F492449
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1274 | 513 | 1209 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10722173|Ga0163163_107221732 |
| Length | 175 |
| Sequence | MSICRVESCNCNDCSYNQKIMHSKVRAATHTGPMGCSSFKLRQLSRRVSQHFDRVVGAAGLKTTQYSLLTHVMRLEPVRPSDLAADMEMDASTLTRNLQPLVAQGWLEVGPGDDGRSRFVTMTAAGREKRAEAQREWKRAQLAFNDHIGEERVARLHALIDECLALMNEPDDLSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 3 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 4 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 5 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 6 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 7 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 8 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 9 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 10 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 11 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 12 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 13 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 14 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 15 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 16 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 17 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 18 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 19 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 20 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 21 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 22 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 23 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 24 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 25 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 26 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 27 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 28 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 29 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 30 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 31 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 32 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 33 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 34 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 35 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 36 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 37 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 38 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 39 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 40 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 41 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 42 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 43 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 44 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 45 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 46 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 47 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 48 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 49 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 50 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 51 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 52 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 53 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 54 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 55 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 56 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 57 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 58 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 59 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 60 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 61 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 62 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 63 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 64 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 65 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 66 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 67 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 68 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 69 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 70 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 71 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 72 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 73 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 74 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 75 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 76 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 77 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 78 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 79 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 80 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 81 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 82 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 83 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 86 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 87 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 88 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 89 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 90 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 91 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 92 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 93 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 94 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 95 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 96 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 97 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 101 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 104 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 106 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 117 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 122 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 123 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 124 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 130 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 134 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 136 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 137 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 138 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 139 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 140 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 141 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 142 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 143 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 144 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 145 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 146 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 147 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 148 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 149 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 150 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 151 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 152 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 153 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 154 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 155 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 156 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 157 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 158 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 159 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 161 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 162 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 163 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 164 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 166 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 167 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 168 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 169 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 183 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 184 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 185 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 197 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 198 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 199 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 200 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 201 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 202 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 203 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 204 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 205 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 208 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 212 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 214 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 215 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 216 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 218 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 219 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 220 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 221 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 224 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 227 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 283 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 284 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 286 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 287 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 289 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 293 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 294 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 295 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 296 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 297 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 298 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 299 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 300 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 301 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 302 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 303 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 304 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 305 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 306 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 307 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 308 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 309 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 310 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 311 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 312 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 313 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 314 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 315 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 316 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 317 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 318 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 319 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 320 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 321 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 322 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 323 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 324 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 325 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 326 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 327 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 328 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 329 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 330 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 331 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 332 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 333 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 334 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 335 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 336 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 337 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 338 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 339 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 340 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 341 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 342 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 343 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 344 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 345 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 346 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 347 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 348 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 349 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 350 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 351 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 352 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 353 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 354 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 355 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 356 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 357 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 358 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 359 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 360 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 361 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 362 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 363 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 364 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 365 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 366 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 367 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 368 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 369 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 370 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 371 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 372 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 373 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 374 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 375 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 376 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 377 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 378 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 379 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 380 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 381 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 382 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 383 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 384 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 385 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 386 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 436 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 437 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 438 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 439 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 440 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 441 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 443 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 444 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 445 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 446 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 447 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 448 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 449 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 450 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 451 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 452 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 453 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 454 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 455 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 461 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 462 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 465 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 466 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 468 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 469 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 471 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 475 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 476 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 477 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 478 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 479 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 480 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 481 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 482 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 483 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 484 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 485 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 486 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 487 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 488 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 489 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 490 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 491 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 492 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 493 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 494 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 495 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 496 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 497 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 499 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 500 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 501 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 502 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 503 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 504 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 505 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 506 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 507 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 508 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 509 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 510 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 511 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 512 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 513 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.66 |
| Metatranscriptomes | 0.24 |
| Isolates | 5.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 26.06 |
| Nodule | 0.71 |
| Rhizoplane | 2.75 |
| Rhizosphere | 59.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10002313 | 3300001979 | Bacteria | 8669 |
| 2 | JGI24739J22299_10042561 | 3300001989 | Bacteria | 1506 |
| 3 | JGI25158J39367_1014260 | 3300002739 | Bacteria | 1030 |
| 4 | JGI25158J39367_1017354 | 3300002739 | Bacteria | 902 |
| 5 | JGI25152J39213_1002086 | 3300002773 | Bacteria | 7852 |
| 6 | JGI25152J39213_1003149 | 3300002773 | Bacteria | 5759 |
| 7 | JGI25152J39213_1011911 | 3300002773 | Bacteria | 1897 |
| 8 | JGI25150J39212_1000609 | 3300002774 | Bacteria | 13775 |
| 9 | JGI25150J39212_1015273 | 3300002774 | Bacteria | 1285 |
| 10 | JGI25159J45721_1003702 | 3300002987 | Bacteria | 5304 |
| 11 | JGI25159J45721_1005109 | 3300002987 | Bacteria | 4171 |
| 12 | JGI25159J45721_1021556 | 3300002987 | Bacteria | 1212 |
| 13 | JGI25151J46595_10003523 | 3300003187 | Bacteria | 8617 |
| 14 | JGI25151J46595_10003837 | 3300003187 | Bacteria | 8137 |
| 15 | JGI25151J46595_10007545 | 3300003187 | Bacteria | 5316 |
| 16 | JGI25151J46595_10044085 | 3300003187 | Bacteria | 1588 |
| 17 | JGI25153J46596_10007592 | 3300003215 | Bacteria | 5304 |
| 18 | JGI25153J46596_10010478 | 3300003215 | Bacteria | 4189 |
| 19 | JGI25153J46596_10036140 | 3300003215 | Bacteria | 1588 |
| 20 | rootH1_10002444 | 3300003316 | Bacteria | 3162 |
| 21 | rootH1_10065105 | 3300003316 | Bacteria | 2086 |
| 22 | rootH1_10066517 | 3300003316 | Bacteria | 1226 |
| 23 | rootH2_10007251 | 3300003320 | Bacteria | 1492 |
| 24 | rootH2_10048751 | 3300003320 | Bacteria | 2678 |
| 25 | rootL2_10004239 | 3300003322 | Bacteria | 31814 |
| 26 | rootL2_10016479 | 3300003322 | Bacteria | 4719 |
| 27 | rootL2_10100371 | 3300003322 | Bacteria | 1642 |
| 28 | rootL2_10196900 | 3300003322 | Bacteria | 2471 |
| 29 | rootH1_10016782 | 3300003323 | Bacteria | 4512 |
| 30 | rootH1_10096611 | 3300003323 | Bacteria | 1847 |
| 31 | rootH1_10172482 | 3300003323 | Bacteria | 2585 |
| 32 | rootH1_10193050 | 3300003323 | Bacteria | 2922 |
| 33 | JGI25160J50197_1005413 | 3300003354 | Bacteria | 5316 |
| 34 | JGI25160J50197_1009233 | 3300003354 | Bacteria | 3677 |
| 35 | JGI25161J50226_1002087 | 3300003374 | Bacteria | 5400 |
| 36 | JGI25161J50226_1003898 | 3300003374 | Bacteria | 3251 |
| 37 | JGI25161J50226_1009984 | 3300003374 | Bacteria | 1305 |
| 38 | Ga0006562J51391_1103471 | 3300003578 | Bacteria | 5110 |
| 39 | Ga0006562J51391_1103472 | 3300003578 | Bacteria | 3890 |
| 40 | Ga0006562J51391_1156325 | 3300003578 | Bacteria | 1373 |
| 41 | Ga0055525_1000021 | 3300003759 | Bacteria | 370802 |
| 42 | Ga0055527_1018589 | 3300003760 | Bacteria | 738 |
| 43 | Ga0055535_1000662 | 3300003761 | Bacteria | 27248 |
| 44 | Ga0055542_1000009 | 3300003762 | Bacteria | 416550 |
| 45 | Ga0055526_1003267 | 3300003771 | Bacteria | 10410 |
| 46 | Ga0055526_1008063 | 3300003771 | Bacteria | 5316 |
| 47 | Ga0055526_1010870 | 3300003771 | Bacteria | 4180 |
| 48 | Ga0055537_1000108 | 3300003773 | Bacteria | 62351 |
| 49 | Ga0055537_1003033 | 3300003773 | Bacteria | 5304 |
| 50 | Ga0055537_1003352 | 3300003773 | Bacteria | 4955 |
| 51 | Ga0055524_1000253 | 3300003775 | Bacteria | 55038 |
| 52 | Ga0055524_1006035 | 3300003775 | Bacteria | 5316 |
| 53 | Ga0055524_1008753 | 3300003775 | Bacteria | 4180 |
| 54 | Ga0055536_1005750 | 3300003781 | Bacteria | 5972 |
| 55 | Ga0055536_1006473 | 3300003781 | Bacteria | 5454 |
| 56 | Ga0055536_1009306 | 3300003781 | Bacteria | 4079 |
| 57 | Ga0055534_1000109 | 3300003784 | Bacteria | 60884 |
| 58 | Ga0055534_1002348 | 3300003784 | Bacteria | 6604 |
| 59 | Ga0055534_1003031 | 3300003784 | Bacteria | 5513 |
| 60 | Ga0055534_1006754 | 3300003784 | Bacteria | 2840 |
| 61 | Ga0055528_1000173 | 3300003790 | Bacteria | 54563 |
| 62 | Ga0055528_1006487 | 3300003790 | Bacteria | 5304 |
| 63 | Ga0055528_1007185 | 3300003790 | Bacteria | 4955 |
| 64 | Ga0055528_1027916 | 3300003790 | Bacteria | 1571 |
| 65 | Ga0055530_10001357 | 3300003791 | Bacteria | 18147 |
| 66 | Ga0055530_10002534 | 3300003791 | Bacteria | 11642 |
| 67 | Ga0055530_10011736 | 3300003791 | Bacteria | 3119 |
