026067 Bacteria 6560
891 Ga0207678_10021030 3300026067 Bacteria 5719
892 Ga0207678_10031331 3300026067 Bacteria 4639
893 Ga0207678_10035339 3300026067 Bacteria 4351
894 Ga0207678_10054178 3300026067 Bacteria 3454
895 Ga0207678_10118176 3300026067 Bacteria 2262
896 Ga0207678_10238951 3300026067 Bacteria 1556
897 Ga0207678_10253336 3300026067 Bacteria 1508
898 Ga0207678_10276128 3300026067 Bacteria 1442
899 Ga0207678_10331680 3300026067 Bacteria 1310
900 Ga0207678_10517369 3300026067 Bacteria 1041
901 Ga0207678_10657247 3300026067 Unclassified 921
902 Ga0207708_10080591 3300026075 Bacteria 2501
903 Ga0207708_11004634 3300026075 Bacteria 725
904 Ga0207702_10008681 3300026078 Bacteria 8569
905 Ga0207702_10011992 3300026078 Bacteria 7206
906 Ga0207702_10018089 3300026078 Bacteria 5832
907 Ga0207702_10019239 3300026078 Bacteria 5649
908 Ga0207702_10250976 3300026078 Bacteria 1661
909 Ga0207702_10512496 3300026078 Bacteria 1170
910 Ga0207641_10047789 3300026088 Bacteria 3610
911 Ga0207641_10114403 3300026088 Bacteria 2397
912 Ga0207641_10322891 3300026088 Bacteria 1464
913 Ga0207641_10382295 3300026088 Bacteria 1348
914 Ga0207641_10644395 3300026088 Bacteria 1040
915 Ga0207648_10032760 3300026089 Bacteria 4586
916 Ga0207648_10048998 3300026089 Bacteria 3698
917 Ga0207648_10057617 3300026089 Bacteria 3389
918 Ga0207648_10133544 3300026089 Bacteria 2185
919 Ga0207648_10257429 3300026089 Bacteria 1557
920 Ga0207648_10599814 3300026089 Bacteria 1015
921 Ga0207648_11370386 3300026089 Bacteria 665
922 Ga0207676_10010027 3300026095 Bacteria 6741
923 Ga0207676_10019953 3300026095 Bacteria 4896
924 Ga0207676_10024017 3300026095 Bacteria 4507
925 Ga0207676_10553947 3300026095 Bacteria 1099
926 Ga0207676_10555705 3300026095 Bacteria 1097
927 Ga0207676_11732101 3300026095 Unclassified 623
928 Ga0207674_10008179 3300026116 Bacteria 12125
929 Ga0207674_10009466 3300026116 Bacteria 11129
930 Ga0207674_10016105 3300026116 Bacteria 8190
931 Ga0207674_10019363 3300026116 Bacteria 7374
932 Ga0207674_10031959 3300026116 Bacteria 5524
933 Ga0207674_10348034 3300026116 Bacteria 1433
934 Ga0207675_100009775 3300026118 Bacteria 8976
935 Ga0207675_100199406 3300026118 Bacteria 1922
936 Ga0207675_100759494 3300026118 Bacteria 981
937 Ga0207675_100980647 3300026118 Bacteria 863
938 Ga0207683_10003970 3300026121 Bacteria 12833
939 Ga0207683_10007389 3300026121 Bacteria 9418
940 Ga0207683_10014357 3300026121 Bacteria 6747
941 Ga0207698_10002372 3300026142 Bacteria 11170
942 Ga0207698_10004554 3300026142 Bacteria 8465
943 Ga0207698_10074367 3300026142 Bacteria 2710
944 Ga0207698_10317849 3300026142 Bacteria 1457
945 Ga0207698_10383642 3300026142 Bacteria 1338
946 Ga0207698_10403149 3300026142 Bacteria 1308
947 Ga0207698_10450450 3300026142 Bacteria 1242
948 Ga0207698_10490746 3300026142 Bacteria 1193
949 Ga0207698_10855616 3300026142 Bacteria 914
950 Ga0207698_11481420 3300026142 Unclassified 694
951 Ga0209970_1028805 3300027614 Bacteria 959
952 Ga0209974_10007547 3300027876 Bacteria 3743
953 Ga0209974_10024430 3300027876 Bacteria 2000
954 Ga0209974_10120084 3300027876 Bacteria 931
955 Ga0209974_10138104 3300027876 Bacteria 873
956 Ga0207428_10138049 3300027907 Bacteria 1863
957 Ga0207428_10396259 3300027907 Bacteria 1011
958 Ga0268266_10014620 3300028379 Bacteria 6745
959 Ga0268266_10060637 3300028379 Bacteria 3261
960 Ga0268266_10323343 3300028379 Bacteria 1444
961 Ga0268266_10725846 3300028379 Bacteria 958
962 Ga0268265_10000742 3300028380 Bacteria 31819
963 Ga0268265_10018582 3300028380 Bacteria 4820
964 Ga0268265_10025807 3300028380 Bacteria 4175
965 Ga0268265_10077971 3300028380 Bacteria 2604
966 Ga0268265_10170735 3300028380 Bacteria 1858
967 Ga0268265_10288363 3300028380 Bacteria 1472
968 Ga0268265_10309706 3300028380 Bacteria 1425
969 Ga0268265_10500374 3300028380 Bacteria 1145
970 Ga0268265_11184368 3300028380 Unclassified 761
971 Ga0268265_11850864 3300028380 Bacteria 610
972 Ga0268264_10025721 3300028381 Bacteria 4808
973 Ga0268264_10056687 3300028381 Bacteria 3275
974 Ga0268264_10105955 3300028381 Bacteria 2453
975 Ga0268264_10127854 3300028381 Bacteria 2248
976 Ga0268264_10542326 3300028381 Bacteria 1140
977 Ga0268264_10580508 3300028381 Bacteria 1103
978 Ga0268264_11080782 3300028381 Bacteria 810
979 Ga0307408_100030897 3300031548 Bacteria 3724
980 Ga0307408_100134604 3300031548 Bacteria 1932
981 Ga0307408_100141527 3300031548 Bacteria 1889
982 Ga0307408_100266165 3300031548 Bacteria 1421
983 Ga0307408_100596734 3300031548 Bacteria 980
984 Ga0307408_100634566 3300031548 Bacteria 953
985 Ga0307405_10033158 3300031731 Bacteria 3060
986 Ga0307405_10036036 3300031731 Bacteria 2961
987 Ga0307405_10105275 3300031731 Bacteria 1900
988 Ga0307405_10181951 3300031731 Bacteria 1510
989 Ga0307405_10187599 3300031731 Bacteria 1490
990 Ga0307405_10251710 3300031731 Bacteria 1315
991 Ga0307405_10318300 3300031731 Bacteria 1187
992 Ga0307405_10822889 3300031731 Unclassified 780
993 Ga0307413_10003630 3300031824 Bacteria 6546
994 Ga0307413_10033784 3300031824 Bacteria 2916
995 Ga0307413_10061334 3300031824 Bacteria 2320
996 Ga0307413_10085230 3300031824 Bacteria 2039
997 Ga0307413_10311974 3300031824 Bacteria 1197
998 Ga0307413_10560415 3300031824 Bacteria 928
999 Ga0307410_10065722 3300031852 Bacteria 2495
1000 Ga0307410_10088249 3300031852 Bacteria 2195
1001 Ga0307410_10111280 3300031852 Bacteria 1981
1002 Ga0307410_10160478 3300031852 Bacteria 1684
1003 Ga0307410_10313084 3300031852 Bacteria 1243
1004 Ga0307410_11010967 3300031852 Bacteria 717
1005 Ga0307410_11022886 3300031852 Bacteria 713
1006 Ga0307410_11085675 3300031852 Bacteria 693
1007 Ga0307406_10030604 3300031901 Bacteria 3270
1008 Ga0307406_10123312 3300031901 Bacteria 1805
1009 Ga0307406_10787079 3300031901 Bacteria 801
1010 Ga0307406_10836383 3300031901 Bacteria 779
1011 Ga0307407_10045410 3300031903 Bacteria 2482
1012 Ga0307407_10114689 3300031903 Bacteria 1697
1013 Ga0307407_10119378 3300031903 Bacteria 1669
1014 Ga0307407_10142994 3300031903 Bacteria 1546
1015 Ga0307412_10130108 3300031911 Bacteria 1827
1016 Ga0307412_10218057 3300031911 Bacteria 1460
1017 Ga0307412_10298319 3300031911 Bacteria 1272
1018 Ga0307412_10299720 3300031911 Bacteria 1270
1019 Ga0307409_100134017 3300031995 Bacteria 2122
1020 Ga0307409_100165512 3300031995 Bacteria 1940
1021 Ga0307409_100336964 3300031995 Bacteria 1417
1022 Ga0307409_100601105 3300031995 Unclassified 1087
