F492449

General Info

Members Datasets Scaffolds Average Seq Length
1274 513 1209 156

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10722173|Ga0163163_107221732
Length 175
Sequence MSICRVESCNCNDCSYNQKIMHSKVRAATHTGPMGCSSFKLRQLSRRVSQHFDRVVGAAGLKTTQYSLLTHVMRLEPVRPSDLAADMEMDASTLTRNLQPLVAQGWLEVGPGDDGRSRFVTMTAAGREKRAEAQREWKRAQLAFNDHIGEERVARLHALIDECLALMNEPDDLSS

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221570 Acidovorax sp. Root568 Isolate Unclassified
11 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
12 2643221596 Acidovorax sp. Root70 Isolate Unclassified
13 2643221609 Acidovorax sp. Root217 Isolate Unclassified
14 2643221611 Acidovorax sp. Root219 Isolate Unclassified
15 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
16 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
17 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
18 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
19 2643221652 Acidovorax sp. Root402 Isolate Unclassified
20 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
21 2643221658 Variovorax sp. Root411 Isolate Unclassified
22 2643221672 Variovorax sp. Root434 Isolate Unclassified
23 2643221683 Variovorax sp. Root473 Isolate Unclassified
24 2643221717 Acidovorax sp. Root267 Isolate Unclassified
25 2738541277 Variovorax sp. GV051 Isolate Unclassified
26 2738541307 Variovorax sp. GV008 Isolate Unclassified
27 2738543012 Acidovorax sp. CF301 Isolate Unclassified
28 2738543019 Variovorax sp. GV040 Isolate Unclassified
29 2816332133 Acidovorax radicis 2721A Isolate Unclassified
30 2818991446 Variovorax sp. 1180 Isolate Unclassified
31 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
32 2831864461 Roseateles noduli HZ7 Isolate Nodule
33 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
34 2842677519 Variovorax sp. R-72495 Isolate Unclassified
35 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
36 2842747753 Variovorax sp. R-72060 Isolate Unclassified
37 2885198086 Variovorax sp. 679 Isolate Unclassified
38 2885211737 Variovorax sp. 553 Isolate Unclassified
39 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
40 2899924645 Variovorax sp. 369 Isolate Unclassified
41 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
42 2904456579 Variovorax sp. 2002 Isolate Unclassified
43 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
44 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
45 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
46 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
47 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
48 2928037797 Variovorax sp. 1126 Isolate Unclassified
49 2928044640 Variovorax sp. 1128 Isolate Unclassified
50 2928051484 Variovorax sp. 1133 Isolate Unclassified
51 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
52 2928070936 Variovorax gossypii 1167 Isolate Unclassified
53 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
54 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
55 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
56 2929520902 Variovorax beijingensis 502 Isolate Unclassified
57 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
58 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
59 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
60 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
61 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
62 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
63 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
64 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
65 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
66 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
67 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
68 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
69 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
70 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
71 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
72 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
73 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
74 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
75 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
76 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
77 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
78 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
79 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
80 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
81 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
82 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
83 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
84 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
85 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
86 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
87 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
88 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
89 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
90 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
91 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
92 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
93 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
94 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
95 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
96 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
97 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
98 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
99 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
100 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
101 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
102 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
103 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
104 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
105 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
106 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
107 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
108 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
109 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
110 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
111 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
112 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
113 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
114 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
115 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
116 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
117 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
118 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
119 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
120 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
121 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
122 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
123 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
124 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
125 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
126 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
127 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
128 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
129 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
130 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
131 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
132 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
133 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
134 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
135 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
136 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
137 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
138 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
139 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
140 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
141 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
142 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
143 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
144 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
145 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
146 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
147 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
148 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
149 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
150 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
151 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
152 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
153 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
154 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
155 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
156 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
157 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
158 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
159 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
160 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
161 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
162 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
163 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
164 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
165 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
166 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
167 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
168 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
169 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
170 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
171 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
172 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
173 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
174 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
175 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
176 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
177 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
178 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
179 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
180 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
181 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
182 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
183 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
184 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
185 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
186 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
187 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
188 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
189 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
190 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
191 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
192 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
193 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
194 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
195 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
196 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
197 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
198 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
199 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
200 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
201 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
202 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
203 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
204 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
205 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
206 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
212 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
214 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
217 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
219 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
220 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
222 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
224 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
225 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
227 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
283 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
284 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
286 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
287 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
289 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
293 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
294 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
295 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
296 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
297 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
298 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
299 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
300 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
301 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
302 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
303 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
304 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
305 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
306 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
307 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
308 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
309 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
310 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
311 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
312 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
313 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
314 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
315 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
316 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
317 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
318 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
319 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