| 68 | Ga0055530_10046583 | 3300003791 | Bacteria | 1029 |
| 69 | Ga0055540_1000009 | 3300003792 | Bacteria | 300466 |
| 70 | Ga0055540_1000011 | 3300003792 | Bacteria | 282927 |
| 71 | Ga0055540_1001177 | 3300003792 | Bacteria | 16163 |
| 72 | Ga0055540_1001272 | 3300003792 | Bacteria | 15344 |
| 73 | Ga0055540_1003479 | 3300003792 | Bacteria | 7597 |
| 74 | Ga0055540_1014702 | 3300003792 | Bacteria | 2318 |
| 75 | Ga0055531_10001459 | 3300003794 | Bacteria | 17416 |
| 76 | Ga0055531_10003853 | 3300003794 | Bacteria | 9389 |
| 77 | Ga0055531_10006988 | 3300003794 | Bacteria | 6269 |
| 78 | Ga0055531_10008746 | 3300003794 | Bacteria | 5283 |
| 79 | Ga0055531_10015050 | 3300003794 | Bacteria | 3436 |
| 80 | Ga0055543_1003320 | 3300004625 | Bacteria | 4815 |
| 81 | Ga0055543_1003901 | 3300004625 | Bacteria | 4218 |
| 82 | Ga0055543_1020669 | 3300004625 | Bacteria | 1207 |
| 83 | Ga0065165_1000270 | 3300005262 | Bacteria | 88828 |
| 84 | Ga0065165_1002517 | 3300005262 | Bacteria | 15273 |
| 85 | Ga0065165_1007482 | 3300005262 | Bacteria | 5354 |
| 86 | Ga0065165_1015198 | 3300005262 | Bacteria | 2947 |
| 87 | Ga0065714_10006079 | 3300005288 | Bacteria | 5536 |
| 88 | Ga0065714_10008805 | 3300005288 | Bacteria | 3091 |
| 89 | Ga0065704_10075643 | 3300005289 | Bacteria | 5484 |
| 90 | Ga0065715_10210477 | 3300005293 | Bacteria | 1316 |
| 91 | Ga0070658_10083823 | 3300005327 | Bacteria | 2621 |
| 92 | Ga0070658_10102909 | 3300005327 | Bacteria | 2362 |
| 93 | Ga0070658_10202820 | 3300005327 | Bacteria | 1674 |
| 94 | Ga0070658_10205517 | 3300005327 | Bacteria | 1663 |
| 95 | Ga0070658_10294256 | 3300005327 | Bacteria | 1384 |
| 96 | Ga0070658_10348623 | 3300005327 | Bacteria | 1267 |
| 97 | Ga0070676_10009290 | 3300005328 | Bacteria | 5317 |
| 98 | Ga0070676_10057235 | 3300005328 | Bacteria | 2307 |
| 99 | Ga0070676_10392855 | 3300005328 | Bacteria | 963 |
| 100 | Ga0070676_10737033 | 3300005328 | Bacteria | 722 |
| 101 | Ga0070683_100005352 | 3300005329 | Bacteria | 10701 |
| 102 | Ga0070690_100334864 | 3300005330 | Bacteria | 1094 |
| 103 | Ga0070670_100003584 | 3300005331 | Bacteria | 12922 |
| 104 | Ga0070670_100009851 | 3300005331 | Bacteria | 8160 |
| 105 | Ga0070670_100015006 | 3300005331 | Bacteria | 6648 |
| 106 | Ga0070670_100093239 | 3300005331 | Bacteria | 2590 |
| 107 | Ga0070670_100109353 | 3300005331 | Bacteria | 2382 |
| 108 | Ga0070670_100297529 | 3300005331 | Bacteria | 1411 |
| 109 | Ga0070677_10015608 | 3300005333 | Bacteria | 2691 |
| 110 | Ga0070677_10026044 | 3300005333 | Bacteria | 2190 |
| 111 | Ga0070677_10027992 | 3300005333 | Bacteria | 2126 |
| 112 | Ga0070677_10054643 | 3300005333 | Bacteria | 1627 |
| 113 | Ga0070677_10412095 | 3300005333 | Bacteria | 715 |
| 114 | Ga0068869_100069759 | 3300005334 | Bacteria | 2599 |
| 115 | Ga0068869_100091461 | 3300005334 | Bacteria | 2289 |
| 116 | Ga0068869_100604704 | 3300005334 | Bacteria | 926 |
| 117 | Ga0070666_10559709 | 3300005335 | Bacteria | 832 |
| 118 | Ga0070666_10659296 | 3300005335 | Bacteria | 766 |
| 119 | Ga0068868_100001157 | 3300005338 | Bacteria | 18078 |
| 120 | Ga0068868_100063065 | 3300005338 | Bacteria | 2939 |
| 121 | Ga0068868_100137460 | 3300005338 | Bacteria | 2004 |
| 122 | Ga0068868_100547663 | 3300005338 | Bacteria | 1019 |
| 123 | Ga0068868_100789163 | 3300005338 | Bacteria | 856 |
| 124 | Ga0070660_100040525 | 3300005339 | Bacteria | 3545 |
| 125 | Ga0070660_100068835 | 3300005339 | Bacteria | 2759 |
| 126 | Ga0070660_100078509 | 3300005339 | Bacteria | 2588 |
| 127 | Ga0070661_100037349 | 3300005344 | Bacteria | 3533 |
| 128 | Ga0070661_100048100 | 3300005344 | Bacteria | 3122 |
| 129 | Ga0070661_100134336 | 3300005344 | Bacteria | 1860 |
| 130 | Ga0070661_100141260 | 3300005344 | Bacteria | 1815 |
| 131 | Ga0070661_101191782 | 3300005344 | Bacteria | 637 |
| 132 | Ga0070668_100143139 | 3300005347 | Bacteria | 1928 |
| 133 | Ga0070668_100156282 | 3300005347 | Bacteria | 1848 |
| 134 | Ga0070668_101787717 | 3300005347 | Bacteria | 565 |
| 135 | Ga0070669_100107590 | 3300005353 | Bacteria | 2112 |
| 136 | Ga0070669_100133329 | 3300005353 | Bacteria | 1908 |
| 137 | Ga0070669_100264990 | 3300005353 | Bacteria | 1372 |
| 138 | Ga0070669_100405460 | 3300005353 | Bacteria | 1116 |
| 139 | Ga0070669_101089507 | 3300005353 | Bacteria | 688 |
| 140 | Ga0070675_100001801 | 3300005354 | Bacteria | 15832 |
| 141 | Ga0070675_100007761 | 3300005354 | Bacteria | 8307 |
| 142 | Ga0070675_100022306 | 3300005354 | Bacteria | 5058 |
| 143 | Ga0070675_100054138 | 3300005354 | Bacteria | 3301 |
| 144 | Ga0070671_100050666 | 3300005355 | Bacteria | 3453 |
| 145 | Ga0070671_100080213 | 3300005355 | Bacteria | 2728 |
| 146 | Ga0070671_100244692 | 3300005355 | Bacteria | 1523 |
| 147 | Ga0070671_100416739 | 3300005355 | Bacteria | 1150 |
| 148 | Ga0070671_100667071 | 3300005355 | Bacteria | 901 |
| 149 | Ga0070674_100001004 | 3300005356 | Bacteria | 14721 |
| 150 | Ga0070674_100016511 | 3300005356 | Bacteria | 4628 |
| 151 | Ga0070674_100417511 | 3300005356 | Bacteria | 1100 |
| 152 | Ga0070674_100553972 | 3300005356 | Bacteria | 965 |
| 153 | Ga0070674_101703460 | 3300005356 | Bacteria | 570 |
| 154 | Ga0070673_100003898 | 3300005364 | Bacteria | 9374 |
| 155 | Ga0070673_100015817 | 3300005364 | Bacteria | 5314 |
| 156 | Ga0070673_100115232 | 3300005364 | Bacteria | 2234 |
| 157 | Ga0070673_100125273 | 3300005364 | Bacteria | 2149 |
| 158 | Ga0070673_100153586 | 3300005364 | Bacteria | 1951 |
| 159 | Ga0070673_100423584 | 3300005364 | Bacteria | 1194 |
| 160 | Ga0070673_100639941 | 3300005364 | Unclassified | 973 |
| 161 | Ga0070673_100903878 | 3300005364 | Bacteria | 819 |
| 162 | Ga0070659_100106388 | 3300005366 | Bacteria | 2261 |
| 163 | Ga0070659_100416211 | 3300005366 | Bacteria | 1136 |
| 164 | Ga0070659_100785965 | 3300005366 | Bacteria | 827 |
| 165 | Ga0070659_100797259 | 3300005366 | Bacteria | 821 |
| 166 | Ga0070667_100088937 | 3300005367 | Bacteria | 2652 |
| 167 | Ga0070667_100090969 | 3300005367 | Bacteria | 2623 |
| 168 | Ga0070667_100195279 | 3300005367 | Bacteria | 1794 |
| 169 | Ga0070667_101047707 | 3300005367 | Bacteria | 762 |
| 170 | Ga0070700_100582016 | 3300005441 | Bacteria | 874 |
| 171 | Ga0070708_100156079 | 3300005445 | Bacteria | 2125 |
| 172 | Ga0070663_100118454 | 3300005455 | Bacteria | 1997 |
| 173 | Ga0070663_100529825 | 3300005455 | Bacteria | 982 |
| 174 | Ga0070663_100599054 | 3300005455 | Bacteria | 927 |
| 175 | Ga0070678_100005974 | 3300005456 | Bacteria | 7092 |
| 176 | Ga0070678_100014268 | 3300005456 | Bacteria | 5006 |
| 177 | Ga0070678_100046649 | 3300005456 | Bacteria | 3109 |
| 178 | Ga0070678_100069235 | 3300005456 | Bacteria | 2634 |
| 179 | Ga0070678_100173760 | 3300005456 | Bacteria | 1757 |
| 180 | Ga0070678_100322745 | 3300005456 | Bacteria | 1319 |
| 181 | Ga0070678_101041865 | 3300005456 | Bacteria | 753 |
| 182 | Ga0070662_100000867 | 3300005457 | Bacteria | 18517 |
| 183 | Ga0070662_100024603 | 3300005457 | Bacteria | 4150 |
| 184 | Ga0070662_100110025 | 3300005457 | Bacteria | 2097 |
| 185 | Ga0070662_100154273 | 3300005457 | Bacteria | 1791 |
| 186 | Ga0070662_100361123 | 3300005457 | Bacteria | 1192 |
| 187 | Ga0070681_10532061 | 3300005458 | Bacteria | 1089 |
| 188 | Ga0070681_11156798 | 3300005458 | Bacteria | 695 |
| 189 | Ga0068867_100005504 | 3300005459 | Bacteria | 8963 |
| 190 | Ga0068867_100032066 | 3300005459 | Bacteria | 3797 |
| 191 | Ga0068867_100077768 | 3300005459 | Bacteria | 2494 |
| 192 | Ga0068867_100096795 | 3300005459 | Bacteria | 2248 |
| 193 | Ga0068867_100099511 | 3300005459 | Bacteria | 2218 |
| 194 | Ga0068867_100255074 | 3300005459 | Bacteria | 1428 |
| 195 | Ga0068867_100895646 | 3300005459 | Bacteria | 798 |
| 196 | Ga0070706_100001400 | 3300005467 | Bacteria | 25498 |
| 197 | Ga0070707_100024364 | 3300005468 | Bacteria | 5731 |
| 198 | Ga0070698_100124625 | 3300005471 | Bacteria | 2534 |
| 199 | Ga0070699_100067925 | 3300005518 | Bacteria | 3095 |
| 200 | Ga0070679_100024940 | 3300005530 | Bacteria | 5863 |
| 201 | Ga0070684_100027307 | 3300005535 | Bacteria | 4815 |
| 202 | Ga0070684_100127611 | 3300005535 | Bacteria | 2292 |
| 203 | Ga0070684_100423920 | 3300005535 | Unclassified | 1228 |
| 204 | Ga0070684_100679080 | 3300005535 | Bacteria | 959 |
| 205 | Ga0068853_100002880 | 3300005539 | Bacteria | 13055 |
| 206 | Ga0068853_100014608 | 3300005539 | Bacteria | 6439 |
| 207 | Ga0068853_100050690 | 3300005539 | Bacteria | 3572 |
| 208 | Ga0068853_100132036 | 3300005539 | Bacteria | 2236 |
| 209 | Ga0068853_100222578 | 3300005539 | Bacteria | 1724 |
| 210 | Ga0068853_100246202 | 3300005539 | Bacteria | 1639 |
| 211 | Ga0068853_101987723 | 3300005539 | Bacteria | 564 |
| 212 | Ga0070672_100000535 | 3300005543 | Bacteria | 22337 |
| 213 | Ga0070672_100002739 | 3300005543 | Bacteria | 11283 |
| 214 | Ga0070672_100019327 | 3300005543 | Bacteria | 4943 |
| 215 | Ga0070672_100049097 | 3300005543 | Bacteria | 3281 |
| 216 | Ga0070672_100098868 | 3300005543 | Bacteria | 2364 |
| 217 | Ga0070672_100204828 | 3300005543 | Bacteria | 1650 |
| 218 | Ga0070693_100029302 | 3300005547 | Bacteria | 3001 |
| 219 | Ga0070693_100487795 | 3300005547 | Bacteria | 872 |
| 220 | Ga0070665_100078999 | 3300005548 | Bacteria | 3296 |
| 221 | Ga0070665_100102402 | 3300005548 | Bacteria | 2867 |
| 222 | Ga0070665_100150572 | 3300005548 | Bacteria | 2329 |
| 223 | Ga0070665_100273946 | 3300005548 | Bacteria | 1689 |
| 224 | Ga0070665_100361883 | 3300005548 | Bacteria | 1457 |
| 225 | Ga0070665_101733628 | 3300005548 | Bacteria | 632 |
| 226 | Ga0068855_100051204 | 3300005563 | Bacteria | 4864 |
| 227 | Ga0068855_100245462 | 3300005563 | Bacteria | 1999 |
| 228 | Ga0068855_100246194 | 3300005563 | Bacteria | 1995 |
| 229 | Ga0070664_100093118 | 3300005564 | Bacteria | 2611 |
| 230 | Ga0070664_100106113 | 3300005564 | Bacteria | 2447 |
| 231 | Ga0070664_100115387 | 3300005564 | Bacteria | 2347 |
| 232 | Ga0070664_100222287 | 3300005564 | Bacteria | 1690 |
| 233 | Ga0070664_100591957 | 3300005564 | Bacteria | 1028 |
| 234 | Ga0068857_100043611 | 3300005577 | Bacteria | 3978 |
| 235 | Ga0068857_100121537 | 3300005577 | Bacteria | 2351 |
| 236 | Ga0068857_100143878 | 3300005577 | Bacteria | 2156 |
| 237 | Ga0068857_100170387 | 3300005577 | Bacteria | 1979 |
| 238 | Ga0068857_100298591 | 3300005577 | Bacteria | 1485 |
| 239 | Ga0068854_100020708 | 3300005578 | Bacteria | 4456 |
| 240 | Ga0068854_100027581 | 3300005578 | Bacteria | 3915 |
| 241 | Ga0068854_100034288 | 3300005578 | Bacteria | 3545 |
| 242 | Ga0068854_100261895 | 3300005578 | Bacteria | 1385 |
| 243 | Ga0068854_100266909 | 3300005578 | Bacteria | 1372 |
| 244 | Ga0068854_101059543 | 3300005578 | Bacteria | 721 |
| 245 | Ga0068856_100004035 | 3300005614 | Bacteria | 14702 |
| 246 | Ga0068856_100190867 | 3300005614 | Bacteria | 2062 |
| 247 | Ga0068852_100072682 | 3300005616 | Bacteria | 3023 |
| 248 | Ga0068852_100094552 | 3300005616 | Bacteria | 2681 |
| 249 | Ga0068852_100139459 | 3300005616 | Bacteria | 2242 |
| 250 | Ga0068852_100189947 | 3300005616 | Bacteria | 1938 |
| 251 | Ga0068852_100606196 | 3300005616 | Bacteria | 1100 |
| 252 | Ga0068852_101088389 | 3300005616 | Bacteria | 819 |
| 253 | Ga0068852_101608748 | 3300005616 | Bacteria | 672 |
| 254 | Ga0068859_100325490 | 3300005617 | Bacteria | 1631 |
| 255 | Ga0068859_100435764 | 3300005617 | Bacteria | 1407 |
| 256 | Ga0068864_100011769 | 3300005618 | Bacteria | 7227 |
| 257 | Ga0068864_100018043 | 3300005618 | Bacteria | 5890 |
| 258 | Ga0068864_100024340 | 3300005618 | Bacteria | 5093 |
| 259 | Ga0068864_100040117 | 3300005618 | Bacteria | 4005 |
| 260 | Ga0068864_100363776 | 3300005618 | Bacteria | 1368 |
| 261 | Ga0068864_100550863 | 3300005618 | Bacteria | 1115 |
| 262 | Ga0068866_10422358 | 3300005718 | Bacteria | 865 |
| 263 | Ga0068861_100003855 | 3300005719 | Bacteria | 10017 |
| 264 | Ga0068861_100036330 | 3300005719 | Bacteria | 3655 |
| 265 | Ga0068861_100518491 | 3300005719 | Bacteria | 1081 |
| 266 | Ga0068851_10020198 | 3300005834 | Bacteria | 3222 |
| 267 | Ga0068851_10062559 | 3300005834 | Bacteria | 1910 |
| 268 | Ga0068851_10147537 | 3300005834 | Bacteria | 1284 |
| 269 | Ga0068851_10371613 | 3300005834 | Bacteria | 836 |
| 270 | Ga0068870_10125652 | 3300005840 | Bacteria | 1483 |
| 271 | Ga0068870_10371678 | 3300005840 | Bacteria | 923 |
| 272 | Ga0068870_10826718 | 3300005840 | Bacteria | 649 |
| 273 | Ga0068863_100058398 | 3300005841 | Bacteria | 3651 |
| 274 | Ga0068863_100067310 | 3300005841 | Bacteria | 3387 |
| 275 | Ga0068863_100195703 | 3300005841 | Bacteria | 1943 |
| 276 | Ga0068863_101060957 | 3300005841 | Bacteria | 814 |
| 277 | Ga0068858_100351657 | 3300005842 | Bacteria | 1411 |
| 278 | Ga0068860_100030780 | 3300005843 | Bacteria | 5160 |
| 279 | Ga0068860_100176947 | 3300005843 | Bacteria | 2062 |
| 280 | Ga0068860_100458633 | 3300005843 | Bacteria | 1268 |
| 281 | Ga0068862_100019148 | 3300005844 | Bacteria | 5707 |
| 282 | Ga0068862_100559178 | 3300005844 | Bacteria | 1093 |
| 283 | Ga0075365_10029510 | 3300006038 | Bacteria | 3507 |
| 284 | Ga0075368_10039873 | 3300006042 | Bacteria | 1842 |
| 285 | Ga0075368_10069954 | 3300006042 | Bacteria | 1416 |
| 286 | Ga0075363_100011747 | 3300006048 | Bacteria | 4203 |
| 287 | Ga0075363_100234686 | 3300006048 | Bacteria | 1054 |
| 288 | Ga0075363_100248920 | 3300006048 | Bacteria | 1023 |
| 289 | Ga0075364_10009592 | 3300006051 | Bacteria | 5813 |
| 290 | Ga0075364_10036051 | 3300006051 | Bacteria | 3198 |
| 291 | Ga0075364_10058694 | 3300006051 | Bacteria | 2522 |
| 292 | Ga0075364_10083153 | 3300006051 | Bacteria | 2119 |
| 293 | Ga0075364_10513618 | 3300006051 | Bacteria | 819 |
| 294 | Ga0075432_10006244 | 3300006058 | Bacteria | 4050 |
| 295 | Ga0070715_10068721 | 3300006163 | Bacteria | 1576 |
| 296 | Ga0075362_10002180 | 3300006177 | Bacteria | 6488 |
| 297 | Ga0075362_10005196 | 3300006177 | Bacteria | 4744 |
| 298 | Ga0075362_10008211 | 3300006177 | Bacteria | 3985 |
| 299 | Ga0075367_10007898 | 3300006178 | Bacteria | 5480 |
| 300 | Ga0075367_10053886 | 3300006178 | Bacteria | 2384 |
| 301 | Ga0075367_10103594 | 3300006178 | Bacteria | 1741 |
| 302 | Ga0075367_10287260 | 3300006178 | Bacteria | 1034 |
| 303 | Ga0075367_10410774 | 3300006178 | Bacteria | 857 |
| 304 | Ga0075369_10033641 | 3300006186 | Bacteria | 2173 |
| 305 | Ga0075369_10033995 | 3300006186 | Bacteria | 2162 |
| 306 | Ga0075369_10034024 | 3300006186 | Bacteria | 2162 |
| 307 | Ga0075369_10078951 | 3300006186 | Bacteria | 1458 |
| 308 | Ga0075369_10125905 | 3300006186 | Bacteria | 1162 |
| 309 | Ga0075366_10000574 | 3300006195 | Bacteria | 17235 |
| 310 | Ga0075366_10004447 | 3300006195 | Bacteria | 7523 |
| 311 | Ga0075366_10011444 | 3300006195 | Bacteria | 5011 |
| 312 | Ga0075366_10014575 | 3300006195 | Bacteria | 4491 |
| 313 | Ga0075366_10015312 | 3300006195 | Bacteria | 4391 |
| 314 | Ga0075366_10024978 | 3300006195 | Bacteria | 3487 |
| 315 | Ga0075366_10082530 | 3300006195 | Bacteria | 1920 |
| 316 | Ga0075366_10089809 | 3300006195 | Bacteria | 1840 |
| 317 | Ga0075366_10116553 | 3300006195 | Bacteria | 1608 |
| 318 | Ga0075366_10165958 | 3300006195 | Bacteria | 1339 |
| 319 | Ga0075366_10214657 | 3300006195 | Bacteria | 1172 |
| 320 | Ga0075366_10258602 | 3300006195 | Bacteria | 1062 |
| 321 | Ga0075366_10586154 | 3300006195 | Bacteria | 691 |
| 322 | Ga0097621_100006734 | 3300006237 | Bacteria | 8163 |
| 323 | Ga0097621_100022260 | 3300006237 | Bacteria | 4918 |
| 324 | Ga0097621_100224534 | 3300006237 | Bacteria | 1638 |
| 325 | Ga0097621_100275860 | 3300006237 | Bacteria | 1479 |
| 326 | Ga0097621_100396668 | 3300006237 | Bacteria | 1235 |
| 327 | Ga0075370_10000101 | 3300006353 | Bacteria | 27175 |
| 328 | Ga0075370_10001469 | 3300006353 | Bacteria | 10255 |
| 329 | Ga0075370_10002241 | 3300006353 | Bacteria | 8894 |
| 330 | Ga0075370_10006236 | 3300006353 | Bacteria | 5981 |
| 331 | Ga0075370_10007120 | 3300006353 | Bacteria | 5679 |
| 332 | Ga0075370_10007736 | 3300006353 | Bacteria | 5487 |
| 333 | Ga0075370_10009745 | 3300006353 | Bacteria | 5002 |
| 334 | Ga0075370_10016095 | 3300006353 | Bacteria | 4019 |
| 335 | Ga0075370_10058418 | 3300006353 | Bacteria | 2194 |
| 336 | Ga0075370_10062392 | 3300006353 | Bacteria | 2123 |
| 337 | Ga0075370_10064153 | 3300006353 | Bacteria | 2095 |
| 338 | Ga0075370_10068296 | 3300006353 | Bacteria | 2030 |
| 339 | Ga0075370_10144180 | 3300006353 | Bacteria | 1393 |
| 340 | Ga0075370_10245908 | 3300006353 | Bacteria | 1060 |
| 341 | Ga0068871_100012983 | 3300006358 | Bacteria | 6169 |
| 342 | Ga0068871_100116623 | 3300006358 | Bacteria | 2251 |
| 343 | Ga0068871_100206425 | 3300006358 | Bacteria | 1698 |
| 344 | Ga0068871_100256037 | 3300006358 | Bacteria | 1526 |
| 345 | Ga0068871_100387693 | 3300006358 | Bacteria | 1242 |
| 346 | Ga0075434_100103811 | 3300006871 | Bacteria | 2851 |
| 347 | Ga0068865_100031594 | 3300006881 | Bacteria | 3531 |
| 348 | Ga0068865_100135512 | 3300006881 | Bacteria | 1850 |
| 349 | Ga0068865_100162763 | 3300006881 | Bacteria | 1704 |
| 350 | Ga0097620_100325492 | 3300006931 | Bacteria | 1631 |
| 351 | Ga0097620_100435715 | 3300006931 | Bacteria | 1407 |
| 352 | Ga0099823_1004645 | 3300006944 | Bacteria | 13490 |
| 353 | Ga0079104_1000040 | 3300006946 | Bacteria | 187962 |
| 354 | Ga0099826_10000510 | 3300006948 | Bacteria | 19067 |
| 355 | Ga0099826_10130486 | 3300006948 | Bacteria | 1466 |
| 356 | Ga0075435_100337081 | 3300007076 | Bacteria | 1292 |
| 357 | Ga0105244_10003834 | 3300009036 | Bacteria | 10592 |
| 358 | Ga0105244_10120607 | 3300009036 | Bacteria | 1270 |
| 359 | Ga0105244_10179130 | 3300009036 | Bacteria | 1006 |
| 360 | Ga0105240_10015568 | 3300009093 | Bacteria | 10336 |
| 361 | Ga0105240_10032391 | 3300009093 | Bacteria | 6768 |
| 362 | Ga0105240_10089902 | 3300009093 | Bacteria | 3754 |
| 363 | Ga0105240_10196814 | 3300009093 | Bacteria | 2365 |
| 364 | Ga0105240_10215319 | 3300009093 | Bacteria | 2241 |
| 365 | Ga0105245_10045639 | 3300009098 | Bacteria | 3914 |
| 366 | Ga0105245_10119233 | 3300009098 | Bacteria | 2463 |
| 367 | Ga0105245_10129601 | 3300009098 | Bacteria | 2365 |
| 368 | Ga0105245_10233131 | 3300009098 | Bacteria | 1781 |
| 369 | Ga0105245_10762888 | 3300009098 | Bacteria | 1004 |
| 370 | Ga0105247_10295951 | 3300009101 | Bacteria | 1121 |
| 371 | Ga0105243_10000884 | 3300009148 | Bacteria | 28201 |
| 372 | Ga0105243_10004307 | 3300009148 | Bacteria | 11266 |
| 373 | Ga0105243_10005624 | 3300009148 | Bacteria | 9759 |
| 374 | Ga0105243_10107881 | 3300009148 | Bacteria | 2323 |
| 375 | Ga0105243_11391317 | 3300009148 | Bacteria | 722 |
| 376 | Ga0105241_10294941 | 3300009174 | Bacteria | 1390 |
| 377 | Ga0105241_10378064 | 3300009174 | Bacteria | 1237 |
| 378 | Ga0105242_11495446 | 3300009176 | Bacteria | 706 |
| 379 | Ga0105248_10016659 | 3300009177 | Bacteria | 8090 |
| 380 | Ga0105248_10188936 | 3300009177 | Bacteria | 2321 |
| 381 | Ga0105248_10205361 | 3300009177 | Bacteria | 2220 |
| 382 | Ga0105248_10284097 | 3300009177 | Bacteria | 1863 |
| 383 | Ga0105248_11334575 | 3300009177 | Bacteria | 811 |
| 384 | Ga0105237_10018505 | 3300009545 | Bacteria | 7209 |
| 385 | Ga0105237_10020678 | 3300009545 | Bacteria | 6778 |
| 386 | Ga0105237_10030172 | 3300009545 | Bacteria | 5509 |
| 387 | Ga0105237_10085132 | 3300009545 | Bacteria | 3151 |
| 388 | Ga0105237_10520670 | 3300009545 | Bacteria | 1196 |
| 389 | Ga0105238_10001855 | 3300009551 | Bacteria | 21183 |
| 390 | Ga0105238_10129652 | 3300009551 | Bacteria | 2500 |
| 391 | Ga0105238_10174918 | 3300009551 | Bacteria | 2123 |
| 392 | Ga0105238_10859728 | 3300009551 | Bacteria | 924 |
| 393 | Ga0105238_11113166 | 3300009551 | Bacteria | 813 |
| 394 | Ga0105249_10118632 | 3300009553 | Bacteria | 2511 |
| 395 | Ga0105249_10202009 | 3300009553 | Bacteria | 1945 |
| 396 | Ga0105249_10527491 | 3300009553 | Bacteria | 1229 |
| 397 | Ga0105249_12312655 | 3300009553 | Bacteria | 610 |
| 398 | Ga0105239_10000531 | 3300010375 | Bacteria | 55121 |
| 399 | Ga0105239_10050731 | 3300010375 | Bacteria | 4549 |
| 400 | Ga0105239_10057462 | 3300010375 | Bacteria | 4268 |
| 401 | Ga0105239_10208877 | 3300010375 | Bacteria | 2188 |
| 402 | Ga0105239_10892832 | 3300010375 | Bacteria | 1020 |
| 403 | Ga0105246_10016577 | 3300011119 | Bacteria | 4666 |
| 404 | Ga0105246_10029657 | 3300011119 | Bacteria | 3604 |
| 405 | Ga0105246_10659367 | 3300011119 | Bacteria | 912 |
| 406 | Ga0105246_10771655 | 3300011119 | Bacteria | 850 |
| 407 | Ga0157317_1007125 | 3300012475 | Bacteria | 796 |
| 408 | Ga0157319_1000006 | 3300012497 | Bacteria | 361506 |
| 409 | Ga0157347_1001297 | 3300012502 | Bacteria | 1933 |
| 410 | Ga0157347_1039672 | 3300012502 | Bacteria | 618 |
| 411 | Ga0157373_10012777 | 3300013100 | Bacteria | 6168 |
| 412 | Ga0157373_10056085 | 3300013100 | Bacteria | 2798 |
| 413 | Ga0157373_10058443 | 3300013100 | Bacteria | 2734 |
| 414 | Ga0157373_10114794 | 3300013100 | Bacteria | 1893 |
| 415 | Ga0157371_10000196 | 3300013102 | Bacteria | 89174 |
| 416 | Ga0157371_10019220 | 3300013102 | Bacteria | 5041 |
| 417 | Ga0157371_10044279 | 3300013102 | Bacteria | 3169 |
| 418 | Ga0157371_10049015 | 3300013102 | Bacteria | 3001 |
| 419 | Ga0157371_10696320 | 3300013102 | Unclassified | 760 |
| 420 | Ga0157370_10278494 | 3300013104 | Bacteria | 1546 |
| 421 | Ga0157369_10009831 | 3300013105 | Bacteria | 10931 |
| 422 | Ga0157369_10015460 | 3300013105 | Bacteria | 8600 |
| 423 | Ga0157369_10989011 | 3300013105 | Bacteria | 861 |
| 424 | Ga0157374_10009658 | 3300013296 | Bacteria | 8284 |
| 425 | Ga0157374_10140338 | 3300013296 | Bacteria | 2345 |
| 426 | Ga0157378_11433377 | 3300013297 | Bacteria | 734 |
| 427 | Ga0163162_10007486 | 3300013306 | Bacteria | 10624 |
| 428 | Ga0163162_10056023 | 3300013306 | Bacteria | 3971 |
| 429 | Ga0163162_10274617 | 3300013306 | Bacteria | 1817 |
| 430 | Ga0157372_10156872 | 3300013307 | Bacteria | 2629 |
| 431 | Ga0157375_10009460 | 3300013308 | Bacteria | 8557 |
| 432 | Ga0157375_10138694 | 3300013308 | Bacteria | 2557 |
| 433 | Ga0157375_10431437 | 3300013308 | Bacteria | 1484 |
| 434 | Ga0163163_10722173 | 3300014325 | Bacteria | 1060 |
| 435 | Ga0163163_10906929 | 3300014325 | Bacteria | 945 |
| 436 | Ga0157380_10028623 | 3300014326 | Bacteria | 4251 |
| 437 | Ga0157380_10220527 | 3300014326 | Bacteria | 1696 |
| 438 | Ga0157380_10736337 | 3300014326 | Bacteria | 996 |
| 439 | Ga0157380_11237216 | 3300014326 | Bacteria | 791 |
| 440 | Ga0157380_11477709 | 3300014326 | Unclassified | 732 |
| 441 | Ga0182008_10000250 | 3300014497 | Bacteria | 41652 |
| 442 | Ga0182008_10000701 | 3300014497 | Bacteria | 24012 |
| 443 | Ga0182008_10001970 | 3300014497 | Bacteria | 13184 |
| 444 | Ga0182008_10006636 | 3300014497 | Bacteria | 6445 |
| 445 | Ga0182008_10041550 | 3300014497 | Bacteria | 2294 |
| 446 | Ga0182008_10067551 | 3300014497 | Bacteria | 1759 |
| 447 | Ga0157377_10000022 | 3300014745 | Bacteria | 146702 |
| 448 | Ga0157377_10041978 | 3300014745 | Bacteria | 2539 |
| 449 | Ga0157377_10298578 | 3300014745 | Bacteria | 1062 |
| 450 | Ga0157379_10010369 | 3300014968 | Bacteria | 8119 |