1023 Ga0307409_100640591 3300031995 Bacteria 1055
1024 Ga0307409_100752091 3300031995 Unclassified 978
1025 Ga0307409_101145289 3300031995 Bacteria 800
1026 Ga0307409_101207458 3300031995 Bacteria 780
1027 Ga0307416_100000897 3300032002 Bacteria 15724
1028 Ga0307416_100085150 3300032002 Bacteria 2689
1029 Ga0307416_100102227 3300032002 Bacteria 2498
1030 Ga0307416_100111745 3300032002 Bacteria 2410
1031 Ga0307416_100824964 3300032002 Bacteria 1024
1032 Ga0307416_100912447 3300032002 Unclassified 979
1033 Ga0307416_101543933 3300032002 Bacteria 769
1034 Ga0307416_102183418 3300032002 Bacteria 655
1035 Ga0307414_10007804 3300032004 Bacteria 6035
1036 Ga0307414_10021208 3300032004 Bacteria 4070
1037 Ga0307414_10075158 3300032004 Bacteria 2451
1038 Ga0307414_10146739 3300032004 Bacteria 1855
1039 Ga0307414_10360913 3300032004 Bacteria 1250
1040 Ga0307414_10396384 3300032004 Bacteria 1197
1041 Ga0307414_10444445 3300032004 Bacteria 1136
1042 Ga0307414_10550492 3300032004 Bacteria 1028
1043 Ga0307411_10010234 3300032005 Bacteria 4986
1044 Ga0307411_10494034 3300032005 Bacteria 1033
1045 Ga0307411_10729202 3300032005 Bacteria 866
1046 Ga0307411_10730153 3300032005 Bacteria 866
1047 Ga0307411_11196061 3300032005 Bacteria 689
1048 Ga0307411_11305284 3300032005 Unclassified 661
1049 Ga0307415_100029822 3300032126 Bacteria 3491
1050 Ga0307415_100047672 3300032126 Bacteria 2885
1051 Ga0307415_100047859 3300032126 Bacteria 2881
1052 Ga0307415_100056083 3300032126 Bacteria 2699
1053 Ga0307415_100596208 3300032126 Bacteria 982
1054 Ga0307415_100850061 3300032126 Bacteria 837
1055 Ga0307415_100996659 3300032126 Bacteria 778
1056 Ga0307415_101066092 3300032126 Unclassified 755
1057 Ga0307415_101518349 3300032126 Bacteria 641
1058 Ga0373944_0144278 3300035089 Bacteria 835
1059 Ga0373936_0243638 3300035113 Bacteria 802
1060 Ga0373941_0047475 3300035115 Bacteria 1353
1061 Ga0373924_0407082 3300035410 Bacteria 608
1062 Ga0373931_0270339 3300035691 Bacteria 1040
1063 Ga0373935_0405861 3300035692 Bacteria 979
1064 Ga0395899_0000781 3300037312 Bacteria 31286
1065 Ga0395899_0023067 3300037312 Bacteria 4716
1066 Ga0395899_0025369 3300037312 Bacteria 4474
1067 Ga0395899_0041125 3300037312 Bacteria 3454
1068 Ga0395899_0084539 3300037312 Bacteria 2306
1069 Ga0395899_0126652 3300037312 Bacteria 1826
1070 Ga0395899_0153404 3300037312 Bacteria 1631
1071 Ga0395899_0166649 3300037312 Bacteria 1554
1072 Ga0395899_0241024 3300037312 Bacteria 1244
1073 Ga0395899_0249599 3300037312 Bacteria 1218
1074 Ga0395899_0254551 3300037312 Bacteria 1203
1075 Ga0395899_0294802 3300037312 Bacteria 1099
1076 Ga0395900_0000136 3300037418 Bacteria 123664
1077 Ga0395900_0008940 3300037418 Bacteria 10272
1078 Ga0395900_0017045 3300037418 Bacteria 7416
1079 Ga0395900_0019502 3300037418 Bacteria 6913
1080 Ga0395900_0025891 3300037418 Bacteria 6005
1081 Ga0395900_0028578 3300037418 Bacteria 5714
1082 Ga0395900_0031858 3300037418 Bacteria 5420
1083 Ga0395900_0044305 3300037418 Bacteria 4585
1084 Ga0395900_0046360 3300037418 Bacteria 4475
1085 Ga0395900_0108159 3300037418 Bacteria 2857
1086 Ga0395900_0137821 3300037418 Bacteria 2500
1087 Ga0395900_0146514 3300037418 Bacteria 2414
1088 Ga0395900_0179500 3300037418 Bacteria 2152
1089 Ga0395900_0205115 3300037418 Bacteria 1992
1090 Ga0395900_0331631 3300037418 Bacteria 1499
1091 Ga0395900_0997433 3300037418 Bacteria 757
1092 Ga0395900_1284623 3300037418 Bacteria 646
1093 Ga0395900_1515327 3300037418 Bacteria 582
1094 Ga0395900_1515459 3300037418 Unclassified 582
1095 Ga0395898_0009082 3300037466 Bacteria 10469
1096 Ga0395898_0012373 3300037466 Bacteria 8824
1097 Ga0395898_0017533 3300037466 Bacteria 7309
1098 Ga0395898_0047850 3300037466 Bacteria 4194
1099 Ga0395898_0051432 3300037466 Bacteria 4028
1100 Ga0395898_0061826 3300037466 Bacteria 3638
1101 Ga0395898_0064734 3300037466 Bacteria 3545
1102 Ga0395898_0101637 3300037466 Bacteria 2760
1103 Ga0395898_0292700 3300037466 Bacteria 1553
1104 Ga0395898_0504120 3300037466 Unclassified 1151
1105 Ga0395898_0901774 3300037466 Bacteria 822
1106 Ga0395898_1416887 3300037466 Unclassified 622
1107 Ga0395898_1535244 3300037466 Bacteria 591
1108 Ga0395905_0001050 3300037471 Bacteria 34941
1109 Ga0395905_0001483 3300037471 Bacteria 28096
1110 Ga0395905_0012680 3300037471 Bacteria 8109
1111 Ga0395905_0015368 3300037471 Bacteria 7275
1112 Ga0395905_0019243 3300037471 Bacteria 6473
1113 Ga0395905_0039223 3300037471 Bacteria 4443
1114 Ga0395905_0066065 3300037471 Bacteria 3387
1115 Ga0395905_0069116 3300037471 Bacteria 3308
1116 Ga0395905_0118518 3300037471 Bacteria 2488
1117 Ga0395905_0139309 3300037471 Bacteria 2282
1118 Ga0395905_0153478 3300037471 Bacteria 2166
1119 Ga0395905_0191507 3300037471 Bacteria 1918
1120 Ga0395905_0223146 3300037471 Bacteria 1763
1121 Ga0395905_0328516 3300037471 Unclassified 1419
1122 Ga0395905_0392019 3300037471 Bacteria 1283
1123 Ga0395905_0482383 3300037471 Bacteria 1139
1124 Ga0395905_0637519 3300037471 Bacteria 967
1125 Ga0395905_0804188 3300037471 Bacteria 843
1126 Ga0395905_1096534 3300037471 Bacteria 699
1127 Ga0395905_1351138 3300037471 Unclassified 616
1128 Ga0395901_0000108 3300038443 Bacteria 113046
1129 Ga0395901_0002936 3300038443 Bacteria 17201
1130 Ga0395901_0004646 3300038443 Bacteria 13853
1131 Ga0395901_0039013 3300038443 Bacteria 4913
1132 Ga0395901_0039711 3300038443 Bacteria 4871
1133 Ga0395901_0053477 3300038443 Bacteria 4195
1134 Ga0395901_0086405 3300038443 Bacteria 3279
1135 Ga0395901_0101233 3300038443 Bacteria 3023
1136 Ga0395901_0121209 3300038443 Bacteria 2748
1137 Ga0395901_0186803 3300038443 Bacteria 2173
1138 Ga0395901_0388894 3300038443 Bacteria 1434
1139 Ga0395901_0834035 3300038443 Unclassified 908
1140 Ga0395901_1322247 3300038443 Unclassified 682
1141 Ga0395901_1961573 3300038443 Unclassified 532
1142 Ga0439465_0166761 3300041413 Bacteria 792
1143 Ga0439432_016131 3300042006 Bacteria 2516
1144 Ga0439432_099241 3300042006 Bacteria 872
1145 Ga0439432_154796 3300042006 Bacteria 672
1146 Ga0439449_0172995 3300042007 Unclassified 807
1147 Ga0439455_0094007 3300042012 Bacteria 824
1148 Ga0439455_0174964 3300042012 Bacteria 617
1149 Ga0450890_024699 3300042127 Bacteria 831
1150 Ga0439446_0193173 3300042156 Bacteria 685
1151 Ga0439464_0043409 3300042439 Bacteria 1286
1152 Ga0466972_0029294 3300044658 Bacteria 2710
1153 Ga0466972_0489675 3300044658 Bacteria 579
1154 Ga0466965_0110231 3300044683 Bacteria 1414