320 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
321 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
322 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
323 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
324 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
325 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
326 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
327 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
328 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
329 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
330 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
331 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
332 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
333 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
334 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
335 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
336 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
337 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
338 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
339 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
340 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
341 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
342 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
343 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
344 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
345 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
346 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
347 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
348 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
349 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
350 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
351 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
352 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
353 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
354 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
355 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
356 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
357 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
358 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
359 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
360 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
361 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
362 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
363 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
364 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
365 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
366 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
367 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
368 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
369 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
370 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
371 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
372 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
373 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
374 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
375 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
376 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
377 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
378 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
379 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
380 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
381 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
382 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
383 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
384 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
385 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
386 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
387 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
388 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
389 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
390 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
391 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
392 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
393 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
394 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
395 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
396 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
397 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
398 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
399 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
400 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
401 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
402 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
403 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
404 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
405 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
406 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
407 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
408 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
409 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
410 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
411 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
412 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
413 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
414 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
415 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
416 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
417 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
418 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
419 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
420 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
421 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
422 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
423 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
424 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
425 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
426 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
427 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
428 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
429 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
430 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
431 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
432 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
433 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
434 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
435 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
436 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
437 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
438 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
439 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
440 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
441 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
442 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
443 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
444 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
445 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
446 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
447 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
448 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
449 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
450 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
451 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
452 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
453 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
454 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
455 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
456 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
457 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
460 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
461 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
462 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
464 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
465 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
466 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
467 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
468 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
469 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
470 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
471 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
472 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
473 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
474 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
475 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
476 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
477 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
478 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
479 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
480 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
481 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
482 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
483 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
484 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
485 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
486 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
487 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
488 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
489 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
490 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
491 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
492 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
493 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
494 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
495 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
496 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
497 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
498 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
499 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
500 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
501 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
502 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
503 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
504 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
505 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
506 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
507 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
508 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
509 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
510 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
511 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
512 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
513 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.66
Metatranscriptomes 0.24
Isolates 5.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 26.06
Nodule 0.71
Rhizoplane 2.75
Rhizosphere 59.65
Stem 0
Stem Tuber 0
Unclassified 10.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002313 3300001979 Bacteria 8669
2 JGI24739J22299_10042561 3300001989 Bacteria 1506
3 JGI25158J39367_1014260 3300002739 Bacteria 1030
4 JGI25158J39367_1017354 3300002739 Bacteria 902
5 JGI25152J39213_1002086 3300002773 Bacteria 7852
6 JGI25152J39213_1003149 3300002773 Bacteria 5759
7 JGI25152J39213_1011911 3300002773 Bacteria 1897
8 JGI25150J39212_1000609 3300002774 Bacteria 13775
9 JGI25150J39212_1015273 3300002774 Bacteria 1285
10 JGI25159J45721_1003702 3300002987 Bacteria 5304
11 JGI25159J45721_1005109 3300002987 Bacteria 4171
12 JGI25159J45721_1021556 3300002987 Bacteria 1212
13 JGI25151J46595_10003523 3300003187 Bacteria 8617
14 JGI25151J46595_10003837 3300003187 Bacteria 8137
15 JGI25151J46595_10007545 3300003187 Bacteria 5316
16 JGI25151J46595_10044085 3300003187 Bacteria 1588
17 JGI25153J46596_10007592 3300003215 Bacteria 5304
18 JGI25153J46596_10010478 3300003215 Bacteria 4189
19 JGI25153J46596_10036140 3300003215 Bacteria 1588
20 rootH1_10002444 3300003316 Bacteria 3162
21 rootH1_10065105 3300003316 Bacteria 2086
22 rootH1_10066517 3300003316 Bacteria 1226
23 rootH2_10007251 3300003320 Bacteria 1492
24 rootH2_10048751 3300003320 Bacteria 2678
25 rootL2_10004239 3300003322 Bacteria 31814
26 rootL2_10016479 3300003322 Bacteria 4719
27 rootL2_10100371 3300003322 Bacteria 1642
28 rootL2_10196900 3300003322 Bacteria 2471
29 rootH1_10016782 3300003323 Bacteria 4512
30 rootH1_10096611 3300003323 Bacteria 1847
31 rootH1_10172482 3300003323 Bacteria 2585
32 rootH1_10193050 3300003323 Bacteria 2922
33 JGI25160J50197_1005413 3300003354 Bacteria 5316
34 JGI25160J50197_1009233 3300003354 Bacteria 3677
35 JGI25161J50226_1002087 3300003374 Bacteria 5400
36 JGI25161J50226_1003898 3300003374 Bacteria 3251
37 JGI25161J50226_1009984 3300003374 Bacteria 1305
38 Ga0006562J51391_1103471 3300003578 Bacteria 5110
39 Ga0006562J51391_1103472 3300003578 Bacteria 3890
40 Ga0006562J51391_1156325 3300003578 Bacteria 1373
41 Ga0055525_1000021 3300003759 Bacteria 370802
42 Ga0055527_1018589 3300003760 Bacteria 738
43 Ga0055535_1000662 3300003761 Bacteria 27248
44 Ga0055542_1000009 3300003762 Bacteria 416550
45 Ga0055526_1003267 3300003771 Bacteria 10410
46 Ga0055526_1008063 3300003771 Bacteria 5316
47 Ga0055526_1010870 3300003771 Bacteria 4180
48 Ga0055537_1000108 3300003773 Bacteria 62351
49 Ga0055537_1003033 3300003773 Bacteria 5304
50 Ga0055537_1003352 3300003773 Bacteria 4955
51 Ga0055524_1000253 3300003775 Bacteria 55038
52 Ga0055524_1006035 3300003775 Bacteria 5316
53 Ga0055524_1008753 3300003775 Bacteria 4180
54 Ga0055536_1005750 3300003781 Bacteria 5972
55 Ga0055536_1006473 3300003781 Bacteria 5454
56 Ga0055536_1009306 3300003781 Bacteria 4079
57 Ga0055534_1000109 3300003784 Bacteria 60884
58 Ga0055534_1002348 3300003784 Bacteria 6604
59 Ga0055534_1003031 3300003784 Bacteria 5513