| 451 | Ga0157379_10054527 | 3300014968 | Bacteria | 3572 |
| 452 | Ga0157379_10123351 | 3300014968 | Bacteria | 2331 |
| 453 | Ga0157379_10414611 | 3300014968 | Bacteria | 1240 |
| 454 | Ga0157376_10005027 | 3300014969 | Bacteria | 9221 |
| 455 | Ga0157376_10049020 | 3300014969 | Bacteria | 3497 |
| 456 | Ga0157376_10242960 | 3300014969 | Bacteria | 1678 |
| 457 | Ga0157376_10965693 | 3300014969 | Bacteria | 873 |
| 458 | Ga0157376_10982276 | 3300014969 | Bacteria | 866 |
| 459 | Ga0182006_1001323 | 3300015261 | Bacteria | 15192 |
| 460 | Ga0182006_1016882 | 3300015261 | Bacteria | 3110 |
| 461 | Ga0182006_1088819 | 3300015261 | Bacteria | 1115 |
| 462 | Ga0182007_10001221 | 3300015262 | Bacteria | 13945 |
| 463 | Ga0182005_1129294 | 3300015265 | Bacteria | 724 |
| 464 | Ga0163161_10000332 | 3300017792 | Bacteria | 40315 |
| 465 | Ga0163161_10003912 | 3300017792 | Bacteria | 10448 |
| 466 | Ga0163161_10023778 | 3300017792 | Bacteria | 4325 |
| 467 | Ga0163161_10110606 | 3300017792 | Bacteria | 2054 |
| 468 | Ga0163161_10164994 | 3300017792 | Bacteria | 1691 |
| 469 | Ga0163161_10277537 | 3300017792 | Bacteria | 1313 |
| 470 | Ga0163161_10336175 | 3300017792 | Bacteria | 1197 |
| 471 | Ga0213872_10000046 | 3300021361 | Bacteria | 109934 |
| 472 | Ga0213872_10046241 | 3300021361 | Bacteria | 1981 |
| 473 | Ga0209436_116173 | 3300025208 | Bacteria | 1127 |
| 474 | Ga0209674_115250 | 3300025226 | Bacteria | 666 |
| 475 | Ga0209672_100443 | 3300025228 | Bacteria | 23461 |
| 476 | Ga0209147_101320 | 3300025229 | Bacteria | 9527 |
| 477 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 478 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 479 | Ga0207425_1000977 | 3300025245 | Bacteria | 13474 |
| 480 | Ga0207425_1001646 | 3300025245 | Bacteria | 8994 |
| 481 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 482 | Ga0209129_1000013 | 3300025258 | Bacteria | 524874 |
| 483 | Ga0209129_1000124 | 3300025258 | Bacteria | 133610 |
| 484 | Ga0209129_1002210 | 3300025258 | Bacteria | 9762 |
| 485 | Ga0209565_1000138 | 3300025263 | Bacteria | 101729 |
| 486 | Ga0209565_1000243 | 3300025263 | Bacteria | 58571 |
| 487 | Ga0209565_1000880 | 3300025263 | Bacteria | 16517 |
| 488 | Ga0209673_1000064 | 3300025273 | Bacteria | 254712 |
| 489 | Ga0209673_1000188 | 3300025273 | Bacteria | 124010 |
| 490 | Ga0209673_1000260 | 3300025273 | Bacteria | 99762 |
| 491 | Ga0209673_1001331 | 3300025273 | Bacteria | 24714 |
| 492 | Ga0209673_1004340 | 3300025273 | Bacteria | 7638 |
| 493 | Ga0209673_1013941 | 3300025273 | Bacteria | 3141 |
| 494 | Ga0209673_1037488 | 3300025273 | Bacteria | 1424 |
| 495 | Ga0209130_1000705 | 3300025284 | Bacteria | 29919 |
| 496 | Ga0209130_1001526 | 3300025284 | Bacteria | 14840 |
| 497 | Ga0209130_1002187 | 3300025284 | Bacteria | 10307 |
| 498 | Ga0209130_1078882 | 3300025284 | Bacteria | 534 |
| 499 | Ga0209675_1000036 | 3300025291 | Bacteria | 254712 |
| 500 | Ga0209675_1000086 | 3300025291 | Bacteria | 151270 |
| 501 | Ga0209675_1001070 | 3300025291 | Bacteria | 16954 |
| 502 | Ga0209675_1004601 | 3300025291 | Bacteria | 6073 |
| 503 | Ga0209675_1006645 | 3300025291 | Bacteria | 4598 |
| 504 | Ga0209675_1024852 | 3300025291 | Bacteria | 1522 |
| 505 | Ga0209676_1000004 | 3300025292 | Bacteria | 1138360 |
| 506 | Ga0209676_1000105 | 3300025292 | Bacteria | 224151 |
| 507 | Ga0209676_1000287 | 3300025292 | Bacteria | 103263 |
| 508 | Ga0209676_1001896 | 3300025292 | Bacteria | 17054 |
| 509 | Ga0209676_1003856 | 3300025292 | Bacteria | 8773 |
| 510 | Ga0209676_1007209 | 3300025292 | Bacteria | 5292 |
| 511 | Ga0209025_1000168 | 3300025294 | Bacteria | 162386 |
| 512 | Ga0209025_1000220 | 3300025294 | Bacteria | 136977 |
| 513 | Ga0209025_1001388 | 3300025294 | Bacteria | 32345 |
| 514 | Ga0209025_1019541 | 3300025294 | Bacteria | 3762 |
| 515 | Ga0209025_1020869 | 3300025294 | Bacteria | 3555 |
| 516 | Ga0209025_1047983 | 3300025294 | Bacteria | 1737 |
| 517 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 518 | Ga0209564_1000057 | 3300025295 | Bacteria | 340400 |
| 519 | Ga0209564_1000222 | 3300025295 | Bacteria | 129405 |
| 520 | Ga0209564_1000287 | 3300025295 | Bacteria | 102328 |
| 521 | Ga0209758_1000134 | 3300025297 | Bacteria | 178294 |
| 522 | Ga0209758_1000214 | 3300025297 | Bacteria | 126364 |
| 523 | Ga0209758_1020433 | 3300025297 | Bacteria | 3133 |
| 524 | Ga0209758_1144446 | 3300025297 | Bacteria | 612 |
| 525 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 526 | Ga0209050_1000009 | 3300025298 | Bacteria | 1047265 |
| 527 | Ga0209050_1000405 | 3300025298 | Bacteria | 80464 |
| 528 | Ga0209050_1001962 | 3300025298 | Bacteria | 19466 |
| 529 | Ga0209050_1002535 | 3300025298 | Bacteria | 15275 |
| 530 | Ga0209050_1005672 | 3300025298 | Bacteria | 7724 |
| 531 | Ga0209050_1014743 | 3300025298 | Bacteria | 3339 |
| 532 | Ga0209050_1015584 | 3300025298 | Bacteria | 3179 |
| 533 | Ga0209050_1028919 | 3300025298 | Bacteria | 1786 |
| 534 | Ga0209256_1000053 | 3300025299 | Bacteria | 298731 |
| 535 | Ga0209256_1000060 | 3300025299 | Bacteria | 262342 |
| 536 | Ga0209256_1000113 | 3300025299 | Bacteria | 175296 |
| 537 | Ga0209256_1000222 | 3300025299 | Bacteria | 105596 |
| 538 | Ga0209256_1000529 | 3300025299 | Bacteria | 55351 |
| 539 | Ga0209256_1030295 | 3300025299 | Bacteria | 1495 |
| 540 | Ga0207426_1000095 | 3300025302 | Bacteria | 274234 |
| 541 | Ga0207426_1000100 | 3300025302 | Bacteria | 262342 |
| 542 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 543 | Ga0209051_1000008 | 3300025303 | Bacteria | 706935 |
| 544 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 545 | Ga0209051_1000064 | 3300025303 | Bacteria | 231735 |
| 546 | Ga0209051_1000248 | 3300025303 | Bacteria | 91104 |
| 547 | Ga0209051_1000473 | 3300025303 | Bacteria | 52277 |
| 548 | Ga0209051_1005090 | 3300025303 | Bacteria | 7813 |
| 549 | Ga0209051_1008691 | 3300025303 | Bacteria | 5346 |
| 550 | Ga0209051_1021829 | 3300025303 | Bacteria | 2712 |
| 551 | Ga0209051_1023298 | 3300025303 | Bacteria | 2579 |
| 552 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 553 | Ga0209257_1000085 | 3300025304 | Bacteria | 291117 |
| 554 | Ga0209257_1000109 | 3300025304 | Bacteria | 239439 |
| 555 | Ga0209257_1000286 | 3300025304 | Bacteria | 111738 |
| 556 | Ga0209257_1000372 | 3300025304 | Bacteria | 90110 |
| 557 | Ga0209257_1003016 | 3300025304 | Bacteria | 15235 |
| 558 | Ga0209257_1006120 | 3300025304 | Bacteria | 7980 |
| 559 | Ga0209257_1006977 | 3300025304 | Bacteria | 7033 |
| 560 | Ga0209257_1013149 | 3300025304 | Bacteria | 3719 |
| 561 | Ga0209257_1023588 | 3300025304 | Bacteria | 2158 |
| 562 | Ga0207697_10003968 | 3300025315 | Bacteria | 7191 |
| 563 | Ga0207697_10036931 | 3300025315 | Bacteria | 2001 |
| 564 | Ga0207656_10003839 | 3300025321 | Bacteria | 5207 |
| 565 | Ga0207656_10043077 | 3300025321 | Bacteria | 1924 |
| 566 | Ga0207655_1005321 | 3300025728 | Bacteria | 8798 |
| 567 | Ga0207682_10001045 | 3300025893 | Bacteria | 12770 |
| 568 | Ga0207682_10023398 | 3300025893 | Bacteria | 2440 |
| 569 | Ga0207682_10049500 | 3300025893 | Bacteria | 1735 |
| 570 | Ga0207682_10053950 | 3300025893 | Bacteria | 1669 |
| 571 | Ga0207682_10117120 | 3300025893 | Bacteria | 1178 |
| 572 | Ga0207710_10449888 | 3300025900 | Unclassified | 665 |
| 573 | Ga0207688_10111235 | 3300025901 | Bacteria | 1590 |
| 574 | Ga0207688_10136576 | 3300025901 | Bacteria | 1440 |
| 575 | Ga0207688_10317751 | 3300025901 | Bacteria | 955 |
| 576 | Ga0207680_10449111 | 3300025903 | Bacteria | 915 |
| 577 | Ga0207685_10119294 | 3300025905 | Bacteria | 1155 |
| 578 | Ga0207645_10005684 | 3300025907 | Bacteria | 9010 |
| 579 | Ga0207645_10005861 | 3300025907 | Bacteria | 8853 |
| 580 | Ga0207645_10027329 | 3300025907 | Bacteria | 3685 |
| 581 | Ga0207645_10077274 | 3300025907 | Bacteria | 2133 |
| 582 | Ga0207645_10282969 | 3300025907 | Bacteria | 1101 |
| 583 | Ga0207645_10299197 | 3300025907 | Bacteria | 1071 |
| 584 | Ga0207645_10337932 | 3300025907 | Bacteria | 1006 |
| 585 | Ga0207645_10647845 | 3300025907 | Bacteria | 718 |
| 586 | Ga0207643_10020521 | 3300025908 | Bacteria | 3627 |
| 587 | Ga0207643_10170068 | 3300025908 | Bacteria | 1315 |
| 588 | Ga0207705_10183502 | 3300025909 | Bacteria | 1580 |
| 589 | Ga0207705_10886138 | 3300025909 | Bacteria | 691 |
| 590 | Ga0207684_10023526 | 3300025910 | Bacteria | 5261 |
| 591 | Ga0207654_10292619 | 3300025911 | Bacteria | 1105 |
| 592 | Ga0207695_10104516 | 3300025913 | Bacteria | 2821 |
| 593 | Ga0207671_10080363 | 3300025914 | Bacteria | 2444 |
| 594 | Ga0207671_10326508 | 3300025914 | Bacteria | 1215 |
| 595 | Ga0207662_10099997 | 3300025918 | Bacteria | 1796 |
| 596 | Ga0207662_10233549 | 3300025918 | Bacteria | 1202 |
| 597 | Ga0207657_10051902 | 3300025919 | Bacteria | 3562 |
| 598 | Ga0207657_10128705 | 3300025919 | Bacteria | 2077 |
| 599 | Ga0207649_10163293 | 3300025920 | Bacteria | 1545 |
| 600 | Ga0207649_10222314 | 3300025920 | Bacteria | 1346 |
| 601 | Ga0207649_10225487 | 3300025920 | Bacteria | 1337 |
| 602 | Ga0207649_10229311 | 3300025920 | Bacteria | 1327 |
| 603 | Ga0207649_10231166 | 3300025920 | Bacteria | 1322 |
| 604 | Ga0207646_10205803 | 3300025922 | Bacteria | 1777 |
| 605 | Ga0207681_10005176 | 3300025923 | Bacteria | 8010 |
| 606 | Ga0207681_10103784 | 3300025923 | Bacteria | 2055 |
| 607 | Ga0207681_10256964 | 3300025923 | Bacteria | 1366 |
| 608 | Ga0207681_10506969 | 3300025923 | Bacteria | 989 |
| 609 | Ga0207681_10652647 | 3300025923 | Bacteria | 872 |
| 610 | Ga0207681_10751564 | 3300025923 | Unclassified | 813 |
| 611 | Ga0207694_10038457 | 3300025924 | Bacteria | 3679 |
| 612 | Ga0207694_10147242 | 3300025924 | Bacteria | 1896 |
| 613 | Ga0207650_10011652 | 3300025925 | Bacteria | 6058 |
| 614 | Ga0207650_10037756 | 3300025925 | Bacteria | 3522 |
| 615 | Ga0207650_10471978 | 3300025925 | Bacteria | 1046 |
| 616 | Ga0207650_10490911 | 3300025925 | Unclassified | 1025 |
| 617 | Ga0207659_10000118 | 3300025926 | Bacteria | 46531 |
| 618 | Ga0207659_10005215 | 3300025926 | Bacteria | 7866 |
| 619 | Ga0207659_10048380 | 3300025926 | Bacteria | 3012 |
| 620 | Ga0207659_10056916 | 3300025926 | Bacteria | 2801 |
| 621 | Ga0207659_10356689 | 3300025926 | Bacteria | 1214 |
| 622 | Ga0207687_10149565 | 3300025927 | Bacteria | 1780 |
| 623 | Ga0207687_10205014 | 3300025927 | Bacteria | 1544 |
| 624 | Ga0207687_10292861 | 3300025927 | Bacteria | 1309 |
| 625 | Ga0207644_10035212 | 3300025931 | Bacteria | 3506 |
| 626 | Ga0207644_10230856 | 3300025931 | Bacteria | 1470 |
| 627 | Ga0207644_10804657 | 3300025931 | Bacteria | 786 |
| 628 | Ga0207690_10031790 | 3300025932 | Bacteria | 3381 |
| 629 | Ga0207690_10430994 | 3300025932 | Bacteria | 1056 |
| 630 | Ga0207706_10000933 | 3300025933 | Bacteria | 29885 |
| 631 | Ga0207706_10020371 | 3300025933 | Bacteria | 5962 |
| 632 | Ga0207706_10029788 | 3300025933 | Bacteria | 4871 |
| 633 | Ga0207706_10062210 | 3300025933 | Bacteria | 3287 |
| 634 | Ga0207706_10136423 | 3300025933 | Bacteria | 2158 |
| 635 | Ga0207706_10137030 | 3300025933 | Bacteria | 2153 |
| 636 | Ga0207686_10865575 | 3300025934 | Bacteria | 728 |
| 637 | Ga0207709_10000604 | 3300025935 | Bacteria | 29795 |
| 638 | Ga0207709_10014639 | 3300025935 | Bacteria | 4335 |
| 639 | Ga0207709_10086087 | 3300025935 | Bacteria | 2039 |
| 640 | Ga0207709_10593571 | 3300025935 | Bacteria | 876 |
| 641 | Ga0207670_10993188 | 3300025936 | Bacteria | 706 |
| 642 | Ga0207669_10000706 | 3300025937 | Bacteria | 14412 |
| 643 | Ga0207669_10237670 | 3300025937 | Bacteria | 1348 |
| 644 | Ga0207669_10244550 | 3300025937 | Bacteria | 1332 |
| 645 | Ga0207669_11726594 | 3300025937 | Bacteria | 535 |
| 646 | Ga0207704_10052541 | 3300025938 | Bacteria | 2471 |
| 647 | Ga0207704_10700234 | 3300025938 | Bacteria | 839 |
| 648 | Ga0207691_10000238 | 3300025940 | Bacteria | 53833 |
| 649 | Ga0207691_10008515 | 3300025940 | Bacteria | 9852 |
| 650 | Ga0207691_10041323 | 3300025940 | Bacteria | 4258 |
| 651 | Ga0207691_10067518 | 3300025940 | Bacteria | 3233 |
| 652 | Ga0207691_10108789 | 3300025940 | Bacteria | 2467 |
| 653 | Ga0207691_10130114 | 3300025940 | Bacteria | 2224 |
| 654 | Ga0207691_11231152 | 3300025940 | Bacteria | 620 |
| 655 | Ga0207711_10046230 | 3300025941 | Bacteria | 3719 |
| 656 | Ga0207711_10118967 | 3300025941 | Bacteria | 2357 |
| 657 | Ga0207711_10293458 | 3300025941 | Bacteria | 1499 |
| 658 | Ga0207689_10000150 | 3300025942 | Bacteria | 60037 |
| 659 | Ga0207689_10015594 | 3300025942 | Bacteria | 6436 |
| 660 | Ga0207689_10241497 | 3300025942 | Bacteria | 1493 |
| 661 | Ga0207661_11332258 | 3300025944 | Unclassified | 659 |
| 662 | Ga0207679_10069210 | 3300025945 | Bacteria | 2655 |
| 663 | Ga0207679_10186959 | 3300025945 | Bacteria | 1719 |
| 664 | Ga0207679_10254378 | 3300025945 | Bacteria | 1495 |
| 665 | Ga0207667_10014800 | 3300025949 | Bacteria | 8875 |
| 666 | Ga0207667_10361165 | 3300025949 | Bacteria | 1481 |
| 667 | Ga0207651_10001131 | 3300025960 | Bacteria | 11895 |
| 668 | Ga0207651_10018228 | 3300025960 | Bacteria | 4171 |
| 669 | Ga0207651_10036335 | 3300025960 | Bacteria | 3214 |
| 670 | Ga0207651_10707367 | 3300025960 | Bacteria | 888 |
| 671 | Ga0207651_11044116 | 3300025960 | Unclassified | 731 |
| 672 | Ga0207712_10203261 | 3300025961 | Bacteria | 1572 |
| 673 | Ga0207712_11082470 | 3300025961 | Bacteria | 713 |
| 674 | Ga0207668_10147265 | 3300025972 | Bacteria | 1818 |
| 675 | Ga0207668_10151195 | 3300025972 | Bacteria | 1797 |
| 676 | Ga0207640_10016633 | 3300025981 | Bacteria | 4284 |
| 677 | Ga0207640_10017371 | 3300025981 | Bacteria | 4209 |
| 678 | Ga0207640_10061385 | 3300025981 | Bacteria | 2490 |
| 679 | Ga0207640_10150578 | 3300025981 | Bacteria | 1709 |
| 680 | Ga0207640_10478832 | 3300025981 | Bacteria | 1032 |
| 681 | Ga0207640_11039078 | 3300025981 | Bacteria | 722 |
| 682 | Ga0207640_11525890 | 3300025981 | Bacteria | 601 |
| 683 | Ga0207658_10159894 | 3300025986 | Bacteria | 1845 |
| 684 | Ga0207658_10525012 | 3300025986 | Bacteria | 1057 |
| 685 | Ga0207658_10740407 | 3300025986 | Bacteria | 890 |
| 686 | Ga0207658_10917625 | 3300025986 | Bacteria | 798 |
| 687 | Ga0207677_10012436 | 3300026023 | Bacteria | 4893 |
| 688 | Ga0207677_10252983 | 3300026023 | Bacteria | 1432 |
| 689 | Ga0207677_10422517 | 3300026023 | Bacteria | 1136 |
| 690 | Ga0207677_10516605 | 3300026023 | Bacteria | 1035 |
| 691 | Ga0207703_10030559 | 3300026035 | Bacteria | 4258 |
| 692 | Ga0207703_10047106 | 3300026035 | Bacteria | 3475 |
| 693 | Ga0207703_11234687 | 3300026035 | Unclassified | 719 |
| 694 | Ga0207639_10031874 | 3300026041 | Bacteria | 3876 |
| 695 | Ga0207639_10053565 | 3300026041 | Bacteria | 3079 |
| 696 | Ga0207639_10097704 | 3300026041 | Bacteria | 2365 |
| 697 | Ga0207639_10139452 | 3300026041 | Bacteria | 2018 |
| 698 | Ga0207639_10140530 | 3300026041 | Bacteria | 2011 |
| 699 | Ga0207639_10317765 | 3300026041 | Bacteria | 1382 |
| 700 | Ga0207639_10372054 | 3300026041 | Bacteria | 1281 |
| 701 | Ga0207639_10747635 | 3300026041 | Bacteria | 909 |
| 702 | Ga0207678_10002944 | 3300026067 | Bacteria | 15425 |
| 703 | Ga0207678_10170607 | 3300026067 | Bacteria | 1857 |
| 704 | Ga0207678_10251494 | 3300026067 | Bacteria | 1513 |
| 705 | Ga0207702_10329396 | 3300026078 | Bacteria | 1456 |
| 706 | Ga0207641_10053797 | 3300026088 | Bacteria | 3414 |
| 707 | Ga0207641_10070146 | 3300026088 | Bacteria | 3011 |
| 708 | Ga0207641_10088799 | 3300026088 | Bacteria | 2700 |
| 709 | Ga0207641_10164319 | 3300026088 | Bacteria | 2020 |
| 710 | Ga0207641_11345274 | 3300026088 | Bacteria | 715 |
| 711 | Ga0207648_10000032 | 3300026089 | Bacteria | 128009 |
| 712 | Ga0207648_10001012 | 3300026089 | Bacteria | 31652 |
| 713 | Ga0207648_10003526 | 3300026089 | Bacteria | 16384 |
| 714 | Ga0207648_10055085 | 3300026089 | Bacteria | 3472 |
| 715 | Ga0207648_10067687 | 3300026089 | Bacteria | 3113 |
| 716 | Ga0207648_10263659 | 3300026089 | Bacteria | 1538 |
| 717 | Ga0207648_10387825 | 3300026089 | Bacteria | 1264 |
| 718 | Ga0207648_11352588 | 3300026089 | Bacteria | 669 |
| 719 | Ga0207676_10025653 | 3300026095 | Bacteria | 4375 |
| 720 | Ga0207676_10032796 | 3300026095 | Bacteria | 3918 |
| 721 | Ga0207676_10181228 | 3300026095 | Bacteria | 1844 |
| 722 | Ga0207676_10272993 | 3300026095 | Bacteria | 1532 |
| 723 | Ga0207674_10020946 | 3300026116 | Bacteria | 7053 |
| 724 | Ga0207674_10023098 | 3300026116 | Bacteria | 6669 |
| 725 | Ga0207674_10041822 | 3300026116 | Bacteria | 4737 |
| 726 | Ga0207674_10189806 | 3300026116 | Bacteria | 2005 |
| 727 | Ga0207674_10589646 | 3300026116 | Bacteria | 1074 |
| 728 | Ga0207675_100001131 | 3300026118 | Bacteria | 26465 |
| 729 | Ga0207675_100734278 | 3300026118 | Bacteria | 998 |
| 730 | Ga0207683_10013866 | 3300026121 | Bacteria | 6873 |
| 731 | Ga0207683_10034729 | 3300026121 | Bacteria | 4383 |
| 732 | Ga0207683_10064766 | 3300026121 | Bacteria | 3222 |
| 733 | Ga0207683_10102351 | 3300026121 | Bacteria | 2557 |
| 734 | Ga0207683_10122058 | 3300026121 | Bacteria | 2340 |
| 735 | Ga0207683_10172376 | 3300026121 | Bacteria | 1960 |
| 736 | Ga0207683_10315112 | 3300026121 | Bacteria | 1432 |
| 737 | Ga0207683_10707199 | 3300026121 | Bacteria | 934 |
| 738 | Ga0207683_10949912 | 3300026121 | Bacteria | 798 |
| 739 | Ga0207683_12004388 | 3300026121 | Bacteria | 527 |
| 740 | Ga0207698_10007726 | 3300026142 | Bacteria | 6747 |
| 741 | Ga0207698_10016066 | 3300026142 | Bacteria | 5035 |
| 742 | Ga0207698_10054479 | 3300026142 | Bacteria | 3077 |
| 743 | Ga0207698_10315874 | 3300026142 | Bacteria | 1461 |
| 744 | Ga0207698_11134620 | 3300026142 | Bacteria | 795 |
| 745 | Ga0207698_11167246 | 3300026142 | Bacteria | 784 |
| 746 | Ga0209281_1000074 | 3300027111 | Bacteria | 267848 |
| 747 | Ga0209389_1038041 | 3300027296 | Bacteria | 3801 |
| 748 | Ga0209371_1000940 | 3300027312 | Bacteria | 22736 |
| 749 | Ga0209371_1028280 | 3300027312 | Bacteria | 1252 |
| 750 | Ga0209282_1025173 | 3300027666 | Bacteria | 3724 |
| 751 | Ga0209813_10027757 | 3300027866 | Bacteria | 1646 |
| 752 | Ga0209813_10050527 | 3300027866 | Bacteria | 1298 |
| 753 | Ga0209974_10002843 | 3300027876 | Bacteria | 6283 |
| 754 | Ga0207428_10229984 | 3300027907 | Bacteria | 1388 |
| 755 | Ga0207428_10432644 | 3300027907 | Bacteria | 961 |
| 756 | Ga0268266_10159657 | 3300028379 | Bacteria | 2038 |
| 757 | Ga0268266_10428228 | 3300028379 | Bacteria | 1255 |
| 758 | Ga0268265_10006770 | 3300028380 | Bacteria | 7753 |
| 759 | Ga0268265_10025277 | 3300028380 | Bacteria | 4213 |
| 760 | Ga0268265_10524472 | 3300028380 | Bacteria | 1120 |
| 761 | Ga0268265_10560735 | 3300028380 | Bacteria | 1086 |
| 762 | Ga0268264_10080643 | 3300028381 | Bacteria | 2779 |
| 763 | Ga0268264_10451274 | 3300028381 | Bacteria | 1246 |
| 764 | Ga0268264_12228741 | 3300028381 | Bacteria | 555 |
| 765 | Ga0265334_10044721 | 3300028573 | Bacteria | 1718 |
| 766 | Ga0307517_10000810 | 3300028786 | Bacteria | 53724 |
| 767 | Ga0307517_10239786 | 3300028786 | Bacteria | 1077 |
| 768 | Ga0307515_10009904 | 3300028794 | Bacteria | 18355 |
| 769 | Ga0307515_10011118 | 3300028794 | Bacteria | 17118 |
| 770 | Ga0307515_10039228 | 3300028794 | Bacteria | 7541 |
| 771 | Ga0307515_10184870 | 3300028794 | Bacteria | 2018 |
| 772 | Ga0307515_10268025 | 3300028794 | Bacteria | 1433 |
| 773 | Ga0307515_10385571 | 3300028794 | Bacteria | 1032 |
| 774 | Ga0268256_1000839 | 3300030500 | Bacteria | 21805 |
| 775 | Ga0268256_1032192 | 3300030500 | Bacteria | 1252 |
| 776 | Ga0307512_10069362 | 3300030522 | Bacteria | 2636 |
| 777 | Ga0307512_10225449 | 3300030522 | Bacteria | 972 |
| 778 | Ga0307512_10291665 | 3300030522 | Bacteria | 769 |
| 779 | Ga0316177_1126994 | 3300030731 | Bacteria | 3064 |
| 780 | Ga0316177_1220430 | 3300030731 | Bacteria | 1092 |
| 781 | Ga0314311_1074524 | 3300030733 | Bacteria | 9216 |
| 782 | Ga0316179_1073255 | 3300030734 | Bacteria | 4927 |
| 783 | Ga0316180_1159712 | 3300030736 | Bacteria | 1296 |
| 784 | Ga0316183_1087890 | 3300030742 | Bacteria | 14196 |
| 785 | Ga0316182_1123892 | 3300030745 | Bacteria | 4299 |
| 786 | Ga0265330_10000054 | 3300031235 | Bacteria | 101420 |
| 787 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 788 | Ga0265328_10017411 | 3300031239 | Bacteria | 2783 |
| 789 | Ga0265325_10003978 | 3300031241 | Bacteria | 9458 |
| 790 | Ga0265331_10001984 | 3300031250 | Bacteria | 14290 |
| 791 | Ga0265327_10000028 | 3300031251 | Bacteria | 361066 |
| 792 | Ga0265327_10000186 | 3300031251 | Bacteria | 131420 |
| 793 | Ga0307513_10004294 | 3300031456 | Bacteria | 19052 |
| 794 | Ga0307513_10026047 | 3300031456 | Bacteria | 6753 |
| 795 | Ga0307513_10318603 | 3300031456 | Bacteria | 1314 |
| 796 | Ga0307509_10000802 | 3300031507 | Bacteria | 53907 |
| 797 | Ga0307509_10016656 | 3300031507 | Bacteria | 8496 |
| 798 | Ga0307509_10050016 | 3300031507 | Bacteria | 4477 |
| 799 | Ga0307509_10051400 | 3300031507 | Bacteria | 4408 |
| 800 | Ga0307509_10177394 | 3300031507 | Bacteria | 2001 |
| 801 | Ga0307509_10475168 | 3300031507 | Bacteria | 939 |
| 802 | Ga0307408_100039175 | 3300031548 | Bacteria | 3348 |
| 803 | Ga0307408_100196529 | 3300031548 | Bacteria | 1629 |
| 804 | Ga0307408_100316603 | 3300031548 | Bacteria | 1313 |
| 805 | Ga0307408_100369862 | 3300031548 | Bacteria | 1222 |
| 806 | Ga0307408_100997816 | 3300031548 | Bacteria | 771 |
| 807 | Ga0307408_101718117 | 3300031548 | Bacteria | 598 |
| 808 | Ga0307408_101898828 | 3300031548 | Bacteria | 571 |
| 809 | Ga0307508_10000194 | 3300031616 | Bacteria | 73425 |
| 810 | Ga0307508_10005253 | 3300031616 | Bacteria | 12357 |
| 811 | Ga0307508_10130809 | 3300031616 | Bacteria | 2113 |
| 812 | Ga0307508_10333326 | 3300031616 | Bacteria | 1109 |
| 813 | Ga0307514_10011053 | 3300031649 | Bacteria | 7521 |
| 814 | Ga0307514_10094556 | 3300031649 | Bacteria | 2166 |
| 815 | Ga0307514_10205143 | 3300031649 | Bacteria | 1232 |
| 816 | Ga0265314_10000012 | 3300031711 | Bacteria | 415184 |
| 817 | Ga0265314_10356704 | 3300031711 | Bacteria | 803 |
| 818 | Ga0307516_10118500 | 3300031730 | Bacteria | 2441 |
| 819 | Ga0307516_10190729 | 3300031730 | Bacteria | 1776 |
| 820 | Ga0307516_10193842 | 3300031730 | Bacteria | 1756 |
| 821 | Ga0307516_10208068 | 3300031730 | Bacteria | 1672 |
| 822 | Ga0307516_10238369 | 3300031730 | Bacteria | 1518 |
| 823 | Ga0307516_10349510 | 3300031730 | Bacteria | 1144 |
| 824 | Ga0307405_10049069 | 3300031731 | Bacteria | 2607 |
| 825 | Ga0307405_10100216 | 3300031731 | Bacteria | 1941 |
| 826 | Ga0307405_10118214 | 3300031731 | Bacteria | 1809 |
| 827 | Ga0307405_10138418 | 3300031731 | Bacteria | 1693 |
| 828 | Ga0307405_10247467 | 3300031731 | Bacteria | 1324 |
| 829 | Ga0307405_10439685 | 3300031731 | Bacteria | 1031 |
| 830 | Ga0307405_10682739 | 3300031731 | Bacteria | 848 |
| 831 | Ga0307413_10420255 | 3300031824 | Bacteria | 1053 |
| 832 | Ga0307413_10431007 | 3300031824 | Bacteria | 1041 |
| 833 | Ga0307413_10982182 | 3300031824 | Bacteria | 723 |
| 834 | Ga0307410_10105384 | 3300031852 | Bacteria | 2030 |
| 835 | Ga0307410_10119839 | 3300031852 | Bacteria | 1917 |