1155 Ga0466963_0043823 3300044694 Bacteria 2943
1156 Ga0466963_0667746 3300044694 Bacteria 733
1157 Ga0466970_0543951 3300044765 Bacteria 671
1158 Ga0466957_0342877 3300044842 Bacteria 1012
1159 Ga0466960_0035855 3300044901 Bacteria 2320
1160 Ga0466960_0081490 3300044901 Bacteria 1632
1161 Ga0466960_0199259 3300044901 Bacteria 1093
1162 Ga0466958_0287991 3300045836 Bacteria 1053
1163 Ga0466967_0071859 3300045976 Bacteria 3099
1164 Ga0466967_0094408 3300045976 Bacteria 2724
1165 Ga0466967_0165884 3300045976 Bacteria 2076
1166 Ga0466967_0587289 3300045976 Unclassified 1099
1167 Ga0466967_1032495 3300045976 Unclassified 819
1168 Ga0495629_0578741 3300046459 Unclassified 752
1169 Ga0495580_0158367 3300046472 Bacteria 1568
1170 Ga0495620_0044307 3300046515 Bacteria 1934
1171 Ga0495663_0005460 3300046525 Bacteria 3527
1172 Ga0495663_0049970 3300046525 Bacteria 1292
1173 Ga0495663_0165123 3300046525 Bacteria 761
1174 Ga0495663_0208295 3300046525 Bacteria 684
1175 Ga0495642_0012146 3300046528 Bacteria 3318
1176 Ga0495598_0015046 3300046537 Bacteria 1944
1177 Ga0495598_0077628 3300046537 Bacteria 1059
1178 Ga0495598_0296252 3300046537 Unclassified 611
1179 Ga0495621_0023514 3300046539 Bacteria 2050
1180 Ga0495621_0061905 3300046539 Unclassified 1360
1181 Ga0495621_0081882 3300046539 Bacteria 1204
1182 Ga0495621_0166757 3300046539 Unclassified 873
1183 Ga0495621_0211211 3300046539 Unclassified 783
1184 Ga0495633_0030048 3300046558 Bacteria 2641
1185 Ga0495633_0043846 3300046558 Bacteria 2121
1186 Ga0495633_0054672 3300046558 Bacteria 1878
1187 Ga0495668_0197529 3300046616 Bacteria 1101
1188 Ga0495668_0246815 3300046616 Bacteria 977
1189 Ga0495668_0395123 3300046616 Bacteria 760
1190 Ga0495668_0677014 3300046616 Unclassified 570
1191 Ga0495625_0218118 3300046660 Bacteria 1251
1192 Ga0495659_0043311 3300046664 Bacteria 1614
1193 Ga0495659_0365036 3300046664 Unclassified 619
1194 Ga0495669_0005058 3300046684 Bacteria 5482
1195 Ga0495669_0007043 3300046684 Bacteria 4708
1196 Ga0495669_0025727 3300046684 Bacteria 2568
1197 Ga0495669_0079185 3300046684 Bacteria 1506
1198 Ga0495669_0120942 3300046684 Bacteria 1227
1199 Ga0495669_0122502 3300046684 Bacteria 1220
1200 Ga0495669_0143059 3300046684 Bacteria 1129
1201 Ga0495669_0232258 3300046684 Unclassified 885
1202 Ga0495669_0392115 3300046684 Bacteria 672
1203 Ga0495670_0020479 3300046691 Bacteria 3262
1204 Ga0495670_0065219 3300046691 Bacteria 1835
1205 Ga0495670_0119029 3300046691 Bacteria 1371
1206 Ga0495670_0149512 3300046691 Bacteria 1224
1207 Ga0495670_0170685 3300046691 Bacteria 1145
1208 Ga0495670_0194866 3300046691 Bacteria 1072
1209 Ga0495670_0202139 3300046691 Bacteria 1052
1210 Ga0495677_0021793 3300047445 Bacteria 2322
1211 Ga0495677_0034800 3300047445 Bacteria 1838
1212 Ga0495677_0342571 3300047445 Unclassified 589
1213 Ga0495677_0378132 3300047445 Bacteria 560
1214 Ga0496100_0085702 3300048903 Bacteria 2138
1215 Ga0496100_0496446 3300048903 Unclassified 940
1216 Ga0496101_0161112 3300048904 Bacteria 1720
1217 Ga0496101_0698212 3300048904 Unclassified 801
1218 Ga0496102_0490045 3300048905 Bacteria 1151
1219 Ga0496103_0177243 3300048906 Bacteria 1370
1220 Ga0496106_0522980 3300048909 Bacteria 953
1221 Ga0496106_1261806 3300048909 Unclassified 575
1222 Ga0496107_0043771 3300048910 Bacteria 3217
1223 Ga0496107_0057346 3300048910 Bacteria 2815
1224 Ga0496107_0078527 3300048910 Bacteria 2405
1225 Ga0496107_0147077 3300048910 Bacteria 1742
1226 Ga0496107_0249453 3300048910 Bacteria 1321
1227 Ga0496107_0349600 3300048910 Bacteria 1100
1228 Ga0496107_0380655 3300048910 Bacteria 1050
1229 Ga0496107_0505628 3300048910 Bacteria 896
1230 Ga0496107_0527396 3300048910 Bacteria 875
1231 Ga0496108_0096616 3300048911 Bacteria 2517
1232 Ga0496108_0167957 3300048911 Bacteria 1897
1233 Ga0496108_1183342 3300048911 Unclassified 647
1234 Ga0496108_1773054 3300048911 Bacteria 506
1235 Ga0496109_0008125 3300048912 Bacteria 8896
1236 Ga0496109_0713582 3300048912 Bacteria 940
1237 Ga0496110_0017898 3300048913 Bacteria 5933
1238 Ga0496110_0034885 3300048913 Bacteria 4361
1239 Ga0496110_0683039 3300048913 Bacteria 927
1240 Ga0496110_0777317 3300048913 Bacteria 861
1241 Ga0496110_0798806 3300048913 Bacteria 848
1242 Ga0496111_0108109 3300048914 Unclassified 2048
1243 Ga0496111_0147079 3300048914 Bacteria 1747
1244 Ga0496112_1016653 3300048915 Bacteria 748
1245 Ga0496113_1395864 3300048916 Unclassified 543
1246 Ga0496114_0018218 3300048917 Bacteria 5675
1247 Ga0496115_0301864 3300048918 Unclassified 1312
1248 Ga0501292_108688 3300049515 Bacteria 556
1249 Ga0501043_1116163 3300049579 Unclassified 557
1250 Ga0501068_0127010 3300049584 Bacteria 1593
1251 Ga0501069_0764950 3300049585 Unclassified 584
1252 Ga0501074_0340296 3300049590 Bacteria 1065
1253 Ga0501235_038754 3300049669 Bacteria 1087
1254 Ga0501235_177148 3300049669 Bacteria 566
1255 Ga0501249_009088 3300049679 Bacteria 2066
1256 Ga0501249_077660 3300049679 Bacteria 779
1257 Ga0501250_096361 3300049680 Bacteria 522
1258 Ga0501225_0155798 3300049705 Unclassified 699
1259 Ga0501080_0809390 3300049742 Unclassified 821
1260 Ga0501267_022597 3300049764 Bacteria 702
1261 Ga0501268_044022 3300049765 Bacteria 848
1262 Ga0501268_108819 3300049765 Bacteria 602
1263 nmdc:mga09592_697851_c1 3300050508 Bacteria 864
1264 nmdc:mga06r32_10994_c1 3300050510 Bacteria 8148
1265 nmdc:mga06r32_281694_c1 3300050510 Bacteria 1649
1266 nmdc:mga08y16_35183_c1 3300050511 Bacteria 5261
1267 nmdc:mga08y16_491956_c1 3300050511 Bacteria 1247
1268 nmdc:mga0rr50_836237_c1 3300050513 Bacteria 785
1269 nmdc:mga08x19_257352_c1 3300050514 Bacteria 1206
1270 nmdc:mga0a205_14261_c1 3300050515 Bacteria 7410
1271 Ga0500658_0000885 3300053134 Bacteria 12286
1272 Ga0500627_0349591 3300053158 Bacteria 638
1273 Ga0590077_120641 3300059426 Unclassified 620
1274 Ga0501082_0932758 3300060353 Unclassified 759
1275 Ga0466962_0238331 3300061719 Bacteria 893
1276 Ga0068871_100152947
1277 MRS1b_contig_533257
1278 JGI24736J21556_1026976
1279 JGI24741J21665_1005635
1280 JGI24741J21665_1005772
1281 JGI24741J21665_1013845
1282 JGI24746J21847_1019206
1283 JGI24740J21852_10004553
1284 JGI24740J21852_10034405
1285 JGI24740J21852_10073746
1286 JGI24739J22299_10008998
1287 JGI24739J22299_10014811
1288 JGI24737J22298_10010644
1289 JGI24737J22298_10057973
1290 JGI24737J22298_10143936
1291 JGI24737J22298_10155028
1292 JGI24735J21928_10003922