60 Ga0055534_1006754 3300003784 Bacteria 2840
61 Ga0055528_1000173 3300003790 Bacteria 54563
62 Ga0055528_1006487 3300003790 Bacteria 5304
63 Ga0055528_1007185 3300003790 Bacteria 4955
64 Ga0055528_1027916 3300003790 Bacteria 1571
65 Ga0055530_10001357 3300003791 Bacteria 18147
66 Ga0055530_10002534 3300003791 Bacteria 11642
67 Ga0055530_10011736 3300003791 Bacteria 3119
68 Ga0055530_10046583 3300003791 Bacteria 1029
69 Ga0055540_1000009 3300003792 Bacteria 300466
70 Ga0055540_1000011 3300003792 Bacteria 282927
71 Ga0055540_1001177 3300003792 Bacteria 16163
72 Ga0055540_1001272 3300003792 Bacteria 15344
73 Ga0055540_1003479 3300003792 Bacteria 7597
74 Ga0055540_1014702 3300003792 Bacteria 2318
75 Ga0055531_10001459 3300003794 Bacteria 17416
76 Ga0055531_10003853 3300003794 Bacteria 9389
77 Ga0055531_10006988 3300003794 Bacteria 6269
78 Ga0055531_10008746 3300003794 Bacteria 5283
79 Ga0055531_10015050 3300003794 Bacteria 3436
80 Ga0055543_1003320 3300004625 Bacteria 4815
81 Ga0055543_1003901 3300004625 Bacteria 4218
82 Ga0055543_1020669 3300004625 Bacteria 1207
83 Ga0065165_1000270 3300005262 Bacteria 88828
84 Ga0065165_1002517 3300005262 Bacteria 15273
85 Ga0065165_1007482 3300005262 Bacteria 5354
86 Ga0065165_1015198 3300005262 Bacteria 2947
87 Ga0065714_10006079 3300005288 Bacteria 5536
88 Ga0065714_10008805 3300005288 Bacteria 3091
89 Ga0065704_10075643 3300005289 Bacteria 5484
90 Ga0065715_10210477 3300005293 Bacteria 1316
91 Ga0070658_10083823 3300005327 Bacteria 2621
92 Ga0070658_10102909 3300005327 Bacteria 2362
93 Ga0070658_10202820 3300005327 Bacteria 1674
94 Ga0070658_10205517 3300005327 Bacteria 1663
95 Ga0070658_10294256 3300005327 Bacteria 1384
96 Ga0070658_10348623 3300005327 Bacteria 1267
97 Ga0070676_10009290 3300005328 Bacteria 5317
98 Ga0070676_10057235 3300005328 Bacteria 2307
99 Ga0070676_10392855 3300005328 Bacteria 963
100 Ga0070676_10737033 3300005328 Bacteria 722
101 Ga0070683_100005352 3300005329 Bacteria 10701
102 Ga0070690_100334864 3300005330 Bacteria 1094
103 Ga0070670_100003584 3300005331 Bacteria 12922
104 Ga0070670_100009851 3300005331 Bacteria 8160
105 Ga0070670_100015006 3300005331 Bacteria 6648
106 Ga0070670_100093239 3300005331 Bacteria 2590
107 Ga0070670_100109353 3300005331 Bacteria 2382
108 Ga0070670_100297529 3300005331 Bacteria 1411
109 Ga0070677_10015608 3300005333 Bacteria 2691
110 Ga0070677_10026044 3300005333 Bacteria 2190
111 Ga0070677_10027992 3300005333 Bacteria 2126
112 Ga0070677_10054643 3300005333 Bacteria 1627
113 Ga0070677_10412095 3300005333 Bacteria 715
114 Ga0068869_100069759 3300005334 Bacteria 2599
115 Ga0068869_100091461 3300005334 Bacteria 2289
116 Ga0068869_100604704 3300005334 Bacteria 926
117 Ga0070666_10559709 3300005335 Bacteria 832
118 Ga0070666_10659296 3300005335 Bacteria 766
119 Ga0068868_100001157 3300005338 Bacteria 18078
120 Ga0068868_100063065 3300005338 Bacteria 2939
121 Ga0068868_100137460 3300005338 Bacteria 2004
122 Ga0068868_100547663 3300005338 Bacteria 1019
123 Ga0068868_100789163 3300005338 Bacteria 856
124 Ga0070660_100040525 3300005339 Bacteria 3545
125 Ga0070660_100068835 3300005339 Bacteria 2759
126 Ga0070660_100078509 3300005339 Bacteria 2588
127 Ga0070661_100037349 3300005344 Bacteria 3533
128 Ga0070661_100048100 3300005344 Bacteria 3122
129 Ga0070661_100134336 3300005344 Bacteria 1860
130 Ga0070661_100141260 3300005344 Bacteria 1815
131 Ga0070661_101191782 3300005344 Bacteria 637
132 Ga0070668_100143139 3300005347 Bacteria 1928
133 Ga0070668_100156282 3300005347 Bacteria 1848
134 Ga0070668_101787717 3300005347 Bacteria 565
135 Ga0070669_100107590 3300005353 Bacteria 2112
136 Ga0070669_100133329 3300005353 Bacteria 1908
137 Ga0070669_100264990 3300005353 Bacteria 1372
138 Ga0070669_100405460 3300005353 Bacteria 1116
139 Ga0070669_101089507 3300005353 Bacteria 688
140 Ga0070675_100001801 3300005354 Bacteria 15832
141 Ga0070675_100007761 3300005354 Bacteria 8307
142 Ga0070675_100022306 3300005354 Bacteria 5058
143 Ga0070675_100054138 3300005354 Bacteria 3301
144 Ga0070671_100050666 3300005355 Bacteria 3453
145 Ga0070671_100080213 3300005355 Bacteria 2728
146 Ga0070671_100244692 3300005355 Bacteria 1523
147 Ga0070671_100416739 3300005355 Bacteria 1150
148 Ga0070671_100667071 3300005355 Bacteria 901
149 Ga0070674_100001004 3300005356 Bacteria 14721
150 Ga0070674_100016511 3300005356 Bacteria 4628
151 Ga0070674_100417511 3300005356 Bacteria 1100
152 Ga0070674_100553972 3300005356 Bacteria 965
153 Ga0070674_101703460 3300005356 Bacteria 570
154 Ga0070673_100003898 3300005364 Bacteria 9374
155 Ga0070673_100015817 3300005364 Bacteria 5314
156 Ga0070673_100115232 3300005364 Bacteria 2234
157 Ga0070673_100125273 3300005364 Bacteria 2149
158 Ga0070673_100153586 3300005364 Bacteria 1951
159 Ga0070673_100423584 3300005364 Bacteria 1194
160 Ga0070673_100639941 3300005364 Unclassified 973
161 Ga0070673_100903878 3300005364 Bacteria 819
162 Ga0070659_100106388 3300005366 Bacteria 2261
163 Ga0070659_100416211 3300005366 Bacteria 1136
164 Ga0070659_100785965 3300005366 Bacteria 827
165 Ga0070659_100797259 3300005366 Bacteria 821
166 Ga0070667_100088937 3300005367 Bacteria 2652
167 Ga0070667_100090969 3300005367 Bacteria 2623
168 Ga0070667_100195279 3300005367 Bacteria 1794
169 Ga0070667_101047707 3300005367 Bacteria 762
170 Ga0070700_100582016 3300005441 Bacteria 874
171 Ga0070708_100156079 3300005445 Bacteria 2125
172 Ga0070663_100118454 3300005455 Bacteria 1997
173 Ga0070663_100529825 3300005455 Bacteria 982
174 Ga0070663_100599054 3300005455 Bacteria 927
175 Ga0070678_100005974 3300005456 Bacteria 7092
176 Ga0070678_100014268 3300005456 Bacteria 5006
177 Ga0070678_100046649 3300005456 Bacteria 3109
178 Ga0070678_100069235 3300005456 Bacteria 2634
179 Ga0070678_100173760 3300005456 Bacteria 1757
180 Ga0070678_100322745 3300005456 Bacteria 1319
181 Ga0070678_101041865 3300005456 Bacteria 753
182 Ga0070662_100000867 3300005457 Bacteria 18517
183 Ga0070662_100024603 3300005457 Bacteria 4150
184 Ga0070662_100110025 3300005457 Bacteria 2097
185 Ga0070662_100154273 3300005457 Bacteria 1791
186 Ga0070662_100361123 3300005457 Bacteria 1192
187 Ga0070681_10532061 3300005458 Bacteria 1089
188 Ga0070681_11156798 3300005458 Bacteria 695
189 Ga0068867_100005504 3300005459 Bacteria 8963
190 Ga0068867_100032066 3300005459 Bacteria 3797
191 Ga0068867_100077768 3300005459 Bacteria 2494
192 Ga0068867_100096795 3300005459 Bacteria 2248
193 Ga0068867_100099511 3300005459 Bacteria 2218
194 Ga0068867_100255074 3300005459 Bacteria 1428
195 Ga0068867_100895646 3300005459 Bacteria 798
196 Ga0070706_100001400 3300005467 Bacteria 25498
197 Ga0070707_100024364 3300005468 Bacteria 5731
198 Ga0070698_100124625 3300005471 Bacteria 2534
199 Ga0070699_100067925 3300005518 Bacteria 3095
200 Ga0070679_100024940 3300005530 Bacteria 5863
201 Ga0070684_100027307 3300005535 Bacteria 4815
202 Ga0070684_100127611 3300005535 Bacteria 2292
203 Ga0070684_100423920 3300005535 Unclassified 1228
204 Ga0070684_100679080 3300005535 Bacteria 959
205 Ga0068853_100002880 3300005539 Bacteria 13055
206 Ga0068853_100014608 3300005539 Bacteria 6439
207 Ga0068853_100050690 3300005539 Bacteria 3572
208 Ga0068853_100132036 3300005539 Bacteria 2236
209 Ga0068853_100222578 3300005539 Bacteria 1724
210 Ga0068853_100246202 3300005539 Bacteria 1639
211 Ga0068853_101987723 3300005539 Bacteria 564
212 Ga0070672_100000535 3300005543 Bacteria 22337
213 Ga0070672_100002739 3300005543 Bacteria 11283
214 Ga0070672_100019327 3300005543 Bacteria 4943
215 Ga0070672_100049097 3300005543 Bacteria 3281
216 Ga0070672_100098868 3300005543 Bacteria 2364
217 Ga0070672_100204828 3300005543 Bacteria 1650
218 Ga0070693_100029302 3300005547 Bacteria 3001
219 Ga0070693_100487795 3300005547 Bacteria 872
220 Ga0070665_100078999 3300005548 Bacteria 3296
221 Ga0070665_100102402 3300005548 Bacteria 2867
222 Ga0070665_100150572 3300005548 Bacteria 2329
223 Ga0070665_100273946 3300005548 Bacteria 1689
224 Ga0070665_100361883 3300005548 Bacteria 1457
225 Ga0070665_101733628 3300005548 Bacteria 632
226 Ga0068855_100051204 3300005563 Bacteria 4864
227 Ga0068855_100245462 3300005563 Bacteria 1999
228 Ga0068855_100246194 3300005563 Bacteria 1995
229 Ga0070664_100093118 3300005564 Bacteria 2611
230 Ga0070664_100106113 3300005564 Bacteria 2447
231 Ga0070664_100115387 3300005564 Bacteria 2347
232 Ga0070664_100222287 3300005564 Bacteria 1690
233 Ga0070664_100591957 3300005564 Bacteria 1028
234 Ga0068857_100043611 3300005577 Bacteria 3978
235 Ga0068857_100121537 3300005577 Bacteria 2351
236 Ga0068857_100143878 3300005577 Bacteria 2156
237 Ga0068857_100170387 3300005577 Bacteria 1979
238 Ga0068857_100298591 3300005577 Bacteria 1485
239 Ga0068854_100020708 3300005578 Bacteria 4456
240 Ga0068854_100027581 3300005578 Bacteria 3915
241 Ga0068854_100034288 3300005578 Bacteria 3545
242 Ga0068854_100261895 3300005578 Bacteria 1385
243 Ga0068854_100266909 3300005578 Bacteria 1372
244 Ga0068854_101059543 3300005578 Bacteria 721
245 Ga0068856_100004035 3300005614 Bacteria 14702
246 Ga0068856_100190867 3300005614 Bacteria 2062
247 Ga0068852_100072682 3300005616 Bacteria 3023
248 Ga0068852_100094552 3300005616 Bacteria 2681
249 Ga0068852_100139459 3300005616 Bacteria 2242
250 Ga0068852_100189947 3300005616 Bacteria 1938
251 Ga0068852_100606196 3300005616 Bacteria 1100
252 Ga0068852_101088389 3300005616 Bacteria 819
253 Ga0068852_101608748 3300005616 Bacteria 672
254 Ga0068859_100325490 3300005617 Bacteria 1631
255 Ga0068859_100435764 3300005617 Bacteria 1407
256 Ga0068864_100011769 3300005618 Bacteria 7227
257 Ga0068864_100018043 3300005618 Bacteria 5890
258 Ga0068864_100024340 3300005618 Bacteria 5093
259 Ga0068864_100040117 3300005618 Bacteria 4005
260 Ga0068864_100363776 3300005618 Bacteria 1368
261 Ga0068864_100550863 3300005618 Bacteria 1115
262 Ga0068866_10422358 3300005718 Bacteria 865
263 Ga0068861_100003855 3300005719 Bacteria 10017
264 Ga0068861_100036330 3300005719 Bacteria 3655
265 Ga0068861_100518491 3300005719 Bacteria 1081
266 Ga0068851_10020198 3300005834 Bacteria 3222
267 Ga0068851_10062559 3300005834 Bacteria 1910
268 Ga0068851_10147537 3300005834 Bacteria 1284
269 Ga0068851_10371613 3300005834 Bacteria 836
270 Ga0068870_10125652 3300005840 Bacteria 1483
271 Ga0068870_10371678 3300005840 Bacteria 923
272 Ga0068870_10826718 3300005840 Bacteria 649
273 Ga0068863_100058398 3300005841 Bacteria 3651
274 Ga0068863_100067310 3300005841 Bacteria 3387
275 Ga0068863_100195703 3300005841 Bacteria 1943
276 Ga0068863_101060957 3300005841 Bacteria 814
277 Ga0068858_100351657 3300005842 Bacteria 1411
278 Ga0068860_100030780 3300005843 Bacteria 5160
279 Ga0068860_100176947 3300005843 Bacteria 2062
280 Ga0068860_100458633 3300005843 Bacteria 1268
281 Ga0068862_100019148 3300005844 Bacteria 5707
282 Ga0068862_100559178 3300005844 Bacteria 1093
283 Ga0075365_10029510 3300006038 Bacteria 3507
284 Ga0075368_10039873 3300006042 Bacteria 1842
285 Ga0075368_10069954 3300006042 Bacteria 1416
286 Ga0075363_100011747 3300006048 Bacteria 4203
287 Ga0075363_100234686 3300006048 Bacteria 1054
288 Ga0075363_100248920 3300006048 Bacteria 1023
289 Ga0075364_10009592 3300006051 Bacteria 5813
290 Ga0075364_10036051 3300006051 Bacteria 3198
291 Ga0075364_10058694 3300006051 Bacteria 2522
292 Ga0075364_10083153 3300006051 Bacteria 2119
293 Ga0075364_10513618 3300006051 Bacteria 819
294 Ga0075432_10006244 3300006058 Bacteria 4050
295 Ga0070715_10068721 3300006163 Bacteria 1576
296 Ga0075362_10002180 3300006177 Bacteria 6488
297 Ga0075362_10005196 3300006177 Bacteria 4744
298 Ga0075362_10008211 3300006177 Bacteria 3985
299 Ga0075367_10007898 3300006178 Bacteria 5480
300 Ga0075367_10053886 3300006178 Bacteria 2384
301 Ga0075367_10103594 3300006178 Bacteria 1741
302 Ga0075367_10287260 3300006178 Bacteria 1034
303 Ga0075367_10410774 3300006178 Bacteria 857
304 Ga0075369_10033641 3300006186 Bacteria 2173
305 Ga0075369_10033995 3300006186 Bacteria 2162
306 Ga0075369_10034024 3300006186 Bacteria 2162
307 Ga0075369_10078951 3300006186 Bacteria 1458
308 Ga0075369_10125905 3300006186 Bacteria 1162
309 Ga0075366_10000574 3300006195 Bacteria 17235
310 Ga0075366_10004447 3300006195 Bacteria 7523
311 Ga0075366_10011444 3300006195 Bacteria 5011
312 Ga0075366_10014575 3300006195 Bacteria 4491
313 Ga0075366_10015312 3300006195 Bacteria 4391
314 Ga0075366_10024978 3300006195 Bacteria 3487
315 Ga0075366_10082530 3300006195 Bacteria 1920
316 Ga0075366_10089809 3300006195 Bacteria 1840
317 Ga0075366_10116553 3300006195 Bacteria 1608
318 Ga0075366_10165958 3300006195 Bacteria 1339
319 Ga0075366_10214657 3300006195 Bacteria 1172
320 Ga0075366_10258602 3300006195 Bacteria 1062
321 Ga0075366_10586154 3300006195 Bacteria 691
322 Ga0097621_100006734 3300006237 Bacteria 8163
323 Ga0097621_100022260 3300006237 Bacteria 4918
324 Ga0097621_100224534 3300006237 Bacteria 1638
325 Ga0097621_100275860 3300006237 Bacteria 1479
326 Ga0097621_100396668 3300006237 Bacteria 1235
327 Ga0075370_10000101 3300006353 Bacteria 27175
328 Ga0075370_10001469 3300006353 Bacteria 10255
329 Ga0075370_10002241 3300006353 Bacteria 8894
330 Ga0075370_10006236 3300006353 Bacteria 5981
331 Ga0075370_10007120 3300006353 Bacteria 5679
332 Ga0075370_10007736 3300006353 Bacteria 5487
333 Ga0075370_10009745 3300006353 Bacteria 5002
334 Ga0075370_10016095 3300006353 Bacteria 4019
335 Ga0075370_10058418 3300006353 Bacteria 2194
336 Ga0075370_10062392 3300006353 Bacteria 2123
337 Ga0075370_10064153 3300006353 Bacteria 2095
338 Ga0075370_10068296 3300006353 Bacteria 2030
339 Ga0075370_10144180 3300006353 Bacteria 1393
340 Ga0075370_10245908 3300006353 Bacteria 1060
341 Ga0068871_100012983 3300006358 Bacteria 6169
342 Ga0068871_100116623 3300006358 Bacteria 2251
343 Ga0068871_100206425 3300006358 Bacteria 1698
344 Ga0068871_100256037 3300006358 Bacteria 1526
345 Ga0068871_100387693 3300006358 Bacteria 1242
346 Ga0075434_100103811 3300006871 Bacteria 2851
347 Ga0068865_100031594 3300006881 Bacteria 3531
348 Ga0068865_100135512 3300006881 Bacteria 1850
349 Ga0068865_100162763 3300006881 Bacteria 1704
350 Ga0097620_100325492 3300006931 Bacteria 1631