| 836 | Ga0307410_10183324 | 3300031852 | Bacteria | 1586 |
| 837 | Ga0307406_10000467 | 3300031901 | Bacteria | 23358 |
| 838 | Ga0307406_10001774 | 3300031901 | Bacteria | 11791 |
| 839 | Ga0307406_10027772 | 3300031901 | Bacteria | 3413 |
| 840 | Ga0307406_10289780 | 3300031901 | Bacteria | 1253 |
| 841 | Ga0307407_10039868 | 3300031903 | Bacteria | 2615 |
| 842 | Ga0307407_10224521 | 3300031903 | Bacteria | 1272 |
| 843 | Ga0307407_10543428 | 3300031903 | Bacteria | 858 |
| 844 | Ga0307412_10012955 | 3300031911 | Bacteria | 4876 |
| 845 | Ga0307412_10045997 | 3300031911 | Bacteria | 2856 |
| 846 | Ga0307412_10190949 | 3300031911 | Bacteria | 1548 |
| 847 | Ga0307412_10247660 | 3300031911 | Bacteria | 1382 |
| 848 | Ga0307412_10251851 | 3300031911 | Bacteria | 1371 |
| 849 | Ga0307412_10947294 | 3300031911 | Bacteria | 757 |
| 850 | Ga0307409_100592030 | 3300031995 | Bacteria | 1095 |
| 851 | Ga0307416_100070299 | 3300032002 | Bacteria | 2902 |
| 852 | Ga0307416_100387377 | 3300032002 | Bacteria | 1430 |
| 853 | Ga0307416_100566115 | 3300032002 | Bacteria | 1212 |
| 854 | Ga0307416_100733494 | 3300032002 | Bacteria | 1079 |
| 855 | Ga0307414_10518330 | 3300032004 | Bacteria | 1058 |
| 856 | Ga0307414_10817313 | 3300032004 | Bacteria | 851 |
| 857 | Ga0307414_11178332 | 3300032004 | Unclassified | 709 |
| 858 | Ga0307411_10002725 | 3300032005 | Bacteria | 7925 |
| 859 | Ga0307411_10406528 | 3300032005 | Bacteria | 1127 |
| 860 | Ga0307411_10505469 | 3300032005 | Bacteria | 1022 |
| 861 | Ga0307411_11029771 | 3300032005 | Bacteria | 738 |
| 862 | Ga0307411_11304708 | 3300032005 | Bacteria | 661 |
| 863 | Ga0307415_100908705 | 3300032126 | Bacteria | 812 |
| 864 | Ga0307507_10098176 | 3300033179 | Bacteria | 2467 |
| 865 | Ga0307510_10005587 | 3300033180 | Bacteria | 14987 |
| 866 | Ga0307510_10030202 | 3300033180 | Bacteria | 6147 |
| 867 | Ga0307510_10092631 | 3300033180 | Bacteria | 2857 |
| 868 | Ga0307510_10115678 | 3300033180 | Bacteria | 2406 |
| 869 | Ga0307510_10310134 | 3300033180 | Bacteria | 1037 |
| 870 | Ga0307510_10407232 | 3300033180 | Bacteria | 803 |
| 871 | Ga0373930_0016597 | 3300034816 | Bacteria | 1395 |
| 872 | Ga0373928_0008445 | 3300035084 | Bacteria | 2000 |
| 873 | Ga0373944_0297103 | 3300035089 | Bacteria | 605 |
| 874 | Ga0373952_0070021 | 3300035092 | Bacteria | 875 |
| 875 | Ga0373932_0040311 | 3300035112 | Bacteria | 1344 |
| 876 | Ga0373941_0005075 | 3300035115 | Bacteria | 3075 |
| 877 | Ga0373953_0099209 | 3300035117 | Bacteria | 1225 |
| 878 | Ga0373943_0429900 | 3300035170 | Bacteria | 765 |
| 879 | Ga0373955_0841147 | 3300035172 | Bacteria | 564 |
| 880 | Ga0373931_0089697 | 3300035691 | Bacteria | 1711 |
| 881 | Ga0373931_0120245 | 3300035691 | Bacteria | 1500 |
| 882 | Ga0373935_0951774 | 3300035692 | Bacteria | 637 |
| 883 | Ga0373947_0698279 | 3300035725 | Bacteria | 692 |
| 884 | Ga0373937_0381968 | 3300036401 | Bacteria | 1336 |
| 885 | Ga0373937_0584925 | 3300036401 | Bacteria | 1060 |
| 886 | Ga0373937_0713287 | 3300036401 | Bacteria | 950 |
| 887 | Ga0373925_0133930 | 3300037068 | Bacteria | 1935 |
| 888 | Ga0373925_0191014 | 3300037068 | Bacteria | 1625 |
| 889 | Ga0373925_0461333 | 3300037068 | Bacteria | 1041 |
| 890 | Ga0395899_0287566 | 3300037312 | Bacteria | 1116 |
| 891 | Ga0395905_0849440 | 3300037471 | Bacteria | 816 |
| 892 | Ga0395901_1034261 | 3300038443 | Bacteria | 795 |
| 893 | Ga0436365_0773501 | 3300039437 | Bacteria | 711 |
| 894 | Ga0436361_0034970 | 3300039447 | Bacteria | 88532 |
| 895 | Ga0436361_0633280 | 3300039447 | Bacteria | 103480 |
| 896 | Ga0436361_0844177 | 3300039447 | Bacteria | 5839 |
| 897 | Ga0436363_0379139 | 3300039450 | Bacteria | 1059 |
| 898 | Ga0436363_1119806 | 3300039450 | Bacteria | 782 |
| 899 | Ga0439447_075986 | 3300041407 | Bacteria | 777 |
| 900 | Ga0451787_615507 | 3300041441 | Bacteria | 529 |
| 901 | Ga0451789_0617931 | 3300041443 | Bacteria | 734 |
| 902 | Ga0451793_0053218 | 3300041452 | Bacteria | 764 |
| 903 | Ga0451793_0124301 | 3300041452 | Bacteria | 721 |
| 904 | Ga0451793_1115609 | 3300041452 | Bacteria | 1591 |
| 905 | Ga0451795_0623483 | 3300041456 | Bacteria | 653 |
| 906 | Ga0451795_1050550 | 3300041456 | Bacteria | 703 |
| 907 | Ga0451800_0822228 | 3300041459 | Bacteria | 835 |
| 908 | Ga0451800_0963213 | 3300041459 | Bacteria | 715 |
| 909 | Ga0451802_0061791 | 3300041460 | Bacteria | 530 |
| 910 | Ga0451802_0401206 | 3300041460 | Bacteria | 900 |
| 911 | Ga0451833_1010680 | 3300041491 | Bacteria | 1352 |
| 912 | Ga0451835_0116812 | 3300041492 | Bacteria | 538 |
| 913 | Ga0451839_0760707 | 3300041496 | Bacteria | 2250 |
| 914 | Ga0451841_0569011 | 3300041498 | Bacteria | 1245 |
| 915 | Ga0451849_1279070 | 3300041505 | Bacteria | 903 |
| 916 | Ga0451843_1517086 | 3300041509 | Bacteria | 604 |
| 917 | Ga0439431_0000116 | 3300041997 | Bacteria | 13851 |
| 918 | Ga0439445_0009703 | 3300042004 | Bacteria | 2270 |
| 919 | Ga0439432_000593 | 3300042006 | Bacteria | 13693 |
| 920 | Ga0439450_017429 | 3300042008 | Bacteria | 1497 |
| 921 | Ga0439451_003517 | 3300042009 | Bacteria | 3177 |
| 922 | Ga0439452_005477 | 3300042010 | Bacteria | 4083 |
| 923 | Ga0439454_012713 | 3300042011 | Bacteria | 1145 |
| 924 | Ga0439463_020904 | 3300042016 | Bacteria | 1633 |
| 925 | Ga0450911_000399 | 3300042115 | Bacteria | 14340 |
| 926 | Ga0450915_004706 | 3300042119 | Bacteria | 818 |
| 927 | Ga0450920_037126 | 3300042122 | Bacteria | 967 |
| 928 | Ga0450890_000920 | 3300042127 | Bacteria | 4254 |
| 929 | Ga0450900_040229 | 3300042136 | Bacteria | 698 |
| 930 | Ga0439446_0008647 | 3300042156 | Bacteria | 2710 |
| 931 | Ga0439446_0097197 | 3300042156 | Bacteria | 928 |
| 932 | Ga0439460_0006452 | 3300042461 | Bacteria | 2911 |
| 933 | Ga0450918_000026 | 3300042531 | Bacteria | 30691 |
| 934 | Ga0450893_0023579 | 3300042532 | Bacteria | 1071 |
| 935 | Ga0451577_0038274 | 3300042876 | Bacteria | 4314 |
| 936 | Ga0451577_0501386 | 3300042876 | Bacteria | 1102 |
| 937 | Ga0453683_0073668 | 3300044673 | Bacteria | 2138 |
| 938 | Ga0466965_0308511 | 3300044683 | Bacteria | 860 |
| 939 | Ga0466961_0127635 | 3300044693 | Bacteria | 1595 |
| 940 | Ga0466963_0314390 | 3300044694 | Bacteria | 1102 |
| 941 | Ga0453684_0107051 | 3300044712 | Bacteria | 3406 |
| 942 | Ga0451576_0167326 | 3300045051 | Bacteria | 2294 |
| 943 | Ga0451576_0301054 | 3300045051 | Bacteria | 1677 |
| 944 | Ga0495627_035541 | 3300046453 | Bacteria | 1552 |
| 945 | Ga0495592_0000272 | 3300046454 | Bacteria | 44189 |
| 946 | Ga0495590_0314865 | 3300046457 | Bacteria | 590 |
| 947 | Ga0495629_0311230 | 3300046459 | Bacteria | 1077 |
| 948 | Ga0495629_0667629 | 3300046459 | Bacteria | 692 |
| 949 | Ga0495638_0035673 | 3300046460 | Bacteria | 3169 |
| 950 | Ga0495638_0092883 | 3300046460 | Bacteria | 1816 |
| 951 | Ga0495650_0005914 | 3300046471 | Bacteria | 7773 |
| 952 | Ga0495650_0013812 | 3300046471 | Bacteria | 4246 |
| 953 | Ga0495582_0711454 | 3300046473 | Bacteria | 581 |
| 954 | Ga0495583_0044197 | 3300046506 | Bacteria | 2069 |
| 955 | Ga0495583_0353486 | 3300046506 | Bacteria | 580 |
| 956 | Ga0495610_0015357 | 3300046512 | Bacteria | 4454 |
| 957 | Ga0495610_0078883 | 3300046512 | Bacteria | 1517 |
| 958 | Ga0495610_0113459 | 3300046512 | Bacteria | 1197 |
| 959 | Ga0495616_0000346 | 3300046513 | Bacteria | 36668 |
| 960 | Ga0495620_0044562 | 3300046515 | Bacteria | 1927 |
| 961 | Ga0495620_0145009 | 3300046515 | Bacteria | 927 |
| 962 | Ga0495630_0157955 | 3300046517 | Bacteria | 1726 |
| 963 | Ga0495630_1217335 | 3300046517 | Bacteria | 569 |
| 964 | Ga0495631_0000146 | 3300046518 | Bacteria | 48263 |
| 965 | Ga0495632_0011776 | 3300046519 | Bacteria | 5090 |
| 966 | Ga0495632_0423259 | 3300046519 | Bacteria | 580 |
| 967 | Ga0495637_0012308 | 3300046520 | Bacteria | 4096 |
| 968 | Ga0495643_0036252 | 3300046522 | Bacteria | 2711 |
| 969 | Ga0495648_0118920 | 3300046524 | Bacteria | 1424 |
| 970 | Ga0495648_0216473 | 3300046524 | Bacteria | 948 |
| 971 | Ga0495666_0097531 | 3300046526 | Bacteria | 1386 |
| 972 | Ga0495666_0419794 | 3300046526 | Bacteria | 600 |
| 973 | Ga0495642_0121231 | 3300046528 | Bacteria | 1122 |
| 974 | Ga0495654_0068165 | 3300046530 | Bacteria | 1691 |
| 975 | Ga0495654_0128131 | 3300046530 | Bacteria | 1142 |
| 976 | Ga0495586_0160408 | 3300046535 | Bacteria | 1268 |
| 977 | Ga0495609_0041124 | 3300046538 | Bacteria | 2079 |
| 978 | Ga0495621_0004688 | 3300046539 | Bacteria | 3869 |
| 979 | Ga0495621_0147525 | 3300046539 | Bacteria | 924 |
| 980 | Ga0495622_0123800 | 3300046557 | Bacteria | 1180 |
| 981 | Ga0495668_0066901 | 3300046616 | Bacteria | 1977 |
| 982 | Ga0495668_0191610 | 3300046616 | Bacteria | 1120 |
| 983 | Ga0495611_0043832 | 3300046648 | Bacteria | 2001 |
| 984 | Ga0495625_0000254 | 3300046660 | Bacteria | 83637 |
| 985 | Ga0495625_0006631 | 3300046660 | Bacteria | 10274 |
| 986 | Ga0495625_0025317 | 3300046660 | Bacteria | 4501 |
| 987 | Ga0495625_0075490 | 3300046660 | Bacteria | 2358 |
| 988 | Ga0495625_0328567 | 3300046660 | Bacteria | 972 |
| 989 | Ga0495635_0760595 | 3300046663 | Bacteria | 626 |
| 990 | Ga0495661_0107487 | 3300046665 | Bacteria | 1559 |
| 991 | Ga0495588_0128275 | 3300046674 | Bacteria | 1338 |
| 992 | Ga0495588_0540591 | 3300046674 | Bacteria | 610 |
| 993 | Ga0495647_0091643 | 3300046681 | Bacteria | 1247 |
| 994 | Ga0495658_0052799 | 3300046683 | Bacteria | 2306 |
| 995 | Ga0495658_0062321 | 3300046683 | Bacteria | 2144 |
| 996 | Ga0495658_0611030 | 3300046683 | Bacteria | 698 |
| 997 | Ga0495624_0474773 | 3300046690 | Bacteria | 749 |
| 998 | Ga0495670_0097284 | 3300046691 | Bacteria | 1512 |
| 999 | Ga0495670_0105937 | 3300046691 | Bacteria | 1452 |
| 1000 | Ga0495670_0160628 | 3300046691 | Bacteria | 1180 |
| 1001 | Ga0495671_0001736 | 3300046692 | Bacteria | 14135 |
| 1002 | Ga0495671_0234578 | 3300046692 | Bacteria | 887 |
| 1003 | Ga0495671_0239191 | 3300046692 | Bacteria | 877 |
| 1004 | Ga0495649_0013683 | 3300046694 | Bacteria | 4676 |
| 1005 | Ga0495589_0280505 | 3300046794 | Bacteria | 775 |
| 1006 | Ga0495660_0034709 | 3300046810 | Bacteria | 2821 |
| 1007 | Ga0495674_0999092 | 3300047319 | Bacteria | 641 |
| 1008 | Ga0495676_0090056 | 3300047321 | Bacteria | 2297 |
| 1009 | Ga0495676_0442978 | 3300047321 | Bacteria | 857 |
| 1010 | Ga0495680_0234393 | 3300047322 | Bacteria | 1306 |
| 1011 | Ga0495687_022632 | 3300047443 | Bacteria | 3013 |
| 1012 | Ga0495687_032090 | 3300047443 | Bacteria | 2402 |
| 1013 | Ga0495684_0110443 | 3300047471 | Bacteria | 2075 |
| 1014 | Ga0495686_0103310 | 3300047472 | Bacteria | 1717 |
| 1015 | Ga0495686_0209643 | 3300047472 | Bacteria | 1114 |
| 1016 | Ga0495593_0003398 | 3300047673 | Bacteria | 9538 |
| 1017 | Ga0495593_0092334 | 3300047673 | Bacteria | 1558 |
| 1018 | Ga0495614_0004586 | 3300048089 | Bacteria | 6222 |
| 1019 | Ga0495615_0093810 | 3300048090 | Bacteria | 840 |
| 1020 | Ga0496100_0123007 | 3300048903 | Bacteria | 1818 |
| 1021 | Ga0496101_0004342 | 3300048904 | Bacteria | 8896 |
| 1022 | Ga0496101_0436825 | 3300048904 | Bacteria | 1032 |
| 1023 | Ga0496101_0575468 | 3300048904 | Bacteria | 891 |
| 1024 | Ga0496102_0015772 | 3300048905 | Bacteria | 6585 |
| 1025 | Ga0496102_0571414 | 3300048905 | Bacteria | 1053 |
| 1026 | Ga0496103_0718219 | 3300048906 | Bacteria | 633 |
| 1027 | Ga0496104_0090739 | 3300048907 | Bacteria | 2920 |
| 1028 | Ga0496104_0127565 | 3300048907 | Bacteria | 2443 |
| 1029 | Ga0496105_0215713 | 3300048908 | Bacteria | 1563 |
| 1030 | Ga0496106_0015637 | 3300048909 | Bacteria | 5613 |
| 1031 | Ga0496106_0072734 | 3300048909 | Bacteria | 2629 |
| 1032 | Ga0496107_0009370 | 3300048910 | Bacteria | 6788 |
| 1033 | Ga0496108_0382544 | 3300048911 | Bacteria | 1229 |
| 1034 | Ga0496109_0028870 | 3300048912 | Bacteria | 4966 |
| 1035 | Ga0496110_1233250 | 3300048913 | Unclassified | 657 |
| 1036 | Ga0496110_1434843 | 3300048913 | Bacteria | 600 |
| 1037 | Ga0496113_0303612 | 3300048916 | Bacteria | 1278 |
| 1038 | Ga0496113_0626213 | 3300048916 | Bacteria | 861 |
| 1039 | Ga0496114_0042591 | 3300048917 | Bacteria | 3764 |
| 1040 | Ga0496114_0262711 | 3300048917 | Bacteria | 1520 |
| 1041 | Ga0496116_0028666 | 3300048919 | Bacteria | 4028 |
| 1042 | Ga0496116_0058825 | 3300048919 | Bacteria | 2503 |
| 1043 | Ga0496116_0072703 | 3300048919 | Bacteria | 2172 |
| 1044 | Ga0496117_0031641 | 3300048920 | Bacteria | 4035 |
| 1045 | Ga0496117_0034303 | 3300048920 | Bacteria | 3825 |
| 1046 | Ga0496117_0103645 | 3300048920 | Bacteria | 1792 |
| 1047 | Ga0496117_0108662 | 3300048920 | Bacteria | 1734 |
| 1048 | Ga0496117_0250160 | 3300048920 | Bacteria | 967 |
| 1049 | Ga0496118_0007154 | 3300048921 | Bacteria | 11946 |
| 1050 | Ga0496118_0062718 | 3300048921 | Bacteria | 2740 |
| 1051 | Ga0496118_0141631 | 3300048921 | Bacteria | 1523 |
| 1052 | Ga0496118_0151133 | 3300048921 | Bacteria | 1453 |
| 1053 | Ga0496121_0049523 | 3300048924 | Bacteria | 3562 |
| 1054 | Ga0496121_0138815 | 3300048924 | Bacteria | 1806 |
| 1055 | Ga0496121_0227663 | 3300048924 | Bacteria | 1308 |
| 1056 | Ga0496121_0702693 | 3300048924 | Bacteria | 608 |
| 1057 | Ga0496122_0000320 | 3300048925 | Bacteria | 105489 |
| 1058 | Ga0496122_0072076 | 3300048925 | Bacteria | 2458 |
| 1059 | Ga0496122_0132058 | 3300048925 | Bacteria | 1584 |
| 1060 | Ga0496122_0238853 | 3300048925 | Bacteria | 1026 |
| 1061 | Ga0496123_0000258 | 3300048926 | Bacteria | 107501 |
| 1062 | Ga0496123_0073492 | 3300048926 | Bacteria | 2121 |
| 1063 | Ga0496123_0084018 | 3300048926 | Bacteria | 1922 |
| 1064 | Ga0496123_0366402 | 3300048926 | Bacteria | 665 |
| 1065 | Ga0496124_0019585 | 3300048927 | Bacteria | 6289 |
| 1066 | Ga0496124_0032014 | 3300048927 | Bacteria | 4651 |
| 1067 | Ga0496124_0084256 | 3300048927 | Bacteria | 2607 |
| 1068 | Ga0496124_0092301 | 3300048927 | Bacteria | 2466 |
| 1069 | Ga0496124_0160561 | 3300048927 | Bacteria | 1752 |
| 1070 | Ga0496125_0022796 | 3300048928 | Bacteria | 5804 |
| 1071 | Ga0496125_0050508 | 3300048928 | Bacteria | 3442 |
| 1072 | Ga0496125_0058522 | 3300048928 | Bacteria | 3112 |
| 1073 | Ga0496125_0214881 | 3300048928 | Bacteria | 1245 |
| 1074 | Ga0496125_0219538 | 3300048928 | Bacteria | 1226 |
| 1075 | Ga0496126_0185739 | 3300048929 | Bacteria | 1763 |
| 1076 | Ga0496126_0389710 | 3300048929 | Bacteria | 1132 |
| 1077 | Ga0495678_187751 | 3300049459 | Bacteria | 644 |
| 1078 | Ga0495682_0175501 | 3300049460 | Bacteria | 762 |
| 1079 | Ga0501034_0434374 | 3300049571 | Bacteria | 1232 |
| 1080 | Ga0501034_0863935 | 3300049571 | Bacteria | 794 |
| 1081 | Ga0501037_0164582 | 3300049573 | Bacteria | 1580 |
| 1082 | Ga0501073_0441384 | 3300049589 | Bacteria | 900 |
| 1083 | Ga0501249_004010 | 3300049679 | Bacteria | 2978 |
| 1084 | Ga0501262_000047 | 3300049759 | Bacteria | 15771 |
| 1085 | Ga0501035_0375085 | 3300049822 | Bacteria | 1187 |
| 1086 | Ga0501044_0246292 | 3300049823 | Bacteria | 1730 |
| 1087 | nmdc:mga03683_122194_c1 | 3300050489 | Bacteria | 1159 |
| 1088 | nmdc:mga03683_2164_c2 | 3300050489 | Bacteria | 1623 |
| 1089 | nmdc:mga03683_292134_c1 | 3300050489 | Unclassified | 763 |
| 1090 | nmdc:mga03n38_10194_c2 | 3300050490 | Bacteria | 2595 |
| 1091 | nmdc:mga03n38_301283_c1 | 3300050490 | Bacteria | 861 |
| 1092 | nmdc:mga03n38_48197_c1 | 3300050490 | Bacteria | 1889 |
| 1093 | nmdc:mga03n38_5373_c1 | 3300050490 | Bacteria | 4354 |
| 1094 | nmdc:mga03n38_93999_c1 | 3300050490 | Bacteria | 1433 |
| 1095 | nmdc:mga03n38_962_c1 | 3300050490 | Bacteria | 7821 |
| 1096 | nmdc:mga00v17_141610_c1 | 3300050491 | Bacteria | 1542 |
| 1097 | nmdc:mga00v17_17913_c1 | 3300050491 | Bacteria | 4017 |
| 1098 | nmdc:mga00v17_402827_c1 | 3300050491 | Bacteria | 889 |
| 1099 | nmdc:mga00v17_467037_c1 | 3300050491 | Bacteria | 819 |
| 1100 | nmdc:mga00v17_497083_c1 | 3300050491 | Bacteria | 791 |
| 1101 | nmdc:mga00v17_77136_c1 | 3300050491 | Bacteria | 2074 |
| 1102 | nmdc:mga0yw44_1144868_c1 | 3300050492 | Bacteria | 525 |
| 1103 | nmdc:mga0yw44_44737_c1 | 3300050492 | Bacteria | 2650 |
| 1104 | nmdc:mga0yw44_467056_c1 | 3300050492 | Bacteria | 855 |
| 1105 | nmdc:mga0k408_114918_c1 | 3300050493 | Bacteria | 1592 |
| 1106 | nmdc:mga0k408_128491_c1 | 3300050493 | Bacteria | 1504 |
| 1107 | nmdc:mga0k408_15900_c1 | 3300050493 | Bacteria | 4167 |
| 1108 | nmdc:mga0k408_1682_c1 | 3300050493 | Bacteria | 11938 |
| 1109 | nmdc:mga0k408_220108_c2 | 3300050493 | Bacteria | 589 |
| 1110 | nmdc:mga0k408_22313_c1 | 3300050493 | Bacteria | 3564 |
| 1111 | nmdc:mga0k408_227497_c1 | 3300050493 | Bacteria | 1113 |
| 1112 | nmdc:mga0k408_45759_c1 | 3300050493 | Bacteria | 2526 |
| 1113 | nmdc:mga0k408_50999_c1 | 3300050493 | Bacteria | 2396 |
| 1114 | nmdc:mga0k408_534565_c1 | 3300050493 | Bacteria | 694 |
| 1115 | nmdc:mga0k408_555600_c1 | 3300050493 | Bacteria | 678 |
| 1116 | nmdc:mga0k408_569995_c1 | 3300050493 | Bacteria | 669 |
| 1117 | nmdc:mga0k408_58948_c1 | 3300050493 | Bacteria | 2230 |
| 1118 | nmdc:mga0k408_6998_c1 | 3300050493 | Bacteria | 6018 |
| 1119 | nmdc:mga0k408_78539_c1 | 3300050493 | Bacteria | 1931 |
| 1120 | nmdc:mga06z11_104541_c1 | 3300050494 | Bacteria | 1559 |
| 1121 | nmdc:mga06z11_262436_c1 | 3300050494 | Bacteria | 1019 |
| 1122 | nmdc:mga06z11_264210_c1 | 3300050494 | Bacteria | 1016 |
| 1123 | nmdc:mga06z11_52528_c1 | 3300050494 | Bacteria | 2092 |
| 1124 | nmdc:mga06z11_9203_c1 | 3300050494 | Bacteria | 4152 |
| 1125 | nmdc:mga04h51_116994_c1 | 3300050495 | Bacteria | 989 |
| 1126 | nmdc:mga04h51_120818_c1 | 3300050495 | Bacteria | 976 |
| 1127 | nmdc:mga04h51_38905_c1 | 3300050495 | Bacteria | 1542 |
| 1128 | nmdc:mga07m45_1045_c1 | 3300050496 | Bacteria | 12330 |
| 1129 | nmdc:mga07m45_1052_c1 | 3300050496 | Bacteria | 12288 |
| 1130 | nmdc:mga07m45_1463_c1 | 3300050496 | Bacteria | 10840 |
| 1131 | nmdc:mga07m45_187455_c1 | 3300050496 | Bacteria | 1203 |
| 1132 | nmdc:mga07m45_207899_c1 | 3300050496 | Bacteria | 1139 |
| 1133 | nmdc:mga07m45_220705_c1 | 3300050496 | Bacteria | 1103 |
| 1134 | nmdc:mga07m45_24407_c1 | 3300050496 | Bacteria | 3312 |
| 1135 | nmdc:mga07m45_256134_c1 | 3300050496 | Bacteria | 1018 |
| 1136 | nmdc:mga07m45_290700_c1 | 3300050496 | Bacteria | 951 |
| 1137 | nmdc:mga07m45_443325_c1 | 3300050496 | Bacteria | 753 |
| 1138 | nmdc:mga07m45_479976_c1 | 3300050496 | Unclassified | 720 |
| 1139 | nmdc:mga07m45_54386_c1 | 3300050496 | Bacteria | 2263 |
| 1140 | nmdc:mga07m45_577170_c1 | 3300050496 | Bacteria | 650 |
| 1141 | nmdc:mga07m45_595_c2 | 3300050496 | Bacteria | 13851 |
| 1142 | nmdc:mga07m45_6204_c1 | 3300050496 | Bacteria | 6031 |
| 1143 | nmdc:mga07m45_981_c1 | 3300050496 | Bacteria | 12571 |
| 1144 | nmdc:mga0n895_103710_c1 | 3300050512 | Bacteria | 2855 |
| 1145 | nmdc:mga0rr50_598354_c1 | 3300050513 | Bacteria | 940 |
| 1146 | nmdc:mga0sz30_505241_c1 | 3300050516 | Bacteria | 544 |
| 1147 | nmdc:mga0sz30_80685_c1 | 3300050516 | Bacteria | 1408 |
| 1148 | Ga0500610_0014869 | 3300053079 | Bacteria | 3665 |
| 1149 | Ga0500610_0030679 | 3300053079 | Bacteria | 2726 |
| 1150 | Ga0500610_0128132 | 3300053079 | Bacteria | 1293 |
| 1151 | Ga0500578_0000537 | 3300053086 | Bacteria | 46023 |
| 1152 | Ga0500578_0086940 | 3300053086 | Bacteria | 1986 |
| 1153 | Ga0500643_072680 | 3300053087 | Bacteria | 953 |
| 1154 | Ga0500644_0003434 | 3300053088 | Bacteria | 3918 |
| 1155 | Ga0500644_0181695 | 3300053088 | Bacteria | 861 |
| 1156 | Ga0500646_0018609 | 3300053090 | Bacteria | 1831 |
| 1157 | Ga0500647_0053260 | 3300053091 | Bacteria | 1947 |
| 1158 | Ga0500647_0136843 | 3300053091 | Bacteria | 1152 |
| 1159 | Ga0500651_0003756 | 3300053093 | Bacteria | 8371 |
| 1160 | Ga0500651_0023247 | 3300053093 | Bacteria | 3881 |
| 1161 | Ga0500651_0117340 | 3300053093 | Bacteria | 1618 |
| 1162 | Ga0500651_0269082 | 3300053093 | Bacteria | 986 |
| 1163 | Ga0500651_0304391 | 3300053093 | Bacteria | 914 |
| 1164 | Ga0500560_216069 | 3300053107 | Bacteria | 613 |
| 1165 | Ga0500562_035386 | 3300053108 | Bacteria | 1323 |
| 1166 | Ga0500569_257867 | 3300053109 | Bacteria | 591 |
| 1167 | Ga0500571_000381 | 3300053110 | Bacteria | 17571 |
| 1168 | Ga0500593_004216 | 3300053117 | Bacteria | 5543 |
| 1169 | Ga0500593_007439 | 3300053117 | Bacteria | 4456 |
| 1170 | Ga0500597_123433 | 3300053120 | Bacteria | 1121 |
| 1171 | Ga0500607_001809 | 3300053121 | Bacteria | 18468 |
| 1172 | Ga0500607_054656 | 3300053121 | Bacteria | 2113 |
| 1173 | Ga0500608_055736 | 3300053122 | Bacteria | 1894 |
| 1174 | Ga0500608_120170 | 3300053122 | Bacteria | 1193 |
| 1175 | Ga0500608_141312 | 3300053122 | Bacteria | 1067 |
| 1176 | Ga0500626_024197 | 3300053128 | Bacteria | 2723 |
| 1177 | Ga0500642_0032574 | 3300053130 | Bacteria | 2188 |
| 1178 | Ga0500652_000155 | 3300053131 | Bacteria | 26280 |
| 1179 | Ga0500655_002877 | 3300053133 | Bacteria | 3126 |
| 1180 | Ga0500655_004348 | 3300053133 | Bacteria | 2557 |
| 1181 | Ga0500658_0000192 | 3300053134 | Bacteria | 29159 |
| 1182 | Ga0500658_0000417 | 3300053134 | Bacteria | 18435 |
| 1183 | Ga0500658_0003329 | 3300053134 | Bacteria | 6093 |
| 1184 | Ga0500559_0004739 | 3300053136 | Bacteria | 6391 |
| 1185 | Ga0500559_0021048 | 3300053136 | Bacteria | 2761 |
| 1186 | Ga0500559_0100995 | 3300053136 | Bacteria | 1329 |
| 1187 | Ga0500561_0089930 | 3300053137 | Bacteria | 907 |
| 1188 | Ga0500564_028526 | 3300053138 | Bacteria | 2569 |
| 1189 | Ga0500568_0003566 | 3300053139 | Bacteria | 8600 |
| 1190 | Ga0500568_0016575 | 3300053139 | Bacteria | 3271 |
| 1191 | Ga0500568_0211802 | 3300053139 | Bacteria | 709 |
| 1192 | Ga0500573_0058921 | 3300053140 | Bacteria | 2201 |
| 1193 | Ga0500574_001773 | 3300053141 | Bacteria | 3341 |
| 1194 | Ga0500577_0164507 | 3300053142 | Bacteria | 946 |
| 1195 | Ga0500604_0010581 | 3300053151 | Bacteria | 2469 |
| 1196 | Ga0500604_0025692 | 3300053151 | Bacteria | 1694 |
| 1197 | Ga0500616_0055380 | 3300053153 | Bacteria | 2074 |
| 1198 | Ga0500619_004740 | 3300053154 | Bacteria | 2953 |
| 1199 | Ga0500619_133770 | 3300053154 | Bacteria | 845 |
| 1200 | Ga0500622_0000423 | 3300053156 | Bacteria | 40034 |
| 1201 | Ga0500622_0001100 | 3300053156 | Bacteria | 22485 |
| 1202 | Ga0500627_0000737 | 3300053158 | Bacteria | 8729 |
| 1203 | Ga0500627_0340197 | 3300053158 | Bacteria | 649 |
| 1204 | Ga0500634_0133993 | 3300053161 | Bacteria | 1184 |
| 1205 | Ga0500638_085214 | 3300053162 | Bacteria | 1496 |
| 1206 | Ga0500625_191069 | 3300053729 | Bacteria | 701 |
| 1207 | Ga0500645_004885 | 3300053730 | Bacteria | 5045 |
| 1208 | Ga0500596_041041 | 3300053735 | Bacteria | 738 |
| 1209 | Ga0500587_001023 | 3300053739 | Bacteria | 3789 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005333 | Ga0070677_10412095 | Ga0070677_104120951 | 134 |
| 2 | 3300025923 | Ga0207681_10506969 | Ga0207681_105069692 | 134 |
| 3 | 3300003316 | rootH1_10002444 | rootH1_100024446 | 135 |
| 4 | 3300003320 | rootH2_10048751 | rootH2_100487512 | 135 |
| 5 | 3300003322 | rootL2_10004239 | rootL2_1000423911 | 135 |
| 6 | iso_pu_bacteria | 2585428058 | 2587733852 | 137 |
| 7 | 3300014326 | Ga0157380_11477709 | Ga0157380_114777092 | 139 |
| 8 | 3300003759 | Ga0055525_1000021 | Ga0055525_100002164 | 140 |