1293 JGI24735J21928_10005033
1294 JGI24735J21928_10046983
1295 JGI24735J21928_10059043
1296 JGI24745J21846_1010379
1297 JGI24738J21930_10015179
1298 JGI24749J21850_1000468
1299 rootH1_10190186
1300 rootH1_10036968
1301 rootH1_10313897
1302 Ga0065704_10538470
1303 Ga0065712_10189202
1304 Ga0065712_10258104
1305 Ga0065715_10037128
1306 Ga0065715_10089302
1307 Ga0065715_10209169
1308 Ga0065715_10358220
1309 Ga0065707_10532745
1310 Ga0070658_10007543
1311 Ga0070658_10020274
1312 Ga0070658_10034596
1313 Ga0070658_10039920
1314 Ga0070658_10062241
1315 Ga0070658_10110092
1316 Ga0070658_10125696
1317 Ga0070658_10246727
1318 Ga0070658_10296291
1319 Ga0070658_10594667
1320 Ga0070658_11181670
1321 Ga0070658_11252924
1322 Ga0070658_11256597
1323 Ga0070676_10033432
1324 Ga0070676_10204737
1325 Ga0070676_10350338
1326 Ga0070676_10514144
1327 Ga0070683_100005870
1328 Ga0070683_100032150
1329 Ga0070683_100059930
1330 Ga0070683_100092153
1331 Ga0070683_100197177
1332 Ga0070683_100201665
1333 Ga0070690_100314181
1334 Ga0070670_100001315
1335 Ga0070670_100006142
1336 Ga0070670_100012634
1337 Ga0070670_100051186
1338 Ga0070670_100106797
1339 Ga0070670_100140792
1340 Ga0070677_10002184
1341 Ga0070677_10023594
1342 Ga0070677_10107976
1343 Ga0070677_10391486
1344 Ga0068869_100059475
1345 Ga0068869_100067006
1346 Ga0068869_100253019
1347 Ga0068869_100404467
1348 Ga0068869_100664942
1349 Ga0070666_10029572
1350 Ga0070666_10133723
1351 Ga0070666_10242957
1352 Ga0070666_10247068
1353 Ga0070666_10270239
1354 Ga0070666_10784535
1355 Ga0070680_100001836
1356 Ga0070680_100003369
1357 Ga0070680_100009885
1358 Ga0070680_100038411
1359 Ga0070680_100076250
1360 Ga0070680_100125064
1361 Ga0070680_100126387
1362 Ga0070680_100134853
1363 Ga0070680_100212514
1364 Ga0070680_100298933
1365 Ga0070680_100458884
1366 Ga0070680_100590985
1367 Ga0070682_100035741
1368 Ga0070682_100076755
1369 Ga0070682_100091549
1370 Ga0070682_100273251
1371 Ga0068868_100012105
1372 Ga0068868_100012499
1373 Ga0068868_100055450
1374 Ga0068868_100141673
1375 Ga0068868_100509575
1376 Ga0068868_100651354
1377 Ga0068868_100796086
1378 Ga0070660_100000039
1379 Ga0070660_100004919
1380 Ga0070660_100019326
1381 Ga0070660_100019583
1382 Ga0070660_100023245
1383 Ga0070660_100041255
1384 Ga0070660_100094564
1385 Ga0070660_100128367
1386 Ga0070660_100222071
1387 Ga0070660_100262169
1388 Ga0070660_100271790
1389 Ga0070660_100354091
1390 Ga0070660_100553854
1391 Ga0070689_100346345
1392 Ga0070689_101461514
1393 Ga0070691_10004396
1394 Ga0070691_10149364
1395 Ga0070691_10322647
1396 Ga0070687_100096232
1397 Ga0070687_100540494
1398 Ga0070661_100040947
1399 Ga0070661_100044510
1400 Ga0070661_100046877
1401 Ga0070661_100056312
1402 Ga0070661_100072441
1403 Ga0070661_100090700
1404 Ga0070661_100095553
1405 Ga0070661_100222721
1406 Ga0070661_100224296
1407 Ga0070661_100224310
1408 Ga0070661_100271995
1409 Ga0070661_100282749
1410 Ga0070661_100319888
1411 Ga0070661_100508134
1412 Ga0070661_100552216
1413 Ga0070661_100899075
1414 Ga0070661_101787325
1415 Ga0070692_10002594
1416 Ga0070692_10017920
1417 Ga0070692_10050058
1418 Ga0070692_10076732
1419 Ga0070668_100001463
1420 Ga0070668_100003995
1421 Ga0070668_100005678
1422 Ga0070668_100067019
1423 Ga0070668_100215657
1424 Ga0070668_100297354
1425 Ga0070668_100370449
1426 Ga0070668_101065343
1427 Ga0070668_101628264
1428 Ga0070669_100005485
1429 Ga0070669_100075508
1430 Ga0070669_100101965
1431 Ga0070669_100137341
1432 Ga0070669_100304124
1433 Ga0070669_100345251
1434 Ga0070669_100404743
1435 Ga0070669_100489101
1436 Ga0070669_100905050
1437 Ga0070669_101000723
1438 Ga0070675_100003732
1439 Ga0070675_100041977
1440 Ga0070675_100165305
1441 Ga0070675_100397963
1442 Ga0070675_100433252
1443 Ga0070675_100524848
1444 Ga0070675_101805848
1445 Ga0070671_100006378
1446 Ga0070671_100007905
1447 Ga0070671_100020554
1448 Ga0070671_100111805
1449 Ga0070671_100150719
1450 Ga0070671_100203542
1451 Ga0070671_100226914
1452 Ga0070671_100266924
1453 Ga0070671_100761451
1454 Ga0070674_100001916
1455 Ga0070674_100006554
1456 Ga0070674_100162917
1457 Ga0070674_100331105
1458 Ga0070674_100672424
1459 Ga0070674_101928256
1460 Ga0070674_101957288
1461 Ga0070673_100013721
1462 Ga0070673_100041827
1463 Ga0070673_100093106
1464 Ga0070673_100093289
1465 Ga0070673_100138558
1466 Ga0070673_100263458
1467 Ga0070673_100912859
1468 Ga0070673_100924128
1469 Ga0070673_101013212
1470 Ga0070688_101064657
1471 Ga0070659_100004539
1472 Ga0070659_100020207
1473 Ga0070659_100049380
1474 Ga0070659_100050846
1475 Ga0070659_100061071
1476 Ga0070659_100120651
1477 Ga0070659_100150101
1478 Ga0070659_100153538
1479 Ga0070659_100625820
1480 Ga0070659_102092137
1481 Ga0070667_100004542
1482 Ga0070667_100005869
1483 Ga0070667_100007896
1484 Ga0070667_100018041
1485 Ga0070667_100058152
1486 Ga0070667_100127304
1487 Ga0070667_100257179
1488 Ga0070667_100299595
1489 Ga0070667_100319490
1490 Ga0070667_100397517
1491 Ga0070667_100480224
1492 Ga0070667_100984117
1493 Ga0070714_100112267
1494 Ga0070701_10084829
1495 Ga0070701_10256861
1496 Ga0070705_101841420
1497 Ga0070700_100014633
1498 Ga0070694_100173630
1499 Ga0070663_100009038
1500 Ga0070663_100015085
1501 Ga0070663_100030785
1502 Ga0070663_100070715
1503 Ga0070663_100214271
1504 Ga0070663_100231522
1505 Ga0070663_100461978
1506 Ga0070663_100592055
1507 Ga0070663_100691622
1508 Ga0070678_100006804
1509 Ga0070678_100015288
1510 Ga0070678_100129045
1511 Ga0070678_101102559
1512 Ga0070662_100003714
1513 Ga0070662_100010824
1514 Ga0070662_100013265
1515 Ga0070662_100025367
1516 Ga0070662_100075506
1517 Ga0070662_100186032
1518 Ga0070662_100254061
1519 Ga0070662_100267722
1520 Ga0070662_100273490
1521 Ga0070662_100275700
1522 Ga0070662_100392791
1523 Ga0070662_100499205
1524 Ga0070662_100767165
1525 Ga0070662_101132275
1526 Ga0070662_101376179
1527 Ga0070662_101916292
1528 Ga0070681_10069291
1529 Ga0070681_10107741
1530 Ga0070681_10144489
1531 Ga0070681_10154891
1532 Ga0070681_10175751
1533 Ga0070681_10561239
1534 Ga0070681_10735413
1535 Ga0070681_10977268
1536 Ga0068867_100006233
1537 Ga0068867_100009574
1538 Ga0068867_100094198
1539 Ga0068867_100109910
1540 Ga0068867_100197153
1541 Ga0068867_100390124
1542 Ga0070685_10830461
1543 Ga0070685_11088270
1544 Ga0070685_11124171
1545 Ga0070685_11187737
1546 Ga0070679_100021063
1547 Ga0070679_100030314
1548 Ga0070679_100039777
1549 Ga0070679_100042192
1550 Ga0070679_100118290