351 Ga0097620_100435715 3300006931 Bacteria 1407
352 Ga0099823_1004645 3300006944 Bacteria 13490
353 Ga0079104_1000040 3300006946 Bacteria 187962
354 Ga0099826_10000510 3300006948 Bacteria 19067
355 Ga0099826_10130486 3300006948 Bacteria 1466
356 Ga0075435_100337081 3300007076 Bacteria 1292
357 Ga0105244_10003834 3300009036 Bacteria 10592
358 Ga0105244_10120607 3300009036 Bacteria 1270
359 Ga0105244_10179130 3300009036 Bacteria 1006
360 Ga0105240_10015568 3300009093 Bacteria 10336
361 Ga0105240_10032391 3300009093 Bacteria 6768
362 Ga0105240_10089902 3300009093 Bacteria 3754
363 Ga0105240_10196814 3300009093 Bacteria 2365
364 Ga0105240_10215319 3300009093 Bacteria 2241
365 Ga0105245_10045639 3300009098 Bacteria 3914
366 Ga0105245_10119233 3300009098 Bacteria 2463
367 Ga0105245_10129601 3300009098 Bacteria 2365
368 Ga0105245_10233131 3300009098 Bacteria 1781
369 Ga0105245_10762888 3300009098 Bacteria 1004
370 Ga0105247_10295951 3300009101 Bacteria 1121
371 Ga0105243_10000884 3300009148 Bacteria 28201
372 Ga0105243_10004307 3300009148 Bacteria 11266
373 Ga0105243_10005624 3300009148 Bacteria 9759
374 Ga0105243_10107881 3300009148 Bacteria 2323
375 Ga0105243_11391317 3300009148 Bacteria 722
376 Ga0105241_10294941 3300009174 Bacteria 1390
377 Ga0105241_10378064 3300009174 Bacteria 1237
378 Ga0105242_11495446 3300009176 Bacteria 706
379 Ga0105248_10016659 3300009177 Bacteria 8090
380 Ga0105248_10188936 3300009177 Bacteria 2321
381 Ga0105248_10205361 3300009177 Bacteria 2220
382 Ga0105248_10284097 3300009177 Bacteria 1863
383 Ga0105248_11334575 3300009177 Bacteria 811
384 Ga0105237_10018505 3300009545 Bacteria 7209
385 Ga0105237_10020678 3300009545 Bacteria 6778
386 Ga0105237_10030172 3300009545 Bacteria 5509
387 Ga0105237_10085132 3300009545 Bacteria 3151
388 Ga0105237_10520670 3300009545 Bacteria 1196
389 Ga0105238_10001855 3300009551 Bacteria 21183
390 Ga0105238_10129652 3300009551 Bacteria 2500
391 Ga0105238_10174918 3300009551 Bacteria 2123
392 Ga0105238_10859728 3300009551 Bacteria 924
393 Ga0105238_11113166 3300009551 Bacteria 813
394 Ga0105249_10118632 3300009553 Bacteria 2511
395 Ga0105249_10202009 3300009553 Bacteria 1945
396 Ga0105249_10527491 3300009553 Bacteria 1229
397 Ga0105249_12312655 3300009553 Bacteria 610
398 Ga0105239_10000531 3300010375 Bacteria 55121
399 Ga0105239_10050731 3300010375 Bacteria 4549
400 Ga0105239_10057462 3300010375 Bacteria 4268
401 Ga0105239_10208877 3300010375 Bacteria 2188
402 Ga0105239_10892832 3300010375 Bacteria 1020
403 Ga0105246_10016577 3300011119 Bacteria 4666
404 Ga0105246_10029657 3300011119 Bacteria 3604
405 Ga0105246_10659367 3300011119 Bacteria 912
406 Ga0105246_10771655 3300011119 Bacteria 850
407 Ga0157317_1007125 3300012475 Bacteria 796
408 Ga0157319_1000006 3300012497 Bacteria 361506
409 Ga0157347_1001297 3300012502 Bacteria 1933
410 Ga0157347_1039672 3300012502 Bacteria 618
411 Ga0157373_10012777 3300013100 Bacteria 6168
412 Ga0157373_10056085 3300013100 Bacteria 2798
413 Ga0157373_10058443 3300013100 Bacteria 2734
414 Ga0157373_10114794 3300013100 Bacteria 1893
415 Ga0157371_10000196 3300013102 Bacteria 89174
416 Ga0157371_10019220 3300013102 Bacteria 5041
417 Ga0157371_10044279 3300013102 Bacteria 3169
418 Ga0157371_10049015 3300013102 Bacteria 3001
419 Ga0157371_10696320 3300013102 Unclassified 760
420 Ga0157370_10278494 3300013104 Bacteria 1546
421 Ga0157369_10009831 3300013105 Bacteria 10931
422 Ga0157369_10015460 3300013105 Bacteria 8600
423 Ga0157369_10989011 3300013105 Bacteria 861
424 Ga0157374_10009658 3300013296 Bacteria 8284
425 Ga0157374_10140338 3300013296 Bacteria 2345
426 Ga0157378_11433377 3300013297 Bacteria 734
427 Ga0163162_10007486 3300013306 Bacteria 10624
428 Ga0163162_10056023 3300013306 Bacteria 3971
429 Ga0163162_10274617 3300013306 Bacteria 1817
430 Ga0157372_10156872 3300013307 Bacteria 2629
431 Ga0157375_10009460 3300013308 Bacteria 8557
432 Ga0157375_10138694 3300013308 Bacteria 2557
433 Ga0157375_10431437 3300013308 Bacteria 1484
434 Ga0163163_10722173 3300014325 Bacteria 1060
435 Ga0163163_10906929 3300014325 Bacteria 945
436 Ga0157380_10028623 3300014326 Bacteria 4251
437 Ga0157380_10220527 3300014326 Bacteria 1696
438 Ga0157380_10736337 3300014326 Bacteria 996
439 Ga0157380_11237216 3300014326 Bacteria 791
440 Ga0157380_11477709 3300014326 Unclassified 732
441 Ga0182008_10000250 3300014497 Bacteria 41652
442 Ga0182008_10000701 3300014497 Bacteria 24012
443 Ga0182008_10001970 3300014497 Bacteria 13184
444 Ga0182008_10006636 3300014497 Bacteria 6445
445 Ga0182008_10041550 3300014497 Bacteria 2294
446 Ga0182008_10067551 3300014497 Bacteria 1759
447 Ga0157377_10000022 3300014745 Bacteria 146702
448 Ga0157377_10041978 3300014745 Bacteria 2539
449 Ga0157377_10298578 3300014745 Bacteria 1062
450 Ga0157379_10010369 3300014968 Bacteria 8119
451 Ga0157379_10054527 3300014968 Bacteria 3572
452 Ga0157379_10123351 3300014968 Bacteria 2331
453 Ga0157379_10414611 3300014968 Bacteria 1240
454 Ga0157376_10005027 3300014969 Bacteria 9221
455 Ga0157376_10049020 3300014969 Bacteria 3497
456 Ga0157376_10242960 3300014969 Bacteria 1678
457 Ga0157376_10965693 3300014969 Bacteria 873
458 Ga0157376_10982276 3300014969 Bacteria 866
459 Ga0182006_1001323 3300015261 Bacteria 15192
460 Ga0182006_1016882 3300015261 Bacteria 3110
461 Ga0182006_1088819 3300015261 Bacteria 1115
462 Ga0182007_10001221 3300015262 Bacteria 13945
463 Ga0182005_1129294 3300015265 Bacteria 724
464 Ga0163161_10000332 3300017792 Bacteria 40315
465 Ga0163161_10003912 3300017792 Bacteria 10448
466 Ga0163161_10023778 3300017792 Bacteria 4325
467 Ga0163161_10110606 3300017792 Bacteria 2054
468 Ga0163161_10164994 3300017792 Bacteria 1691
469 Ga0163161_10277537 3300017792 Bacteria 1313
470 Ga0163161_10336175 3300017792 Bacteria 1197
471 Ga0213872_10000046 3300021361 Bacteria 109934
472 Ga0213872_10046241 3300021361 Bacteria 1981
473 Ga0209436_116173 3300025208 Bacteria 1127
474 Ga0209674_115250 3300025226 Bacteria 666
475 Ga0209672_100443 3300025228 Bacteria 23461
476 Ga0209147_101320 3300025229 Bacteria 9527
477 Ga0209563_100005 3300025230 Bacteria 1774893
478 Ga0209258_100009 3300025242 Bacteria 996276
479 Ga0207425_1000977 3300025245 Bacteria 13474
480 Ga0207425_1001646 3300025245 Bacteria 8994
481 Ga0209148_1000007 3300025254 Bacteria 1592273
482 Ga0209129_1000013 3300025258 Bacteria 524874
483 Ga0209129_1000124 3300025258 Bacteria 133610
484 Ga0209129_1002210 3300025258 Bacteria 9762
485 Ga0209565_1000138 3300025263 Bacteria 101729
486 Ga0209565_1000243 3300025263 Bacteria 58571
487 Ga0209565_1000880 3300025263 Bacteria 16517
488 Ga0209673_1000064 3300025273 Bacteria 254712
489 Ga0209673_1000188 3300025273 Bacteria 124010
490 Ga0209673_1000260 3300025273 Bacteria 99762
491 Ga0209673_1001331 3300025273 Bacteria 24714
492 Ga0209673_1004340 3300025273 Bacteria 7638
493 Ga0209673_1013941 3300025273 Bacteria 3141
494 Ga0209673_1037488 3300025273 Bacteria 1424
495 Ga0209130_1000705 3300025284 Bacteria 29919
496 Ga0209130_1001526 3300025284 Bacteria 14840
497 Ga0209130_1002187 3300025284 Bacteria 10307
498 Ga0209130_1078882 3300025284 Bacteria 534
499 Ga0209675_1000036 3300025291 Bacteria 254712
500 Ga0209675_1000086 3300025291 Bacteria 151270
501 Ga0209675_1001070 3300025291 Bacteria 16954
502 Ga0209675_1004601 3300025291 Bacteria 6073
503 Ga0209675_1006645 3300025291 Bacteria 4598
504 Ga0209675_1024852 3300025291 Bacteria 1522
505 Ga0209676_1000004 3300025292 Bacteria 1138360
506 Ga0209676_1000105 3300025292 Bacteria 224151
507 Ga0209676_1000287 3300025292 Bacteria 103263
508 Ga0209676_1001896 3300025292 Bacteria 17054
509 Ga0209676_1003856 3300025292 Bacteria 8773
510 Ga0209676_1007209 3300025292 Bacteria 5292
511 Ga0209025_1000168 3300025294 Bacteria 162386
512 Ga0209025_1000220 3300025294 Bacteria 136977
513 Ga0209025_1001388 3300025294 Bacteria 32345
514 Ga0209025_1019541 3300025294 Bacteria 3762
515 Ga0209025_1020869 3300025294 Bacteria 3555
516 Ga0209025_1047983 3300025294 Bacteria 1737
517 Ga0209564_1000005 3300025295 Bacteria 1147192
518 Ga0209564_1000057 3300025295 Bacteria 340400
519 Ga0209564_1000222 3300025295 Bacteria 129405
520 Ga0209564_1000287 3300025295 Bacteria 102328
521 Ga0209758_1000134 3300025297 Bacteria 178294
522 Ga0209758_1000214 3300025297 Bacteria 126364
523 Ga0209758_1020433 3300025297 Bacteria 3133
524 Ga0209758_1144446 3300025297 Bacteria 612
525 Ga0209050_1000002 3300025298 Bacteria 1792849
526 Ga0209050_1000009 3300025298 Bacteria 1047265
527 Ga0209050_1000405 3300025298 Bacteria 80464
528 Ga0209050_1001962 3300025298 Bacteria 19466
529 Ga0209050_1002535 3300025298 Bacteria 15275
530 Ga0209050_1005672 3300025298 Bacteria 7724
531 Ga0209050_1014743 3300025298 Bacteria 3339
532 Ga0209050_1015584 3300025298 Bacteria 3179
533 Ga0209050_1028919 3300025298 Bacteria 1786
534 Ga0209256_1000053 3300025299 Bacteria 298731
535 Ga0209256_1000060 3300025299 Bacteria 262342
536 Ga0209256_1000113 3300025299 Bacteria 175296
537 Ga0209256_1000222 3300025299 Bacteria 105596
538 Ga0209256_1000529 3300025299 Bacteria 55351
539 Ga0209256_1030295 3300025299 Bacteria 1495
540 Ga0207426_1000095 3300025302 Bacteria 274234
541 Ga0207426_1000100 3300025302 Bacteria 262342
542 Ga0209051_1000002 3300025303 Bacteria 1631846
543 Ga0209051_1000008 3300025303 Bacteria 706935
544 Ga0209051_1000020 3300025303 Bacteria 508628
545 Ga0209051_1000064 3300025303 Bacteria 231735
546 Ga0209051_1000248 3300025303 Bacteria 91104
547 Ga0209051_1000473 3300025303 Bacteria 52277
548 Ga0209051_1005090 3300025303 Bacteria 7813
549 Ga0209051_1008691 3300025303 Bacteria 5346
550 Ga0209051_1021829 3300025303 Bacteria 2712
551 Ga0209051_1023298 3300025303 Bacteria 2579
552 Ga0209257_1000002 3300025304 Bacteria 1767052
553 Ga0209257_1000085 3300025304 Bacteria 291117
554 Ga0209257_1000109 3300025304 Bacteria 239439
555 Ga0209257_1000286 3300025304 Bacteria 111738
556 Ga0209257_1000372 3300025304 Bacteria 90110
557 Ga0209257_1003016 3300025304 Bacteria 15235
558 Ga0209257_1006120 3300025304 Bacteria 7980
559 Ga0209257_1006977 3300025304 Bacteria 7033
560 Ga0209257_1013149 3300025304 Bacteria 3719
561 Ga0209257_1023588 3300025304 Bacteria 2158
562 Ga0207697_10003968 3300025315 Bacteria 7191
563 Ga0207697_10036931 3300025315 Bacteria 2001
564 Ga0207656_10003839 3300025321 Bacteria 5207
565 Ga0207656_10043077 3300025321 Bacteria 1924
566 Ga0207655_1005321 3300025728 Bacteria 8798
567 Ga0207682_10001045 3300025893 Bacteria 12770
568 Ga0207682_10023398 3300025893 Bacteria 2440
569 Ga0207682_10049500 3300025893 Bacteria 1735
570 Ga0207682_10053950 3300025893 Bacteria 1669
571 Ga0207682_10117120 3300025893 Bacteria 1178
572 Ga0207710_10449888 3300025900 Unclassified 665
573 Ga0207688_10111235 3300025901 Bacteria 1590
574 Ga0207688_10136576 3300025901 Bacteria 1440
575 Ga0207688_10317751 3300025901 Bacteria 955
576 Ga0207680_10449111 3300025903 Bacteria 915
577 Ga0207685_10119294 3300025905 Bacteria 1155
578 Ga0207645_10005684 3300025907 Bacteria 9010
579 Ga0207645_10005861 3300025907 Bacteria 8853
580 Ga0207645_10027329 3300025907 Bacteria 3685
581 Ga0207645_10077274 3300025907 Bacteria 2133
582 Ga0207645_10282969 3300025907 Bacteria 1101
583 Ga0207645_10299197 3300025907 Bacteria 1071
584 Ga0207645_10337932 3300025907 Bacteria 1006
585 Ga0207645_10647845 3300025907 Bacteria 718
586 Ga0207643_10020521 3300025908 Bacteria 3627
587 Ga0207643_10170068 3300025908 Bacteria 1315
588 Ga0207705_10183502 3300025909 Bacteria 1580
589 Ga0207705_10886138 3300025909 Bacteria 691
590 Ga0207684_10023526 3300025910 Bacteria 5261
591 Ga0207654_10292619 3300025911 Bacteria 1105
592 Ga0207695_10104516 3300025913 Bacteria 2821
593 Ga0207671_10080363 3300025914 Bacteria 2444
594 Ga0207671_10326508 3300025914 Bacteria 1215
595 Ga0207662_10099997 3300025918 Bacteria 1796
596 Ga0207662_10233549 3300025918 Bacteria 1202
597 Ga0207657_10051902 3300025919 Bacteria 3562
598 Ga0207657_10128705 3300025919 Bacteria 2077
599 Ga0207649_10163293 3300025920 Bacteria 1545
600 Ga0207649_10222314 3300025920 Bacteria 1346
601 Ga0207649_10225487 3300025920 Bacteria 1337
602 Ga0207649_10229311 3300025920 Bacteria 1327
603 Ga0207649_10231166 3300025920 Bacteria 1322
604 Ga0207646_10205803 3300025922 Bacteria 1777
605 Ga0207681_10005176 3300025923 Bacteria 8010
606 Ga0207681_10103784 3300025923 Bacteria 2055
607 Ga0207681_10256964 3300025923 Bacteria 1366
608 Ga0207681_10506969 3300025923 Bacteria 989
609 Ga0207681_10652647 3300025923 Bacteria 872
610 Ga0207681_10751564 3300025923 Unclassified 813
611 Ga0207694_10038457 3300025924 Bacteria 3679
612 Ga0207694_10147242 3300025924 Bacteria 1896
613 Ga0207650_10011652 3300025925 Bacteria 6058
614 Ga0207650_10037756 3300025925 Bacteria 3522
615 Ga0207650_10471978 3300025925 Bacteria 1046
616 Ga0207650_10490911 3300025925 Unclassified 1025
617 Ga0207659_10000118 3300025926 Bacteria 46531
618 Ga0207659_10005215 3300025926 Bacteria 7866
619 Ga0207659_10048380 3300025926 Bacteria 3012
620 Ga0207659_10056916 3300025926 Bacteria 2801
621 Ga0207659_10356689 3300025926 Bacteria 1214
622 Ga0207687_10149565 3300025927 Bacteria 1780
623 Ga0207687_10205014 3300025927 Bacteria 1544
624 Ga0207687_10292861 3300025927 Bacteria 1309
625 Ga0207644_10035212 3300025931 Bacteria 3506
626 Ga0207644_10230856 3300025931 Bacteria 1470
627 Ga0207644_10804657 3300025931 Bacteria 786
628 Ga0207690_10031790 3300025932 Bacteria 3381
629 Ga0207690_10430994 3300025932 Bacteria 1056
630 Ga0207706_10000933 3300025933 Bacteria 29885
631 Ga0207706_10020371 3300025933 Bacteria 5962
632 Ga0207706_10029788 3300025933 Bacteria 4871
633 Ga0207706_10062210 3300025933 Bacteria 3287
634 Ga0207706_10136423 3300025933 Bacteria 2158
635 Ga0207706_10137030 3300025933 Bacteria 2153
636 Ga0207686_10865575 3300025934 Bacteria 728
637 Ga0207709_10000604 3300025935 Bacteria 29795
638 Ga0207709_10014639 3300025935 Bacteria 4335
639 Ga0207709_10086087 3300025935 Bacteria 2039
640 Ga0207709_10593571 3300025935 Bacteria 876
641 Ga0207670_10993188 3300025936 Bacteria 706
642 Ga0207669_10000706 3300025937 Bacteria 14412
643 Ga0207669_10237670 3300025937 Bacteria 1348
644 Ga0207669_10244550 3300025937 Bacteria 1332