| 9 | 3300006048 | Ga0075363_100234686 | Ga0075363_1002346862 | 140 |
| 10 | 3300006186 | Ga0075369_10033995 | Ga0075369_100339951 | 140 |
| 11 | 3300014497 | Ga0182008_10067551 | Ga0182008_100675512 | 140 |
| 12 | 3300025226 | Ga0209674_115250 | Ga0209674_1152502 | 140 |
| 13 | 3300025230 | Ga0209563_100005 | Ga0209563_100005263 | 140 |
| 14 | 3300025303 | Ga0209051_1021829 | Ga0209051_10218294 | 140 |
| 15 | 3300041452 | Ga0451793_1115609 | Ga0451793_1115609_272_712 | 140 |
| 16 | 3300041460 | Ga0451802_0401206 | Ga0451802_0401206_124_564 | 140 |
| 17 | 3300046460 | Ga0495638_0092883 | Ga0495638_0092883_187_627 | 140 |
| 18 | 3300046519 | Ga0495632_0423259 | Ga0495632_0423259_98_538 | 140 |
| 19 | 3300050491 | nmdc:mga00v17_402827_c1 | nmdc:mga00v17_402827_c1_273_713 | 140 |
| 20 | 3300050492 | nmdc:mga0yw44_1144868_c1 | nmdc:mga0yw44_1144868_c1_61_501 | 140 |
| 21 | 3300050496 | nmdc:mga07m45_6204_c1 | nmdc:mga07m45_6204_c1_531_971 | 140 |
| 22 | 3300053088 | Ga0500644_0181695 | Ga0500644_0181695_98_538 | 140 |
| 23 | 3300053093 | Ga0500651_0117340 | Ga0500651_0117340_131_571 | 140 |
| 24 | 3300053131 | Ga0500652_000155 | Ga0500652_000155_11537_11977 | 140 |
| 25 | 3300053133 | Ga0500655_004348 | Ga0500655_004348_303_743 | 140 |
| 26 | 3300053156 | Ga0500622_0000423 | Ga0500622_0000423_8780_9220 | 140 |
| 27 | 3300053158 | Ga0500627_0340197 | Ga0500627_0340197_46_486 | 140 |
| 28 | 3300021361 | Ga0213872_10000046 | Ga0213872_1000004614 | 141 |
| 29 | 3300021361 | Ga0213872_10046241 | Ga0213872_100462412 | 141 |
| 30 | 3300030731 | Ga0316177_1220430 | Ga0316177_12204302 | 141 |
| 31 | 3300031239 | Ga0265328_10017411 | Ga0265328_100174112 | 141 |
| 32 | 3300031250 | Ga0265331_10001984 | Ga0265331_1000198416 | 141 |
| 33 | 3300031251 | Ga0265327_10000028 | Ga0265327_10000028280 | 141 |
| 34 | 3300031548 | Ga0307408_100196529 | Ga0307408_1001965292 | 141 |
| 35 | 3300031824 | Ga0307413_10431007 | Ga0307413_104310072 | 141 |
| 36 | 3300031901 | Ga0307406_10289780 | Ga0307406_102897802 | 141 |
| 37 | 3300031903 | Ga0307407_10224521 | Ga0307407_102245211 | 141 |
| 38 | 3300039447 | Ga0436361_0633280 | Ga0436361_0633280_94723_95175 | 141 |
| 39 | 3300039447 | Ga0436361_0844177 | Ga0436361_0844177_3818_4273 | 141 |
| 40 | 3300046524 | Ga0495648_0216473 | Ga0495648_0216473_469_897 | 141 |
| 41 | 3300046690 | Ga0495624_0474773 | Ga0495624_0474773_287_715 | 141 |
| 42 | iso_pu_bacteria | 2643221592 | 2643972551 | 141 |
| 43 | iso_pu_bacteria | 2643221625 | 2644138441 | 141 |
| 44 | iso_pu_bacteria | 2643221648 | 2644273059 | 141 |
| 45 | 3300003323 | rootH1_10193050 | rootH1_101930503 | 142 |
| 46 | 3300005262 | Ga0065165_1002517 | Ga0065165_10025176 | 142 |
| 47 | 3300025273 | Ga0209673_1037488 | Ga0209673_10374883 | 142 |
| 48 | 3300025298 | Ga0209050_1001962 | Ga0209050_100196219 | 142 |
| 49 | 3300031507 | Ga0307509_10016656 | Ga0307509_100166564 | 142 |
| 50 | 3300031616 | Ga0307508_10005253 | Ga0307508_1000525310 | 142 |
| 51 | 3300033180 | Ga0307510_10092631 | Ga0307510_100926314 | 142 |
| 52 | 3300033180 | Ga0307510_10310134 | Ga0307510_103101342 | 142 |
| 53 | 3300039447 | Ga0436361_0034970 | Ga0436361_0034970_75205_75672 | 142 |
| 54 | 3300041441 | Ga0451787_615507 | Ga0451787_615507_14_448 | 142 |
| 55 | 3300041460 | Ga0451802_0061791 | Ga0451802_0061791_55_501 | 142 |
| 56 | iso_pu_bacteria | 2585428057 | 2587727833 | 142 |
| 57 | iso_pu_bacteria | 2585428062 | 2587754507 | 142 |
| 58 | iso_pu_bacteria | 2643221654 | 2644302117 | 142 |
| 59 | iso_pu_bacteria | 2831864461 | 2831869784 | 142 |
| 60 | 3300009545 | Ga0105237_10085132 | Ga0105237_100851324 | 143 |
| 61 | 3300031507 | Ga0307509_10475168 | Ga0307509_104751682 | 143 |
| 62 | 3300031616 | Ga0307508_10130809 | Ga0307508_101308094 | 143 |
| 63 | 3300033179 | Ga0307507_10098176 | Ga0307507_100981763 | 143 |
| 64 | 3300046526 | Ga0495666_0097531 | Ga0495666_0097531_639_1094 | 143 |
| 65 | 3300053086 | Ga0500578_0086940 | Ga0500578_0086940_678_1133 | 143 |
| 66 | 3300005334 | Ga0068869_100091461 | Ga0068869_1000914612 | 144 |
| 67 | 3300005356 | Ga0070674_100016511 | Ga0070674_1000165115 | 144 |
| 68 | 3300005457 | Ga0070662_100024603 | Ga0070662_1000246032 | 144 |
| 69 | 3300005459 | Ga0068867_100255074 | Ga0068867_1002550741 | 144 |
| 70 | 3300005577 | Ga0068857_100143878 | Ga0068857_1001438782 | 144 |
| 71 | 3300025937 | Ga0207669_10237670 | Ga0207669_102376702 | 144 |
| 72 | 3300025981 | Ga0207640_10017371 | Ga0207640_100173713 | 144 |
| 73 | 3300026142 | Ga0207698_10054479 | Ga0207698_100544792 | 144 |
| 74 | 3300031548 | Ga0307408_100369862 | Ga0307408_1003698622 | 144 |
| 75 | 3300033180 | Ga0307510_10005587 | Ga0307510_100055872 | 144 |
| 76 | 3300035172 | Ga0373955_0841147 | Ga0373955_0841147_39_479 | 144 |
| 77 | 3300036401 | Ga0373937_0381968 | Ga0373937_0381968_19_465 | 144 |
| 78 | 3300039437 | Ga0436365_0773501 | Ga0436365_0773501_199_645 | 144 |
| 79 | 3300039450 | Ga0436363_0379139 | Ga0436363_0379139_492_938 | 144 |
| 80 | 3300039450 | Ga0436363_1119806 | Ga0436363_1119806_128_571 | 144 |
| 81 | 3300048090 | Ga0495615_0093810 | Ga0495615_0093810_32_472 | 144 |
| 82 | 3300048904 | Ga0496101_0575468 | Ga0496101_0575468_369_821 | 144 |
| 83 | 3300048905 | Ga0496102_0015772 | Ga0496102_0015772_2943_3413 | 144 |
| 84 | 3300050516 | nmdc:mga0sz30_505241_c1 | nmdc:mga0sz30_505241_c1_62_499 | 144 |
| 85 | 3300053086 | Ga0500578_0000537 | Ga0500578_0000537_15853_16326 | 144 |
| 86 | 3300053091 | Ga0500647_0053260 | Ga0500647_0053260_19_516 | 144 |
| 87 | 3300053151 | Ga0500604_0025692 | Ga0500604_0025692_949_1422 | 144 |
| 88 | iso_pu_bacteria | 2643221644 | 2644248287 | 144 |
| 89 | iso_pu_bacteria | 2842747753 | 2842749155 | 144 |
| 90 | 3300003578 | Ga0006562J51391_1103471 | Ga0006562J51391_11034715 | 145 |
| 91 | 3300003578 | Ga0006562J51391_1103472 | Ga0006562J51391_11034722 | 145 |
| 92 | 3300003791 | Ga0055530_10002534 | Ga0055530_100025347 | 145 |
| 93 | 3300003792 | Ga0055540_1000011 | Ga0055540_1000011117 | 145 |
| 94 | 3300003794 | Ga0055531_10015050 | Ga0055531_100150502 | 145 |
| 95 | 3300005347 | Ga0070668_101787717 | Ga0070668_1017877171 | 145 |
| 96 | 3300005356 | Ga0070674_101703460 | Ga0070674_1017034601 | 145 |
| 97 | 3300006051 | Ga0075364_10058694 | Ga0075364_100586941 | 145 |
| 98 | 3300006195 | Ga0075366_10082530 | Ga0075366_100825303 | 145 |
| 99 | 3300006353 | Ga0075370_10002241 | Ga0075370_100022418 | 145 |
| 100 | 3300009553 | Ga0105249_10202009 | Ga0105249_102020091 | 145 |
| 101 | 3300013100 | Ga0157373_10012777 | Ga0157373_100127775 | 145 |
| 102 | 3300014497 | Ga0182008_10006636 | Ga0182008_100066365 | 145 |
| 103 | 3300015261 | Ga0182006_1016882 | Ga0182006_10168823 | 145 |
| 104 | 3300025273 | Ga0209673_1004340 | Ga0209673_10043407 | 145 |
| 105 | 3300025295 | Ga0209564_1000005 | Ga0209564_1000005631 | 145 |
| 106 | 3300025298 | Ga0209050_1002535 | Ga0209050_10025357 | 145 |
| 107 | 3300025303 | Ga0209051_1000020 | Ga0209051_1000020117 | 145 |
| 108 | 3300025304 | Ga0209257_1000085 | Ga0209257_1000085117 | 145 |
| 109 | 3300025936 | Ga0207670_10993188 | Ga0207670_109931882 | 145 |
| 110 | 3300025937 | Ga0207669_11726594 | Ga0207669_117265941 | 145 |
| 111 | 3300025961 | Ga0207712_11082470 | Ga0207712_110824702 | 145 |
| 112 | 3300028794 | Ga0307515_10009904 | Ga0307515_100099047 | 145 |
| 113 | 3300028794 | Ga0307515_10039228 | Ga0307515_100392282 | 145 |
| 114 | 3300030522 | Ga0307512_10225449 | Ga0307512_102254492 | 145 |
| 115 | 3300031456 | Ga0307513_10004294 | Ga0307513_100042943 | 145 |
| 116 | 3300031456 | Ga0307513_10026047 | Ga0307513_100260472 | 145 |
| 117 | 3300031507 | Ga0307509_10050016 | Ga0307509_100500166 | 145 |
| 118 | 3300031507 | Ga0307509_10051400 | Ga0307509_100514003 | 145 |
| 119 | 3300031616 | Ga0307508_10000194 | Ga0307508_1000019423 | 145 |
| 120 | 3300031649 | Ga0307514_10011053 | Ga0307514_100110535 | 145 |
| 121 | 3300031730 | Ga0307516_10118500 | Ga0307516_101185002 | 145 |
| 122 | 3300031824 | Ga0307413_10420255 | Ga0307413_104202551 | 145 |
| 123 | 3300031911 | Ga0307412_10947294 | Ga0307412_109472941 | 145 |
| 124 | 3300033180 | Ga0307510_10407232 | Ga0307510_104072322 | 145 |
| 125 | 3300035692 | Ga0373935_0951774 | Ga0373935_0951774_17_505 | 145 |
| 126 | 3300037471 | Ga0395905_0849440 | Ga0395905_0849440_21_485 | 145 |
| 127 | 3300041456 | Ga0451795_0623483 | Ga0451795_0623483_80_562 | 145 |
| 128 | 3300041459 | Ga0451800_0822228 | Ga0451800_0822228_264_722 | 145 |
| 129 | 3300041459 | Ga0451800_0963213 | Ga0451800_0963213_12_494 | 145 |
| 130 | 3300041496 | Ga0451839_0760707 | Ga0451839_0760707_495_977 | 145 |
| 131 | 3300041505 | Ga0451849_1279070 | Ga0451849_1279070_332_814 | 145 |
| 132 | 3300042532 | Ga0450893_0023579 | Ga0450893_0023579_313_777 | 145 |
| 133 | 3300044712 | Ga0453684_0107051 | Ga0453684_0107051_691_1140 | 145 |
| 134 | 3300046457 | Ga0495590_0314865 | Ga0495590_0314865_87_527 | 145 |
| 135 | 3300046512 | Ga0495610_0015357 | Ga0495610_0015357_3651_4133 | 145 |
| 136 | 3300046515 | Ga0495620_0145009 | Ga0495620_0145009_161_643 | 145 |
| 137 | 3300046522 | Ga0495643_0036252 | Ga0495643_0036252_1294_1776 | 145 |
| 138 | 3300046660 | Ga0495625_0006631 | Ga0495625_0006631_9192_9674 | 145 |
| 139 | 3300046692 | Ga0495671_0234578 | Ga0495671_0234578_363_842 | 145 |
| 140 | 3300047472 | Ga0495686_0209643 | Ga0495686_0209643_71_553 | 145 |
| 141 | 3300050489 | nmdc:mga03683_292134_c1 | nmdc:mga03683_292134_c1_285_740 | 145 |
| 142 | 3300050490 | nmdc:mga03n38_48197_c1 | nmdc:mga03n38_48197_c1_234_716 | 145 |
| 143 | 3300050493 | nmdc:mga0k408_534565_c1 | nmdc:mga0k408_534565_c1_168_650 | 145 |
| 144 | 3300050493 | nmdc:mga0k408_58948_c1 | nmdc:mga0k408_58948_c1_1016_1480 | 145 |
| 145 | 3300050496 | nmdc:mga07m45_207899_c1 | nmdc:mga07m45_207899_c1_406_888 | 145 |
| 146 | 3300053090 | Ga0500646_0018609 | Ga0500646_0018609_344_802 | 145 |
| 147 | 3300053739 | Ga0500587_001023 | Ga0500587_001023_742_1224 | 145 |
| 148 | iso_pu_bacteria | 2913036834 | 2913039049 | 145 |
| 149 | iso_pu_bacteria | 2923586266 | 2923586729 | 145 |
| 150 | iso_pu_bacteria | 2931369376 | 2931369953 | 145 |
| 151 | 3300005327 | Ga0070658_10083823 | Ga0070658_100838232 | 146 |
| 152 | 3300005327 | Ga0070658_10102909 | Ga0070658_101029093 | 146 |
| 153 | 3300005328 | Ga0070676_10009290 | Ga0070676_100092907 | 146 |
| 154 | 3300005329 | Ga0070683_100005352 | Ga0070683_1000053528 | 146 |
| 155 | 3300005331 | Ga0070670_100009851 | Ga0070670_1000098516 | 146 |
| 156 | 3300005331 | Ga0070670_100109353 | Ga0070670_1001093531 | 146 |
| 157 | 3300005333 | Ga0070677_10026044 | Ga0070677_100260443 | 146 |
| 158 | 3300005333 | Ga0070677_10054643 | Ga0070677_100546432 | 146 |
| 159 | 3300005334 | Ga0068869_100069759 | Ga0068869_1000697592 | 146 |
| 160 | 3300005335 | Ga0070666_10659296 | Ga0070666_106592961 | 146 |
| 161 | 3300005338 | Ga0068868_100001157 | Ga0068868_1000011576 | 146 |
| 162 | 3300005338 | Ga0068868_100063065 | Ga0068868_1000630652 | 146 |
| 163 | 3300005339 | Ga0070660_100068835 | Ga0070660_1000688353 | 146 |
| 164 | 3300005339 | Ga0070660_100078509 | Ga0070660_1000785092 | 146 |
| 165 | 3300005344 | Ga0070661_100037349 | Ga0070661_1000373492 | 146 |
| 166 | 3300005344 | Ga0070661_100134336 | Ga0070661_1001343362 | 146 |
| 167 | 3300005344 | Ga0070661_101191782 | Ga0070661_1011917821 | 146 |
| 168 | 3300005347 | Ga0070668_100156282 | Ga0070668_1001562822 | 146 |
| 169 | 3300005353 | Ga0070669_100107590 | Ga0070669_1001075903 | 146 |
| 170 | 3300005354 | Ga0070675_100001801 | Ga0070675_1000018015 | 146 |
| 171 | 3300005354 | Ga0070675_100054138 | Ga0070675_1000541382 | 146 |
| 172 | 3300005355 | Ga0070671_100244692 | Ga0070671_1002446922 | 146 |
| 173 | 3300005355 | Ga0070671_100416739 | Ga0070671_1004167392 | 146 |
| 174 | 3300005356 | Ga0070674_100417511 | Ga0070674_1004175112 | 146 |
| 175 | 3300005364 | Ga0070673_100115232 | Ga0070673_1001152322 | 146 |
| 176 | 3300005364 | Ga0070673_100125273 | Ga0070673_1001252732 | 146 |
| 177 | 3300005364 | Ga0070673_100153586 | Ga0070673_1001535862 | 146 |
| 178 | 3300005366 | Ga0070659_100106388 | Ga0070659_1001063882 | 146 |
| 179 | 3300005367 | Ga0070667_100088937 | Ga0070667_1000889374 | 146 |
| 180 | 3300005367 | Ga0070667_100195279 | Ga0070667_1001952793 | 146 |
| 181 | 3300005455 | Ga0070663_100118454 | Ga0070663_1001184543 | 146 |
| 182 | 3300005456 | Ga0070678_100046649 | Ga0070678_1000466492 | 146 |
| 183 | 3300005456 | Ga0070678_100173760 | Ga0070678_1001737602 | 146 |
| 184 | 3300005457 | Ga0070662_100000867 | Ga0070662_10000086710 | 146 |
| 185 | 3300005457 | Ga0070662_100110025 | Ga0070662_1001100253 | 146 |
| 186 | 3300005457 | Ga0070662_100154273 | Ga0070662_1001542732 | 146 |
| 187 | 3300005458 | Ga0070681_10532061 | Ga0070681_105320612 | 146 |
| 188 | 3300005459 | Ga0068867_100005504 | Ga0068867_1000055043 | 146 |
| 189 | 3300005459 | Ga0068867_100895646 | Ga0068867_1008956462 | 146 |
| 190 | 3300005535 | Ga0070684_100027307 | Ga0070684_1000273077 | 146 |
| 191 | 3300005535 | Ga0070684_100127611 | Ga0070684_1001276112 | 146 |
| 192 | 3300005535 | Ga0070684_100423920 | Ga0070684_1004239202 | 146 |
| 193 | 3300005535 | Ga0070684_100679080 | Ga0070684_1006790802 | 146 |
| 194 | 3300005539 | Ga0068853_100002880 | Ga0068853_1000028806 | 146 |
| 195 | 3300005539 | Ga0068853_100132036 | Ga0068853_1001320362 | 146 |
| 196 | 3300005539 | Ga0068853_101987723 | Ga0068853_1019877231 | 146 |
| 197 | 3300005543 | Ga0070672_100019327 | Ga0070672_1000193273 | 146 |
| 198 | 3300005543 | Ga0070672_100049097 | Ga0070672_1000490972 | 146 |
| 199 | 3300005543 | Ga0070672_100098868 | Ga0070672_1000988682 | 146 |
| 200 | 3300005543 | Ga0070672_100204828 | Ga0070672_1002048282 | 146 |
| 201 | 3300005547 | Ga0070693_100029302 | Ga0070693_1000293024 | 146 |
| 202 | 3300005547 | Ga0070693_100487795 | Ga0070693_1004877952 | 146 |
| 203 | 3300005563 | Ga0068855_100051204 | Ga0068855_1000512047 | 146 |
| 204 | 3300005564 | Ga0070664_100093118 | Ga0070664_1000931182 | 146 |
| 205 | 3300005564 | Ga0070664_100115387 | Ga0070664_1001153872 | 146 |
| 206 | 3300005577 | Ga0068857_100043611 | Ga0068857_1000436113 | 146 |
| 207 | 3300005577 | Ga0068857_100121537 | Ga0068857_1001215373 | 146 |
| 208 | 3300005578 | Ga0068854_100027581 | Ga0068854_1000275813 | 146 |
| 209 | 3300005578 | Ga0068854_100261895 | Ga0068854_1002618952 | 146 |
| 210 | 3300005614 | Ga0068856_100004035 | Ga0068856_1000040356 | 146 |
| 211 | 3300005614 | Ga0068856_100190867 | Ga0068856_1001908672 | 146 |
| 212 | 3300005616 | Ga0068852_100072682 | Ga0068852_1000726822 | 146 |
| 213 | 3300005616 | Ga0068852_100139459 | Ga0068852_1001394592 | 146 |
| 214 | 3300005616 | Ga0068852_100189947 | Ga0068852_1001899472 | 146 |
| 215 | 3300005616 | Ga0068852_100606196 | Ga0068852_1006061962 | 146 |
| 216 | 3300005617 | Ga0068859_100435764 | Ga0068859_1004357642 | 146 |
| 217 | 3300005618 | Ga0068864_100024340 | Ga0068864_1000243402 | 146 |
| 218 | 3300005618 | Ga0068864_100363776 | Ga0068864_1003637762 | 146 |
| 219 | 3300005618 | Ga0068864_100550863 | Ga0068864_1005508632 | 146 |
| 220 | 3300005719 | Ga0068861_100003855 | Ga0068861_10000385512 | 146 |
| 221 | 3300005834 | Ga0068851_10020198 | Ga0068851_100201987 | 146 |
| 222 | 3300005834 | Ga0068851_10371613 | Ga0068851_103716132 | 146 |
| 223 | 3300005840 | Ga0068870_10371678 | Ga0068870_103716782 | 146 |
| 224 | 3300005841 | Ga0068863_100058398 | Ga0068863_1000583984 | 146 |
| 225 | 3300005841 | Ga0068863_100195703 | Ga0068863_1001957033 | 146 |
| 226 | 3300005842 | Ga0068858_100351657 | Ga0068858_1003516572 | 146 |
| 227 | 3300005843 | Ga0068860_100030780 | Ga0068860_1000307806 | 146 |
| 228 | 3300005843 | Ga0068860_100458633 | Ga0068860_1004586332 | 146 |
| 229 | 3300006195 | Ga0075366_10014575 | Ga0075366_100145754 | 146 |
| 230 | 3300006237 | Ga0097621_100022260 | Ga0097621_1000222603 | 146 |
| 231 | 3300006353 | Ga0075370_10007120 | Ga0075370_100071204 | 146 |
| 232 | 3300006358 | Ga0068871_100116623 | Ga0068871_1001166232 | 146 |
| 233 | 3300006871 | Ga0075434_100103811 | Ga0075434_1001038112 | 146 |
| 234 | 3300006881 | Ga0068865_100031594 | Ga0068865_1000315942 | 146 |
| 235 | 3300006881 | Ga0068865_100162763 | Ga0068865_1001627632 | 146 |
| 236 | 3300006931 | Ga0097620_100435715 | Ga0097620_1004357152 | 146 |
| 237 | 3300007076 | Ga0075435_100337081 | Ga0075435_1003370812 | 146 |
| 238 | 3300009098 | Ga0105245_10045639 | Ga0105245_100456392 | 146 |
| 239 | 3300009098 | Ga0105245_10129601 | Ga0105245_101296012 | 146 |
| 240 | 3300009101 | Ga0105247_10295951 | Ga0105247_102959511 | 146 |
| 241 | 3300009177 | Ga0105248_10016659 | Ga0105248_100166592 | 146 |
| 242 | 3300009177 | Ga0105248_10205361 | Ga0105248_102053612 | 146 |
| 243 | 3300009545 | Ga0105237_10520670 | Ga0105237_105206702 | 146 |
| 244 | 3300009551 | Ga0105238_10129652 | Ga0105238_101296522 | 146 |
| 245 | 3300009553 | Ga0105249_10527491 | Ga0105249_105274912 | 146 |
| 246 | 3300010375 | Ga0105239_10057462 | Ga0105239_100574624 | 146 |
| 247 | 3300013100 | Ga0157373_10056085 | Ga0157373_100560851 | 146 |
| 248 | 3300013102 | Ga0157371_10044279 | Ga0157371_100442792 | 146 |
| 249 | 3300013102 | Ga0157371_10696320 | Ga0157371_106963202 | 146 |
| 250 | 3300013105 | Ga0157369_10015460 | Ga0157369_100154603 | 146 |
| 251 | 3300013105 | Ga0157369_10989011 | Ga0157369_109890112 | 146 |
| 252 | 3300013296 | Ga0157374_10009658 | Ga0157374_100096586 | 146 |
| 253 | 3300013296 | Ga0157374_10140338 | Ga0157374_101403383 | 146 |
| 254 | 3300013306 | Ga0163162_10007486 | Ga0163162_1000748611 | 146 |
| 255 | 3300013306 | Ga0163162_10274617 | Ga0163162_102746173 | 146 |
| 256 | 3300013307 | Ga0157372_10156872 | Ga0157372_101568722 | 146 |
| 257 | 3300014326 | Ga0157380_10028623 | Ga0157380_100286234 | 146 |
| 258 | 3300014745 | Ga0157377_10041978 | Ga0157377_100419782 | 146 |
| 259 | 3300014968 | Ga0157379_10010369 | Ga0157379_100103694 | 146 |
| 260 | 3300014968 | Ga0157379_10054527 | Ga0157379_100545272 | 146 |
| 261 | 3300014969 | Ga0157376_10005027 | Ga0157376_100050275 | 146 |
| 262 | 3300014969 | Ga0157376_10982276 | Ga0157376_109822761 | 146 |
| 263 | 3300017792 | Ga0163161_10003912 | Ga0163161_100039126 | 146 |
| 264 | 3300025893 | Ga0207682_10049500 | Ga0207682_100495002 | 146 |
| 265 | 3300025893 | Ga0207682_10053950 | Ga0207682_100539502 | 146 |
| 266 | 3300025900 | Ga0207710_10449888 | Ga0207710_104498881 | 146 |
| 267 | 3300025901 | Ga0207688_10317751 | Ga0207688_103177512 | 146 |
| 268 | 3300025907 | Ga0207645_10005684 | Ga0207645_100056847 | 146 |
| 269 | 3300025907 | Ga0207645_10027329 | Ga0207645_100273293 | 146 |
| 270 | 3300025907 | Ga0207645_10077274 | Ga0207645_100772743 | 146 |
| 271 | 3300025908 | Ga0207643_10020521 | Ga0207643_100205213 | 146 |
| 272 | 3300025909 | Ga0207705_10886138 | Ga0207705_108861382 | 146 |
| 273 | 3300025911 | Ga0207654_10292619 | Ga0207654_102926192 | 146 |
| 274 | 3300025918 | Ga0207662_10233549 | Ga0207662_102335492 | 146 |
| 275 | 3300025919 | Ga0207657_10051902 | Ga0207657_100519022 | 146 |
| 276 | 3300025919 | Ga0207657_10128705 | Ga0207657_101287052 | 146 |
| 277 | 3300025920 | Ga0207649_10163293 | Ga0207649_101632932 | 146 |
| 278 | 3300025920 | Ga0207649_10225487 | Ga0207649_102254872 | 146 |
| 279 | 3300025920 | Ga0207649_10229311 | Ga0207649_102293112 | 146 |
| 280 | 3300025923 | Ga0207681_10103784 | Ga0207681_101037842 | 146 |
| 281 | 3300025923 | Ga0207681_10256964 | Ga0207681_102569642 | 146 |
| 282 | 3300025924 | Ga0207694_10038457 | Ga0207694_100384572 | 146 |
| 283 | 3300025925 | Ga0207650_10471978 | Ga0207650_104719782 | 146 |
| 284 | 3300025926 | Ga0207659_10005215 | Ga0207659_100052156 | 146 |
| 285 | 3300025926 | Ga0207659_10056916 | Ga0207659_100569162 | 146 |
| 286 | 3300025926 | Ga0207659_10356689 | Ga0207659_103566892 | 146 |
| 287 | 3300025927 | Ga0207687_10149565 | Ga0207687_101495652 | 146 |
| 288 | 3300025927 | Ga0207687_10292861 | Ga0207687_102928611 | 146 |
| 289 | 3300025931 | Ga0207644_10230856 | Ga0207644_102308562 | 146 |
| 290 | 3300025932 | Ga0207690_10031790 | Ga0207690_100317902 | 146 |
| 291 | 3300025933 | Ga0207706_10000933 | Ga0207706_1000093327 | 146 |
| 292 | 3300025933 | Ga0207706_10136423 | Ga0207706_101364232 | 146 |
| 293 | 3300025933 | Ga0207706_10137030 | Ga0207706_101370302 | 146 |
| 294 | 3300025938 | Ga0207704_10052541 | Ga0207704_100525413 | 146 |
| 295 | 3300025940 | Ga0207691_10041323 | Ga0207691_100413233 | 146 |
| 296 | 3300025940 | Ga0207691_10108789 | Ga0207691_101087893 | 146 |
| 297 | 3300025940 | Ga0207691_10130114 | Ga0207691_101301143 | 146 |
| 298 | 3300025941 | Ga0207711_10046230 | Ga0207711_100462305 | 146 |
| 299 | 3300025941 | Ga0207711_10118967 | Ga0207711_101189672 | 146 |
| 300 | 3300025942 | Ga0207689_10000150 | Ga0207689_1000015054 | 146 |
| 301 | 3300025944 | Ga0207661_11332258 | Ga0207661_113322581 | 146 |
| 302 | 3300025945 | Ga0207679_10254378 | Ga0207679_102543782 | 146 |
| 303 | 3300025949 | Ga0207667_10361165 | Ga0207667_103611652 | 146 |
| 304 | 3300025960 | Ga0207651_10018228 | Ga0207651_100182285 | 146 |
| 305 | 3300025960 | Ga0207651_11044116 | Ga0207651_110441162 | 146 |
| 306 | 3300025972 | Ga0207668_10151195 | Ga0207668_101511952 | 146 |
| 307 | 3300025981 | Ga0207640_10061385 | Ga0207640_100613852 | 146 |
| 308 | 3300026023 | Ga0207677_10012436 | Ga0207677_100124364 | 146 |
| 309 | 3300026023 | Ga0207677_10252983 | Ga0207677_102529832 | 146 |
| 310 | 3300026023 | Ga0207677_10422517 | Ga0207677_104225172 | 146 |
| 311 | 3300026035 | Ga0207703_10030559 | Ga0207703_100305594 | 146 |
| 312 | 3300026035 | Ga0207703_10047106 | Ga0207703_100471065 | 146 |
| 313 | 3300026035 | Ga0207703_11234687 | Ga0207703_112346871 | 146 |
| 314 | 3300026041 | Ga0207639_10053565 | Ga0207639_100535654 | 146 |
| 315 | 3300026041 | Ga0207639_10097704 | Ga0207639_100977042 | 146 |
| 316 | 3300026067 | Ga0207678_10002944 | Ga0207678_1000294411 | 146 |
| 317 | 3300026067 | Ga0207678_10170607 | Ga0207678_101706072 | 146 |
| 318 | 3300026078 | Ga0207702_10329396 | Ga0207702_103293962 | 146 |
| 319 | 3300026088 | Ga0207641_10088799 | Ga0207641_100887993 | 146 |
| 320 | 3300026088 | Ga0207641_10164319 | Ga0207641_101643192 | 146 |
| 321 | 3300026089 | Ga0207648_10001012 | Ga0207648_100010125 | 146 |
| 322 | 3300026089 | Ga0207648_10387825 | Ga0207648_103878252 | 146 |
| 323 | 3300026095 | Ga0207676_10181228 | Ga0207676_101812282 | 146 |
| 324 | 3300026095 | Ga0207676_10272993 | Ga0207676_102729932 | 146 |
| 325 | 3300026116 | Ga0207674_10020946 | Ga0207674_100209468 | 146 |
| 326 | 3300026116 | Ga0207674_10041822 | Ga0207674_100418223 | 146 |
| 327 | 3300026118 | Ga0207675_100001131 | Ga0207675_10000113131 | 146 |
| 328 | 3300026121 | Ga0207683_10064766 | Ga0207683_100647662 | 146 |
| 329 | 3300026121 | Ga0207683_10122058 | Ga0207683_101220581 | 146 |
| 330 | 3300026142 | Ga0207698_10007726 | Ga0207698_100077262 | 146 |
| 331 | 3300026142 | Ga0207698_10016066 | Ga0207698_100160664 | 146 |
| 332 | 3300026142 | Ga0207698_10315874 | Ga0207698_103158742 | 146 |
| 333 | 3300028380 | Ga0268265_10560735 | Ga0268265_105607352 | 146 |