1551 Ga0070679_100367618
1552 Ga0070679_100489224
1553 Ga0070679_100689193
1554 Ga0070679_101397484
1555 Ga0070679_101411791
1556 Ga0070684_100049962
1557 Ga0070684_100100583
1558 Ga0070684_100402659
1559 Ga0070684_100557561
1560 Ga0070684_100671908
1561 Ga0068853_100091049
1562 Ga0068853_100135865
1563 Ga0068853_100221589
1564 Ga0068853_100417476
1565 Ga0068853_100434494
1566 Ga0070672_100003248
1567 Ga0070672_100033069
1568 Ga0070672_100065229
1569 Ga0070672_100137434
1570 Ga0070672_100282601
1571 Ga0070672_100638659
1572 Ga0070672_100719176
1573 Ga0070672_101119520
1574 Ga0070686_100009625
1575 Ga0070695_100387988
1576 Ga0070696_100549847
1577 Ga0070696_100779876
1578 Ga0070696_100914700
1579 Ga0070693_100065916
1580 Ga0070693_100116241
1581 Ga0070693_101102718
1582 Ga0070665_100015013
1583 Ga0070665_100015126
1584 Ga0070665_100066009
1585 Ga0070665_100365963
1586 Ga0070665_100416306
1587 Ga0070665_100713179
1588 Ga0070665_100861389
1589 Ga0070704_100116020
1590 Ga0070704_101857081
1591 Ga0068855_100000135
1592 Ga0068855_100007630
1593 Ga0068855_100099732
1594 Ga0068855_100207398
1595 Ga0068855_100452993
1596 Ga0068855_100507085
1597 Ga0068855_100717954
1598 Ga0068855_100718166
1599 Ga0068855_101128092
1600 Ga0068855_101153628
1601 Ga0068855_101466393
1602 Ga0070664_100006486
1603 Ga0070664_100025708
1604 Ga0070664_100031368
1605 Ga0070664_100081264
1606 Ga0070664_100090002
1607 Ga0070664_100097919
1608 Ga0070664_100316599
1609 Ga0070664_100528439
1610 Ga0070664_100851788
1611 Ga0070664_102083931
1612 Ga0068857_100014654
1613 Ga0068857_100037507
1614 Ga0068857_100176691
1615 Ga0068857_100934483
1616 Ga0068854_100000126
1617 Ga0068854_100027685
1618 Ga0068854_100029890
1619 Ga0068854_100114552
1620 Ga0068854_100203569
1621 Ga0068854_100360167
1622 Ga0068854_100505783
1623 Ga0068854_100844039
1624 Ga0068854_100926156
1625 Ga0068856_100006459
1626 Ga0068856_100013705
1627 Ga0068856_100051897
1628 Ga0068856_100080444
1629 Ga0068856_100290270
1630 Ga0068856_100323108
1631 Ga0068856_100686819
1632 Ga0068856_100688765
1633 Ga0068856_100740984
1634 Ga0068856_102551105
1635 Ga0068852_100006802
1636 Ga0068852_100016531
1637 Ga0068852_100026484
1638 Ga0068852_100034043
1639 Ga0068852_100039498
1640 Ga0068852_100081404
1641 Ga0068852_100105338
1642 Ga0068852_100263265
1643 Ga0068852_100315053
1644 Ga0068852_100365225
1645 Ga0068852_100414422
1646 Ga0068852_100457208
1647 Ga0068852_100499780
1648 Ga0068852_100696084
1649 Ga0068852_101320064
1650 Ga0068852_102386009
1651 Ga0068859_100001731
1652 Ga0068859_100162075
1653 Ga0068859_100331316
1654 Ga0068859_100515150
1655 Ga0068859_100523950
1656 Ga0068859_100524014
1657 Ga0068864_100014661
1658 Ga0068864_100255877
1659 Ga0068864_100328761
1660 Ga0068864_100351886
1661 Ga0068866_10042109
1662 Ga0068866_10251089
1663 Ga0068861_100004724
1664 Ga0068861_100068594
1665 Ga0068851_10009825
1666 Ga0068851_10336566
1667 Ga0068851_10545734
1668 Ga0068851_10840327
1669 Ga0068870_10021698
1670 Ga0068870_10205754
1671 Ga0068870_10549563
1672 Ga0068863_100052246
1673 Ga0068863_100062786
1674 Ga0068863_100110662
1675 Ga0068863_100124004
1676 Ga0068863_100282462
1677 Ga0068863_101700737
1678 Ga0068863_102582696
1679 Ga0068858_100016457
1680 Ga0068858_100027958
1681 Ga0068858_100079908
1682 Ga0068858_100108259
1683 Ga0068858_100126851
1684 Ga0068858_100745323
1685 Ga0068858_101585407
1686 Ga0068858_102325114
1687 Ga0068860_100002719
1688 Ga0068860_100010737
1689 Ga0068860_100243779
1690 Ga0068860_100289726
1691 Ga0068860_100371936
1692 Ga0068860_100478267
1693 Ga0068862_100005184
1694 Ga0068862_100008143
1695 Ga0068862_100017537
1696 Ga0068862_100056361
1697 Ga0068862_100084288
1698 Ga0068862_100122738
1699 Ga0068862_100297562
1700 Ga0068862_100654722
1701 Ga0068862_100945329
1702 Ga0068862_101506331
1703 Ga0070712_100155418
1704 Ga0070712_100175530
1705 Ga0097621_100014653
1706 Ga0097621_100033135
1707 Ga0097621_100174474
1708 Ga0097621_100435104
1709 Ga0097621_100506016
1710 Ga0097621_101078168
1711 Ga0075370_10864897
1712 Ga0068871_100020901
1713 Ga0068871_100036121
1714 Ga0068871_100287309
1715 Ga0068871_100701193
1716 Ga0068871_101702639
1717 Ga0075428_101068151
1718 Ga0075431_100306760
1719 Ga0075433_10025826
1720 Ga0075434_100194392
1721 Ga0075434_100274963
1722 Ga0075429_100604207
1723 Ga0068865_100012058
1724 Ga0068865_100167073
1725 Ga0068865_100245191
1726 Ga0068865_101210596
1727 Ga0097620_100001731
1728 Ga0097620_100162098
1729 Ga0097620_100331313
1730 Ga0097620_100515126
1731 Ga0097620_100523945
1732 Ga0097620_100524039
1733 Ga0105240_10005847
1734 Ga0105240_10078416
1735 Ga0105240_10273038
1736 Ga0105240_10848248
1737 Ga0105240_11668656
1738 Ga0111539_10011004
1739 Ga0111539_10232692
1740 Ga0105245_10042689
1741 Ga0105245_10284396
1742 Ga0105245_10341587
1743 Ga0105245_11272798
1744 Ga0105247_10748761
1745 Ga0105247_10754032
1746 Ga0105243_10195542
1747 Ga0105243_10257635
1748 Ga0105243_10432367
1749 Ga0105243_10807932
1750 Ga0105241_10193231
1751 Ga0105241_10456027
1752 Ga0105241_10510246
1753 Ga0105241_10598425
1754 Ga0105241_11587518
1755 Ga0105242_10118482
1756 Ga0105242_10698689
1757 Ga0105242_12583851
1758 Ga0105248_10022148
1759 Ga0105248_10096279
1760 Ga0105248_10105650
1761 Ga0105248_10142031
1762 Ga0105248_10536681
1763 Ga0105248_10646425
1764 Ga0105248_11619222
1765 Ga0105237_10006949
1766 Ga0105238_10016954
1767 Ga0105238_10072864
1768 Ga0105238_10278434
1769 Ga0105249_10002721
1770 Ga0105249_10136833
1771 Ga0105249_10143357
1772 Ga0105249_10261680
1773 Ga0105249_11416239
1774 Ga0105239_10352736
1775 Ga0105239_10575766
1776 Ga0105239_11345146
1777 Ga0105246_10154155
1778 Ga0105246_10273816
1779 Ga0105246_11001800
1780 Ga0105246_11141654
1781 Ga0157327_1011930
1782 Ga0157373_10002119
1783 Ga0157373_10035549
1784 Ga0157373_10046948
1785 Ga0157373_10056534
1786 Ga0157373_10060446
1787 Ga0157373_10070142
1788 Ga0157373_10075171
1789 Ga0157373_10122626
1790 Ga0157373_10155213
1791 Ga0157373_10209963
1792 Ga0157373_10238484
1793 Ga0157373_10344569
1794 Ga0157373_10383948
1795 Ga0157373_11307979
1796 Ga0157371_10002495
1797 Ga0157371_10014711
1798 Ga0157371_10019728
1799 Ga0157371_10020129
1800 Ga0157371_10031491
1801 Ga0157371_10038566
1802 Ga0157371_10049084
1803 Ga0157371_10084600
1804 Ga0157371_10118177
1805 Ga0157371_10139863
1806 Ga0157371_10172498
1807 Ga0157371_10189256
1808 Ga0157371_10332470
1809 Ga0157371_10369985