645 Ga0207669_11726594 3300025937 Bacteria 535
646 Ga0207704_10052541 3300025938 Bacteria 2471
647 Ga0207704_10700234 3300025938 Bacteria 839
648 Ga0207691_10000238 3300025940 Bacteria 53833
649 Ga0207691_10008515 3300025940 Bacteria 9852
650 Ga0207691_10041323 3300025940 Bacteria 4258
651 Ga0207691_10067518 3300025940 Bacteria 3233
652 Ga0207691_10108789 3300025940 Bacteria 2467
653 Ga0207691_10130114 3300025940 Bacteria 2224
654 Ga0207691_11231152 3300025940 Bacteria 620
655 Ga0207711_10046230 3300025941 Bacteria 3719
656 Ga0207711_10118967 3300025941 Bacteria 2357
657 Ga0207711_10293458 3300025941 Bacteria 1499
658 Ga0207689_10000150 3300025942 Bacteria 60037
659 Ga0207689_10015594 3300025942 Bacteria 6436
660 Ga0207689_10241497 3300025942 Bacteria 1493
661 Ga0207661_11332258 3300025944 Unclassified 659
662 Ga0207679_10069210 3300025945 Bacteria 2655
663 Ga0207679_10186959 3300025945 Bacteria 1719
664 Ga0207679_10254378 3300025945 Bacteria 1495
665 Ga0207667_10014800 3300025949 Bacteria 8875
666 Ga0207667_10361165 3300025949 Bacteria 1481
667 Ga0207651_10001131 3300025960 Bacteria 11895
668 Ga0207651_10018228 3300025960 Bacteria 4171
669 Ga0207651_10036335 3300025960 Bacteria 3214
670 Ga0207651_10707367 3300025960 Bacteria 888
671 Ga0207651_11044116 3300025960 Unclassified 731
672 Ga0207712_10203261 3300025961 Bacteria 1572
673 Ga0207712_11082470 3300025961 Bacteria 713
674 Ga0207668_10147265 3300025972 Bacteria 1818
675 Ga0207668_10151195 3300025972 Bacteria 1797
676 Ga0207640_10016633 3300025981 Bacteria 4284
677 Ga0207640_10017371 3300025981 Bacteria 4209
678 Ga0207640_10061385 3300025981 Bacteria 2490
679 Ga0207640_10150578 3300025981 Bacteria 1709
680 Ga0207640_10478832 3300025981 Bacteria 1032
681 Ga0207640_11039078 3300025981 Bacteria 722
682 Ga0207640_11525890 3300025981 Bacteria 601
683 Ga0207658_10159894 3300025986 Bacteria 1845
684 Ga0207658_10525012 3300025986 Bacteria 1057
685 Ga0207658_10740407 3300025986 Bacteria 890
686 Ga0207658_10917625 3300025986 Bacteria 798
687 Ga0207677_10012436 3300026023 Bacteria 4893
688 Ga0207677_10252983 3300026023 Bacteria 1432
689 Ga0207677_10422517 3300026023 Bacteria 1136
690 Ga0207677_10516605 3300026023 Bacteria 1035
691 Ga0207703_10030559 3300026035 Bacteria 4258
692 Ga0207703_10047106 3300026035 Bacteria 3475
693 Ga0207703_11234687 3300026035 Unclassified 719
694 Ga0207639_10031874 3300026041 Bacteria 3876
695 Ga0207639_10053565 3300026041 Bacteria 3079
696 Ga0207639_10097704 3300026041 Bacteria 2365
697 Ga0207639_10139452 3300026041 Bacteria 2018
698 Ga0207639_10140530 3300026041 Bacteria 2011
699 Ga0207639_10317765 3300026041 Bacteria 1382
700 Ga0207639_10372054 3300026041 Bacteria 1281
701 Ga0207639_10747635 3300026041 Bacteria 909
702 Ga0207678_10002944 3300026067 Bacteria 15425
703 Ga0207678_10170607 3300026067 Bacteria 1857
704 Ga0207678_10251494 3300026067 Bacteria 1513
705 Ga0207702_10329396 3300026078 Bacteria 1456
706 Ga0207641_10053797 3300026088 Bacteria 3414
707 Ga0207641_10070146 3300026088 Bacteria 3011
708 Ga0207641_10088799 3300026088 Bacteria 2700
709 Ga0207641_10164319 3300026088 Bacteria 2020
710 Ga0207641_11345274 3300026088 Bacteria 715
711 Ga0207648_10000032 3300026089 Bacteria 128009
712 Ga0207648_10001012 3300026089 Bacteria 31652
713 Ga0207648_10003526 3300026089 Bacteria 16384
714 Ga0207648_10055085 3300026089 Bacteria 3472
715 Ga0207648_10067687 3300026089 Bacteria 3113
716 Ga0207648_10263659 3300026089 Bacteria 1538
717 Ga0207648_10387825 3300026089 Bacteria 1264
718 Ga0207648_11352588 3300026089 Bacteria 669
719 Ga0207676_10025653 3300026095 Bacteria 4375
720 Ga0207676_10032796 3300026095 Bacteria 3918
721 Ga0207676_10181228 3300026095 Bacteria 1844
722 Ga0207676_10272993 3300026095 Bacteria 1532
723 Ga0207674_10020946 3300026116 Bacteria 7053
724 Ga0207674_10023098 3300026116 Bacteria 6669
725 Ga0207674_10041822 3300026116 Bacteria 4737
726 Ga0207674_10189806 3300026116 Bacteria 2005
727 Ga0207674_10589646 3300026116 Bacteria 1074
728 Ga0207675_100001131 3300026118 Bacteria 26465
729 Ga0207675_100734278 3300026118 Bacteria 998
730 Ga0207683_10013866 3300026121 Bacteria 6873
731 Ga0207683_10034729 3300026121 Bacteria 4383
732 Ga0207683_10064766 3300026121 Bacteria 3222
733 Ga0207683_10102351 3300026121 Bacteria 2557
734 Ga0207683_10122058 3300026121 Bacteria 2340
735 Ga0207683_10172376 3300026121 Bacteria 1960
736 Ga0207683_10315112 3300026121 Bacteria 1432
737 Ga0207683_10707199 3300026121 Bacteria 934
738 Ga0207683_10949912 3300026121 Bacteria 798
739 Ga0207683_12004388 3300026121 Bacteria 527
740 Ga0207698_10007726 3300026142 Bacteria 6747
741 Ga0207698_10016066 3300026142 Bacteria 5035
742 Ga0207698_10054479 3300026142 Bacteria 3077
743 Ga0207698_10315874 3300026142 Bacteria 1461
744 Ga0207698_11134620 3300026142 Bacteria 795
745 Ga0207698_11167246 3300026142 Bacteria 784
746 Ga0209281_1000074 3300027111 Bacteria 267848
747 Ga0209389_1038041 3300027296 Bacteria 3801
748 Ga0209371_1000940 3300027312 Bacteria 22736
749 Ga0209371_1028280 3300027312 Bacteria 1252
750 Ga0209282_1025173 3300027666 Bacteria 3724
751 Ga0209813_10027757 3300027866 Bacteria 1646
752 Ga0209813_10050527 3300027866 Bacteria 1298
753 Ga0209974_10002843 3300027876 Bacteria 6283
754 Ga0207428_10229984 3300027907 Bacteria 1388
755 Ga0207428_10432644 3300027907 Bacteria 961
756 Ga0268266_10159657 3300028379 Bacteria 2038
757 Ga0268266_10428228 3300028379 Bacteria 1255
758 Ga0268265_10006770 3300028380 Bacteria 7753
759 Ga0268265_10025277 3300028380 Bacteria 4213
760 Ga0268265_10524472 3300028380 Bacteria 1120
761 Ga0268265_10560735 3300028380 Bacteria 1086
762 Ga0268264_10080643 3300028381 Bacteria 2779
763 Ga0268264_10451274 3300028381 Bacteria 1246
764 Ga0268264_12228741 3300028381 Bacteria 555
765 Ga0265334_10044721 3300028573 Bacteria 1718
766 Ga0307517_10000810 3300028786 Bacteria 53724
767 Ga0307517_10239786 3300028786 Bacteria 1077
768 Ga0307515_10009904 3300028794 Bacteria 18355
769 Ga0307515_10011118 3300028794 Bacteria 17118
770 Ga0307515_10039228 3300028794 Bacteria 7541
771 Ga0307515_10184870 3300028794 Bacteria 2018
772 Ga0307515_10268025 3300028794 Bacteria 1433
773 Ga0307515_10385571 3300028794 Bacteria 1032
774 Ga0268256_1000839 3300030500 Bacteria 21805
775 Ga0268256_1032192 3300030500 Bacteria 1252
776 Ga0307512_10069362 3300030522 Bacteria 2636
777 Ga0307512_10225449 3300030522 Bacteria 972
778 Ga0307512_10291665 3300030522 Bacteria 769
779 Ga0316177_1126994 3300030731 Bacteria 3064
780 Ga0316177_1220430 3300030731 Bacteria 1092
781 Ga0314311_1074524 3300030733 Bacteria 9216
782 Ga0316179_1073255 3300030734 Bacteria 4927
783 Ga0316180_1159712 3300030736 Bacteria 1296
784 Ga0316183_1087890 3300030742 Bacteria 14196
785 Ga0316182_1123892 3300030745 Bacteria 4299
786 Ga0265330_10000054 3300031235 Bacteria 101420
787 Ga0265332_10000002 3300031238 Bacteria 709510
788 Ga0265328_10017411 3300031239 Bacteria 2783
789 Ga0265325_10003978 3300031241 Bacteria 9458
790 Ga0265331_10001984 3300031250 Bacteria 14290
791 Ga0265327_10000028 3300031251 Bacteria 361066
792 Ga0265327_10000186 3300031251 Bacteria 131420
793 Ga0307513_10004294 3300031456 Bacteria 19052
794 Ga0307513_10026047 3300031456 Bacteria 6753
795 Ga0307513_10318603 3300031456 Bacteria 1314
796 Ga0307509_10000802 3300031507 Bacteria 53907
797 Ga0307509_10016656 3300031507 Bacteria 8496
798 Ga0307509_10050016 3300031507 Bacteria 4477
799 Ga0307509_10051400 3300031507 Bacteria 4408
800 Ga0307509_10177394 3300031507 Bacteria 2001
801 Ga0307509_10475168 3300031507 Bacteria 939
802 Ga0307408_100039175 3300031548 Bacteria 3348
803 Ga0307408_100196529 3300031548 Bacteria 1629
804 Ga0307408_100316603 3300031548 Bacteria 1313
805 Ga0307408_100369862 3300031548 Bacteria 1222
806 Ga0307408_100997816 3300031548 Bacteria 771
807 Ga0307408_101718117 3300031548 Bacteria 598
808 Ga0307408_101898828 3300031548 Bacteria 571
809 Ga0307508_10000194 3300031616 Bacteria 73425
810 Ga0307508_10005253 3300031616 Bacteria 12357
811 Ga0307508_10130809 3300031616 Bacteria 2113
812 Ga0307508_10333326 3300031616 Bacteria 1109
813 Ga0307514_10011053 3300031649 Bacteria 7521
814 Ga0307514_10094556 3300031649 Bacteria 2166
815 Ga0307514_10205143 3300031649 Bacteria 1232
816 Ga0265314_10000012 3300031711 Bacteria 415184
817 Ga0265314_10356704 3300031711 Bacteria 803
818 Ga0307516_10118500 3300031730 Bacteria 2441
819 Ga0307516_10190729 3300031730 Bacteria 1776
820 Ga0307516_10193842 3300031730 Bacteria 1756
821 Ga0307516_10208068 3300031730 Bacteria 1672
822 Ga0307516_10238369 3300031730 Bacteria 1518
823 Ga0307516_10349510 3300031730 Bacteria 1144
824 Ga0307405_10049069 3300031731 Bacteria 2607
825 Ga0307405_10100216 3300031731 Bacteria 1941
826 Ga0307405_10118214 3300031731 Bacteria 1809
827 Ga0307405_10138418 3300031731 Bacteria 1693
828 Ga0307405_10247467 3300031731 Bacteria 1324
829 Ga0307405_10439685 3300031731 Bacteria 1031
830 Ga0307405_10682739 3300031731 Bacteria 848
831 Ga0307413_10420255 3300031824 Bacteria 1053
832 Ga0307413_10431007 3300031824 Bacteria 1041
833 Ga0307413_10982182 3300031824 Bacteria 723
834 Ga0307410_10105384 3300031852 Bacteria 2030
835 Ga0307410_10119839 3300031852 Bacteria 1917
836 Ga0307410_10183324 3300031852 Bacteria 1586
837 Ga0307406_10000467 3300031901 Bacteria 23358
838 Ga0307406_10001774 3300031901 Bacteria 11791
839 Ga0307406_10027772 3300031901 Bacteria 3413
840 Ga0307406_10289780 3300031901 Bacteria 1253
841 Ga0307407_10039868 3300031903 Bacteria 2615
842 Ga0307407_10224521 3300031903 Bacteria 1272
843 Ga0307407_10543428 3300031903 Bacteria 858
844 Ga0307412_10012955 3300031911 Bacteria 4876
845 Ga0307412_10045997 3300031911 Bacteria 2856
846 Ga0307412_10190949 3300031911 Bacteria 1548
847 Ga0307412_10247660 3300031911 Bacteria 1382
848 Ga0307412_10251851 3300031911 Bacteria 1371
849 Ga0307412_10947294 3300031911 Bacteria 757
850 Ga0307409_100592030 3300031995 Bacteria 1095
851 Ga0307416_100070299 3300032002 Bacteria 2902
852 Ga0307416_100387377 3300032002 Bacteria 1430
853 Ga0307416_100566115 3300032002 Bacteria 1212
854 Ga0307416_100733494 3300032002 Bacteria 1079
855 Ga0307414_10518330 3300032004 Bacteria 1058
856 Ga0307414_10817313 3300032004 Bacteria 851
857 Ga0307414_11178332 3300032004 Unclassified 709
858 Ga0307411_10002725 3300032005 Bacteria 7925
859 Ga0307411_10406528 3300032005 Bacteria 1127
860 Ga0307411_10505469 3300032005 Bacteria 1022
861 Ga0307411_11029771 3300032005 Bacteria 738
862 Ga0307411_11304708 3300032005 Bacteria 661
863 Ga0307415_100908705 3300032126 Bacteria 812
864 Ga0307507_10098176 3300033179 Bacteria 2467
865 Ga0307510_10005587 3300033180 Bacteria 14987
866 Ga0307510_10030202 3300033180 Bacteria 6147
867 Ga0307510_10092631 3300033180 Bacteria 2857
868 Ga0307510_10115678 3300033180 Bacteria 2406
869 Ga0307510_10310134 3300033180 Bacteria 1037
870 Ga0307510_10407232 3300033180 Bacteria 803
871 Ga0373930_0016597 3300034816 Bacteria 1395
872 Ga0373928_0008445 3300035084 Bacteria 2000
873 Ga0373944_0297103 3300035089 Bacteria 605
874 Ga0373952_0070021 3300035092 Bacteria 875
875 Ga0373932_0040311 3300035112 Bacteria 1344
876 Ga0373941_0005075 3300035115 Bacteria 3075
877 Ga0373953_0099209 3300035117 Bacteria 1225
878 Ga0373943_0429900 3300035170 Bacteria 765
879 Ga0373955_0841147 3300035172 Bacteria 564
880 Ga0373931_0089697 3300035691 Bacteria 1711
881 Ga0373931_0120245 3300035691 Bacteria 1500
882 Ga0373935_0951774 3300035692 Bacteria 637
883 Ga0373947_0698279 3300035725 Bacteria 692
884 Ga0373937_0381968 3300036401 Bacteria 1336
885 Ga0373937_0584925 3300036401 Bacteria 1060
886 Ga0373937_0713287 3300036401 Bacteria 950
887 Ga0373925_0133930 3300037068 Bacteria 1935
888 Ga0373925_0191014 3300037068 Bacteria 1625
889 Ga0373925_0461333 3300037068 Bacteria 1041
890 Ga0395899_0287566 3300037312 Bacteria 1116
891 Ga0395905_0849440 3300037471 Bacteria 816
892 Ga0395901_1034261 3300038443 Bacteria 795
893 Ga0436365_0773501 3300039437 Bacteria 711
894 Ga0436361_0034970 3300039447 Bacteria 88532
895 Ga0436361_0633280 3300039447 Bacteria 103480
896 Ga0436361_0844177 3300039447 Bacteria 5839
897 Ga0436363_0379139 3300039450 Bacteria 1059
898 Ga0436363_1119806 3300039450 Bacteria 782
899 Ga0439447_075986 3300041407 Bacteria 777
900 Ga0451787_615507 3300041441 Bacteria 529
901 Ga0451789_0617931 3300041443 Bacteria 734
902 Ga0451793_0053218 3300041452 Bacteria 764
903 Ga0451793_0124301 3300041452 Bacteria 721
904 Ga0451793_1115609 3300041452 Bacteria 1591
905 Ga0451795_0623483 3300041456 Bacteria 653
906 Ga0451795_1050550 3300041456 Bacteria 703
907 Ga0451800_0822228 3300041459 Bacteria 835
908 Ga0451800_0963213 3300041459 Bacteria 715
909 Ga0451802_0061791 3300041460 Bacteria 530
910 Ga0451802_0401206 3300041460 Bacteria 900
911 Ga0451833_1010680 3300041491 Bacteria 1352
912 Ga0451835_0116812 3300041492 Bacteria 538
913 Ga0451839_0760707 3300041496 Bacteria 2250
914 Ga0451841_0569011 3300041498 Bacteria 1245
915 Ga0451849_1279070 3300041505 Bacteria 903
916 Ga0451843_1517086 3300041509 Bacteria 604
917 Ga0439431_0000116 3300041997 Bacteria 13851
918 Ga0439445_0009703 3300042004 Bacteria 2270
919 Ga0439432_000593 3300042006 Bacteria 13693
920 Ga0439450_017429 3300042008 Bacteria 1497
921 Ga0439451_003517 3300042009 Bacteria 3177
922 Ga0439452_005477 3300042010 Bacteria 4083
923 Ga0439454_012713 3300042011 Bacteria 1145
924 Ga0439463_020904 3300042016 Bacteria 1633
925 Ga0450911_000399 3300042115 Bacteria 14340
926 Ga0450915_004706 3300042119 Bacteria 818
927 Ga0450920_037126 3300042122 Bacteria 967
928 Ga0450890_000920 3300042127 Bacteria 4254
929 Ga0450900_040229 3300042136 Bacteria 698
930 Ga0439446_0008647 3300042156 Bacteria 2710
931 Ga0439446_0097197 3300042156 Bacteria 928
932 Ga0439460_0006452 3300042461 Bacteria 2911
933 Ga0450918_000026 3300042531 Bacteria 30691
934 Ga0450893_0023579 3300042532 Bacteria 1071
935 Ga0451577_0038274 3300042876 Bacteria 4314
936 Ga0451577_0501386 3300042876 Bacteria 1102
937 Ga0453683_0073668 3300044673 Bacteria 2138
938 Ga0466965_0308511 3300044683 Bacteria 860
939 Ga0466961_0127635 3300044693 Bacteria 1595
940 Ga0466963_0314390 3300044694 Bacteria 1102