| 334 | 3300028381 | Ga0268264_10080643 | Ga0268264_100806432 | 146 |
| 335 | 3300028381 | Ga0268264_10451274 | Ga0268264_104512741 | 146 |
| 336 | 3300028794 | Ga0307515_10011118 | Ga0307515_1001111814 | 146 |
| 337 | 3300031731 | Ga0307405_10100216 | Ga0307405_101002164 | 146 |
| 338 | 3300031852 | Ga0307410_10105384 | Ga0307410_101053842 | 146 |
| 339 | 3300031911 | Ga0307412_10012955 | Ga0307412_100129554 | 146 |
| 340 | 3300032002 | Ga0307416_100733494 | Ga0307416_1007334942 | 146 |
| 341 | 3300034816 | Ga0373930_0016597 | Ga0373930_0016597_807_1271 | 146 |
| 342 | 3300035084 | Ga0373928_0008445 | Ga0373928_0008445_1443_1907 | 146 |
| 343 | 3300035092 | Ga0373952_0070021 | Ga0373952_0070021_71_535 | 146 |
| 344 | 3300035115 | Ga0373941_0005075 | Ga0373941_0005075_577_1041 | 146 |
| 345 | 3300036401 | Ga0373937_0713287 | Ga0373937_0713287_144_635 | 146 |
| 346 | 3300037068 | Ga0373925_0191014 | Ga0373925_0191014_688_1179 | 146 |
| 347 | 3300041443 | Ga0451789_0617931 | Ga0451789_0617931_218_688 | 146 |
| 348 | 3300045051 | Ga0451576_0301054 | Ga0451576_0301054_53_514 | 146 |
| 349 | 3300046539 | Ga0495621_0147525 | Ga0495621_0147525_198_662 | 146 |
| 350 | 3300046681 | Ga0495647_0091643 | Ga0495647_0091643_392_856 | 146 |
| 351 | 3300046683 | Ga0495658_0611030 | Ga0495658_0611030_100_561 | 146 |
| 352 | 3300047472 | Ga0495686_0103310 | Ga0495686_0103310_387_869 | 146 |
| 353 | 3300048903 | Ga0496100_0123007 | Ga0496100_0123007_328_792 | 146 |
| 354 | 3300048904 | Ga0496101_0436825 | Ga0496101_0436825_253_717 | 146 |
| 355 | 3300048905 | Ga0496102_0571414 | Ga0496102_0571414_502_966 | 146 |
| 356 | 3300048907 | Ga0496104_0127565 | Ga0496104_0127565_814_1278 | 146 |
| 357 | 3300048909 | Ga0496106_0015637 | Ga0496106_0015637_2787_3269 | 146 |
| 358 | 3300048909 | Ga0496106_0072734 | Ga0496106_0072734_993_1457 | 146 |
| 359 | 3300048910 | Ga0496107_0009370 | Ga0496107_0009370_1510_1974 | 146 |
| 360 | 3300048912 | Ga0496109_0028870 | Ga0496109_0028870_2889_3353 | 146 |
| 361 | 3300048916 | Ga0496113_0303612 | Ga0496113_0303612_73_537 | 146 |
| 362 | 3300048916 | Ga0496113_0626213 | Ga0496113_0626213_351_848 | 146 |
| 363 | 3300048917 | Ga0496114_0042591 | Ga0496114_0042591_3197_3661 | 146 |
| 364 | 3300048924 | Ga0496121_0227663 | Ga0496121_0227663_36_518 | 146 |
| 365 | 3300050490 | nmdc:mga03n38_10194_c2 | nmdc:mga03n38_10194_c2_859_1326 | 146 |
| 366 | 3300050493 | nmdc:mga0k408_22313_c1 | nmdc:mga0k408_22313_c1_2082_2549 | 146 |
| 367 | 3300050494 | nmdc:mga06z11_262436_c1 | nmdc:mga06z11_262436_c1_244_711 | 146 |
| 368 | 3300050496 | nmdc:mga07m45_1463_c1 | nmdc:mga07m45_1463_c1_6568_7035 | 146 |
| 369 | 3300050512 | nmdc:mga0n895_103710_c1 | nmdc:mga0n895_103710_c1_1238_1702 | 146 |
| 370 | 3300050513 | nmdc:mga0rr50_598354_c1 | nmdc:mga0rr50_598354_c1_449_913 | 146 |
| 371 | iso_pu_bacteria | 2919704043 | 2919709109 | 146 |
| 372 | iso_pu_bacteria | 2928115317 | 2928116070 | 146 |
| 373 | iso_pu_bacteria | 8019775933 | 8019781229 | 146 |
| 374 | iso_pu_bacteria | 8019775933 | 8019781511 | 146 |
| 375 | 3300003322 | rootL2_10100371 | rootL2_101003712 | 147 |
| 376 | 3300005327 | Ga0070658_10205517 | Ga0070658_102055173 | 147 |
| 377 | 3300005339 | Ga0070660_100040525 | Ga0070660_1000405252 | 147 |
| 378 | 3300005458 | Ga0070681_11156798 | Ga0070681_111567981 | 147 |
| 379 | 3300005530 | Ga0070679_100024940 | Ga0070679_1000249403 | 147 |
| 380 | 3300005539 | Ga0068853_100050690 | Ga0068853_1000506904 | 147 |
| 381 | 3300005548 | Ga0070665_101733628 | Ga0070665_1017336281 | 147 |
| 382 | 3300005563 | Ga0068855_100246194 | Ga0068855_1002461943 | 147 |
| 383 | 3300005841 | Ga0068863_101060957 | Ga0068863_1010609572 | 147 |
| 384 | 3300006358 | Ga0068871_100387693 | Ga0068871_1003876932 | 147 |
| 385 | 3300009093 | Ga0105240_10089902 | Ga0105240_100899022 | 147 |
| 386 | 3300014325 | Ga0163163_10722173 | Ga0163163_107221732 | 147 |
| 387 | 3300014968 | Ga0157379_10414611 | Ga0157379_104146113 | 147 |
| 388 | 3300014969 | Ga0157376_10242960 | Ga0157376_102429603 | 147 |
| 389 | 3300025913 | Ga0207695_10104516 | Ga0207695_101045162 | 147 |
| 390 | 3300025986 | Ga0207658_10525012 | Ga0207658_105250122 | 147 |
| 391 | 3300025986 | Ga0207658_10740407 | Ga0207658_107404072 | 147 |
| 392 | 3300026041 | Ga0207639_10317765 | Ga0207639_103177652 | 147 |
| 393 | 3300026041 | Ga0207639_10372054 | Ga0207639_103720543 | 147 |
| 394 | 3300026088 | Ga0207641_11345274 | Ga0207641_113452741 | 147 |
| 395 | 3300028381 | Ga0268264_12228741 | Ga0268264_122287411 | 147 |
| 396 | 3300031507 | Ga0307509_10000802 | Ga0307509_1000080222 | 147 |
| 397 | 3300031649 | Ga0307514_10094556 | Ga0307514_100945563 | 147 |
| 398 | 3300031649 | Ga0307514_10205143 | Ga0307514_102051432 | 147 |
| 399 | 3300033180 | Ga0307510_10030202 | Ga0307510_100302024 | 147 |
| 400 | 3300035112 | Ga0373932_0040311 | Ga0373932_0040311_103_570 | 147 |
| 401 | 3300035170 | Ga0373943_0429900 | Ga0373943_0429900_30_497 | 147 |
| 402 | 3300035691 | Ga0373931_0120245 | Ga0373931_0120245_994_1461 | 147 |
| 403 | 3300037068 | Ga0373925_0461333 | Ga0373925_0461333_395_862 | 147 |
| 404 | 3300042008 | Ga0439450_017429 | Ga0439450_017429_673_1149 | 147 |
| 405 | 3300042119 | Ga0450915_004706 | Ga0450915_004706_68_541 | 147 |
| 406 | 3300042122 | Ga0450920_037126 | Ga0450920_037126_62_535 | 147 |
| 407 | 3300042156 | Ga0439446_0097197 | Ga0439446_0097197_433_906 | 147 |
| 408 | 3300042461 | Ga0439460_0006452 | Ga0439460_0006452_1107_1583 | 147 |
| 409 | 3300042531 | Ga0450918_000026 | Ga0450918_000026_29391_29864 | 147 |
| 410 | 3300046454 | Ga0495592_0000272 | Ga0495592_0000272_18646_19110 | 147 |
| 411 | 3300046459 | Ga0495629_0667629 | Ga0495629_0667629_92_559 | 147 |
| 412 | 3300046517 | Ga0495630_0157955 | Ga0495630_0157955_749_1216 | 147 |
| 413 | 3300046526 | Ga0495666_0419794 | Ga0495666_0419794_49_576 | 147 |
| 414 | 3300046535 | Ga0495586_0160408 | Ga0495586_0160408_796_1257 | 147 |
| 415 | 3300046663 | Ga0495635_0760595 | Ga0495635_0760595_146_613 | 147 |
| 416 | 3300047321 | Ga0495676_0090056 | Ga0495676_0090056_1297_1764 | 147 |
| 417 | 3300047673 | Ga0495593_0092334 | Ga0495593_0092334_450_917 | 147 |
| 418 | 3300048925 | Ga0496122_0238853 | Ga0496122_0238853_184_648 | 147 |
| 419 | 3300048926 | Ga0496123_0366402 | Ga0496123_0366402_134_598 | 147 |
| 420 | 3300049589 | Ga0501073_0441384 | Ga0501073_0441384_203_658 | 147 |
| 421 | 3300049822 | Ga0501035_0375085 | Ga0501035_0375085_668_1123 | 147 |
| 422 | 3300053093 | Ga0500651_0269082 | Ga0500651_0269082_14_478 | 147 |
| 423 | 3300053117 | Ga0500593_007439 | Ga0500593_007439_2957_3502 | 147 |
| 424 | 3300053154 | Ga0500619_004740 | Ga0500619_004740_419_883 | 147 |
| 425 | 3300053730 | Ga0500645_004885 | Ga0500645_004885_2989_3474 | 147 |
| 426 | iso_pu_bacteria | 2513020051 | 2513227272 | 147 |
| 427 | iso_pu_bacteria | 2599185214 | 2599622645 | 147 |
| 428 | iso_pu_bacteria | 2599185226 | 2599671124 | 147 |
| 429 | iso_pu_bacteria | 2599185227 | 2599679839 | 147 |
| 430 | iso_pu_bacteria | 2599185229 | 2599691855 | 147 |
| 431 | iso_pu_bacteria | 2643221658 | 2644324841 | 147 |
| 432 | iso_pu_bacteria | 2643221672 | 2644396709 | 147 |
| 433 | iso_pu_bacteria | 2643221683 | 2644467389 | 147 |
| 434 | iso_pu_bacteria | 2738541277 | 2738718548 | 147 |
| 435 | iso_pu_bacteria | 2738543019 | 2739280566 | 147 |
| 436 | iso_pu_bacteria | 2818991446 | 2819600014 | 147 |
| 437 | iso_pu_bacteria | 2831265667 | 2831267111 | 147 |
| 438 | iso_pu_bacteria | 2838054893 | 2838056193 | 147 |
| 439 | iso_pu_bacteria | 2842677519 | 2842679116 | 147 |
| 440 | iso_pu_bacteria | 2842718218 | 2842719348 | 147 |
| 441 | iso_pu_bacteria | 2885198086 | 2885204865 | 147 |
| 442 | iso_pu_bacteria | 2885211737 | 2885218448 | 147 |
| 443 | iso_pu_bacteria | 2886848708 | 2886853473 | 147 |
| 444 | iso_pu_bacteria | 2899924645 | 2899926039 | 147 |
| 445 | iso_pu_bacteria | 2904449895 | 2904452257 | 147 |
| 446 | iso_pu_bacteria | 2904456579 | 2904458597 | 147 |
| 447 | iso_pu_bacteria | 2904541872 | 2904548614 | 147 |
| 448 | iso_pu_bacteria | 2919462493 | 2919466311 | 147 |
| 449 | iso_pu_bacteria | 2928037797 | 2928041565 | 147 |
| 450 | iso_pu_bacteria | 2928044640 | 2928049129 | 147 |
| 451 | iso_pu_bacteria | 2928051484 | 2928052263 | 147 |
| 452 | iso_pu_bacteria | 2928064002 | 2928065066 | 147 |
| 453 | iso_pu_bacteria | 2928070936 | 2928077472 | 147 |
| 454 | iso_pu_bacteria | 2928084124 | 2928087408 | 147 |
| 455 | iso_pu_bacteria | 2929160207 | 2929164718 | 147 |
| 456 | iso_pu_bacteria | 2929520902 | 2929522185 | 147 |
| 457 | iso_pu_bacteria | 2945909444 | 2945910670 | 147 |
| 458 | iso_pu_bacteria | 2945945610 | 2945946572 | 147 |
| 459 | iso_pu_bacteria | 2945984333 | 2945987158 | 147 |
| 460 | iso_pu_bacteria | 2954767861 | 2954771339 | 147 |
| 461 | 3300003215 | JGI25153J46596_10010478 | JGI25153J46596_100104784 | 148 |
| 462 | 3300003771 | Ga0055526_1003267 | Ga0055526_10032673 | 148 |
| 463 | 3300003792 | Ga0055540_1000009 | Ga0055540_1000009260 | 148 |
| 464 | 3300005328 | Ga0070676_10737033 | Ga0070676_107370332 | 148 |
| 465 | 3300005331 | Ga0070670_100093239 | Ga0070670_1000932394 | 148 |
| 466 | 3300005334 | Ga0068869_100604704 | Ga0068869_1006047041 | 148 |
| 467 | 3300005338 | Ga0068868_100137460 | Ga0068868_1001374602 | 148 |
| 468 | 3300005355 | Ga0070671_100080213 | Ga0070671_1000802134 | 148 |
| 469 | 3300005364 | Ga0070673_100903878 | Ga0070673_1009038782 | 148 |
| 470 | 3300005366 | Ga0070659_100785965 | Ga0070659_1007859652 | 148 |
| 471 | 3300005367 | Ga0070667_101047707 | Ga0070667_1010477072 | 148 |
| 472 | 3300005548 | Ga0070665_100078999 | Ga0070665_1000789995 | 148 |
| 473 | 3300005548 | Ga0070665_100150572 | Ga0070665_1001505724 | 148 |
| 474 | 3300005617 | Ga0068859_100325490 | Ga0068859_1003254903 | 148 |
| 475 | 3300005618 | Ga0068864_100040117 | Ga0068864_1000401172 | 148 |
| 476 | 3300005840 | Ga0068870_10826718 | Ga0068870_108267181 | 148 |
| 477 | 3300005841 | Ga0068863_100067310 | Ga0068863_1000673102 | 148 |
| 478 | 3300005843 | Ga0068860_100176947 | Ga0068860_1001769473 | 148 |
| 479 | 3300006195 | Ga0075366_10000574 | Ga0075366_100005748 | 148 |
| 480 | 3300006195 | Ga0075366_10165958 | Ga0075366_101659582 | 148 |
| 481 | 3300006237 | Ga0097621_100224534 | Ga0097621_1002245342 | 148 |
| 482 | 3300006353 | Ga0075370_10000101 | Ga0075370_100001018 | 148 |
| 483 | 3300006353 | Ga0075370_10068296 | Ga0075370_100682964 | 148 |
| 484 | 3300006931 | Ga0097620_100325492 | Ga0097620_1003254923 | 148 |
| 485 | 3300009098 | Ga0105245_10233131 | Ga0105245_102331313 | 148 |
| 486 | 3300009098 | Ga0105245_10762888 | Ga0105245_107628882 | 148 |
| 487 | 3300009174 | Ga0105241_10294941 | Ga0105241_102949413 | 148 |
| 488 | 3300011119 | Ga0105246_10771655 | Ga0105246_107716552 | 148 |
| 489 | 3300013308 | Ga0157375_10138694 | Ga0157375_101386944 | 148 |
| 490 | 3300014497 | Ga0182008_10041550 | Ga0182008_100415502 | 148 |
| 491 | 3300014968 | Ga0157379_10123351 | Ga0157379_101233513 | 148 |
| 492 | 3300025245 | Ga0207425_1001646 | Ga0207425_10016464 | 148 |
| 493 | 3300025258 | Ga0209129_1000124 | Ga0209129_100012431 | 148 |
| 494 | 3300025273 | Ga0209673_1013941 | Ga0209673_10139414 | 148 |
| 495 | 3300025292 | Ga0209676_1001896 | Ga0209676_10018968 | 148 |
| 496 | 3300025295 | Ga0209564_1000057 | Ga0209564_100005790 | 148 |
| 497 | 3300025297 | Ga0209758_1000214 | Ga0209758_100021460 | 148 |
| 498 | 3300025298 | Ga0209050_1000009 | Ga0209050_1000009868 | 148 |
| 499 | 3300025299 | Ga0209256_1030295 | Ga0209256_10302952 | 148 |
| 500 | 3300025303 | Ga0209051_1000008 | Ga0209051_1000008625 | 148 |
| 501 | 3300025304 | Ga0209257_1013149 | Ga0209257_10131494 | 148 |
| 502 | 3300025927 | Ga0207687_10205014 | Ga0207687_102050143 | 148 |
| 503 | 3300025960 | Ga0207651_10707367 | Ga0207651_107073672 | 148 |
| 504 | 3300025986 | Ga0207658_10917625 | Ga0207658_109176252 | 148 |
| 505 | 3300026023 | Ga0207677_10516605 | Ga0207677_105166052 | 148 |
| 506 | 3300026088 | Ga0207641_10053797 | Ga0207641_100537972 | 148 |
| 507 | 3300026095 | Ga0207676_10032796 | Ga0207676_100327962 | 148 |
| 508 | 3300027312 | Ga0209371_1000940 | Ga0209371_100094010 | 148 |
| 509 | 3300027866 | Ga0209813_10027757 | Ga0209813_100277573 | 148 |
| 510 | 3300028379 | Ga0268266_10159657 | Ga0268266_101596573 | 148 |
| 511 | 3300028786 | Ga0307517_10000810 | Ga0307517_1000081016 | 148 |
| 512 | 3300030500 | Ga0268256_1000839 | Ga0268256_10008399 | 148 |
| 513 | 3300030522 | Ga0307512_10069362 | Ga0307512_100693622 | 148 |
| 514 | 3300031507 | Ga0307509_10177394 | Ga0307509_101773942 | 148 |
| 515 | 3300031548 | Ga0307408_101718117 | Ga0307408_1017181171 | 148 |
| 516 | 3300031730 | Ga0307516_10208068 | Ga0307516_102080682 | 148 |
| 517 | 3300031730 | Ga0307516_10349510 | Ga0307516_103495102 | 148 |
| 518 | 3300041407 | Ga0439447_075986 | Ga0439447_075986_149_601 | 148 |
| 519 | 3300041452 | Ga0451793_0124301 | Ga0451793_0124301_149_595 | 148 |
| 520 | 3300041491 | Ga0451833_1010680 | Ga0451833_1010680_182_688 | 148 |
| 521 | 3300041492 | Ga0451835_0116812 | Ga0451835_0116812_18_515 | 148 |
| 522 | 3300041997 | Ga0439431_0000116 | Ga0439431_0000116_3193_3645 | 148 |
| 523 | 3300042004 | Ga0439445_0009703 | Ga0439445_0009703_661_1113 | 148 |
| 524 | 3300042006 | Ga0439432_000593 | Ga0439432_000593_10319_10771 | 148 |
| 525 | 3300042009 | Ga0439451_003517 | Ga0439451_003517_1818_2270 | 148 |
| 526 | 3300042010 | Ga0439452_005477 | Ga0439452_005477_2984_3436 | 148 |
| 527 | 3300042016 | Ga0439463_020904 | Ga0439463_020904_556_1008 | 148 |
| 528 | 3300042156 | Ga0439446_0008647 | Ga0439446_0008647_490_942 | 148 |
| 529 | 3300046471 | Ga0495650_0005914 | Ga0495650_0005914_5503_5964 | 148 |
| 530 | 3300046471 | Ga0495650_0013812 | Ga0495650_0013812_3270_3725 | 148 |
| 531 | 3300046524 | Ga0495648_0118920 | Ga0495648_0118920_665_1168 | 148 |
| 532 | 3300048917 | Ga0496114_0262711 | Ga0496114_0262711_212_676 | 148 |
| 533 | 3300050493 | nmdc:mga0k408_227497_c1 | nmdc:mga0k408_227497_c1_131_634 | 148 |
| 534 | 3300050493 | nmdc:mga0k408_6998_c1 | nmdc:mga0k408_6998_c1_646_1134 | 148 |
| 535 | 3300050494 | nmdc:mga06z11_264210_c1 | nmdc:mga06z11_264210_c1_376_864 | 148 |
| 536 | 3300050495 | nmdc:mga04h51_38905_c1 | nmdc:mga04h51_38905_c1_437_925 | 148 |
| 537 | 3300050496 | nmdc:mga07m45_1045_c1 | nmdc:mga07m45_1045_c1_1392_1880 | 148 |
| 538 | 3300050496 | nmdc:mga07m45_443325_c1 | nmdc:mga07m45_443325_c1_266_736 | 148 |
| 539 | 3300053130 | Ga0500642_0032574 | Ga0500642_0032574_706_1206 | 148 |
| 540 | 3300053151 | Ga0500604_0010581 | Ga0500604_0010581_1394_1894 | 148 |
| 541 | 3300002987 | JGI25159J45721_1021556 | JGI25159J45721_10215561 | 149 |
| 542 | 3300003316 | rootH1_10065105 | rootH1_100651052 | 149 |
| 543 | 3300003322 | rootL2_10016479 | rootL2_100164793 | 149 |
| 544 | 3300003323 | rootH1_10172482 | rootH1_101724823 | 149 |
| 545 | 3300003784 | Ga0055534_1003031 | Ga0055534_10030313 | 149 |
| 546 | 3300005288 | Ga0065714_10008805 | Ga0065714_100088052 | 149 |
| 547 | 3300005293 | Ga0065715_10210477 | Ga0065715_102104772 | 149 |
| 548 | 3300005327 | Ga0070658_10202820 | Ga0070658_102028203 | 149 |
| 549 | 3300005327 | Ga0070658_10348623 | Ga0070658_103486232 | 149 |
| 550 | 3300005328 | Ga0070676_10057235 | Ga0070676_100572352 | 149 |
| 551 | 3300005328 | Ga0070676_10392855 | Ga0070676_103928552 | 149 |
| 552 | 3300005330 | Ga0070690_100334864 | Ga0070690_1003348642 | 149 |
| 553 | 3300005331 | Ga0070670_100003584 | Ga0070670_1000035849 | 149 |
| 554 | 3300005331 | Ga0070670_100015006 | Ga0070670_1000150063 | 149 |
| 555 | 3300005331 | Ga0070670_100297529 | Ga0070670_1002975292 | 149 |
| 556 | 3300005333 | Ga0070677_10015608 | Ga0070677_100156082 | 149 |
| 557 | 3300005333 | Ga0070677_10027992 | Ga0070677_100279922 | 149 |
| 558 | 3300005335 | Ga0070666_10559709 | Ga0070666_105597092 | 149 |
| 559 | 3300005338 | Ga0068868_100547663 | Ga0068868_1005476631 | 149 |
| 560 | 3300005338 | Ga0068868_100789163 | Ga0068868_1007891632 | 149 |
| 561 | 3300005344 | Ga0070661_100141260 | Ga0070661_1001412602 | 149 |
| 562 | 3300005347 | Ga0070668_100143139 | Ga0070668_1001431393 | 149 |
| 563 | 3300005353 | Ga0070669_100133329 | Ga0070669_1001333292 | 149 |
| 564 | 3300005353 | Ga0070669_100264990 | Ga0070669_1002649902 | 149 |
| 565 | 3300005354 | Ga0070675_100007761 | Ga0070675_1000077619 | 149 |
| 566 | 3300005354 | Ga0070675_100022306 | Ga0070675_1000223068 | 149 |
| 567 | 3300005355 | Ga0070671_100050666 | Ga0070671_1000506665 | 149 |
| 568 | 3300005356 | Ga0070674_100001004 | Ga0070674_1000010042 | 149 |
| 569 | 3300005356 | Ga0070674_100553972 | Ga0070674_1005539722 | 149 |
| 570 | 3300005364 | Ga0070673_100003898 | Ga0070673_1000038988 | 149 |
| 571 | 3300005364 | Ga0070673_100015817 | Ga0070673_1000158176 | 149 |
| 572 | 3300005364 | Ga0070673_100423584 | Ga0070673_1004235842 | 149 |
| 573 | 3300005366 | Ga0070659_100797259 | Ga0070659_1007972591 | 149 |
| 574 | 3300005367 | Ga0070667_100090969 | Ga0070667_1000909692 | 149 |
| 575 | 3300005441 | Ga0070700_100582016 | Ga0070700_1005820162 | 149 |
| 576 | 3300005445 | Ga0070708_100156079 | Ga0070708_1001560792 | 149 |
| 577 | 3300005455 | Ga0070663_100529825 | Ga0070663_1005298252 | 149 |
| 578 | 3300005455 | Ga0070663_100599054 | Ga0070663_1005990542 | 149 |
| 579 | 3300005456 | Ga0070678_100005974 | Ga0070678_10000597411 | 149 |
| 580 | 3300005456 | Ga0070678_100014268 | Ga0070678_1000142686 | 149 |
| 581 | 3300005456 | Ga0070678_100069235 | Ga0070678_1000692352 | 149 |
| 582 | 3300005456 | Ga0070678_100322745 | Ga0070678_1003227452 | 149 |
| 583 | 3300005459 | Ga0068867_100032066 | Ga0068867_1000320665 | 149 |
| 584 | 3300005459 | Ga0068867_100077768 | Ga0068867_1000777682 | 149 |
| 585 | 3300005459 | Ga0068867_100099511 | Ga0068867_1000995112 | 149 |
| 586 | 3300005467 | Ga0070706_100001400 | Ga0070706_10000140013 | 149 |
| 587 | 3300005468 | Ga0070707_100024364 | Ga0070707_1000243645 | 149 |
| 588 | 3300005471 | Ga0070698_100124625 | Ga0070698_1001246252 | 149 |
| 589 | 3300005518 | Ga0070699_100067925 | Ga0070699_1000679252 | 149 |
| 590 | 3300005539 | Ga0068853_100222578 | Ga0068853_1002225782 | 149 |
| 591 | 3300005543 | Ga0070672_100000535 | Ga0070672_1000005356 | 149 |
| 592 | 3300005543 | Ga0070672_100002739 | Ga0070672_1000027398 | 149 |
| 593 | 3300005548 | Ga0070665_100102402 | Ga0070665_1001024022 | 149 |
| 594 | 3300005548 | Ga0070665_100361883 | Ga0070665_1003618832 | 149 |
| 595 | 3300005564 | Ga0070664_100222287 | Ga0070664_1002222872 | 149 |
| 596 | 3300005564 | Ga0070664_100591957 | Ga0070664_1005919572 | 149 |
| 597 | 3300005577 | Ga0068857_100298591 | Ga0068857_1002985912 | 149 |
| 598 | 3300005578 | Ga0068854_100020708 | Ga0068854_1000207086 | 149 |
| 599 | 3300005578 | Ga0068854_100034288 | Ga0068854_1000342883 | 149 |
| 600 | 3300005616 | Ga0068852_100094552 | Ga0068852_1000945524 | 149 |
| 601 | 3300005616 | Ga0068852_101608748 | Ga0068852_1016087482 | 149 |
| 602 | 3300005618 | Ga0068864_100011769 | Ga0068864_10001176912 | 149 |
| 603 | 3300005618 | Ga0068864_100018043 | Ga0068864_1000180435 | 149 |
| 604 | 3300005718 | Ga0068866_10422358 | Ga0068866_104223581 | 149 |
| 605 | 3300005719 | Ga0068861_100036330 | Ga0068861_1000363302 | 149 |
| 606 | 3300005719 | Ga0068861_100518491 | Ga0068861_1005184912 | 149 |
| 607 | 3300005834 | Ga0068851_10062559 | Ga0068851_100625593 | 149 |
| 608 | 3300005834 | Ga0068851_10147537 | Ga0068851_101475373 | 149 |
| 609 | 3300005840 | Ga0068870_10125652 | Ga0068870_101256523 | 149 |
| 610 | 3300005844 | Ga0068862_100019148 | Ga0068862_1000191485 | 149 |
| 611 | 3300005844 | Ga0068862_100559178 | Ga0068862_1005591782 | 149 |
| 612 | 3300006042 | Ga0075368_10069954 | Ga0075368_100699542 | 149 |
| 613 | 3300006048 | Ga0075363_100011747 | Ga0075363_1000117475 | 149 |
| 614 | 3300006048 | Ga0075363_100248920 | Ga0075363_1002489202 | 149 |
| 615 | 3300006051 | Ga0075364_10083153 | Ga0075364_100831533 | 149 |
| 616 | 3300006163 | Ga0070715_10068721 | Ga0070715_100687212 | 149 |
| 617 | 3300006177 | Ga0075362_10002180 | Ga0075362_100021802 | 149 |
| 618 | 3300006177 | Ga0075362_10008211 | Ga0075362_100082115 | 149 |
| 619 | 3300006178 | Ga0075367_10007898 | Ga0075367_100078985 | 149 |
| 620 | 3300006178 | Ga0075367_10053886 | Ga0075367_100538862 | 149 |
| 621 | 3300006178 | Ga0075367_10103594 | Ga0075367_101035942 | 149 |
| 622 | 3300006178 | Ga0075367_10287260 | Ga0075367_102872601 | 149 |
| 623 | 3300006186 | Ga0075369_10033641 | Ga0075369_100336412 | 149 |
| 624 | 3300006186 | Ga0075369_10078951 | Ga0075369_100789512 | 149 |
| 625 | 3300006186 | Ga0075369_10125905 | Ga0075369_101259052 | 149 |
| 626 | 3300006195 | Ga0075366_10024978 | Ga0075366_100249782 | 149 |
| 627 | 3300006195 | Ga0075366_10116553 | Ga0075366_101165532 | 149 |
| 628 | 3300006195 | Ga0075366_10258602 | Ga0075366_102586022 | 149 |
| 629 | 3300006195 | Ga0075366_10586154 | Ga0075366_105861542 | 149 |
| 630 | 3300006237 | Ga0097621_100006734 | Ga0097621_1000067347 | 149 |
| 631 | 3300006237 | Ga0097621_100396668 | Ga0097621_1003966682 | 149 |
| 632 | 3300006353 | Ga0075370_10009745 | Ga0075370_100097455 | 149 |
| 633 | 3300006353 | Ga0075370_10016095 | Ga0075370_100160952 | 149 |
| 634 | 3300006353 | Ga0075370_10144180 | Ga0075370_101441802 | 149 |
| 635 | 3300006358 | Ga0068871_100012983 | Ga0068871_1000129832 | 149 |
| 636 | 3300006358 | Ga0068871_100206425 | Ga0068871_1002064252 | 149 |
| 637 | 3300006358 | Ga0068871_100256037 | Ga0068871_1002560372 | 149 |
| 638 | 3300006881 | Ga0068865_100135512 | Ga0068865_1001355124 | 149 |
| 639 | 3300009036 | Ga0105244_10179130 | Ga0105244_101791302 | 149 |
| 640 | 3300009093 | Ga0105240_10032391 | Ga0105240_100323917 | 149 |
| 641 | 3300009148 | Ga0105243_10004307 | Ga0105243_1000430710 | 149 |
| 642 | 3300009148 | Ga0105243_10107881 | Ga0105243_101078813 | 149 |
| 643 | 3300009174 | Ga0105241_10378064 | Ga0105241_103780641 | 149 |
| 644 | 3300009176 | Ga0105242_11495446 | Ga0105242_114954462 | 149 |
| 645 | 3300009177 | Ga0105248_10188936 | Ga0105248_101889361 | 149 |
| 646 | 3300009177 | Ga0105248_10284097 | Ga0105248_102840972 | 149 |
| 647 | 3300009177 | Ga0105248_11334575 | Ga0105248_113345752 | 149 |
| 648 | 3300009545 | Ga0105237_10018505 | Ga0105237_100185057 | 149 |
| 649 | 3300009551 | Ga0105238_10859728 | Ga0105238_108597282 | 149 |
| 650 | 3300009553 | Ga0105249_10118632 | Ga0105249_101186322 | 149 |
| 651 | 3300010375 | Ga0105239_10050731 | Ga0105239_100507312 | 149 |
| 652 | 3300013102 | Ga0157371_10000196 | Ga0157371_100001963 | 149 |
| 653 | 3300013102 | Ga0157371_10019220 | Ga0157371_100192203 | 149 |
| 654 | 3300013297 | Ga0157378_11433377 | Ga0157378_114333771 | 149 |
| 655 | 3300013306 | Ga0163162_10056023 | Ga0163162_100560232 | 149 |
| 656 | 3300013308 | Ga0157375_10009460 | Ga0157375_100094604 | 149 |
| 657 | 3300013308 | Ga0157375_10431437 | Ga0157375_104314372 | 149 |
| 658 | 3300014325 | Ga0163163_10906929 | Ga0163163_109069292 | 149 |
| 659 | 3300014326 | Ga0157380_10220527 | Ga0157380_102205272 | 149 |
| 660 | 3300014326 | Ga0157380_10736337 | Ga0157380_107363372 | 149 |