1810 Ga0157371_10488040
1811 Ga0157371_10613188
1812 Ga0157370_10003030
1813 Ga0157370_10041207
1814 Ga0157370_10052675
1815 Ga0157370_10084124
1816 Ga0157370_10153171
1817 Ga0157370_10378622
1818 Ga0157370_10713486
1819 Ga0157370_10776410
1820 Ga0157370_11051720
1821 Ga0157369_10006058
1822 Ga0157369_10014079
1823 Ga0157369_10101060
1824 Ga0157369_10105327
1825 Ga0157369_10154510
1826 Ga0157369_10160829
1827 Ga0157369_10420521
1828 Ga0157374_10002970
1829 Ga0157374_10116962
1830 Ga0157374_11572092
1831 Ga0157374_11776964
1832 Ga0157378_10169314
1833 Ga0157378_10241364
1834 Ga0157378_10422051
1835 Ga0157378_12083694
1836 Ga0163162_10026961
1837 Ga0163162_10071926
1838 Ga0163162_10181727
1839 Ga0163162_10252818
1840 Ga0163162_10349476
1841 Ga0157372_10084269
1842 Ga0157372_10169656
1843 Ga0157372_10329250
1844 Ga0157372_10364339
1845 Ga0157372_10370324
1846 Ga0157372_10656094
1847 Ga0157372_10665933
1848 Ga0157375_10007791
1849 Ga0157375_10111770
1850 Ga0157375_10157812
1851 Ga0157375_10218371
1852 Ga0157375_10293950
1853 Ga0157375_10372560
1854 Ga0157375_10627275
1855 Ga0157375_10701300
1856 Ga0157375_10834928
1857 Ga0157375_11469067
1858 Ga0163163_10014909
1859 Ga0163163_10032667
1860 Ga0163163_10046892
1861 Ga0163163_10248080
1862 Ga0163163_12117751
1863 Ga0157380_10001874
1864 Ga0157380_10102664
1865 Ga0157380_10469056
1866 Ga0157380_10701516
1867 Ga0157380_13164161
1868 Ga0157377_10068051
1869 Ga0157379_10066503
1870 Ga0157379_10387372
1871 Ga0157376_10734961
1872 Ga0163161_10043368
1873 Ga0163161_10192874
1874 Ga0163161_10542661
1875 Ga0207666_1004772
1876 Ga0207697_10000125
1877 Ga0207697_10024331
1878 Ga0207697_10052006
1879 Ga0207697_10315493
1880 Ga0207656_10039715
1881 Ga0207656_10090555
1882 Ga0207656_10140724
1883 Ga0207682_10029197
1884 Ga0207682_10029229
1885 Ga0207682_10153943
1886 Ga0207642_10052227
1887 Ga0207642_10109659
1888 Ga0207688_10062268
1889 Ga0207688_10272336
1890 Ga0207688_10416103
1891 Ga0207688_10731433
1892 Ga0207680_10070685
1893 Ga0207680_10120442
1894 Ga0207680_10239311
1895 Ga0207680_10395261
1896 Ga0207680_10808881
1897 Ga0207680_11093120
1898 Ga0207647_10005235
1899 Ga0207647_10011896
1900 Ga0207647_10021521
1901 Ga0207647_10028174
1902 Ga0207647_10030798
1903 Ga0207647_10048121
1904 Ga0207647_10064675
1905 Ga0207647_10070020
1906 Ga0207647_10192341
1907 Ga0207647_10330489
1908 Ga0207647_10488299
1909 Ga0207699_10050902
1910 Ga0207645_10002197
1911 Ga0207645_10017940
1912 Ga0207645_10029921
1913 Ga0207645_10041107
1914 Ga0207645_10058158
1915 Ga0207645_10512243
1916 Ga0207643_10041314
1917 Ga0207643_10167946
1918 Ga0207705_10000050
1919 Ga0207705_10000096
1920 Ga0207705_10000427
1921 Ga0207705_10009681
1922 Ga0207705_10021471
1923 Ga0207705_10028455
1924 Ga0207705_10065813
1925 Ga0207705_10072837
1926 Ga0207705_10098595
1927 Ga0207705_10122836
1928 Ga0207705_10194836
1929 Ga0207705_10238915
1930 Ga0207705_10247132
1931 Ga0207705_10261261
1932 Ga0207705_10772189
1933 Ga0207654_10104871
1934 Ga0207654_10412535
1935 Ga0207654_10836401
1936 Ga0207654_11030757
1937 Ga0207707_10042493
1938 Ga0207707_10452038
1939 Ga0207707_10505580
1940 Ga0207707_10618613
1941 Ga0207695_10008871
1942 Ga0207695_10023987
1943 Ga0207695_10430823
1944 Ga0207671_10080019
1945 Ga0207693_10114470
1946 Ga0207693_10134864
1947 Ga0207663_10511877
1948 Ga0207660_10013211
1949 Ga0207660_10032646
1950 Ga0207660_10060550
1951 Ga0207660_10221708
1952 Ga0207660_10337692
1953 Ga0207660_11008757
1954 Ga0207662_10123538
1955 Ga0207657_10000020
1956 Ga0207657_10000121
1957 Ga0207657_10004865
1958 Ga0207657_10007083
1959 Ga0207657_10007573
1960 Ga0207657_10009128
1961 Ga0207657_10012711
1962 Ga0207657_10014993
1963 Ga0207657_10025734
1964 Ga0207657_10047702
1965 Ga0207657_10058337
1966 Ga0207657_10069445
1967 Ga0207657_10091621
1968 Ga0207657_10196417
1969 Ga0207657_10234437
1970 Ga0207657_10516075
1971 Ga0207657_10578451
1972 Ga0207657_10585987
1973 Ga0207657_11297325
1974 Ga0207649_10000506
1975 Ga0207649_10007579
1976 Ga0207649_10017878
1977 Ga0207649_10037806
1978 Ga0207649_10040028
1979 Ga0207649_10139619
1980 Ga0207649_10569901
1981 Ga0207649_10586771
1982 Ga0207652_10028238
1983 Ga0207652_10085106
1984 Ga0207652_10110231
1985 Ga0207652_10168694
1986 Ga0207652_10240141
1987 Ga0207652_10257174
1988 Ga0207681_10002579
1989 Ga0207681_10002864
1990 Ga0207681_10291361
1991 Ga0207681_10542823
1992 Ga0207681_10815145
1993 Ga0207681_11783801
1994 Ga0207694_10087083
1995 Ga0207694_10093562
1996 Ga0207694_10417669
1997 Ga0207650_10002017
1998 Ga0207650_10019270
1999 Ga0207650_10090597
2000 Ga0207650_10119202
2001 Ga0207650_10141653
2002 Ga0207650_10154555
2003 Ga0207650_10505457
2004 Ga0207659_10001571
2005 Ga0207659_10225787
2006 Ga0207659_10427802
2007 Ga0207659_10583705
2008 Ga0207687_10079060
2009 Ga0207687_10088266
2010 Ga0207687_10158717
2011 Ga0207700_10088334
2012 Ga0207664_10041480
2013 Ga0207664_10189873
2014 Ga0207644_10003740
2015 Ga0207644_10005380
2016 Ga0207644_10007254
2017 Ga0207644_10030297
2018 Ga0207644_10257048
2019 Ga0207644_10267265
2020 Ga0207644_10280429
2021 Ga0207690_10006299
2022 Ga0207690_10012501
2023 Ga0207690_10027712
2024 Ga0207690_10100348
2025 Ga0207690_10116712
2026 Ga0207690_10116798
2027 Ga0207690_10206733
2028 Ga0207690_10348918
2029 Ga0207690_10469787
2030 Ga0207706_10000227
2031 Ga0207706_10001553
2032 Ga0207706_10004783
2033 Ga0207706_10014733
2034 Ga0207706_10016841
2035 Ga0207706_10094756
2036 Ga0207706_10095124
2037 Ga0207706_10105146
2038 Ga0207706_10119525
2039 Ga0207706_10156703
2040 Ga0207706_10359222
2041 Ga0207706_10486726
2042 Ga0207706_10803896
2043 Ga0207706_11079470
2044 Ga0207686_10272670
2045 Ga0207709_10051225
2046 Ga0207709_10210826
2047 Ga0207709_10880335
2048 Ga0207670_10636141
2049 Ga0207670_10875807
2050 Ga0207669_10025946
2051 Ga0207669_10050642
2052 Ga0207669_10304651
2053 Ga0207669_10418488
2054 Ga0207669_10535739
2055 Ga0207704_10057256
2056 Ga0207704_10133841
2057 Ga0207704_10134842
2058 Ga0207704_11121900
2059 Ga0207665_10136296
2060 Ga0207691_10019020
2061 Ga0207691_10028391
2062 Ga0207691_10045805
2063 Ga0207691_10075505
2064 Ga0207691_10175443
2065 Ga0207691_10253030
2066 Ga0207691_10656691
2067 Ga0207711_10009897
2068 Ga0207711_10037328
2069 Ga0207711_10045198
2070 Ga0207711_10046296
2071 Ga0207711_10109342
2072 Ga0207711_10121282
2073 Ga0207711_10145897
2074 Ga0207711_10311613
2075 Ga0207689_10032793