941 Ga0453684_0107051 3300044712 Bacteria 3406
942 Ga0451576_0167326 3300045051 Bacteria 2294
943 Ga0451576_0301054 3300045051 Bacteria 1677
944 Ga0495627_035541 3300046453 Bacteria 1552
945 Ga0495592_0000272 3300046454 Bacteria 44189
946 Ga0495590_0314865 3300046457 Bacteria 590
947 Ga0495629_0311230 3300046459 Bacteria 1077
948 Ga0495629_0667629 3300046459 Bacteria 692
949 Ga0495638_0035673 3300046460 Bacteria 3169
950 Ga0495638_0092883 3300046460 Bacteria 1816
951 Ga0495650_0005914 3300046471 Bacteria 7773
952 Ga0495650_0013812 3300046471 Bacteria 4246
953 Ga0495582_0711454 3300046473 Bacteria 581
954 Ga0495583_0044197 3300046506 Bacteria 2069
955 Ga0495583_0353486 3300046506 Bacteria 580
956 Ga0495610_0015357 3300046512 Bacteria 4454
957 Ga0495610_0078883 3300046512 Bacteria 1517
958 Ga0495610_0113459 3300046512 Bacteria 1197
959 Ga0495616_0000346 3300046513 Bacteria 36668
960 Ga0495620_0044562 3300046515 Bacteria 1927
961 Ga0495620_0145009 3300046515 Bacteria 927
962 Ga0495630_0157955 3300046517 Bacteria 1726
963 Ga0495630_1217335 3300046517 Bacteria 569
964 Ga0495631_0000146 3300046518 Bacteria 48263
965 Ga0495632_0011776 3300046519 Bacteria 5090
966 Ga0495632_0423259 3300046519 Bacteria 580
967 Ga0495637_0012308 3300046520 Bacteria 4096
968 Ga0495643_0036252 3300046522 Bacteria 2711
969 Ga0495648_0118920 3300046524 Bacteria 1424
970 Ga0495648_0216473 3300046524 Bacteria 948
971 Ga0495666_0097531 3300046526 Bacteria 1386
972 Ga0495666_0419794 3300046526 Bacteria 600
973 Ga0495642_0121231 3300046528 Bacteria 1122
974 Ga0495654_0068165 3300046530 Bacteria 1691
975 Ga0495654_0128131 3300046530 Bacteria 1142
976 Ga0495586_0160408 3300046535 Bacteria 1268
977 Ga0495609_0041124 3300046538 Bacteria 2079
978 Ga0495621_0004688 3300046539 Bacteria 3869
979 Ga0495621_0147525 3300046539 Bacteria 924
980 Ga0495622_0123800 3300046557 Bacteria 1180
981 Ga0495668_0066901 3300046616 Bacteria 1977
982 Ga0495668_0191610 3300046616 Bacteria 1120
983 Ga0495611_0043832 3300046648 Bacteria 2001
984 Ga0495625_0000254 3300046660 Bacteria 83637
985 Ga0495625_0006631 3300046660 Bacteria 10274
986 Ga0495625_0025317 3300046660 Bacteria 4501
987 Ga0495625_0075490 3300046660 Bacteria 2358
988 Ga0495625_0328567 3300046660 Bacteria 972
989 Ga0495635_0760595 3300046663 Bacteria 626
990 Ga0495661_0107487 3300046665 Bacteria 1559
991 Ga0495588_0128275 3300046674 Bacteria 1338
992 Ga0495588_0540591 3300046674 Bacteria 610
993 Ga0495647_0091643 3300046681 Bacteria 1247
994 Ga0495658_0052799 3300046683 Bacteria 2306
995 Ga0495658_0062321 3300046683 Bacteria 2144
996 Ga0495658_0611030 3300046683 Bacteria 698
997 Ga0495624_0474773 3300046690 Bacteria 749
998 Ga0495670_0097284 3300046691 Bacteria 1512
999 Ga0495670_0105937 3300046691 Bacteria 1452
1000 Ga0495670_0160628 3300046691 Bacteria 1180
1001 Ga0495671_0001736 3300046692 Bacteria 14135
1002 Ga0495671_0234578 3300046692 Bacteria 887
1003 Ga0495671_0239191 3300046692 Bacteria 877
1004 Ga0495649_0013683 3300046694 Bacteria 4676
1005 Ga0495589_0280505 3300046794 Bacteria 775
1006 Ga0495660_0034709 3300046810 Bacteria 2821
1007 Ga0495674_0999092 3300047319 Bacteria 641
1008 Ga0495676_0090056 3300047321 Bacteria 2297
1009 Ga0495676_0442978 3300047321 Bacteria 857
1010 Ga0495680_0234393 3300047322 Bacteria 1306
1011 Ga0495687_022632 3300047443 Bacteria 3013
1012 Ga0495687_032090 3300047443 Bacteria 2402
1013 Ga0495684_0110443 3300047471 Bacteria 2075
1014 Ga0495686_0103310 3300047472 Bacteria 1717
1015 Ga0495686_0209643 3300047472 Bacteria 1114
1016 Ga0495593_0003398 3300047673 Bacteria 9538
1017 Ga0495593_0092334 3300047673 Bacteria 1558
1018 Ga0495614_0004586 3300048089 Bacteria 6222
1019 Ga0495615_0093810 3300048090 Bacteria 840
1020 Ga0496100_0123007 3300048903 Bacteria 1818
1021 Ga0496101_0004342 3300048904 Bacteria 8896
1022 Ga0496101_0436825 3300048904 Bacteria 1032
1023 Ga0496101_0575468 3300048904 Bacteria 891
1024 Ga0496102_0015772 3300048905 Bacteria 6585
1025 Ga0496102_0571414 3300048905 Bacteria 1053
1026 Ga0496103_0718219 3300048906 Bacteria 633
1027 Ga0496104_0090739 3300048907 Bacteria 2920
1028 Ga0496104_0127565 3300048907 Bacteria 2443
1029 Ga0496105_0215713 3300048908 Bacteria 1563
1030 Ga0496106_0015637 3300048909 Bacteria 5613
1031 Ga0496106_0072734 3300048909 Bacteria 2629
1032 Ga0496107_0009370 3300048910 Bacteria 6788
1033 Ga0496108_0382544 3300048911 Bacteria 1229
1034 Ga0496109_0028870 3300048912 Bacteria 4966
1035 Ga0496110_1233250 3300048913 Unclassified 657
1036 Ga0496110_1434843 3300048913 Bacteria 600
1037 Ga0496113_0303612 3300048916 Bacteria 1278
1038 Ga0496113_0626213 3300048916 Bacteria 861
1039 Ga0496114_0042591 3300048917 Bacteria 3764
1040 Ga0496114_0262711 3300048917 Bacteria 1520
1041 Ga0496116_0028666 3300048919 Bacteria 4028
1042 Ga0496116_0058825 3300048919 Bacteria 2503
1043 Ga0496116_0072703 3300048919 Bacteria 2172
1044 Ga0496117_0031641 3300048920 Bacteria 4035
1045 Ga0496117_0034303 3300048920 Bacteria 3825
1046 Ga0496117_0103645 3300048920 Bacteria 1792
1047 Ga0496117_0108662 3300048920 Bacteria 1734
1048 Ga0496117_0250160 3300048920 Bacteria 967
1049 Ga0496118_0007154 3300048921 Bacteria 11946
1050 Ga0496118_0062718 3300048921 Bacteria 2740
1051 Ga0496118_0141631 3300048921 Bacteria 1523
1052 Ga0496118_0151133 3300048921 Bacteria 1453
1053 Ga0496121_0049523 3300048924 Bacteria 3562
1054 Ga0496121_0138815 3300048924 Bacteria 1806
1055 Ga0496121_0227663 3300048924 Bacteria 1308
1056 Ga0496121_0702693 3300048924 Bacteria 608
1057 Ga0496122_0000320 3300048925 Bacteria 105489
1058 Ga0496122_0072076 3300048925 Bacteria 2458
1059 Ga0496122_0132058 3300048925 Bacteria 1584
1060 Ga0496122_0238853 3300048925 Bacteria 1026
1061 Ga0496123_0000258 3300048926 Bacteria 107501
1062 Ga0496123_0073492 3300048926 Bacteria 2121
1063 Ga0496123_0084018 3300048926 Bacteria 1922
1064 Ga0496123_0366402 3300048926 Bacteria 665
1065 Ga0496124_0019585 3300048927 Bacteria 6289
1066 Ga0496124_0032014 3300048927 Bacteria 4651
1067 Ga0496124_0084256 3300048927 Bacteria 2607
1068 Ga0496124_0092301 3300048927 Bacteria 2466
1069 Ga0496124_0160561 3300048927 Bacteria 1752
1070 Ga0496125_0022796 3300048928 Bacteria 5804
1071 Ga0496125_0050508 3300048928 Bacteria 3442
1072 Ga0496125_0058522 3300048928 Bacteria 3112
1073 Ga0496125_0214881 3300048928 Bacteria 1245
1074 Ga0496125_0219538 3300048928 Bacteria 1226
1075 Ga0496126_0185739 3300048929 Bacteria 1763
1076 Ga0496126_0389710 3300048929 Bacteria 1132
1077 Ga0495678_187751 3300049459 Bacteria 644
1078 Ga0495682_0175501 3300049460 Bacteria 762
1079 Ga0501034_0434374 3300049571 Bacteria 1232
1080 Ga0501034_0863935 3300049571 Bacteria 794
1081 Ga0501037_0164582 3300049573 Bacteria 1580
1082 Ga0501073_0441384 3300049589 Bacteria 900
1083 Ga0501249_004010 3300049679 Bacteria 2978
1084 Ga0501262_000047 3300049759 Bacteria 15771
1085 Ga0501035_0375085 3300049822 Bacteria 1187
1086 Ga0501044_0246292 3300049823 Bacteria 1730
1087 nmdc:mga03683_122194_c1 3300050489 Bacteria 1159
1088 nmdc:mga03683_2164_c2 3300050489 Bacteria 1623
1089 nmdc:mga03683_292134_c1 3300050489 Unclassified 763
1090 nmdc:mga03n38_10194_c2 3300050490 Bacteria 2595
1091 nmdc:mga03n38_301283_c1 3300050490 Bacteria 861
1092 nmdc:mga03n38_48197_c1 3300050490 Bacteria 1889
1093 nmdc:mga03n38_5373_c1 3300050490 Bacteria 4354
1094 nmdc:mga03n38_93999_c1 3300050490 Bacteria 1433
1095 nmdc:mga03n38_962_c1 3300050490 Bacteria 7821
1096 nmdc:mga00v17_141610_c1 3300050491 Bacteria 1542
1097 nmdc:mga00v17_17913_c1 3300050491 Bacteria 4017
1098 nmdc:mga00v17_402827_c1 3300050491 Bacteria 889
1099 nmdc:mga00v17_467037_c1 3300050491 Bacteria 819
1100 nmdc:mga00v17_497083_c1 3300050491 Bacteria 791
1101 nmdc:mga00v17_77136_c1 3300050491 Bacteria 2074
1102 nmdc:mga0yw44_1144868_c1 3300050492 Bacteria 525
1103 nmdc:mga0yw44_44737_c1 3300050492 Bacteria 2650
1104 nmdc:mga0yw44_467056_c1 3300050492 Bacteria 855
1105 nmdc:mga0k408_114918_c1 3300050493 Bacteria 1592
1106 nmdc:mga0k408_128491_c1 3300050493 Bacteria 1504
1107 nmdc:mga0k408_15900_c1 3300050493 Bacteria 4167
1108 nmdc:mga0k408_1682_c1 3300050493 Bacteria 11938
1109 nmdc:mga0k408_220108_c2 3300050493 Bacteria 589
1110 nmdc:mga0k408_22313_c1 3300050493 Bacteria 3564
1111 nmdc:mga0k408_227497_c1 3300050493 Bacteria 1113
1112 nmdc:mga0k408_45759_c1 3300050493 Bacteria 2526
1113 nmdc:mga0k408_50999_c1 3300050493 Bacteria 2396
1114 nmdc:mga0k408_534565_c1 3300050493 Bacteria 694
1115 nmdc:mga0k408_555600_c1 3300050493 Bacteria 678
1116 nmdc:mga0k408_569995_c1 3300050493 Bacteria 669
1117 nmdc:mga0k408_58948_c1 3300050493 Bacteria 2230
1118 nmdc:mga0k408_6998_c1 3300050493 Bacteria 6018
1119 nmdc:mga0k408_78539_c1 3300050493 Bacteria 1931
1120 nmdc:mga06z11_104541_c1 3300050494 Bacteria 1559
1121 nmdc:mga06z11_262436_c1 3300050494 Bacteria 1019
1122 nmdc:mga06z11_264210_c1 3300050494 Bacteria 1016
1123 nmdc:mga06z11_52528_c1 3300050494 Bacteria 2092
1124 nmdc:mga06z11_9203_c1 3300050494 Bacteria 4152
1125 nmdc:mga04h51_116994_c1 3300050495 Bacteria 989
1126 nmdc:mga04h51_120818_c1 3300050495 Bacteria 976
1127 nmdc:mga04h51_38905_c1 3300050495 Bacteria 1542
1128 nmdc:mga07m45_1045_c1 3300050496 Bacteria 12330
1129 nmdc:mga07m45_1052_c1 3300050496 Bacteria 12288
1130 nmdc:mga07m45_1463_c1 3300050496 Bacteria 10840
1131 nmdc:mga07m45_187455_c1 3300050496 Bacteria 1203
1132 nmdc:mga07m45_207899_c1 3300050496 Bacteria 1139
1133 nmdc:mga07m45_220705_c1 3300050496 Bacteria 1103
1134 nmdc:mga07m45_24407_c1 3300050496 Bacteria 3312
1135 nmdc:mga07m45_256134_c1 3300050496 Bacteria 1018
1136 nmdc:mga07m45_290700_c1 3300050496 Bacteria 951
1137 nmdc:mga07m45_443325_c1 3300050496 Bacteria 753
1138 nmdc:mga07m45_479976_c1 3300050496 Unclassified 720
1139 nmdc:mga07m45_54386_c1 3300050496 Bacteria 2263
1140 nmdc:mga07m45_577170_c1 3300050496 Bacteria 650
1141 nmdc:mga07m45_595_c2 3300050496 Bacteria 13851
1142 nmdc:mga07m45_6204_c1 3300050496 Bacteria 6031
1143 nmdc:mga07m45_981_c1 3300050496 Bacteria 12571
1144 nmdc:mga0n895_103710_c1 3300050512 Bacteria 2855
1145 nmdc:mga0rr50_598354_c1 3300050513 Bacteria 940
1146 nmdc:mga0sz30_505241_c1 3300050516 Bacteria 544
1147 nmdc:mga0sz30_80685_c1 3300050516 Bacteria 1408
1148 Ga0500610_0014869 3300053079 Bacteria 3665
1149 Ga0500610_0030679 3300053079 Bacteria 2726
1150 Ga0500610_0128132 3300053079 Bacteria 1293
1151 Ga0500578_0000537 3300053086 Bacteria 46023
1152 Ga0500578_0086940 3300053086 Bacteria 1986
1153 Ga0500643_072680 3300053087 Bacteria 953
1154 Ga0500644_0003434 3300053088 Bacteria 3918
1155 Ga0500644_0181695 3300053088 Bacteria 861
1156 Ga0500646_0018609 3300053090 Bacteria 1831
1157 Ga0500647_0053260 3300053091 Bacteria 1947
1158 Ga0500647_0136843 3300053091 Bacteria 1152
1159 Ga0500651_0003756 3300053093 Bacteria 8371
1160 Ga0500651_0023247 3300053093 Bacteria 3881
1161 Ga0500651_0117340 3300053093 Bacteria 1618
1162 Ga0500651_0269082 3300053093 Bacteria 986
1163 Ga0500651_0304391 3300053093 Bacteria 914
1164 Ga0500560_216069 3300053107 Bacteria 613
1165 Ga0500562_035386 3300053108 Bacteria 1323
1166 Ga0500569_257867 3300053109 Bacteria 591
1167 Ga0500571_000381 3300053110 Bacteria 17571
1168 Ga0500593_004216 3300053117 Bacteria 5543
1169 Ga0500593_007439 3300053117 Bacteria 4456
1170 Ga0500597_123433 3300053120 Bacteria 1121
1171 Ga0500607_001809 3300053121 Bacteria 18468
1172 Ga0500607_054656 3300053121 Bacteria 2113
1173 Ga0500608_055736 3300053122 Bacteria 1894
1174 Ga0500608_120170 3300053122 Bacteria 1193
1175 Ga0500608_141312 3300053122 Bacteria 1067
1176 Ga0500626_024197 3300053128 Bacteria 2723
1177 Ga0500642_0032574 3300053130 Bacteria 2188
1178 Ga0500652_000155 3300053131 Bacteria 26280
1179 Ga0500655_002877 3300053133 Bacteria 3126
1180 Ga0500655_004348 3300053133 Bacteria 2557
1181 Ga0500658_0000192 3300053134 Bacteria 29159
1182 Ga0500658_0000417 3300053134 Bacteria 18435
1183 Ga0500658_0003329 3300053134 Bacteria 6093
1184 Ga0500559_0004739 3300053136 Bacteria 6391
1185 Ga0500559_0021048 3300053136 Bacteria 2761
1186 Ga0500559_0100995 3300053136 Bacteria 1329
1187 Ga0500561_0089930 3300053137 Bacteria 907
1188 Ga0500564_028526 3300053138 Bacteria 2569
1189 Ga0500568_0003566 3300053139 Bacteria 8600
1190 Ga0500568_0016575 3300053139 Bacteria 3271
1191 Ga0500568_0211802 3300053139 Bacteria 709
1192 Ga0500573_0058921 3300053140 Bacteria 2201
1193 Ga0500574_001773 3300053141 Bacteria 3341
1194 Ga0500577_0164507 3300053142 Bacteria 946
1195 Ga0500604_0010581 3300053151 Bacteria 2469
1196 Ga0500604_0025692 3300053151 Bacteria 1694
1197 Ga0500616_0055380 3300053153 Bacteria 2074
1198 Ga0500619_004740 3300053154 Bacteria 2953
1199 Ga0500619_133770 3300053154 Bacteria 845
1200 Ga0500622_0000423 3300053156 Bacteria 40034
1201 Ga0500622_0001100 3300053156 Bacteria 22485
1202 Ga0500627_0000737 3300053158 Bacteria 8729
1203 Ga0500627_0340197 3300053158 Bacteria 649
1204 Ga0500634_0133993 3300053161 Bacteria 1184
1205 Ga0500638_085214 3300053162 Bacteria 1496
1206 Ga0500625_191069 3300053729 Bacteria 701
1207 Ga0500645_004885 3300053730 Bacteria 5045
1208 Ga0500596_041041 3300053735 Bacteria 738
1209 Ga0500587_001023 3300053739 Bacteria 3789

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005333 Ga0070677_10412095 Ga0070677_104120951 134
2 3300025923 Ga0207681_10506969 Ga0207681_105069692 134
3 3300003316 rootH1_10002444 rootH1_100024446 135
4 3300003320 rootH2_10048751 rootH2_100487512 135
5 3300003322 rootL2_10004239 rootL2_1000423911 135
6 iso_pu_bacteria 2585428058 2587733852 137
7 3300014326 Ga0157380_11477709 Ga0157380_114777092 139
8 3300003759 Ga0055525_1000021 Ga0055525_100002164 140
9 3300006048 Ga0075363_100234686 Ga0075363_1002346862 140
10 3300006186 Ga0075369_10033995 Ga0075369_100339951 140
11 3300014497 Ga0182008_10067551 Ga0182008_100675512 140
12 3300025226 Ga0209674_115250 Ga0209674_1152502 140
13 3300025230 Ga0209563_100005 Ga0209563_100005263 140
14 3300025303 Ga0209051_1021829 Ga0209051_10218294 140
15 3300041452 Ga0451793_1115609 Ga0451793_1115609_272_712 140
16 3300041460 Ga0451802_0401206 Ga0451802_0401206_124_564 140
17 3300046460 Ga0495638_0092883 Ga0495638_0092883_187_627 140