| 661 | 3300014497 | Ga0182008_10000701 | Ga0182008_1000070113 | 149 |
| 662 | 3300014745 | Ga0157377_10000022 | Ga0157377_10000022119 | 149 |
| 663 | 3300014745 | Ga0157377_10298578 | Ga0157377_102985782 | 149 |
| 664 | 3300014969 | Ga0157376_10049020 | Ga0157376_100490203 | 149 |
| 665 | 3300017792 | Ga0163161_10164994 | Ga0163161_101649942 | 149 |
| 666 | 3300017792 | Ga0163161_10336175 | Ga0163161_103361752 | 149 |
| 667 | 3300025284 | Ga0209130_1002187 | Ga0209130_10021874 | 149 |
| 668 | 3300025291 | Ga0209675_1001070 | Ga0209675_10010706 | 149 |
| 669 | 3300025292 | Ga0209676_1003856 | Ga0209676_10038565 | 149 |
| 670 | 3300025298 | Ga0209050_1028919 | Ga0209050_10289192 | 149 |
| 671 | 3300025303 | Ga0209051_1023298 | Ga0209051_10232983 | 149 |
| 672 | 3300025304 | Ga0209257_1006977 | Ga0209257_10069773 | 149 |
| 673 | 3300025315 | Ga0207697_10003968 | Ga0207697_100039687 | 149 |
| 674 | 3300025315 | Ga0207697_10036931 | Ga0207697_100369313 | 149 |
| 675 | 3300025321 | Ga0207656_10043077 | Ga0207656_100430773 | 149 |
| 676 | 3300025893 | Ga0207682_10001045 | Ga0207682_1000104514 | 149 |
| 677 | 3300025893 | Ga0207682_10023398 | Ga0207682_100233983 | 149 |
| 678 | 3300025893 | Ga0207682_10117120 | Ga0207682_101171202 | 149 |
| 679 | 3300025901 | Ga0207688_10111235 | Ga0207688_101112351 | 149 |
| 680 | 3300025901 | Ga0207688_10136576 | Ga0207688_101365762 | 149 |
| 681 | 3300025903 | Ga0207680_10449111 | Ga0207680_104491112 | 149 |
| 682 | 3300025905 | Ga0207685_10119294 | Ga0207685_101192942 | 149 |
| 683 | 3300025907 | Ga0207645_10005861 | Ga0207645_100058616 | 149 |
| 684 | 3300025907 | Ga0207645_10282969 | Ga0207645_102829692 | 149 |
| 685 | 3300025907 | Ga0207645_10299197 | Ga0207645_102991972 | 149 |
| 686 | 3300025907 | Ga0207645_10337932 | Ga0207645_103379322 | 149 |
| 687 | 3300025907 | Ga0207645_10647845 | Ga0207645_106478452 | 149 |
| 688 | 3300025908 | Ga0207643_10170068 | Ga0207643_101700681 | 149 |
| 689 | 3300025909 | Ga0207705_10183502 | Ga0207705_101835022 | 149 |
| 690 | 3300025910 | Ga0207684_10023526 | Ga0207684_100235262 | 149 |
| 691 | 3300025914 | Ga0207671_10080363 | Ga0207671_100803634 | 149 |
| 692 | 3300025918 | Ga0207662_10099997 | Ga0207662_100999972 | 149 |
| 693 | 3300025920 | Ga0207649_10231166 | Ga0207649_102311663 | 149 |
| 694 | 3300025922 | Ga0207646_10205803 | Ga0207646_102058032 | 149 |
| 695 | 3300025923 | Ga0207681_10005176 | Ga0207681_100051769 | 149 |
| 696 | 3300025923 | Ga0207681_10652647 | Ga0207681_106526472 | 149 |
| 697 | 3300025925 | Ga0207650_10011652 | Ga0207650_100116528 | 149 |
| 698 | 3300025925 | Ga0207650_10037756 | Ga0207650_100377564 | 149 |
| 699 | 3300025925 | Ga0207650_10490911 | Ga0207650_104909112 | 149 |
| 700 | 3300025926 | Ga0207659_10000118 | Ga0207659_1000011833 | 149 |
| 701 | 3300025926 | Ga0207659_10048380 | Ga0207659_100483802 | 149 |
| 702 | 3300025931 | Ga0207644_10035212 | Ga0207644_100352122 | 149 |
| 703 | 3300025931 | Ga0207644_10804657 | Ga0207644_108046571 | 149 |
| 704 | 3300025933 | Ga0207706_10020371 | Ga0207706_100203715 | 149 |
| 705 | 3300025935 | Ga0207709_10086087 | Ga0207709_100860872 | 149 |
| 706 | 3300025937 | Ga0207669_10000706 | Ga0207669_1000070613 | 149 |
| 707 | 3300025938 | Ga0207704_10700234 | Ga0207704_107002342 | 149 |
| 708 | 3300025940 | Ga0207691_10000238 | Ga0207691_1000023840 | 149 |
| 709 | 3300025940 | Ga0207691_10008515 | Ga0207691_100085156 | 149 |
| 710 | 3300025940 | Ga0207691_10067518 | Ga0207691_100675183 | 149 |
| 711 | 3300025940 | Ga0207691_11231152 | Ga0207691_112311521 | 149 |
| 712 | 3300025941 | Ga0207711_10293458 | Ga0207711_102934582 | 149 |
| 713 | 3300025942 | Ga0207689_10015594 | Ga0207689_100155948 | 149 |
| 714 | 3300025942 | Ga0207689_10241497 | Ga0207689_102414973 | 149 |
| 715 | 3300025945 | Ga0207679_10069210 | Ga0207679_100692103 | 149 |
| 716 | 3300025960 | Ga0207651_10001131 | Ga0207651_1000113112 | 149 |
| 717 | 3300025960 | Ga0207651_10036335 | Ga0207651_100363354 | 149 |
| 718 | 3300025961 | Ga0207712_10203261 | Ga0207712_102032611 | 149 |
| 719 | 3300025972 | Ga0207668_10147265 | Ga0207668_101472652 | 149 |
| 720 | 3300025981 | Ga0207640_10016633 | Ga0207640_100166333 | 149 |
| 721 | 3300025981 | Ga0207640_11525890 | Ga0207640_115258901 | 149 |
| 722 | 3300025986 | Ga0207658_10159894 | Ga0207658_101598943 | 149 |
| 723 | 3300026041 | Ga0207639_10139452 | Ga0207639_101394522 | 149 |
| 724 | 3300026041 | Ga0207639_10140530 | Ga0207639_101405304 | 149 |
| 725 | 3300026067 | Ga0207678_10251494 | Ga0207678_102514943 | 149 |
| 726 | 3300026088 | Ga0207641_10070146 | Ga0207641_100701461 | 149 |
| 727 | 3300026089 | Ga0207648_10000032 | Ga0207648_1000003215 | 149 |
| 728 | 3300026089 | Ga0207648_10003526 | Ga0207648_100035268 | 149 |
| 729 | 3300026089 | Ga0207648_10055085 | Ga0207648_100550852 | 149 |
| 730 | 3300026089 | Ga0207648_10067687 | Ga0207648_100676872 | 149 |
| 731 | 3300026089 | Ga0207648_11352588 | Ga0207648_113525882 | 149 |
| 732 | 3300026095 | Ga0207676_10025653 | Ga0207676_100256533 | 149 |
| 733 | 3300026116 | Ga0207674_10023098 | Ga0207674_100230988 | 149 |
| 734 | 3300026116 | Ga0207674_10589646 | Ga0207674_105896462 | 149 |
| 735 | 3300026118 | Ga0207675_100734278 | Ga0207675_1007342782 | 149 |
| 736 | 3300026121 | Ga0207683_10013866 | Ga0207683_100138664 | 149 |
| 737 | 3300026121 | Ga0207683_10034729 | Ga0207683_100347291 | 149 |
| 738 | 3300026121 | Ga0207683_10172376 | Ga0207683_101723762 | 149 |
| 739 | 3300026121 | Ga0207683_10315112 | Ga0207683_103151123 | 149 |
| 740 | 3300026121 | Ga0207683_10707199 | Ga0207683_107071991 | 149 |
| 741 | 3300026142 | Ga0207698_11134620 | Ga0207698_111346202 | 149 |
| 742 | 3300027876 | Ga0209974_10002843 | Ga0209974_100028437 | 149 |
| 743 | 3300028379 | Ga0268266_10428228 | Ga0268266_104282282 | 149 |
| 744 | 3300028380 | Ga0268265_10025277 | Ga0268265_100252773 | 149 |
| 745 | 3300028380 | Ga0268265_10524472 | Ga0268265_105244721 | 149 |
| 746 | 3300028786 | Ga0307517_10239786 | Ga0307517_102397862 | 149 |
| 747 | 3300028794 | Ga0307515_10385571 | Ga0307515_103855712 | 149 |
| 748 | 3300031548 | Ga0307408_100316603 | Ga0307408_1003166032 | 149 |
| 749 | 3300031548 | Ga0307408_101898828 | Ga0307408_1018988281 | 149 |
| 750 | 3300031616 | Ga0307508_10333326 | Ga0307508_103333262 | 149 |
| 751 | 3300031730 | Ga0307516_10190729 | Ga0307516_101907292 | 149 |
| 752 | 3300031730 | Ga0307516_10238369 | Ga0307516_102383692 | 149 |
| 753 | 3300031731 | Ga0307405_10118214 | Ga0307405_101182143 | 149 |
| 754 | 3300031731 | Ga0307405_10439685 | Ga0307405_104396852 | 149 |
| 755 | 3300031731 | Ga0307405_10682739 | Ga0307405_106827392 | 149 |
| 756 | 3300031824 | Ga0307413_10982182 | Ga0307413_109821822 | 149 |
| 757 | 3300031852 | Ga0307410_10183324 | Ga0307410_101833242 | 149 |
| 758 | 3300031901 | Ga0307406_10027772 | Ga0307406_100277724 | 149 |
| 759 | 3300031903 | Ga0307407_10039868 | Ga0307407_100398682 | 149 |
| 760 | 3300031995 | Ga0307409_100592030 | Ga0307409_1005920302 | 149 |
| 761 | 3300032002 | Ga0307416_100070299 | Ga0307416_1000702995 | 149 |
| 762 | 3300032002 | Ga0307416_100387377 | Ga0307416_1003873772 | 149 |
| 763 | 3300032004 | Ga0307414_10518330 | Ga0307414_105183302 | 149 |
| 764 | 3300032004 | Ga0307414_10817313 | Ga0307414_108173132 | 149 |
| 765 | 3300032005 | Ga0307411_10002725 | Ga0307411_100027253 | 149 |
| 766 | 3300032005 | Ga0307411_10406528 | Ga0307411_104065282 | 149 |
| 767 | 3300032126 | Ga0307415_100908705 | Ga0307415_1009087051 | 149 |
| 768 | 3300033180 | Ga0307510_10115678 | Ga0307510_101156783 | 149 |
| 769 | 3300035089 | Ga0373944_0297103 | Ga0373944_0297103_94_570 | 149 |
| 770 | 3300035117 | Ga0373953_0099209 | Ga0373953_0099209_629_1108 | 149 |
| 771 | 3300035725 | Ga0373947_0698279 | Ga0373947_0698279_194_670 | 149 |
| 772 | 3300036401 | Ga0373937_0584925 | Ga0373937_0584925_267_743 | 149 |
| 773 | 3300037068 | Ga0373925_0133930 | Ga0373925_0133930_50_529 | 149 |
| 774 | 3300038443 | Ga0395901_1034261 | Ga0395901_1034261_168_665 | 149 |
| 775 | 3300041456 | Ga0451795_1050550 | Ga0451795_1050550_122_616 | 149 |
| 776 | 3300041509 | Ga0451843_1517086 | Ga0451843_1517086_21_521 | 149 |
| 777 | 3300044693 | Ga0466961_0127635 | Ga0466961_0127635_1091_1564 | 149 |
| 778 | 3300046473 | Ga0495582_0711454 | Ga0495582_0711454_63_542 | 149 |
| 779 | 3300046506 | Ga0495583_0044197 | Ga0495583_0044197_586_1077 | 149 |
| 780 | 3300046517 | Ga0495630_1217335 | Ga0495630_1217335_73_537 | 149 |
| 781 | 3300046519 | Ga0495632_0011776 | Ga0495632_0011776_2057_2548 | 149 |
| 782 | 3300046528 | Ga0495642_0121231 | Ga0495642_0121231_234_725 | 149 |
| 783 | 3300046616 | Ga0495668_0066901 | Ga0495668_0066901_579_1070 | 149 |
| 784 | 3300046616 | Ga0495668_0191610 | Ga0495668_0191610_595_1044 | 149 |
| 785 | 3300046648 | Ga0495611_0043832 | Ga0495611_0043832_782_1273 | 149 |
| 786 | 3300046660 | Ga0495625_0075490 | Ga0495625_0075490_343_834 | 149 |
| 787 | 3300046660 | Ga0495625_0328567 | Ga0495625_0328567_131_646 | 149 |
| 788 | 3300046683 | Ga0495658_0052799 | Ga0495658_0052799_1225_1704 | 149 |
| 789 | 3300046683 | Ga0495658_0062321 | Ga0495658_0062321_843_1319 | 149 |
| 790 | 3300046692 | Ga0495671_0239191 | Ga0495671_0239191_323_814 | 149 |
| 791 | 3300046694 | Ga0495649_0013683 | Ga0495649_0013683_1244_1735 | 149 |
| 792 | 3300046794 | Ga0495589_0280505 | Ga0495589_0280505_77_568 | 149 |
| 793 | 3300046810 | Ga0495660_0034709 | Ga0495660_0034709_1409_1900 | 149 |
| 794 | 3300047319 | Ga0495674_0999092 | Ga0495674_0999092_95_574 | 149 |
| 795 | 3300047322 | Ga0495680_0234393 | Ga0495680_0234393_779_1258 | 149 |
| 796 | 3300047443 | Ga0495687_022632 | Ga0495687_022632_1082_1573 | 149 |
| 797 | 3300047443 | Ga0495687_032090 | Ga0495687_032090_830_1321 | 149 |
| 798 | 3300047471 | Ga0495684_0110443 | Ga0495684_0110443_1142_1621 | 149 |
| 799 | 3300048906 | Ga0496103_0718219 | Ga0496103_0718219_63_512 | 149 |
| 800 | 3300048907 | Ga0496104_0090739 | Ga0496104_0090739_1017_1493 | 149 |
| 801 | 3300048908 | Ga0496105_0215713 | Ga0496105_0215713_641_1117 | 149 |
| 802 | 3300048911 | Ga0496108_0382544 | Ga0496108_0382544_211_690 | 149 |
| 803 | 3300048913 | Ga0496110_1233250 | Ga0496110_1233250_168_644 | 149 |
| 804 | 3300048913 | Ga0496110_1434843 | Ga0496110_1434843_90_539 | 149 |
| 805 | 3300048920 | Ga0496117_0250160 | Ga0496117_0250160_38_523 | 149 |
| 806 | 3300048921 | Ga0496118_0141631 | Ga0496118_0141631_164_643 | 149 |
| 807 | 3300048924 | Ga0496121_0702693 | Ga0496121_0702693_47_496 | 149 |
| 808 | 3300048925 | Ga0496122_0000320 | Ga0496122_0000320_101912_102361 | 149 |
| 809 | 3300048926 | Ga0496123_0000258 | Ga0496123_0000258_9453_9902 | 149 |
| 810 | 3300048927 | Ga0496124_0032014 | Ga0496124_0032014_3513_3962 | 149 |
| 811 | 3300048928 | Ga0496125_0214881 | Ga0496125_0214881_569_1018 | 149 |
| 812 | 3300048929 | Ga0496126_0389710 | Ga0496126_0389710_226_675 | 149 |
| 813 | 3300049460 | Ga0495682_0175501 | Ga0495682_0175501_85_576 | 149 |
| 814 | 3300050489 | nmdc:mga03683_122194_c1 | nmdc:mga03683_122194_c1_167_658 | 149 |
| 815 | 3300050490 | nmdc:mga03n38_301283_c1 | nmdc:mga03n38_301283_c1_10_501 | 149 |
| 816 | 3300050490 | nmdc:mga03n38_5373_c1 | nmdc:mga03n38_5373_c1_2718_3209 | 149 |
| 817 | 3300050490 | nmdc:mga03n38_93999_c1 | nmdc:mga03n38_93999_c1_409_870 | 149 |
| 818 | 3300050491 | nmdc:mga00v17_497083_c1 | nmdc:mga00v17_497083_c1_37_528 | 149 |
| 819 | 3300050492 | nmdc:mga0yw44_467056_c1 | nmdc:mga0yw44_467056_c1_354_845 | 149 |
| 820 | 3300050493 | nmdc:mga0k408_15900_c1 | nmdc:mga0k408_15900_c1_2909_3400 | 149 |
| 821 | 3300050493 | nmdc:mga0k408_1682_c1 | nmdc:mga0k408_1682_c1_10077_10568 | 149 |
| 822 | 3300050493 | nmdc:mga0k408_45759_c1 | nmdc:mga0k408_45759_c1_1634_2113 | 149 |
| 823 | 3300050493 | nmdc:mga0k408_555600_c1 | nmdc:mga0k408_555600_c1_180_668 | 149 |
| 824 | 3300050493 | nmdc:mga0k408_569995_c1 | nmdc:mga0k408_569995_c1_151_612 | 149 |
| 825 | 3300050494 | nmdc:mga06z11_104541_c1 | nmdc:mga06z11_104541_c1_85_576 | 149 |
| 826 | 3300050494 | nmdc:mga06z11_52528_c1 | nmdc:mga06z11_52528_c1_1443_1934 | 149 |
| 827 | 3300050494 | nmdc:mga06z11_9203_c1 | nmdc:mga06z11_9203_c1_626_1087 | 149 |
| 828 | 3300050495 | nmdc:mga04h51_120818_c1 | nmdc:mga04h51_120818_c1_11_502 | 149 |
| 829 | 3300050496 | nmdc:mga07m45_220705_c1 | nmdc:mga07m45_220705_c1_349_840 | 149 |
| 830 | 3300050496 | nmdc:mga07m45_24407_c1 | nmdc:mga07m45_24407_c1_1233_1694 | 149 |
| 831 | 3300050496 | nmdc:mga07m45_54386_c1 | nmdc:mga07m45_54386_c1_63_554 | 149 |
| 832 | 3300050516 | nmdc:mga0sz30_80685_c1 | nmdc:mga0sz30_80685_c1_405_896 | 149 |
| 833 | 3300053093 | Ga0500651_0023247 | Ga0500651_0023247_3137_3622 | 149 |
| 834 | 3300053093 | Ga0500651_0304391 | Ga0500651_0304391_16_507 | 149 |
| 835 | 3300053134 | Ga0500658_0003329 | Ga0500658_0003329_3506_3997 | 149 |
| 836 | 3300053136 | Ga0500559_0004739 | Ga0500559_0004739_5124_5573 | 149 |
| 837 | 3300053136 | Ga0500559_0100995 | Ga0500559_0100995_628_1080 | 149 |
| 838 | 3300053139 | Ga0500568_0016575 | Ga0500568_0016575_213_704 | 149 |
| 839 | 3300053140 | Ga0500573_0058921 | Ga0500573_0058921_1277_1726 | 149 |
| 840 | iso_pu_bacteria | 2643221570 | 2643865861 | 149 |
| 841 | iso_pu_bacteria | 2643221596 | 2643993152 | 149 |
| 842 | iso_pu_bacteria | 2643221652 | 2644294266 | 149 |
| 843 | iso_pu_bacteria | 2990710928 | 2990712412 | 149 |
| 844 | 3300003323 | rootH1_10016782 | rootH1_100167824 | 150 |
| 845 | 3300003374 | JGI25161J50226_1009984 | JGI25161J50226_10099841 | 150 |
| 846 | 3300003775 | Ga0055524_1000253 | Ga0055524_100025321 | 150 |
| 847 | 3300003791 | Ga0055530_10046583 | Ga0055530_100465831 | 150 |
| 848 | 3300003792 | Ga0055540_1014702 | Ga0055540_10147022 | 150 |
| 849 | 3300003794 | Ga0055531_10006988 | Ga0055531_100069882 | 150 |
| 850 | 3300004625 | Ga0055543_1020669 | Ga0055543_10206691 | 150 |
| 851 | 3300005262 | Ga0065165_1000270 | Ga0065165_100027078 | 150 |
| 852 | 3300005353 | Ga0070669_101089507 | Ga0070669_1010895072 | 150 |
| 853 | 3300005355 | Ga0070671_100667071 | Ga0070671_1006670712 | 150 |
| 854 | 3300005364 | Ga0070673_100639941 | Ga0070673_1006399412 | 150 |
| 855 | 3300005548 | Ga0070665_100273946 | Ga0070665_1002739463 | 150 |
| 856 | 3300005616 | Ga0068852_101088389 | Ga0068852_1010883892 | 150 |
| 857 | 3300006195 | Ga0075366_10089809 | Ga0075366_100898092 | 150 |
| 858 | 3300006353 | Ga0075370_10058418 | Ga0075370_100584182 | 150 |
| 859 | 3300006944 | Ga0099823_1004645 | Ga0099823_10046452 | 150 |
| 860 | 3300006946 | Ga0079104_1000040 | Ga0079104_1000040169 | 150 |
| 861 | 3300009093 | Ga0105240_10015568 | Ga0105240_100155686 | 150 |
| 862 | 3300009545 | Ga0105237_10020678 | Ga0105237_100206786 | 150 |
| 863 | 3300009551 | Ga0105238_10001855 | Ga0105238_100018556 | 150 |
| 864 | 3300010375 | Ga0105239_10000531 | Ga0105239_1000053121 | 150 |
| 865 | 3300012475 | Ga0157317_1007125 | Ga0157317_10071251 | 150 |
| 866 | 3300012497 | Ga0157319_1000006 | Ga0157319_1000006198 | 150 |
| 867 | 3300014326 | Ga0157380_11237216 | Ga0157380_112372162 | 150 |
| 868 | 3300025284 | Ga0209130_1078882 | Ga0209130_10788821 | 150 |
| 869 | 3300025291 | Ga0209675_1024852 | Ga0209675_10248522 | 150 |
| 870 | 3300025298 | Ga0209050_1014743 | Ga0209050_10147433 | 150 |
| 871 | 3300025298 | Ga0209050_1015584 | Ga0209050_10155844 | 150 |
| 872 | 3300025299 | Ga0209256_1000053 | Ga0209256_1000053182 | 150 |
| 873 | 3300025299 | Ga0209256_1000113 | Ga0209256_1000113135 | 150 |
| 874 | 3300025299 | Ga0209256_1000529 | Ga0209256_100052925 | 150 |
| 875 | 3300025303 | Ga0209051_1008691 | Ga0209051_10086914 | 150 |
| 876 | 3300025304 | Ga0209257_1000372 | Ga0209257_100037273 | 150 |
| 877 | 3300025304 | Ga0209257_1006120 | Ga0209257_10061208 | 150 |
| 878 | 3300025923 | Ga0207681_10751564 | Ga0207681_107515642 | 150 |
| 879 | 3300025937 | Ga0207669_10244550 | Ga0207669_102445502 | 150 |
| 880 | 3300026089 | Ga0207648_10263659 | Ga0207648_102636592 | 150 |
| 881 | 3300026121 | Ga0207683_10102351 | Ga0207683_101023512 | 150 |
| 882 | 3300026142 | Ga0207698_11167246 | Ga0207698_111672461 | 150 |
| 883 | 3300027111 | Ga0209281_1000074 | Ga0209281_1000074246 | 150 |
| 884 | 3300027296 | Ga0209389_1038041 | Ga0209389_10380414 | 150 |
| 885 | 3300027312 | Ga0209371_1028280 | Ga0209371_10282801 | 150 |
| 886 | 3300028573 | Ga0265334_10044721 | Ga0265334_100447212 | 150 |
| 887 | 3300030500 | Ga0268256_1032192 | Ga0268256_10321921 | 150 |
| 888 | 3300031235 | Ga0265330_10000054 | Ga0265330_1000005480 | 150 |
| 889 | 3300031238 | Ga0265332_10000002 | Ga0265332_10000002274 | 150 |
| 890 | 3300031241 | Ga0265325_10003978 | Ga0265325_1000397810 | 150 |
| 891 | 3300031456 | Ga0307513_10318603 | Ga0307513_103186032 | 150 |
| 892 | 3300031548 | Ga0307408_100039175 | Ga0307408_1000391752 | 150 |
| 893 | 3300031711 | Ga0265314_10000012 | Ga0265314_10000012111 | 150 |
| 894 | 3300031711 | Ga0265314_10356704 | Ga0265314_103567042 | 150 |
| 895 | 3300031730 | Ga0307516_10193842 | Ga0307516_101938422 | 150 |
| 896 | 3300032004 | Ga0307414_11178332 | Ga0307414_111783321 | 150 |
| 897 | 3300035691 | Ga0373931_0089697 | Ga0373931_0089697_1194_1685 | 150 |
| 898 | 3300037312 | Ga0395899_0287566 | Ga0395899_0287566_448_909 | 150 |
| 899 | 3300042011 | Ga0439454_012713 | Ga0439454_012713_617_1135 | 150 |
| 900 | 3300042115 | Ga0450911_000399 | Ga0450911_000399_10073_10546 | 150 |
| 901 | 3300042127 | Ga0450890_000920 | Ga0450890_000920_2279_2797 | 150 |
| 902 | 3300042136 | Ga0450900_040229 | Ga0450900_040229_97_615 | 150 |
| 903 | 3300044683 | Ga0466965_0308511 | Ga0466965_0308511_315_809 | 150 |
| 904 | 3300044694 | Ga0466963_0314390 | Ga0466963_0314390_416_934 | 150 |
| 905 | 3300046691 | Ga0495670_0160628 | Ga0495670_0160628_84_590 | 150 |
| 906 | 3300048927 | Ga0496124_0019585 | Ga0496124_0019585_466_984 | 150 |
| 907 | 3300048928 | Ga0496125_0058522 | Ga0496125_0058522_1660_2133 | 150 |
| 908 | 3300048929 | Ga0496126_0185739 | Ga0496126_0185739_1248_1721 | 150 |
| 909 | 3300049571 | Ga0501034_0434374 | Ga0501034_0434374_189_650 | 150 |
| 910 | 3300049571 | Ga0501034_0863935 | Ga0501034_0863935_17_490 | 150 |
| 911 | 3300049573 | Ga0501037_0164582 | Ga0501037_0164582_246_716 | 150 |
| 912 | 3300049823 | Ga0501044_0246292 | Ga0501044_0246292_894_1364 | 150 |
| 913 | 3300050493 | nmdc:mga0k408_114918_c1 | nmdc:mga0k408_114918_c1_755_1273 | 150 |
| 914 | 3300050496 | nmdc:mga07m45_290700_c1 | nmdc:mga07m45_290700_c1_95_613 | 150 |
| 915 | 3300053156 | Ga0500622_0001100 | Ga0500622_0001100_5538_6044 | 150 |
| 916 | iso_pu_bacteria | 2643221609 | 2644060455 | 150 |
| 917 | iso_pu_bacteria | 2643221611 | 2644073777 | 150 |
| 918 | iso_pu_bacteria | 2643221628 | 2644159994 | 150 |
| 919 | iso_pu_bacteria | 2738543012 | 2739242484 | 150 |
| 920 | iso_pu_bacteria | 2816332133 | 2816473194 | 150 |
| 921 | iso_pu_bacteria | 2945972063 | 2945976298 | 150 |
| 922 | 3300001979 | JGI24740J21852_10002313 | JGI24740J21852_100023134 | 151 |
| 923 | 3300001989 | JGI24739J22299_10042561 | JGI24739J22299_100425612 | 151 |
| 924 | 3300002739 | JGI25158J39367_1014260 | JGI25158J39367_10142602 | 151 |
| 925 | 3300002739 | JGI25158J39367_1017354 | JGI25158J39367_10173541 | 151 |
| 926 | 3300002773 | JGI25152J39213_1002086 | JGI25152J39213_10020866 | 151 |
| 927 | 3300002773 | JGI25152J39213_1003149 | JGI25152J39213_10031493 | 151 |
| 928 | 3300002773 | JGI25152J39213_1011911 | JGI25152J39213_10119113 | 151 |
| 929 | 3300002774 | JGI25150J39212_1000609 | JGI25150J39212_10006097 | 151 |
| 930 | 3300002774 | JGI25150J39212_1015273 | JGI25150J39212_10152732 | 151 |
| 931 | 3300002987 | JGI25159J45721_1003702 | JGI25159J45721_10037025 | 151 |
| 932 | 3300002987 | JGI25159J45721_1005109 | JGI25159J45721_10051093 | 151 |
| 933 | 3300003187 | JGI25151J46595_10003523 | JGI25151J46595_100035235 | 151 |
| 934 | 3300003187 | JGI25151J46595_10003837 | JGI25151J46595_100038372 | 151 |
| 935 | 3300003187 | JGI25151J46595_10007545 | JGI25151J46595_100075455 | 151 |
| 936 | 3300003187 | JGI25151J46595_10044085 | JGI25151J46595_100440852 | 151 |
| 937 | 3300003215 | JGI25153J46596_10007592 | JGI25153J46596_100075925 | 151 |
| 938 | 3300003215 | JGI25153J46596_10036140 | JGI25153J46596_100361402 | 151 |
| 939 | 3300003316 | rootH1_10066517 | rootH1_100665171 | 151 |
| 940 | 3300003320 | rootH2_10007251 | rootH2_100072512 | 151 |
| 941 | 3300003322 | rootL2_10196900 | rootL2_101969003 | 151 |
| 942 | 3300003323 | rootH1_10096611 | rootH1_100966112 | 151 |
| 943 | 3300003354 | JGI25160J50197_1005413 | JGI25160J50197_10054135 | 151 |
| 944 | 3300003354 | JGI25160J50197_1009233 | JGI25160J50197_10092333 | 151 |
| 945 | 3300003374 | JGI25161J50226_1002087 | JGI25161J50226_10020873 | 151 |
| 946 | 3300003374 | JGI25161J50226_1003898 | JGI25161J50226_10038982 | 151 |
| 947 | 3300003578 | Ga0006562J51391_1156325 | Ga0006562J51391_11563252 | 151 |
| 948 | 3300003760 | Ga0055527_1018589 | Ga0055527_10185891 | 151 |
| 949 | 3300003761 | Ga0055535_1000662 | Ga0055535_100066223 | 151 |
| 950 | 3300003762 | Ga0055542_1000009 | Ga0055542_1000009370 | 151 |
| 951 | 3300003771 | Ga0055526_1008063 | Ga0055526_10080635 | 151 |
| 952 | 3300003771 | Ga0055526_1010870 | Ga0055526_10108703 | 151 |
| 953 | 3300003773 | Ga0055537_1000108 | Ga0055537_100010848 | 151 |
| 954 | 3300003773 | Ga0055537_1003033 | Ga0055537_10030335 | 151 |
| 955 | 3300003773 | Ga0055537_1003352 | Ga0055537_10033523 | 151 |
| 956 | 3300003775 | Ga0055524_1006035 | Ga0055524_10060355 | 151 |
| 957 | 3300003775 | Ga0055524_1008753 | Ga0055524_10087533 | 151 |
| 958 | 3300003781 | Ga0055536_1005750 | Ga0055536_10057502 | 151 |
| 959 | 3300003781 | Ga0055536_1006473 | Ga0055536_10064734 | 151 |
| 960 | 3300003781 | Ga0055536_1009306 | Ga0055536_10093062 | 151 |
| 961 | 3300003784 | Ga0055534_1000109 | Ga0055534_100010948 | 151 |
| 962 | 3300003784 | Ga0055534_1002348 | Ga0055534_10023486 | 151 |
| 963 | 3300003784 | Ga0055534_1006754 | Ga0055534_10067543 | 151 |
| 964 | 3300003790 | Ga0055528_1000173 | Ga0055528_100017348 | 151 |
| 965 | 3300003790 | Ga0055528_1006487 | Ga0055528_10064875 | 151 |
| 966 | 3300003790 | Ga0055528_1007185 | Ga0055528_10071853 | 151 |
| 967 | 3300003790 | Ga0055528_1027916 | Ga0055528_10279161 | 151 |
| 968 | 3300003791 | Ga0055530_10001357 | Ga0055530_1000135712 | 151 |
| 969 | 3300003791 | Ga0055530_10011736 | Ga0055530_100117363 | 151 |
| 970 | 3300003792 | Ga0055540_1001177 | Ga0055540_10011779 | 151 |
| 971 | 3300003792 | Ga0055540_1001272 | Ga0055540_100127213 | 151 |
| 972 | 3300003792 | Ga0055540_1003479 | Ga0055540_10034793 | 151 |
| 973 | 3300003794 | Ga0055531_10001459 | Ga0055531_1000145914 | 151 |
| 974 | 3300003794 | Ga0055531_10003853 | Ga0055531_100038536 | 151 |
| 975 | 3300003794 | Ga0055531_10008746 | Ga0055531_100087463 | 151 |
| 976 | 3300004625 | Ga0055543_1003320 | Ga0055543_10033205 | 151 |
| 977 | 3300004625 | Ga0055543_1003901 | Ga0055543_10039013 | 151 |
| 978 | 3300005262 | Ga0065165_1007482 | Ga0065165_10074825 | 151 |
| 979 | 3300005262 | Ga0065165_1015198 | Ga0065165_10151983 | 151 |
| 980 | 3300005288 | Ga0065714_10006079 | Ga0065714_100060794 | 151 |