2076 Ga0207689_10055263
2077 Ga0207689_10071979
2078 Ga0207689_10232523
2079 Ga0207689_10251073
2080 Ga0207661_10012590
2081 Ga0207661_10109388
2082 Ga0207661_10109729
2083 Ga0207661_10617809
2084 Ga0207661_10635694
2085 Ga0207679_10003062
2086 Ga0207679_10067031
2087 Ga0207679_10080128
2088 Ga0207679_10083852
2089 Ga0207679_10372568
2090 Ga0207679_10488446
2091 Ga0207679_10927883
2092 Ga0207667_10000569
2093 Ga0207667_10014067
2094 Ga0207667_10018650
2095 Ga0207667_10039122
2096 Ga0207667_10084959
2097 Ga0207667_10132413
2098 Ga0207667_10151675
2099 Ga0207667_10197996
2100 Ga0207667_11396986
2101 Ga0207651_10025332
2102 Ga0207651_10059926
2103 Ga0207651_10099404
2104 Ga0207651_10273382
2105 Ga0207651_10304534
2106 Ga0207651_10472357
2107 Ga0207651_10509721
2108 Ga0207651_10897479
2109 Ga0207712_10007493
2110 Ga0207712_10007951
2111 Ga0207712_10767621
2112 Ga0207712_11009852
2113 Ga0207668_10000825
2114 Ga0207668_10001859
2115 Ga0207668_10005359
2116 Ga0207668_10112547
2117 Ga0207668_10426226
2118 Ga0207668_10468477
2119 Ga0207668_10595569
2120 Ga0207668_10945605
2121 Ga0207668_11110602
2122 Ga0207640_10000150
2123 Ga0207640_10001724
2124 Ga0207640_10008931
2125 Ga0207640_10051180
2126 Ga0207640_10130657
2127 Ga0207640_10158826
2128 Ga0207640_10206750
2129 Ga0207640_10571312
2130 Ga0207640_10609238
2131 Ga0207640_11814685
2132 Ga0207658_10008032
2133 Ga0207658_10015973
2134 Ga0207658_10027403
2135 Ga0207658_10035436
2136 Ga0207658_10042508
2137 Ga0207658_10265209
2138 Ga0207658_10285156
2139 Ga0207658_10333101
2140 Ga0207658_10377617
2141 Ga0207658_10499207
2142 Ga0207658_10783228
2143 Ga0207677_10001255
2144 Ga0207677_10011783
2145 Ga0207677_10197396
2146 Ga0207677_10568208
2147 Ga0207677_10755699
2148 Ga0207703_10003718
2149 Ga0207703_10104334
2150 Ga0207703_10152558
2151 Ga0207703_10181545
2152 Ga0207703_10531311
2153 Ga0207703_10640933
2154 Ga0207703_10697816
2155 Ga0207703_11199754
2156 Ga0207639_10006803
2157 Ga0207639_10017178
2158 Ga0207639_10176747
2159 Ga0207639_10402154
2160 Ga0207639_10434778
2161 Ga0207639_10480570
2162 Ga0207639_10728369
2163 Ga0207678_10001002
2164 Ga0207678_10010787
2165 Ga0207678_10016130
2166 Ga0207678_10021030
2167 Ga0207678_10031331
2168 Ga0207678_10035339
2169 Ga0207678_10054178
2170 Ga0207678_10118176
2171 Ga0207678_10238951
2172 Ga0207678_10253336
2173 Ga0207678_10276128
2174 Ga0207678_10331680
2175 Ga0207678_10517369
2176 Ga0207678_10657247
2177 Ga0207708_10080591
2178 Ga0207708_11004634
2179 Ga0207702_10008681
2180 Ga0207702_10011992
2181 Ga0207702_10018089
2182 Ga0207702_10019239
2183 Ga0207702_10250976
2184 Ga0207702_10512496
2185 Ga0207641_10047789
2186 Ga0207641_10114403
2187 Ga0207641_10322891
2188 Ga0207641_10382295
2189 Ga0207641_10644395
2190 Ga0207648_10032760
2191 Ga0207648_10048998
2192 Ga0207648_10057617
2193 Ga0207648_10133544
2194 Ga0207648_10257429
2195 Ga0207648_10599814
2196 Ga0207648_11370386
2197 Ga0207676_10010027
2198 Ga0207676_10019953
2199 Ga0207676_10024017
2200 Ga0207676_10553947
2201 Ga0207676_10555705
2202 Ga0207676_11732101
2203 Ga0207674_10008179
2204 Ga0207674_10009466
2205 Ga0207674_10016105
2206 Ga0207674_10019363
2207 Ga0207674_10031959
2208 Ga0207674_10348034
2209 Ga0207675_100009775
2210 Ga0207675_100199406
2211 Ga0207675_100759494
2212 Ga0207675_100980647
2213 Ga0207683_10003970
2214 Ga0207683_10007389
2215 Ga0207683_10014357
2216 Ga0207698_10002372
2217 Ga0207698_10004554
2218 Ga0207698_10074367
2219 Ga0207698_10317849
2220 Ga0207698_10383642
2221 Ga0207698_10403149
2222 Ga0207698_10450450
2223 Ga0207698_10490746
2224 Ga0207698_10855616
2225 Ga0207698_11481420
2226 Ga0209970_1028805
2227 Ga0209974_10007547
2228 Ga0209974_10024430
2229 Ga0209974_10120084
2230 Ga0209974_10138104
2231 Ga0207428_10138049
2232 Ga0207428_10396259
2233 Ga0268266_10014620
2234 Ga0268266_10060637
2235 Ga0268266_10323343
2236 Ga0268266_10725846
2237 Ga0268265_10000742
2238 Ga0268265_10018582
2239 Ga0268265_10025807
2240 Ga0268265_10077971
2241 Ga0268265_10170735
2242 Ga0268265_10288363
2243 Ga0268265_10309706
2244 Ga0268265_10500374
2245 Ga0268265_11184368
2246 Ga0268265_11850864
2247 Ga0268264_10025721
2248 Ga0268264_10056687
2249 Ga0268264_10105955
2250 Ga0268264_10127854
2251 Ga0268264_10542326
2252 Ga0268264_10580508
2253 Ga0268264_11080782
2254 Ga0307408_100030897
2255 Ga0307408_100134604
2256 Ga0307408_100141527
2257 Ga0307408_100266165
2258 Ga0307408_100596734
2259 Ga0307408_100634566
2260 Ga0307405_10033158
2261 Ga0307405_10036036
2262 Ga0307405_10105275
2263 Ga0307405_10181951
2264 Ga0307405_10187599
2265 Ga0307405_10251710
2266 Ga0307405_10318300
2267 Ga0307405_10822889
2268 Ga0307413_10003630
2269 Ga0307413_10033784
2270 Ga0307413_10061334
2271 Ga0307413_10085230
2272 Ga0307413_10311974
2273 Ga0307413_10560415
2274 Ga0307410_10065722
2275 Ga0307410_10088249
2276 Ga0307410_10111280
2277 Ga0307410_10160478
2278 Ga0307410_10313084
2279 Ga0307410_11010967
2280 Ga0307410_11022886
2281 Ga0307410_11085675
2282 Ga0307406_10030604
2283 Ga0307406_10123312
2284 Ga0307406_10787079
2285 Ga0307406_10836383
2286 Ga0307407_10045410
2287 Ga0307407_10114689
2288 Ga0307407_10119378
2289 Ga0307407_10142994
2290 Ga0307412_10130108
2291 Ga0307412_10218057
2292 Ga0307412_10298319
2293 Ga0307412_10299720
2294 Ga0307409_100134017
2295 Ga0307409_100165512
2296 Ga0307409_100336964
2297 Ga0307409_100601105
2298 Ga0307409_100640591
2299 Ga0307409_100752091
2300 Ga0307409_101145289
2301 Ga0307409_101207458
2302 Ga0307416_100000897
2303 Ga0307416_100085150
2304 Ga0307416_100102227
2305 Ga0307416_100111745
2306 Ga0307416_100824964
2307 Ga0307416_100912447
2308 Ga0307416_101543933
2309 Ga0307416_102183418
2310 Ga0307414_10007804
2311 Ga0307414_10021208
2312 Ga0307414_10075158
2313 Ga0307414_10146739
2314 Ga0307414_10360913
2315 Ga0307414_10396384
2316 Ga0307414_10444445
2317 Ga0307414_10550492
2318 Ga0307411_10010234
2319 Ga0307411_10494034
2320 Ga0307411_10729202
2321 Ga0307411_10730153
2322 Ga0307411_11196061
2323 Ga0307411_11305284
2324 Ga0307415_100029822
2325 Ga0307415_100047672
2326 Ga0307415_100047859
2327 Ga0307415_100056083
2328 Ga0307415_100596208
2329 Ga0307415_100850061
2330 Ga0307415_100996659
2331 Ga0307415_101066092
2332 Ga0307415_101518349
2333 Ga0373944_0144278
2334 Ga0373936_0243638
2335 Ga0373941_0047475
2336 Ga0373924_0407082
2337 Ga0373931_0270339
2338 Ga0373935_0405861
2339 Ga0395899_0000781
2340 Ga0395899_0023067
2341 Ga0395899_0025369
2342 Ga0395899_0041125
2343 Ga0395899_0084539
2344 Ga0395899_0126652
2345 Ga0395899_0153404
2346 Ga0395899_0166649
2347 Ga0395899_0241024
2348 Ga0395899_0249599
2349 Ga0395899_0254551
2350 Ga0395899_0294802
2351 Ga0395900_0000136
2352 Ga0395900_0008940
2353 Ga0395900_0017045
2354 Ga0395900_0019502
2355 Ga0395900_0025891
2356 Ga0395900_0028578
2357 Ga0395900_0031858
2358 Ga0395900_0044305
2359 Ga0395900_0046360
2360 Ga0395900_0108159
2361 Ga0395900_0137821
2362 Ga0395900_0146514
2363 Ga0395900_0179500
2364 Ga0395900_0205115
2365 Ga0395900_0331631
2366 Ga0395900_0997433
2367 Ga0395900_1284623
2368 Ga0395900_1515327
2369 Ga0395900_1515459
2370 Ga0395898_0009082
2371 Ga0395898_0012373
2372 Ga0395898_0017533
2373 Ga0395898_0047850
2374 Ga0395898_0051432
2375 Ga0395898_0061826
2376 Ga0395898_0064734
2377 Ga0395898_0101637
2378 Ga0395898_0292700
2379 Ga0395898_0504120
2380 Ga0395898_0901774
2381 Ga0395898_1416887
2382 Ga0395898_1535244
2383 Ga0395905_0001050
2384 Ga0395905_0001483
2385 Ga0395905_0012680
2386 Ga0395905_0015368
2387 Ga0395905_0019243
2388 Ga0395905_0039223
2389 Ga0395905_0066065
2390 Ga0395905_0069116
2391 Ga0395905_0118518
2392 Ga0395905_0139309
2393 Ga0395905_0153478
2394 Ga0395905_0191507
2395 Ga0395905_0223146
2396 Ga0395905_0328516
2397 Ga0395905_0392019
2398 Ga0395905_0482383
2399 Ga0395905_0637519
2400 Ga0395905_0804188
2401 Ga0395905_1096534
2402 Ga0395905_1351138
2403 Ga0395901_0000108
2404 Ga0395901_0002936
2405 Ga0395901_0004646
2406 Ga0395901_0039013
2407 Ga0395901_0039711
2408 Ga0395901_0053477
2409 Ga0395901_0086405
2410 Ga0395901_0101233
2411 Ga0395901_0121209
2412 Ga0395901_0186803
2413 Ga0395901_0388894
2414 Ga0395901_0834035
2415 Ga0395901_1322247
2416 Ga0395901_1961573
2417 Ga0439465_0166761
2418 Ga0439432_016131
2419 Ga0439432_099241
2420 Ga0439432_154796
2421 Ga0439449_0172995
2422 Ga0439455_0094007
2423 Ga0439455_0174964
2424 Ga0450890_024699
2425 Ga0439446_0193173
2426 Ga0439464_0043409
2427 Ga0466972_0029294
2428 Ga0466972_0489675
2429 Ga0466965_0110231
2430 Ga0466963_0043823
2431 Ga0466963_0667746
2432 Ga0466970_0543951
2433 Ga0466957_0342877
2434 Ga0466960_0035855
2435 Ga0466960_0081490
2436 Ga0466960_0199259
2437 Ga0466958_0287991
2438 Ga0466967_0071859
2439 Ga0466967_0094408
2440 Ga0466967_0165884
2441 Ga0466967_0587289
2442 Ga0466967_1032495
2443 Ga0495629_0578741
2444 Ga0495580_0158367
2445 Ga0495620_0044307
2446 Ga0495663_0005460
2447 Ga0495663_0049970
2448 Ga0495663_0165123
2449 Ga0495663_0208295
2450 Ga0495642_0012146
2451 Ga0495598_0015046
2452 Ga0495598_0077628
2453 Ga0495598_0296252
2454 Ga0495621_0023514
2455 Ga0495621_0061905
2456 Ga0495621_0081882
2457 Ga0495621_0166757
2458 Ga0495621_0211211
2459 Ga0495633_0030048
2460 Ga0495633_0043846
2461 Ga0495633_0054672
2462 Ga0495668_0197529
2463 Ga0495668_0246815
2464 Ga0495668_0395123
2465 Ga0495668_0677014
2466 Ga0495625_0218118
2467 Ga0495659_0043311
2468 Ga0495659_0365036
2469 Ga0495669_0005058
2470 Ga0495669_0007043
2471 Ga0495669_0025727
2472 Ga0495669_0079185
2473 Ga0495669_0120942
2474 Ga0495669_0122502
2475 Ga0495669_0143059
2476 Ga0495669_0232258
2477 Ga0495669_0392115
2478 Ga0495670_0020479
2479 Ga0495670_0065219
2480 Ga0495670_0119029
2481 Ga0495670_0149512
2482 Ga0495670_0170685
2483 Ga0495670_0194866
2484 Ga0495670_0202139
2485 Ga0495677_0021793
2486 Ga0495677_0034800
2487 Ga0495677_0342571
2488 Ga0495677_0378132
2489 Ga0496100_0085702
2490 Ga0496100_0496446
2491 Ga0496101_0161112
2492 Ga0496101_0698212
2493 Ga0496102_0490045
2494 Ga0496103_0177243
2495 Ga0496106_0522980
2496 Ga0496106_1261806
2497 Ga0496107_0043771
2498 Ga0496107_0057346
2499 Ga0496107_0078527
2500 Ga0496107_0147077
2501 Ga0496107_0249453
2502 Ga0496107_0349600
2503 Ga0496107_0380655
2504 Ga0496107_0505628
2505 Ga0496107_0527396
2506 Ga0496108_0096616
2507 Ga0496108_0167957
2508 Ga0496108_1183342
2509 Ga0496108_1773054
2510 Ga0496109_0008125
2511 Ga0496109_0713582
2512 Ga0496110_0017898
2513 Ga0496110_0034885
2514 Ga0496110_0683039
2515 Ga0496110_0777317
2516 Ga0496110_0798806
2517 Ga0496111_0108109
2518 Ga0496111_0147079
2519 Ga0496112_1016653
2520 Ga0496113_1395864
2521 Ga0496114_0018218
2522 Ga0496115_0301864
2523 Ga0501292_108688
2524 Ga0501043_1116163
2525 Ga0501068_0127010
2526 Ga0501069_0764950
2527 Ga0501074_0340296
2528 Ga0501235_038754
2529 Ga0501235_177148
2530 Ga0501249_009088
2531 Ga0501249_077660
2532 Ga0501250_096361
2533 Ga0501225_0155798
2534 Ga0501080_0809390
2535 Ga0501267_022597
2536 Ga0501268_044022
2537 Ga0501268_108819
2538 nmdc:mga09592_697851_c1
2539 nmdc:mga06r32_10994_c1
2540 nmdc:mga06r32_281694_c1
2541 nmdc:mga08y16_35183_c1
2542 nmdc:mga08y16_491956_c1
2543 nmdc:mga0rr50_836237_c1
2544 nmdc:mga08x19_257352_c1
2545 nmdc:mga0a205_14261_c1
2546 Ga0500658_0000885
2547 Ga0500627_0349591
2548 Ga0590077_120641
2549 Ga0501082_0932758
2550 Ga0466962_0238331

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

35

150

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mav-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 6.0 in complex with mn2+ 0.8922 4 123
6ifh-assembly1.cif.gz_A unphosphorylated spo0f from paenisporosarcina sp. tg-14 0.8848 3 124
3q15-assembly1.cif.gz_C-2 crystal structure of raph complexed with spo0f 0.8835 5 123
1mb3-assembly1.cif.gz_A crystal structure of the response regulator divk at ph 8.5 in complex with mg2+ 0.8835 4 123
5m7n-assembly1.cif.gz_B crystal structure of ntrx from brucella abortus in complex with atp processed with the crystaldirect automated mounting and cryo-cooling technology 0.881 2 126
ID Description Score Start End Superfamily
af_P30843_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9158 5 82 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9063 4 82 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9034 3 82 3.40.50.2300
af_P9WGM7_2_84_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9018 1 82 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9008 5 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A516IU41-F1-model_v4 Response regulator 0.9871 1 129 GO:0000160
AF-A0A0Q8QZA0-F1-model_v4 Response regulatory domain-containing protein 0.9786 5 126 GO:0000160
AF-A0A5C7NNC9-F1-model_v4 deleted 0.9772 3 124
AF-A0A2S6NI34-F1-model_v4 Uncharacterized protein 0.9769 5 124 GO:0000160
GO:0003677
GO:0006355
GO:0071111
AF-A0A2R4XG28-F1-model_v4 Diguanylate phosphodiesterase 0.9764 4 122 GO:0000160
GO:0071111

Map