18 3300046519 Ga0495632_0423259 Ga0495632_0423259_98_538 140
19 3300050491 nmdc:mga00v17_402827_c1 nmdc:mga00v17_402827_c1_273_713 140
20 3300050492 nmdc:mga0yw44_1144868_c1 nmdc:mga0yw44_1144868_c1_61_501 140
21 3300050496 nmdc:mga07m45_6204_c1 nmdc:mga07m45_6204_c1_531_971 140
22 3300053088 Ga0500644_0181695 Ga0500644_0181695_98_538 140
23 3300053093 Ga0500651_0117340 Ga0500651_0117340_131_571 140
24 3300053131 Ga0500652_000155 Ga0500652_000155_11537_11977 140
25 3300053133 Ga0500655_004348 Ga0500655_004348_303_743 140
26 3300053156 Ga0500622_0000423 Ga0500622_0000423_8780_9220 140
27 3300053158 Ga0500627_0340197 Ga0500627_0340197_46_486 140
28 3300021361 Ga0213872_10000046 Ga0213872_1000004614 141
29 3300021361 Ga0213872_10046241 Ga0213872_100462412 141
30 3300030731 Ga0316177_1220430 Ga0316177_12204302 141
31 3300031239 Ga0265328_10017411 Ga0265328_100174112 141
32 3300031250 Ga0265331_10001984 Ga0265331_1000198416 141
33 3300031251 Ga0265327_10000028 Ga0265327_10000028280 141
34 3300031548 Ga0307408_100196529 Ga0307408_1001965292 141
35 3300031824 Ga0307413_10431007 Ga0307413_104310072 141
36 3300031901 Ga0307406_10289780 Ga0307406_102897802 141
37 3300031903 Ga0307407_10224521 Ga0307407_102245211 141
38 3300039447 Ga0436361_0633280 Ga0436361_0633280_94723_95175 141
39 3300039447 Ga0436361_0844177 Ga0436361_0844177_3818_4273 141
40 3300046524 Ga0495648_0216473 Ga0495648_0216473_469_897 141
41 3300046690 Ga0495624_0474773 Ga0495624_0474773_287_715 141
42 iso_pu_bacteria 2643221592 2643972551 141
43 iso_pu_bacteria 2643221625 2644138441 141
44 iso_pu_bacteria 2643221648 2644273059 141
45 3300003323 rootH1_10193050 rootH1_101930503 142
46 3300005262 Ga0065165_1002517 Ga0065165_10025176 142
47 3300025273 Ga0209673_1037488 Ga0209673_10374883 142
48 3300025298 Ga0209050_1001962 Ga0209050_100196219 142
49 3300031507 Ga0307509_10016656 Ga0307509_100166564 142
50 3300031616 Ga0307508_10005253 Ga0307508_1000525310 142
51 3300033180 Ga0307510_10092631 Ga0307510_100926314 142
52 3300033180 Ga0307510_10310134 Ga0307510_103101342 142
53 3300039447 Ga0436361_0034970 Ga0436361_0034970_75205_75672 142
54 3300041441 Ga0451787_615507 Ga0451787_615507_14_448 142
55 3300041460 Ga0451802_0061791 Ga0451802_0061791_55_501 142
56 iso_pu_bacteria 2585428057 2587727833 142
57 iso_pu_bacteria 2585428062 2587754507 142
58 iso_pu_bacteria 2643221654 2644302117 142
59 iso_pu_bacteria 2831864461 2831869784 142
60 3300009545 Ga0105237_10085132 Ga0105237_100851324 143
61 3300031507 Ga0307509_10475168 Ga0307509_104751682 143
62 3300031616 Ga0307508_10130809 Ga0307508_101308094 143
63 3300033179 Ga0307507_10098176 Ga0307507_100981763 143
64 3300046526 Ga0495666_0097531 Ga0495666_0097531_639_1094 143
65 3300053086 Ga0500578_0086940 Ga0500578_0086940_678_1133 143
66 3300005334 Ga0068869_100091461 Ga0068869_1000914612 144
67 3300005356 Ga0070674_100016511 Ga0070674_1000165115 144
68 3300005457 Ga0070662_100024603 Ga0070662_1000246032 144
69 3300005459 Ga0068867_100255074 Ga0068867_1002550741 144
70 3300005577 Ga0068857_100143878 Ga0068857_1001438782 144
71 3300025937 Ga0207669_10237670 Ga0207669_102376702 144
72 3300025981 Ga0207640_10017371 Ga0207640_100173713 144
73 3300026142 Ga0207698_10054479 Ga0207698_100544792 144
74 3300031548 Ga0307408_100369862 Ga0307408_1003698622 144
75 3300033180 Ga0307510_10005587 Ga0307510_100055872 144
76 3300035172 Ga0373955_0841147 Ga0373955_0841147_39_479 144
77 3300036401 Ga0373937_0381968 Ga0373937_0381968_19_465 144
78 3300039437 Ga0436365_0773501 Ga0436365_0773501_199_645 144
79 3300039450 Ga0436363_0379139 Ga0436363_0379139_492_938 144
80 3300039450 Ga0436363_1119806 Ga0436363_1119806_128_571 144
81 3300048090 Ga0495615_0093810 Ga0495615_0093810_32_472 144
82 3300048904 Ga0496101_0575468 Ga0496101_0575468_369_821 144
83 3300048905 Ga0496102_0015772 Ga0496102_0015772_2943_3413 144
84 3300050516 nmdc:mga0sz30_505241_c1 nmdc:mga0sz30_505241_c1_62_499 144
85 3300053086 Ga0500578_0000537 Ga0500578_0000537_15853_16326 144
86 3300053091 Ga0500647_0053260 Ga0500647_0053260_19_516 144
87 3300053151 Ga0500604_0025692 Ga0500604_0025692_949_1422 144
88 iso_pu_bacteria 2643221644 2644248287 144
89 iso_pu_bacteria 2842747753 2842749155 144
90 3300003578 Ga0006562J51391_1103471 Ga0006562J51391_11034715 145
91 3300003578 Ga0006562J51391_1103472 Ga0006562J51391_11034722 145
92 3300003791 Ga0055530_10002534 Ga0055530_100025347 145
93 3300003792 Ga0055540_1000011 Ga0055540_1000011117 145
94 3300003794 Ga0055531_10015050 Ga0055531_100150502 145
95 3300005347 Ga0070668_101787717 Ga0070668_1017877171 145
96 3300005356 Ga0070674_101703460 Ga0070674_1017034601 145
97 3300006051 Ga0075364_10058694 Ga0075364_100586941 145
98 3300006195 Ga0075366_10082530 Ga0075366_100825303 145
99 3300006353 Ga0075370_10002241 Ga0075370_100022418 145
100 3300009553 Ga0105249_10202009 Ga0105249_102020091 145
101 3300013100 Ga0157373_10012777 Ga0157373_100127775 145
102 3300014497 Ga0182008_10006636 Ga0182008_100066365 145
103 3300015261 Ga0182006_1016882 Ga0182006_10168823 145
104 3300025273 Ga0209673_1004340 Ga0209673_10043407 145
105 3300025295 Ga0209564_1000005 Ga0209564_1000005631 145
106 3300025298 Ga0209050_1002535 Ga0209050_10025357 145
107 3300025303 Ga0209051_1000020 Ga0209051_1000020117 145
108 3300025304 Ga0209257_1000085 Ga0209257_1000085117 145
109 3300025936 Ga0207670_10993188 Ga0207670_109931882 145
110 3300025937 Ga0207669_11726594 Ga0207669_117265941 145
111 3300025961 Ga0207712_11082470 Ga0207712_110824702 145
112 3300028794 Ga0307515_10009904 Ga0307515_100099047 145
113 3300028794 Ga0307515_10039228 Ga0307515_100392282 145
114 3300030522 Ga0307512_10225449 Ga0307512_102254492 145
115 3300031456 Ga0307513_10004294 Ga0307513_100042943 145
116 3300031456 Ga0307513_10026047 Ga0307513_100260472 145
117 3300031507 Ga0307509_10050016 Ga0307509_100500166 145
118 3300031507 Ga0307509_10051400 Ga0307509_100514003 145
119 3300031616 Ga0307508_10000194 Ga0307508_1000019423 145
120 3300031649 Ga0307514_10011053 Ga0307514_100110535 145
121 3300031730 Ga0307516_10118500 Ga0307516_101185002 145
122 3300031824 Ga0307413_10420255 Ga0307413_104202551 145
123 3300031911 Ga0307412_10947294 Ga0307412_109472941 145
124 3300033180 Ga0307510_10407232 Ga0307510_104072322 145
125 3300035692 Ga0373935_0951774 Ga0373935_0951774_17_505 145
126 3300037471 Ga0395905_0849440 Ga0395905_0849440_21_485 145
127 3300041456 Ga0451795_0623483 Ga0451795_0623483_80_562 145
128 3300041459 Ga0451800_0822228 Ga0451800_0822228_264_722 145
129 3300041459 Ga0451800_0963213 Ga0451800_0963213_12_494 145
130 3300041496 Ga0451839_0760707 Ga0451839_0760707_495_977 145
131 3300041505 Ga0451849_1279070 Ga0451849_1279070_332_814 145
132 3300042532 Ga0450893_0023579 Ga0450893_0023579_313_777 145
133 3300044712 Ga0453684_0107051 Ga0453684_0107051_691_1140 145
134 3300046457 Ga0495590_0314865 Ga0495590_0314865_87_527 145
135 3300046512 Ga0495610_0015357 Ga0495610_0015357_3651_4133 145
136 3300046515 Ga0495620_0145009 Ga0495620_0145009_161_643 145
137 3300046522 Ga0495643_0036252 Ga0495643_0036252_1294_1776 145
138 3300046660 Ga0495625_0006631 Ga0495625_0006631_9192_9674 145
139 3300046692 Ga0495671_0234578 Ga0495671_0234578_363_842 145
140 3300047472 Ga0495686_0209643 Ga0495686_0209643_71_553 145
141 3300050489 nmdc:mga03683_292134_c1 nmdc:mga03683_292134_c1_285_740 145
142 3300050490 nmdc:mga03n38_48197_c1 nmdc:mga03n38_48197_c1_234_716 145
143 3300050493 nmdc:mga0k408_534565_c1 nmdc:mga0k408_534565_c1_168_650 145
144 3300050493 nmdc:mga0k408_58948_c1 nmdc:mga0k408_58948_c1_1016_1480 145
145 3300050496 nmdc:mga07m45_207899_c1 nmdc:mga07m45_207899_c1_406_888 145
146 3300053090 Ga0500646_0018609 Ga0500646_0018609_344_802 145
147 3300053739 Ga0500587_001023 Ga0500587_001023_742_1224 145
148 iso_pu_bacteria 2913036834 2913039049 145
149 iso_pu_bacteria 2923586266 2923586729 145
150 iso_pu_bacteria 2931369376 2931369953 145
151 3300005327 Ga0070658_10083823 Ga0070658_100838232 146
152 3300005327 Ga0070658_10102909 Ga0070658_101029093 146
153 3300005328 Ga0070676_10009290 Ga0070676_100092907 146
154 3300005329 Ga0070683_100005352 Ga0070683_1000053528 146
155 3300005331 Ga0070670_100009851 Ga0070670_1000098516 146
156 3300005331 Ga0070670_100109353 Ga0070670_1001093531 146
157 3300005333 Ga0070677_10026044 Ga0070677_100260443 146
158 3300005333 Ga0070677_10054643 Ga0070677_100546432 146
159 3300005334 Ga0068869_100069759 Ga0068869_1000697592 146
160 3300005335 Ga0070666_10659296 Ga0070666_106592961 146
161 3300005338 Ga0068868_100001157 Ga0068868_1000011576 146
162 3300005338 Ga0068868_100063065 Ga0068868_1000630652 146
163 3300005339 Ga0070660_100068835 Ga0070660_1000688353 146
164 3300005339 Ga0070660_100078509 Ga0070660_1000785092 146
165 3300005344 Ga0070661_100037349 Ga0070661_1000373492 146
166 3300005344 Ga0070661_100134336 Ga0070661_1001343362 146
167 3300005344 Ga0070661_101191782 Ga0070661_1011917821 146
168 3300005347 Ga0070668_100156282 Ga0070668_1001562822 146
169 3300005353 Ga0070669_100107590 Ga0070669_1001075903 146
170 3300005354 Ga0070675_100001801 Ga0070675_1000018015 146
171 3300005354 Ga0070675_100054138 Ga0070675_1000541382 146
172 3300005355 Ga0070671_100244692 Ga0070671_1002446922 146
173 3300005355 Ga0070671_100416739 Ga0070671_1004167392 146
174 3300005356 Ga0070674_100417511 Ga0070674_1004175112 146
175 3300005364 Ga0070673_100115232 Ga0070673_1001152322 146
176 3300005364 Ga0070673_100125273 Ga0070673_1001252732 146
177 3300005364 Ga0070673_100153586 Ga0070673_1001535862 146
178 3300005366 Ga0070659_100106388 Ga0070659_1001063882 146
179 3300005367 Ga0070667_100088937 Ga0070667_1000889374 146
180 3300005367 Ga0070667_100195279 Ga0070667_1001952793 146
181 3300005455 Ga0070663_100118454 Ga0070663_1001184543 146
182 3300005456 Ga0070678_100046649 Ga0070678_1000466492 146
183 3300005456 Ga0070678_100173760 Ga0070678_1001737602 146
184 3300005457 Ga0070662_100000867 Ga0070662_10000086710 146
185 3300005457 Ga0070662_100110025 Ga0070662_1001100253 146
186 3300005457 Ga0070662_100154273 Ga0070662_1001542732 146
187 3300005458 Ga0070681_10532061 Ga0070681_105320612 146
188 3300005459 Ga0068867_100005504 Ga0068867_1000055043 146
189 3300005459 Ga0068867_100895646 Ga0068867_1008956462 146
190 3300005535 Ga0070684_100027307 Ga0070684_1000273077 146
191 3300005535 Ga0070684_100127611 Ga0070684_1001276112 146
192 3300005535 Ga0070684_100423920 Ga0070684_1004239202 146
193 3300005535 Ga0070684_100679080 Ga0070684_1006790802 146
194 3300005539 Ga0068853_100002880 Ga0068853_1000028806 146
195 3300005539 Ga0068853_100132036 Ga0068853_1001320362 146
196 3300005539 Ga0068853_101987723 Ga0068853_1019877231 146
197 3300005543 Ga0070672_100019327 Ga0070672_1000193273 146
198 3300005543 Ga0070672_100049097 Ga0070672_1000490972 146
199 3300005543 Ga0070672_100098868 Ga0070672_1000988682 146
200 3300005543 Ga0070672_100204828 Ga0070672_1002048282 146
201 3300005547 Ga0070693_100029302 Ga0070693_1000293024 146
202 3300005547 Ga0070693_100487795 Ga0070693_1004877952 146
203 3300005563 Ga0068855_100051204 Ga0068855_1000512047 146
204 3300005564 Ga0070664_100093118 Ga0070664_1000931182 146
205 3300005564 Ga0070664_100115387 Ga0070664_1001153872 146
206 3300005577 Ga0068857_100043611 Ga0068857_1000436113 146
207 3300005577 Ga0068857_100121537 Ga0068857_1001215373 146
208 3300005578 Ga0068854_100027581 Ga0068854_1000275813 146
209 3300005578 Ga0068854_100261895 Ga0068854_1002618952 146
210 3300005614 Ga0068856_100004035 Ga0068856_1000040356 146
211 3300005614 Ga0068856_100190867 Ga0068856_1001908672 146
212 3300005616 Ga0068852_100072682 Ga0068852_1000726822 146
213 3300005616 Ga0068852_100139459 Ga0068852_1001394592 146
214 3300005616 Ga0068852_100189947 Ga0068852_1001899472 146
215 3300005616 Ga0068852_100606196 Ga0068852_1006061962 146
216 3300005617 Ga0068859_100435764 Ga0068859_1004357642 146
217 3300005618 Ga0068864_100024340 Ga0068864_1000243402 146
218 3300005618 Ga0068864_100363776 Ga0068864_1003637762 146
219 3300005618 Ga0068864_100550863 Ga0068864_1005508632 146
220 3300005719 Ga0068861_100003855 Ga0068861_10000385512 146
221 3300005834 Ga0068851_10020198 Ga0068851_100201987 146
222 3300005834 Ga0068851_10371613 Ga0068851_103716132 146
223 3300005840 Ga0068870_10371678 Ga0068870_103716782 146
224 3300005841 Ga0068863_100058398 Ga0068863_1000583984 146
225 3300005841 Ga0068863_100195703 Ga0068863_1001957033 146
226 3300005842 Ga0068858_100351657 Ga0068858_1003516572 146
227 3300005843 Ga0068860_100030780 Ga0068860_1000307806 146
228 3300005843 Ga0068860_100458633 Ga0068860_1004586332 146
229 3300006195 Ga0075366_10014575 Ga0075366_100145754 146
230 3300006237 Ga0097621_100022260 Ga0097621_1000222603 146
231 3300006353 Ga0075370_10007120 Ga0075370_100071204 146
232 3300006358 Ga0068871_100116623 Ga0068871_1001166232 146
233 3300006871 Ga0075434_100103811 Ga0075434_1001038112 146
234 3300006881 Ga0068865_100031594 Ga0068865_1000315942 146
235 3300006881 Ga0068865_100162763 Ga0068865_1001627632 146
236 3300006931 Ga0097620_100435715 Ga0097620_1004357152 146
237 3300007076 Ga0075435_100337081 Ga0075435_1003370812 146
238 3300009098 Ga0105245_10045639 Ga0105245_100456392 146
239 3300009098 Ga0105245_10129601 Ga0105245_101296012 146
240 3300009101 Ga0105247_10295951 Ga0105247_102959511 146
241 3300009177 Ga0105248_10016659 Ga0105248_100166592 146
242 3300009177 Ga0105248_10205361 Ga0105248_102053612 146
243 3300009545 Ga0105237_10520670 Ga0105237_105206702 146
244 3300009551 Ga0105238_10129652 Ga0105238_101296522 146
245 3300009553 Ga0105249_10527491 Ga0105249_105274912 146
246 3300010375 Ga0105239_10057462 Ga0105239_100574624 146
247 3300013100 Ga0157373_10056085 Ga0157373_100560851 146
248 3300013102 Ga0157371_10044279 Ga0157371_100442792 146
249 3300013102 Ga0157371_10696320 Ga0157371_106963202 146
250 3300013105 Ga0157369_10015460 Ga0157369_100154603 146
251 3300013105 Ga0157369_10989011 Ga0157369_109890112 146
252 3300013296 Ga0157374_10009658 Ga0157374_100096586 146
253 3300013296 Ga0157374_10140338 Ga0157374_101403383 146
254 3300013306 Ga0163162_10007486 Ga0163162_1000748611 146
255 3300013306 Ga0163162_10274617 Ga0163162_102746173 146
256 3300013307 Ga0157372_10156872 Ga0157372_101568722 146
257 3300014326 Ga0157380_10028623 Ga0157380_100286234 146
258 3300014745 Ga0157377_10041978 Ga0157377_100419782 146
259 3300014968 Ga0157379_10010369 Ga0157379_100103694 146
260 3300014968 Ga0157379_10054527 Ga0157379_100545272 146
261 3300014969 Ga0157376_10005027 Ga0157376_100050275 146
262 3300014969 Ga0157376_10982276 Ga0157376_109822761 146
263 3300017792 Ga0163161_10003912 Ga0163161_100039126 146
264 3300025893 Ga0207682_10049500 Ga0207682_100495002 146
265 3300025893 Ga0207682_10053950 Ga0207682_100539502 146
266 3300025900 Ga0207710_10449888 Ga0207710_104498881 146
267 3300025901 Ga0207688_10317751 Ga0207688_103177512 146
268 3300025907 Ga0207645_10005684 Ga0207645_100056847 146
269 3300025907 Ga0207645_10027329 Ga0207645_100273293 146
270 3300025907 Ga0207645_10077274 Ga0207645_100772743 146
271 3300025908 Ga0207643_10020521 Ga0207643_100205213 146
272 3300025909 Ga0207705_10886138 Ga0207705_108861382 146
273 3300025911 Ga0207654_10292619 Ga0207654_102926192 146
274 3300025918 Ga0207662_10233549 Ga0207662_102335492 146
275 3300025919 Ga0207657_10051902 Ga0207657_100519022 146
276 3300025919 Ga0207657_10128705 Ga0207657_101287052 146
277 3300025920 Ga0207649_10163293 Ga0207649_101632932 146
278 3300025920 Ga0207649_10225487 Ga0207649_102254872 146
279 3300025920 Ga0207649_10229311 Ga0207649_102293112 146
280 3300025923 Ga0207681_10103784 Ga0207681_101037842 146
281 3300025923 Ga0207681_10256964 Ga0207681_102569642 146
282 3300025924 Ga0207694_10038457 Ga0207694_100384572 146
283 3300025925 Ga0207650_10471978 Ga0207650_104719782 146
284 3300025926 Ga0207659_10005215 Ga0207659_100052156 146
285 3300025926 Ga0207659_10056916 Ga0207659_100569162 146
286 3300025926 Ga0207659_10356689 Ga0207659_103566892 146
287 3300025927 Ga0207687_10149565 Ga0207687_101495652 146
288 3300025927 Ga0207687_10292861 Ga0207687_102928611 146
289 3300025931 Ga0207644_10230856 Ga0207644_102308562 146
290 3300025932 Ga0207690_10031790 Ga0207690_100317902 146
291 3300025933 Ga0207706_10000933 Ga0207706_1000093327 146
292 3300025933 Ga0207706_10136423 Ga0207706_101364232 146
293 3300025933 Ga0207706_10137030 Ga0207706_101370302 146
294 3300025938 Ga0207704_10052541 Ga0207704_100525413 146
295 3300025940 Ga0207691_10041323 Ga0207691_100413233 146
296 3300025940 Ga0207691_10108789 Ga0207691_101087893 146
297 3300025940 Ga0207691_10130114 Ga0207691_101301143 146
298 3300025941 Ga0207711_10046230 Ga0207711_100462305 146
299 3300025941 Ga0207711_10118967 Ga0207711_101189672 146
300 3300025942 Ga0207689_10000150 Ga0207689_1000015054 146
301 3300025944 Ga0207661_11332258 Ga0207661_113322581 146
302 3300025945 Ga0207679_10254378 Ga0207679_102543782 146
303 3300025949 Ga0207667_10361165 Ga0207667_103611652 146
304 3300025960 Ga0207651_10018228 Ga0207651_100182285 146
305 3300025960 Ga0207651_11044116 Ga0207651_110441162 146
306 3300025972 Ga0207668_10151195 Ga0207668_101511952 146
307 3300025981 Ga0207640_10061385 Ga0207640_100613852 146
308 3300026023 Ga0207677_10012436 Ga0207677_100124364 146
309 3300026023 Ga0207677_10252983 Ga0207677_102529832 146
310 3300026023 Ga0207677_10422517 Ga0207677_104225172 146
311 3300026035 Ga0207703_10030559 Ga0207703_100305594 146
312 3300026035 Ga0207703_10047106 Ga0207703_100471065 146
313 3300026035 Ga0207703_11234687 Ga0207703_112346871 146
314 3300026041 Ga0207639_10053565 Ga0207639_100535654 146
315 3300026041 Ga0207639_10097704 Ga0207639_100977042 146
316 3300026067 Ga0207678_10002944 Ga0207678_1000294411 146
317 3300026067 Ga0207678_10170607 Ga0207678_101706072 146
318 3300026078 Ga0207702_10329396 Ga0207702_103293962 146
319 3300026088 Ga0207641_10088799 Ga0207641_100887993 146
320 3300026088 Ga0207641_10164319 Ga0207641_101643192 146
321 3300026089 Ga0207648_10001012 Ga0207648_100010125 146
322 3300026089 Ga0207648_10387825 Ga0207648_103878252 146
323 3300026095 Ga0207676_10181228 Ga0207676_101812282 146
324 3300026095 Ga0207676_10272993 Ga0207676_102729932 146
325 3300026116 Ga0207674_10020946 Ga0207674_100209468 146
326 3300026116 Ga0207674_10041822 Ga0207674_100418223 146
327 3300026118 Ga0207675_100001131 Ga0207675_10000113131 146
328 3300026121 Ga0207683_10064766 Ga0207683_100647662 146
329 3300026121 Ga0207683_10122058 Ga0207683_101220581 146
330 3300026142 Ga0207698_10007726 Ga0207698_100077262 146
331 3300026142 Ga0207698_10016066 Ga0207698_100160664 146
332 3300026142 Ga0207698_10315874 Ga0207698_103158742 146
333 3300028380 Ga0268265_10560735 Ga0268265_105607352 146
334 3300028381 Ga0268264_10080643 Ga0268264_100806432 146
335 3300028381 Ga0268264_10451274 Ga0268264_104512741 146
336 3300028794 Ga0307515_10011118 Ga0307515_1001111814 146
337 3300031731 Ga0307405_10100216 Ga0307405_101002164 146
338 3300031852 Ga0307410_10105384 Ga0307410_101053842 146
339 3300031911 Ga0307412_10012955 Ga0307412_100129554 146
340 3300032002 Ga0307416_100733494 Ga0307416_1007334942 146
341 3300034816 Ga0373930_0016597 Ga0373930_0016597_807_1271 146
342 3300035084 Ga0373928_0008445 Ga0373928_0008445_1443_1907 146
343 3300035092 Ga0373952_0070021 Ga0373952_0070021_71_535 146
344 3300035115 Ga0373941_0005075 Ga0373941_0005075_577_1041 146
345 3300036401 Ga0373937_0713287 Ga0373937_0713287_144_635 146
346 3300037068 Ga0373925_0191014 Ga0373925_0191014_688_1179 146
347 3300041443 Ga0451789_0617931 Ga0451789_0617931_218_688 146
348 3300045051 Ga0451576_0301054 Ga0451576_0301054_53_514 146
349 3300046539 Ga0495621_0147525 Ga0495621_0147525_198_662 146
350 3300046681 Ga0495647_0091643 Ga0495647_0091643_392_856 146
351 3300046683 Ga0495658_0611030 Ga0495658_0611030_100_561 146
352 3300047472 Ga0495686_0103310 Ga0495686_0103310_387_869 146
353 3300048903 Ga0496100_0123007 Ga0496100_0123007_328_792 146
354 3300048904 Ga0496101_0436825 Ga0496101_0436825_253_717 146
355 3300048905 Ga0496102_0571414 Ga0496102_0571414_502_966 146
356 3300048907 Ga0496104_0127565 Ga0496104_0127565_814_1278 146
357 3300048909 Ga0496106_0015637 Ga0496106_0015637_2787_3269 146
358 3300048909 Ga0496106_0072734 Ga0496106_0072734_993_1457 146
359 3300048910 Ga0496107_0009370 Ga0496107_0009370_1510_1974 146
360 3300048912 Ga0496109_0028870 Ga0496109_0028870_2889_3353 146
361 3300048916 Ga0496113_0303612 Ga0496113_0303612_73_537 146
362 3300048916 Ga0496113_0626213 Ga0496113_0626213_351_848 146
363 3300048917 Ga0496114_0042591 Ga0496114_0042591_3197_3661 146
364 3300048924 Ga0496121_0227663 Ga0496121_0227663_36_518 146
365 3300050490 nmdc:mga03n38_10194_c2 nmdc:mga03n38_10194_c2_859_1326 146
366 3300050493 nmdc:mga0k408_22313_c1 nmdc:mga0k408_22313_c1_2082_2549 146
367 3300050494 nmdc:mga06z11_262436_c1 nmdc:mga06z11_262436_c1_244_711 146
368 3300050496 nmdc:mga07m45_1463_c1 nmdc:mga07m45_1463_c1_6568_7035 146
369 3300050512 nmdc:mga0n895_103710_c1 nmdc:mga0n895_103710_c1_1238_1702 146
370 3300050513 nmdc:mga0rr50_598354_c1 nmdc:mga0rr50_598354_c1_449_913 146
371 iso_pu_bacteria 2919704043 2919709109 146
372 iso_pu_bacteria 2928115317 2928116070 146
373 iso_pu_bacteria 8019775933 8019781229 146
374 iso_pu_bacteria 8019775933 8019781511 146
375 3300003322 rootL2_10100371 rootL2_101003712 147
376 3300005327 Ga0070658_10205517 Ga0070658_102055173 147
377 3300005339 Ga0070660_100040525 Ga0070660_1000405252 147
378 3300005458 Ga0070681_11156798 Ga0070681_111567981 147
379 3300005530 Ga0070679_100024940 Ga0070679_1000249403 147
380 3300005539 Ga0068853_100050690 Ga0068853_1000506904 147
381 3300005548 Ga0070665_101733628 Ga0070665_1017336281 147
382 3300005563 Ga0068855_100246194 Ga0068855_1002461943 147
383 3300005841 Ga0068863_101060957 Ga0068863_1010609572 147
384 3300006358 Ga0068871_100387693 Ga0068871_1003876932 147
385 3300009093 Ga0105240_10089902 Ga0105240_100899022 147
386 3300014325 Ga0163163_10722173 Ga0163163_107221732 147
387 3300014968 Ga0157379_10414611 Ga0157379_104146113 147
388 3300014969 Ga0157376_10242960 Ga0157376_102429603 147
389 3300025913 Ga0207695_10104516 Ga0207695_101045162 147
390 3300025986 Ga0207658_10525012 Ga0207658_105250122 147
391 3300025986 Ga0207658_10740407 Ga0207658_107404072 147
392 3300026041 Ga0207639_10317765 Ga0207639_103177652 147
393 3300026041 Ga0207639_10372054 Ga0207639_103720543 147
394 3300026088 Ga0207641_11345274 Ga0207641_113452741 147
395 3300028381 Ga0268264_12228741 Ga0268264_122287411 147
396 3300031507 Ga0307509_10000802 Ga0307509_1000080222 147
397 3300031649 Ga0307514_10094556 Ga0307514_100945563 147
398 3300031649 Ga0307514_10205143 Ga0307514_102051432 147
399 3300033180 Ga0307510_10030202 Ga0307510_100302024 147
400 3300035112 Ga0373932_0040311 Ga0373932_0040311_103_570 147
401 3300035170 Ga0373943_0429900 Ga0373943_0429900_30_497 147
402 3300035691 Ga0373931_0120245 Ga0373931_0120245_994_1461 147
403 3300037068 Ga0373925_0461333 Ga0373925_0461333_395_862 147
404 3300042008 Ga0439450_017429 Ga0439450_017429_673_1149 147
405 3300042119 Ga0450915_004706 Ga0450915_004706_68_541 147
406 3300042122 Ga0450920_037126 Ga0450920_037126_62_535 147
407 3300042156 Ga0439446_0097197 Ga0439446_0097197_433_906 147
408 3300042461 Ga0439460_0006452 Ga0439460_0006452_1107_1583 147
409 3300042531 Ga0450918_000026 Ga0450918_000026_29391_29864 147
410 3300046454 Ga0495592_0000272 Ga0495592_0000272_18646_19110 147
411 3300046459 Ga0495629_0667629 Ga0495629_0667629_92_559 147
412 3300046517 Ga0495630_0157955 Ga0495630_0157955_749_1216 147
413 3300046526 Ga0495666_0419794 Ga0495666_0419794_49_576 147
414 3300046535 Ga0495586_0160408 Ga0495586_0160408_796_1257 147
415 3300046663 Ga0495635_0760595 Ga0495635_0760595_146_613 147
416 3300047321 Ga0495676_0090056 Ga0495676_0090056_1297_1764 147
417 3300047673 Ga0495593_0092334 Ga0495593_0092334_450_917 147
418 3300048925 Ga0496122_0238853 Ga0496122_0238853_184_648 147
419 3300048926 Ga0496123_0366402 Ga0496123_0366402_134_598 147
420 3300049589 Ga0501073_0441384 Ga0501073_0441384_203_658 147
421 3300049822 Ga0501035_0375085 Ga0501035_0375085_668_1123 147
422 3300053093 Ga0500651_0269082 Ga0500651_0269082_14_478 147
423 3300053117 Ga0500593_007439 Ga0500593_007439_2957_3502 147
424 3300053154 Ga0500619_004740 Ga0500619_004740_419_883 147
425 3300053730 Ga0500645_004885 Ga0500645_004885_2989_3474 147
426 iso_pu_bacteria 2513020051 2513227272 147
427 iso_pu_bacteria 2599185214 2599622645 147
428 iso_pu_bacteria 2599185226 2599671124 147
429 iso_pu_bacteria 2599185227 2599679839 147
430 iso_pu_bacteria 2599185229 2599691855 147
431 iso_pu_bacteria 2643221658 2644324841 147
432 iso_pu_bacteria 2643221672 2644396709 147
433 iso_pu_bacteria 2643221683 2644467389 147
434 iso_pu_bacteria 2738541277 2738718548 147
435 iso_pu_bacteria 2738543019 2739280566 147
436 iso_pu_bacteria 2818991446 2819600014 147
437 iso_pu_bacteria 2831265667 2831267111 147
438 iso_pu_bacteria 2838054893 2838056193 147
439 iso_pu_bacteria 2842677519 2842679116 147
440 iso_pu_bacteria 2842718218 2842719348 147
441 iso_pu_bacteria 2885198086 2885204865 147
442 iso_pu_bacteria 2885211737 2885218448 147
443 iso_pu_bacteria 2886848708 2886853473 147
444 iso_pu_bacteria 2899924645 2899926039 147
445 iso_pu_bacteria 2904449895 2904452257 147
446 iso_pu_bacteria 2904456579 2904458597 147
447 iso_pu_bacteria 2904541872 2904548614 147
448 iso_pu_bacteria 2919462493 2919466311 147
449 iso_pu_bacteria 2928037797 2928041565 147
450 iso_pu_bacteria 2928044640 2928049129 147
451 iso_pu_bacteria 2928051484 2928052263 147
452 iso_pu_bacteria 2928064002 2928065066 147
453 iso_pu_bacteria 2928070936 2928077472 147
454 iso_pu_bacteria 2928084124 2928087408 147
455 iso_pu_bacteria 2929160207 2929164718 147
456 iso_pu_bacteria 2929520902 2929522185 147
457 iso_pu_bacteria 2945909444 2945910670 147
458 iso_pu_bacteria 2945945610 2945946572 147
459 iso_pu_bacteria 2945984333 2945987158 147
460 iso_pu_bacteria 2954767861 2954771339 147
461 3300003215 JGI25153J46596_10010478 JGI25153J46596_100104784 148
462 3300003771 Ga0055526_1003267 Ga0055526_10032673 148
463 3300003792 Ga0055540_1000009 Ga0055540_1000009260 148
464 3300005328 Ga0070676_10737033 Ga0070676_107370332 148
465 3300005331 Ga0070670_100093239 Ga0070670_1000932394 148
466 3300005334 Ga0068869_100604704 Ga0068869_1006047041 148
467 3300005338 Ga0068868_100137460 Ga0068868_1001374602 148
468 3300005355 Ga0070671_100080213 Ga0070671_1000802134 148
469 3300005364 Ga0070673_100903878 Ga0070673_1009038782 148
470 3300005366 Ga0070659_100785965 Ga0070659_1007859652 148
471 3300005367 Ga0070667_101047707 Ga0070667_1010477072 148
472 3300005548 Ga0070665_100078999 Ga0070665_1000789995 148
473 3300005548 Ga0070665_100150572 Ga0070665_1001505724 148
474 3300005617 Ga0068859_100325490 Ga0068859_1003254903 148
475 3300005618 Ga0068864_100040117 Ga0068864_1000401172 148
476 3300005840 Ga0068870_10826718 Ga0068870_108267181 148
477 3300005841 Ga0068863_100067310 Ga0068863_1000673102 148
478 3300005843 Ga0068860_100176947 Ga0068860_1001769473 148
479 3300006195 Ga0075366_10000574 Ga0075366_100005748 148
480 3300006195 Ga0075366_10165958 Ga0075366_101659582 148
481 3300006237 Ga0097621_100224534 Ga0097621_1002245342 148
482 3300006353 Ga0075370_10000101 Ga0075370_100001018 148
483 3300006353 Ga0075370_10068296 Ga0075370_100682964 148
484 3300006931 Ga0097620_100325492 Ga0097620_1003254923 148
485 3300009098 Ga0105245_10233131 Ga0105245_102331313 148
486 3300009098 Ga0105245_10762888 Ga0105245_107628882 148
487 3300009174 Ga0105241_10294941 Ga0105241_102949413 148
488 3300011119 Ga0105246_10771655 Ga0105246_107716552 148
489 3300013308 Ga0157375_10138694 Ga0157375_101386944 148
490 3300014497 Ga0182008_10041550 Ga0182008_100415502 148
491 3300014968 Ga0157379_10123351 Ga0157379_101233513 148
492 3300025245 Ga0207425_1001646 Ga0207425_10016464 148
493 3300025258 Ga0209129_1000124 Ga0209129_100012431 148
494 3300025273 Ga0209673_1013941 Ga0209673_10139414 148
495 3300025292 Ga0209676_1001896 Ga0209676_10018968 148
496 3300025295 Ga0209564_1000057 Ga0209564_100005790 148
497 3300025297 Ga0209758_1000214 Ga0209758_100021460 148
498 3300025298 Ga0209050_1000009 Ga0209050_1000009868 148
499 3300025299 Ga0209256_1030295 Ga0209256_10302952 148
500 3300025303 Ga0209051_1000008 