| 981 | 3300005289 | Ga0065704_10075643 | Ga0065704_100756432 | 151 |
| 982 | 3300005327 | Ga0070658_10294256 | Ga0070658_102942562 | 151 |
| 983 | 3300005344 | Ga0070661_100048100 | Ga0070661_1000481003 | 151 |
| 984 | 3300005353 | Ga0070669_100405460 | Ga0070669_1004054602 | 151 |
| 985 | 3300005366 | Ga0070659_100416211 | Ga0070659_1004162112 | 151 |
| 986 | 3300005456 | Ga0070678_101041865 | Ga0070678_1010418651 | 151 |
| 987 | 3300005457 | Ga0070662_100361123 | Ga0070662_1003611232 | 151 |
| 988 | 3300005459 | Ga0068867_100096795 | Ga0068867_1000967953 | 151 |
| 989 | 3300005539 | Ga0068853_100014608 | Ga0068853_1000146086 | 151 |
| 990 | 3300005539 | Ga0068853_100246202 | Ga0068853_1002462022 | 151 |
| 991 | 3300005563 | Ga0068855_100245462 | Ga0068855_1002454623 | 151 |
| 992 | 3300005564 | Ga0070664_100106113 | Ga0070664_1001061133 | 151 |
| 993 | 3300005577 | Ga0068857_100170387 | Ga0068857_1001703872 | 151 |
| 994 | 3300005578 | Ga0068854_100266909 | Ga0068854_1002669092 | 151 |
| 995 | 3300005578 | Ga0068854_101059543 | Ga0068854_1010595431 | 151 |
| 996 | 3300006038 | Ga0075365_10029510 | Ga0075365_100295104 | 151 |
| 997 | 3300006042 | Ga0075368_10039873 | Ga0075368_100398732 | 151 |
| 998 | 3300006051 | Ga0075364_10009592 | Ga0075364_100095924 | 151 |
| 999 | 3300006051 | Ga0075364_10036051 | Ga0075364_100360512 | 151 |
| 1000 | 3300006051 | Ga0075364_10513618 | Ga0075364_105136182 | 151 |
| 1001 | 3300006058 | Ga0075432_10006244 | Ga0075432_100062444 | 151 |
| 1002 | 3300006177 | Ga0075362_10005196 | Ga0075362_100051963 | 151 |
| 1003 | 3300006178 | Ga0075367_10410774 | Ga0075367_104107742 | 151 |
| 1004 | 3300006186 | Ga0075369_10034024 | Ga0075369_100340243 | 151 |
| 1005 | 3300006195 | Ga0075366_10004447 | Ga0075366_100044471 | 151 |
| 1006 | 3300006195 | Ga0075366_10011444 | Ga0075366_100114445 | 151 |
| 1007 | 3300006195 | Ga0075366_10015312 | Ga0075366_100153124 | 151 |
| 1008 | 3300006195 | Ga0075366_10214657 | Ga0075366_102146572 | 151 |
| 1009 | 3300006237 | Ga0097621_100275860 | Ga0097621_1002758601 | 151 |
| 1010 | 3300006353 | Ga0075370_10001469 | Ga0075370_100014695 | 151 |
| 1011 | 3300006353 | Ga0075370_10006236 | Ga0075370_100062365 | 151 |
| 1012 | 3300006353 | Ga0075370_10007736 | Ga0075370_100077364 | 151 |
| 1013 | 3300006353 | Ga0075370_10062392 | Ga0075370_100623922 | 151 |
| 1014 | 3300006353 | Ga0075370_10064153 | Ga0075370_100641532 | 151 |
| 1015 | 3300006353 | Ga0075370_10245908 | Ga0075370_102459082 | 151 |
| 1016 | 3300006948 | Ga0099826_10000510 | Ga0099826_1000051011 | 151 |
| 1017 | 3300006948 | Ga0099826_10130486 | Ga0099826_101304862 | 151 |
| 1018 | 3300009036 | Ga0105244_10003834 | Ga0105244_100038343 | 151 |
| 1019 | 3300009036 | Ga0105244_10120607 | Ga0105244_101206072 | 151 |
| 1020 | 3300009093 | Ga0105240_10196814 | Ga0105240_101968141 | 151 |
| 1021 | 3300009093 | Ga0105240_10215319 | Ga0105240_102153192 | 151 |
| 1022 | 3300009098 | Ga0105245_10119233 | Ga0105245_101192333 | 151 |
| 1023 | 3300009148 | Ga0105243_10000884 | Ga0105243_1000088416 | 151 |
| 1024 | 3300009148 | Ga0105243_10005624 | Ga0105243_1000562410 | 151 |
| 1025 | 3300009148 | Ga0105243_11391317 | Ga0105243_113913172 | 151 |
| 1026 | 3300009545 | Ga0105237_10030172 | Ga0105237_100301724 | 151 |
| 1027 | 3300009551 | Ga0105238_10174918 | Ga0105238_101749182 | 151 |
| 1028 | 3300009551 | Ga0105238_11113166 | Ga0105238_111131662 | 151 |
| 1029 | 3300009553 | Ga0105249_12312655 | Ga0105249_123126551 | 151 |
| 1030 | 3300010375 | Ga0105239_10208877 | Ga0105239_102088773 | 151 |
| 1031 | 3300010375 | Ga0105239_10892832 | Ga0105239_108928322 | 151 |
| 1032 | 3300011119 | Ga0105246_10016577 | Ga0105246_100165773 | 151 |
| 1033 | 3300011119 | Ga0105246_10029657 | Ga0105246_100296572 | 151 |
| 1034 | 3300011119 | Ga0105246_10659367 | Ga0105246_106593671 | 151 |
| 1035 | 3300012502 | Ga0157347_1001297 | Ga0157347_10012972 | 151 |
| 1036 | 3300012502 | Ga0157347_1039672 | Ga0157347_10396721 | 151 |
| 1037 | 3300013100 | Ga0157373_10058443 | Ga0157373_100584433 | 151 |
| 1038 | 3300013100 | Ga0157373_10114794 | Ga0157373_101147942 | 151 |
| 1039 | 3300013102 | Ga0157371_10049015 | Ga0157371_100490153 | 151 |
| 1040 | 3300013104 | Ga0157370_10278494 | Ga0157370_102784942 | 151 |
| 1041 | 3300013105 | Ga0157369_10009831 | Ga0157369_1000983111 | 151 |
| 1042 | 3300014497 | Ga0182008_10000250 | Ga0182008_1000025016 | 151 |
| 1043 | 3300014497 | Ga0182008_10001970 | Ga0182008_100019705 | 151 |
| 1044 | 3300014969 | Ga0157376_10965693 | Ga0157376_109656932 | 151 |
| 1045 | 3300015261 | Ga0182006_1001323 | Ga0182006_100132311 | 151 |
| 1046 | 3300015261 | Ga0182006_1088819 | Ga0182006_10888192 | 151 |
| 1047 | 3300015262 | Ga0182007_10001221 | Ga0182007_100012215 | 151 |
| 1048 | 3300015265 | Ga0182005_1129294 | Ga0182005_11292941 | 151 |
| 1049 | 3300017792 | Ga0163161_10000332 | Ga0163161_1000033215 | 151 |
| 1050 | 3300017792 | Ga0163161_10023778 | Ga0163161_100237785 | 151 |
| 1051 | 3300017792 | Ga0163161_10110606 | Ga0163161_101106062 | 151 |
| 1052 | 3300017792 | Ga0163161_10277537 | Ga0163161_102775372 | 151 |
| 1053 | 3300025208 | Ga0209436_116173 | Ga0209436_1161732 | 151 |
| 1054 | 3300025228 | Ga0209672_100443 | Ga0209672_1004439 | 151 |
| 1055 | 3300025229 | Ga0209147_101320 | Ga0209147_1013203 | 151 |
| 1056 | 3300025242 | Ga0209258_100009 | Ga0209258_100009284 | 151 |
| 1057 | 3300025245 | Ga0207425_1000977 | Ga0207425_10009778 | 151 |
| 1058 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007284 | 151 |
| 1059 | 3300025258 | Ga0209129_1000013 | Ga0209129_1000013357 | 151 |
| 1060 | 3300025258 | Ga0209129_1002210 | Ga0209129_10022102 | 151 |
| 1061 | 3300025263 | Ga0209565_1000138 | Ga0209565_100013837 | 151 |
| 1062 | 3300025263 | Ga0209565_1000243 | Ga0209565_100024323 | 151 |
| 1063 | 3300025263 | Ga0209565_1000880 | Ga0209565_10008803 | 151 |
| 1064 | 3300025273 | Ga0209673_1000064 | Ga0209673_100006437 | 151 |
| 1065 | 3300025273 | Ga0209673_1000188 | Ga0209673_100018816 | 151 |
| 1066 | 3300025273 | Ga0209673_1000260 | Ga0209673_100026075 | 151 |
| 1067 | 3300025273 | Ga0209673_1001331 | Ga0209673_10013318 | 151 |
| 1068 | 3300025284 | Ga0209130_1000705 | Ga0209130_100070516 | 151 |
| 1069 | 3300025284 | Ga0209130_1001526 | Ga0209130_10015269 | 151 |
| 1070 | 3300025291 | Ga0209675_1000036 | Ga0209675_100003637 | 151 |
| 1071 | 3300025291 | Ga0209675_1000086 | Ga0209675_100008637 | 151 |
| 1072 | 3300025291 | Ga0209675_1004601 | Ga0209675_10046013 | 151 |
| 1073 | 3300025291 | Ga0209675_1006645 | Ga0209675_10066453 | 151 |
| 1074 | 3300025292 | Ga0209676_1000004 | Ga0209676_1000004217 | 151 |
| 1075 | 3300025292 | Ga0209676_1000105 | Ga0209676_10001053 | 151 |
| 1076 | 3300025292 | Ga0209676_1000287 | Ga0209676_10002872 | 151 |
| 1077 | 3300025292 | Ga0209676_1007209 | Ga0209676_10072093 | 151 |
| 1078 | 3300025294 | Ga0209025_1000168 | Ga0209025_100016882 | 151 |
| 1079 | 3300025294 | Ga0209025_1000220 | Ga0209025_100022049 | 151 |
| 1080 | 3300025294 | Ga0209025_1001388 | Ga0209025_100138812 | 151 |
| 1081 | 3300025294 | Ga0209025_1019541 | Ga0209025_10195412 | 151 |
| 1082 | 3300025294 | Ga0209025_1020869 | Ga0209025_10208693 | 151 |
| 1083 | 3300025294 | Ga0209025_1047983 | Ga0209025_10479832 | 151 |
| 1084 | 3300025295 | Ga0209564_1000222 | Ga0209564_100022225 | 151 |
| 1085 | 3300025295 | Ga0209564_1000287 | Ga0209564_100028723 | 151 |
| 1086 | 3300025297 | Ga0209758_1000134 | Ga0209758_100013467 | 151 |
| 1087 | 3300025297 | Ga0209758_1020433 | Ga0209758_10204332 | 151 |
| 1088 | 3300025297 | Ga0209758_1144446 | Ga0209758_11444461 | 151 |
| 1089 | 3300025298 | Ga0209050_1000002 | Ga0209050_1000002727 | 151 |
| 1090 | 3300025298 | Ga0209050_1000405 | Ga0209050_100040563 | 151 |
| 1091 | 3300025298 | Ga0209050_1005672 | Ga0209050_10056729 | 151 |
| 1092 | 3300025299 | Ga0209256_1000060 | Ga0209256_1000060134 | 151 |
| 1093 | 3300025299 | Ga0209256_1000222 | Ga0209256_100022279 | 151 |
| 1094 | 3300025302 | Ga0207426_1000095 | Ga0207426_100009562 | 151 |
| 1095 | 3300025302 | Ga0207426_1000100 | Ga0207426_1000100134 | 151 |
| 1096 | 3300025303 | Ga0209051_1000002 | Ga0209051_1000002495 | 151 |
| 1097 | 3300025303 | Ga0209051_1000064 | Ga0209051_1000064218 | 151 |
| 1098 | 3300025303 | Ga0209051_1000248 | Ga0209051_100024871 | 151 |
| 1099 | 3300025303 | Ga0209051_1000473 | Ga0209051_100047326 | 151 |
| 1100 | 3300025303 | Ga0209051_1005090 | Ga0209051_10050902 | 151 |
| 1101 | 3300025304 | Ga0209257_1000002 | Ga0209257_1000002636 | 151 |
| 1102 | 3300025304 | Ga0209257_1000109 | Ga0209257_1000109218 | 151 |
| 1103 | 3300025304 | Ga0209257_1000286 | Ga0209257_100028614 | 151 |
| 1104 | 3300025304 | Ga0209257_1003016 | Ga0209257_100301616 | 151 |
| 1105 | 3300025304 | Ga0209257_1023588 | Ga0209257_10235882 | 151 |
| 1106 | 3300025321 | Ga0207656_10003839 | Ga0207656_100038392 | 151 |
| 1107 | 3300025728 | Ga0207655_1005321 | Ga0207655_10053216 | 151 |
| 1108 | 3300025914 | Ga0207671_10326508 | Ga0207671_103265082 | 151 |
| 1109 | 3300025920 | Ga0207649_10222314 | Ga0207649_102223141 | 151 |
| 1110 | 3300025924 | Ga0207694_10147242 | Ga0207694_101472423 | 151 |
| 1111 | 3300025932 | Ga0207690_10430994 | Ga0207690_104309942 | 151 |
| 1112 | 3300025933 | Ga0207706_10029788 | Ga0207706_100297882 | 151 |
| 1113 | 3300025933 | Ga0207706_10062210 | Ga0207706_100622102 | 151 |
| 1114 | 3300025934 | Ga0207686_10865575 | Ga0207686_108655751 | 151 |
| 1115 | 3300025935 | Ga0207709_10000604 | Ga0207709_1000060411 | 151 |
| 1116 | 3300025935 | Ga0207709_10014639 | Ga0207709_100146393 | 151 |
| 1117 | 3300025935 | Ga0207709_10593571 | Ga0207709_105935712 | 151 |
| 1118 | 3300025945 | Ga0207679_10186959 | Ga0207679_101869593 | 151 |
| 1119 | 3300025949 | Ga0207667_10014800 | Ga0207667_100148003 | 151 |
| 1120 | 3300025981 | Ga0207640_10150578 | Ga0207640_101505782 | 151 |
| 1121 | 3300025981 | Ga0207640_10478832 | Ga0207640_104788322 | 151 |
| 1122 | 3300025981 | Ga0207640_11039078 | Ga0207640_110390781 | 151 |
| 1123 | 3300026041 | Ga0207639_10031874 | Ga0207639_100318742 | 151 |
| 1124 | 3300026041 | Ga0207639_10747635 | Ga0207639_107476352 | 151 |
| 1125 | 3300026116 | Ga0207674_10189806 | Ga0207674_101898062 | 151 |
| 1126 | 3300026121 | Ga0207683_10949912 | Ga0207683_109499122 | 151 |
| 1127 | 3300026121 | Ga0207683_12004388 | Ga0207683_120043881 | 151 |
| 1128 | 3300027666 | Ga0209282_1025173 | Ga0209282_10251732 | 151 |
| 1129 | 3300027866 | Ga0209813_10050527 | Ga0209813_100505272 | 151 |
| 1130 | 3300027907 | Ga0207428_10229984 | Ga0207428_102299842 | 151 |
| 1131 | 3300027907 | Ga0207428_10432644 | Ga0207428_104326442 | 151 |
| 1132 | 3300028380 | Ga0268265_10006770 | Ga0268265_100067709 | 151 |
| 1133 | 3300028794 | Ga0307515_10184870 | Ga0307515_101848702 | 151 |
| 1134 | 3300028794 | Ga0307515_10268025 | Ga0307515_102680252 | 151 |
| 1135 | 3300030522 | Ga0307512_10291665 | Ga0307512_102916651 | 151 |
| 1136 | 3300030731 | Ga0316177_1126994 | Ga0316177_11269943 | 151 |
| 1137 | 3300030733 | Ga0314311_1074524 | Ga0314311_10745249 | 151 |
| 1138 | 3300030734 | Ga0316179_1073255 | Ga0316179_10732554 | 151 |
| 1139 | 3300030736 | Ga0316180_1159712 | Ga0316180_11597122 | 151 |
| 1140 | 3300030742 | Ga0316183_1087890 | Ga0316183_108789014 | 151 |
| 1141 | 3300030745 | Ga0316182_1123892 | Ga0316182_11238921 | 151 |
| 1142 | 3300031251 | Ga0265327_10000186 | Ga0265327_1000018673 | 151 |
| 1143 | 3300031548 | Ga0307408_100997816 | Ga0307408_1009978161 | 151 |
| 1144 | 3300031731 | Ga0307405_10049069 | Ga0307405_100490692 | 151 |
| 1145 | 3300031731 | Ga0307405_10138418 | Ga0307405_101384182 | 151 |
| 1146 | 3300031731 | Ga0307405_10247467 | Ga0307405_102474672 | 151 |
| 1147 | 3300031852 | Ga0307410_10119839 | Ga0307410_101198392 | 151 |
| 1148 | 3300031901 | Ga0307406_10000467 | Ga0307406_1000046720 | 151 |
| 1149 | 3300031901 | Ga0307406_10001774 | Ga0307406_100017743 | 151 |
| 1150 | 3300031903 | Ga0307407_10543428 | Ga0307407_105434282 | 151 |
| 1151 | 3300031911 | Ga0307412_10045997 | Ga0307412_100459973 | 151 |
| 1152 | 3300031911 | Ga0307412_10190949 | Ga0307412_101909492 | 151 |
| 1153 | 3300031911 | Ga0307412_10247660 | Ga0307412_102476602 | 151 |
| 1154 | 3300031911 | Ga0307412_10251851 | Ga0307412_102518512 | 151 |
| 1155 | 3300032002 | Ga0307416_100566115 | Ga0307416_1005661152 | 151 |
| 1156 | 3300032005 | Ga0307411_10505469 | Ga0307411_105054692 | 151 |
| 1157 | 3300032005 | Ga0307411_11029771 | Ga0307411_110297712 | 151 |
| 1158 | 3300032005 | Ga0307411_11304708 | Ga0307411_113047082 | 151 |
| 1159 | 3300041452 | Ga0451793_0053218 | Ga0451793_0053218_241_696 | 151 |
| 1160 | 3300041498 | Ga0451841_0569011 | Ga0451841_0569011_83_538 | 151 |
| 1161 | 3300042876 | Ga0451577_0038274 | Ga0451577_0038274_1168_1647 | 151 |
| 1162 | 3300042876 | Ga0451577_0501386 | Ga0451577_0501386_398_877 | 151 |
| 1163 | 3300044673 | Ga0453683_0073668 | Ga0453683_0073668_1205_1684 | 151 |
| 1164 | 3300045051 | Ga0451576_0167326 | Ga0451576_0167326_384_863 | 151 |
| 1165 | 3300046453 | Ga0495627_035541 | Ga0495627_035541_466_921 | 151 |
| 1166 | 3300046459 | Ga0495629_0311230 | Ga0495629_0311230_585_1040 | 151 |
| 1167 | 3300046460 | Ga0495638_0035673 | Ga0495638_0035673_1626_2081 | 151 |
| 1168 | 3300046506 | Ga0495583_0353486 | Ga0495583_0353486_112_567 | 151 |
| 1169 | 3300046512 | Ga0495610_0078883 | Ga0495610_0078883_1040_1495 | 151 |
| 1170 | 3300046512 | Ga0495610_0113459 | Ga0495610_0113459_189_644 | 151 |
| 1171 | 3300046513 | Ga0495616_0000346 | Ga0495616_0000346_20920_21375 | 151 |
| 1172 | 3300046515 | Ga0495620_0044562 | Ga0495620_0044562_1250_1705 | 151 |
| 1173 | 3300046518 | Ga0495631_0000146 | Ga0495631_0000146_15524_15979 | 151 |
| 1174 | 3300046520 | Ga0495637_0012308 | Ga0495637_0012308_739_1194 | 151 |
| 1175 | 3300046530 | Ga0495654_0068165 | Ga0495654_0068165_1184_1639 | 151 |
| 1176 | 3300046530 | Ga0495654_0128131 | Ga0495654_0128131_474_929 | 151 |
| 1177 | 3300046538 | Ga0495609_0041124 | Ga0495609_0041124_437_892 | 151 |
| 1178 | 3300046539 | Ga0495621_0004688 | Ga0495621_0004688_3279_3734 | 151 |
| 1179 | 3300046557 | Ga0495622_0123800 | Ga0495622_0123800_94_549 | 151 |
| 1180 | 3300046660 | Ga0495625_0000254 | Ga0495625_0000254_65007_65501 | 151 |
| 1181 | 3300046660 | Ga0495625_0025317 | Ga0495625_0025317_2224_2679 | 151 |
| 1182 | 3300046665 | Ga0495661_0107487 | Ga0495661_0107487_473_928 | 151 |
| 1183 | 3300046674 | Ga0495588_0128275 | Ga0495588_0128275_591_1046 | 151 |
| 1184 | 3300046674 | Ga0495588_0540591 | Ga0495588_0540591_50_505 | 151 |
| 1185 | 3300046691 | Ga0495670_0097284 | Ga0495670_0097284_484_939 | 151 |
| 1186 | 3300046691 | Ga0495670_0105937 | Ga0495670_0105937_788_1243 | 151 |
| 1187 | 3300046692 | Ga0495671_0001736 | Ga0495671_0001736_5418_5873 | 151 |
| 1188 | 3300047321 | Ga0495676_0442978 | Ga0495676_0442978_184_639 | 151 |
| 1189 | 3300047673 | Ga0495593_0003398 | Ga0495593_0003398_1497_1952 | 151 |
| 1190 | 3300048089 | Ga0495614_0004586 | Ga0495614_0004586_4323_4778 | 151 |
| 1191 | 3300048904 | Ga0496101_0004342 | Ga0496101_0004342_1643_2098 | 151 |
| 1192 | 3300048919 | Ga0496116_0028666 | Ga0496116_0028666_2526_2981 | 151 |
| 1193 | 3300048919 | Ga0496116_0058825 | Ga0496116_0058825_24_479 | 151 |
| 1194 | 3300048919 | Ga0496116_0072703 | Ga0496116_0072703_1589_2044 | 151 |
| 1195 | 3300048920 | Ga0496117_0031641 | Ga0496117_0031641_3442_3897 | 151 |
| 1196 | 3300048920 | Ga0496117_0034303 | Ga0496117_0034303_1571_2026 | 151 |
| 1197 | 3300048920 | Ga0496117_0103645 | Ga0496117_0103645_199_654 | 151 |
| 1198 | 3300048920 | Ga0496117_0108662 | Ga0496117_0108662_677_1132 | 151 |
| 1199 | 3300048921 | Ga0496118_0007154 | Ga0496118_0007154_4810_5265 | 151 |
| 1200 | 3300048921 | Ga0496118_0062718 | Ga0496118_0062718_1102_1557 | 151 |
| 1201 | 3300048921 | Ga0496118_0151133 | Ga0496118_0151133_520_975 | 151 |
| 1202 | 3300048924 | Ga0496121_0049523 | Ga0496121_0049523_239_694 | 151 |
| 1203 | 3300048924 | Ga0496121_0138815 | Ga0496121_0138815_71_526 | 151 |
| 1204 | 3300048925 | Ga0496122_0072076 | Ga0496122_0072076_516_1007 | 151 |
| 1205 | 3300048925 | Ga0496122_0132058 | Ga0496122_0132058_1087_1542 | 151 |
| 1206 | 3300048926 | Ga0496123_0073492 | Ga0496123_0073492_1353_1808 | 151 |
| 1207 | 3300048926 | Ga0496123_0084018 | Ga0496123_0084018_1406_1861 | 151 |
| 1208 | 3300048927 | Ga0496124_0084256 | Ga0496124_0084256_1019_1474 | 151 |
| 1209 | 3300048927 | Ga0496124_0092301 | Ga0496124_0092301_202_657 | 151 |
| 1210 | 3300048927 | Ga0496124_0160561 | Ga0496124_0160561_542_997 | 151 |
| 1211 | 3300048928 | Ga0496125_0022796 | Ga0496125_0022796_2680_3135 | 151 |
| 1212 | 3300048928 | Ga0496125_0050508 | Ga0496125_0050508_2832_3287 | 151 |
| 1213 | 3300048928 | Ga0496125_0219538 | Ga0496125_0219538_238_729 | 151 |
| 1214 | 3300049459 | Ga0495678_187751 | Ga0495678_187751_91_582 | 151 |
| 1215 | 3300049679 | Ga0501249_004010 | Ga0501249_004010_2115_2612 | 151 |
| 1216 | 3300049759 | Ga0501262_000047 | Ga0501262_000047_425_928 | 151 |
| 1217 | 3300050489 | nmdc:mga03683_2164_c2 | nmdc:mga03683_2164_c2_1103_1597 | 151 |
| 1218 | 3300050490 | nmdc:mga03n38_962_c1 | nmdc:mga03n38_962_c1_6842_7336 | 151 |
| 1219 | 3300050491 | nmdc:mga00v17_141610_c1 | nmdc:mga00v17_141610_c1_1023_1517 | 151 |
| 1220 | 3300050491 | nmdc:mga00v17_17913_c1 | nmdc:mga00v17_17913_c1_2884_3378 | 151 |
| 1221 | 3300050491 | nmdc:mga00v17_467037_c1 | nmdc:mga00v17_467037_c1_352_807 | 151 |
| 1222 | 3300050491 | nmdc:mga00v17_77136_c1 | nmdc:mga00v17_77136_c1_1506_2000 | 151 |
| 1223 | 3300050492 | nmdc:mga0yw44_44737_c1 | nmdc:mga0yw44_44737_c1_1412_1915 | 151 |
| 1224 | 3300050493 | nmdc:mga0k408_128491_c1 | nmdc:mga0k408_128491_c1_83_538 | 151 |
| 1225 | 3300050493 | nmdc:mga0k408_220108_c2 | nmdc:mga0k408_220108_c2_118_573 | 151 |
| 1226 | 3300050493 | nmdc:mga0k408_50999_c1 | nmdc:mga0k408_50999_c1_221_715 | 151 |
| 1227 | 3300050493 | nmdc:mga0k408_78539_c1 | nmdc:mga0k408_78539_c1_1411_1914 | 151 |
| 1228 | 3300050495 | nmdc:mga04h51_116994_c1 | nmdc:mga04h51_116994_c1_249_743 | 151 |
| 1229 | 3300050496 | nmdc:mga07m45_1052_c1 | nmdc:mga07m45_1052_c1_1841_2296 | 151 |
| 1230 | 3300050496 | nmdc:mga07m45_187455_c1 | nmdc:mga07m45_187455_c1_445_900 | 151 |
| 1231 | 3300050496 | nmdc:mga07m45_256134_c1 | nmdc:mga07m45_256134_c1_422_916 | 151 |
| 1232 | 3300050496 | nmdc:mga07m45_479976_c1 | nmdc:mga07m45_479976_c1_70_528 | 151 |
| 1233 | 3300050496 | nmdc:mga07m45_577170_c1 | nmdc:mga07m45_577170_c1_164_619 | 151 |
| 1234 | 3300050496 | nmdc:mga07m45_595_c2 | nmdc:mga07m45_595_c2_13315_13770 | 151 |
| 1235 | 3300050496 | nmdc:mga07m45_981_c1 | nmdc:mga07m45_981_c1_10566_11060 | 151 |
| 1236 | 3300053079 | Ga0500610_0014869 | Ga0500610_0014869_1452_1907 | 151 |
| 1237 | 3300053079 | Ga0500610_0030679 | Ga0500610_0030679_511_966 | 151 |
| 1238 | 3300053079 | Ga0500610_0128132 | Ga0500610_0128132_205_660 | 151 |
| 1239 | 3300053087 | Ga0500643_072680 | Ga0500643_072680_163_618 | 151 |
| 1240 | 3300053088 | Ga0500644_0003434 | Ga0500644_0003434_2627_3085 | 151 |
| 1241 | 3300053091 | Ga0500647_0136843 | Ga0500647_0136843_437_892 | 151 |
| 1242 | 3300053093 | Ga0500651_0003756 | Ga0500651_0003756_702_1157 | 151 |
| 1243 | 3300053107 | Ga0500560_216069 | Ga0500560_216069_14_469 | 151 |
| 1244 | 3300053108 | Ga0500562_035386 | Ga0500562_035386_112_570 | 151 |
| 1245 | 3300053109 | Ga0500569_257867 | Ga0500569_257867_94_549 | 151 |
| 1246 | 3300053110 | Ga0500571_000381 | Ga0500571_000381_15463_15918 | 151 |
| 1247 | 3300053117 | Ga0500593_004216 | Ga0500593_004216_4126_4581 | 151 |
| 1248 | 3300053120 | Ga0500597_123433 | Ga0500597_123433_276_731 | 151 |
| 1249 | 3300053121 | Ga0500607_001809 | Ga0500607_001809_2216_2671 | 151 |
| 1250 | 3300053121 | Ga0500607_054656 | Ga0500607_054656_1437_1892 | 151 |
| 1251 | 3300053122 | Ga0500608_055736 | Ga0500608_055736_1170_1625 | 151 |
| 1252 | 3300053122 | Ga0500608_120170 | Ga0500608_120170_139_594 | 151 |
| 1253 | 3300053122 | Ga0500608_141312 | Ga0500608_141312_222_677 | 151 |
| 1254 | 3300053128 | Ga0500626_024197 | Ga0500626_024197_1379_1834 | 151 |
| 1255 | 3300053133 | Ga0500655_002877 | Ga0500655_002877_1812_2267 | 151 |
| 1256 | 3300053134 | Ga0500658_0000192 | Ga0500658_0000192_11083_11538 | 151 |
| 1257 | 3300053134 | Ga0500658_0000417 | Ga0500658_0000417_6601_7056 | 151 |
| 1258 | 3300053136 | Ga0500559_0021048 | Ga0500559_0021048_1454_1909 | 151 |
| 1259 | 3300053137 | Ga0500561_0089930 | Ga0500561_0089930_140_595 | 151 |
| 1260 | 3300053138 | Ga0500564_028526 | Ga0500564_028526_226_681 | 151 |
| 1261 | 3300053139 | Ga0500568_0003566 | Ga0500568_0003566_2987_3442 | 151 |
| 1262 | 3300053139 | Ga0500568_0211802 | Ga0500568_0211802_79_537 | 151 |
| 1263 | 3300053141 | Ga0500574_001773 | Ga0500574_001773_1913_2368 | 151 |
| 1264 | 3300053142 | Ga0500577_0164507 | Ga0500577_0164507_175_633 | 151 |
| 1265 | 3300053153 | Ga0500616_0055380 | Ga0500616_0055380_737_1192 | 151 |
| 1266 | 3300053154 | Ga0500619_133770 | Ga0500619_133770_350_805 | 151 |
| 1267 | 3300053158 | Ga0500627_0000737 | Ga0500627_0000737_4441_4896 | 151 |
| 1268 | 3300053161 | Ga0500634_0133993 | Ga0500634_0133993_432_887 | 151 |
| 1269 | 3300053162 | Ga0500638_085214 | Ga0500638_085214_154_609 | 151 |
| 1270 | 3300053729 | Ga0500625_191069 | Ga0500625_191069_174_629 | 151 |
| 1271 | 3300053735 | Ga0500596_041041 | Ga0500596_041041_185_640 | 151 |
| 1272 | iso_pu_bacteria | 2547132374 | 2548497452 | 151 |
| 1273 | iso_pu_bacteria | 2643221717 | 2644647427 | 151 |
| 1274 | iso_pu_bacteria | 2738541307 | 2738884670 | 151 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9389 | 38 | 97 |
| 5duk-assembly1.cif.gz_A | n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 | 0.9381 | 38 | 88 |
| 5j6x-assembly2.cif.gz_B | crystal structure of the apo-zalpha of zebrafish pkz | 0.9252 | 38 | 98 |
| 5duk-assembly1.cif.gz_B | n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 | 0.9136 | 38 | 88 |
| 5f7p-assembly1.cif.gz_A | rok repressor lmo0178 from listeria monocytogenes | 0.9133 | 39 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9532 | 35 | 95 | 1.10.10.10 |
| af_K7LWV0_206_275_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9512 | 52 | 82 | 1.10.10.10 |
| af_Q58793_322_389_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9406 | 36 | 99 | 1.10.10.10 |
| 5dukA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9396 | 38 | 78 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9389 | 38 | 97 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R1VTS1-F1-model_v4 | deleted | 0.9323 | 20 | 146 |
|
| AF-N8QEA3-F1-model_v4 | HTH marR-type domain-containing protein | 0.9256 | 20 | 142 |
GO:0003700
GO:0006950 |
| AF-A0A109BED7-F1-model_v4 | deleted | 0.9243 | 16 | 151 |
|
| AF-A0A3D3PI80-F1-model_v4 | MarR family transcriptional regulator | 0.9235 | 1 | 138 |
GO:0003700
GO:0006950 |
| AF-A0A4S8F2F3-F1-model_v4 | Winged helix-turn-helix transcriptional regulator | 0.9131 | 1 | 142 |
GO:0003700
GO:0006950 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar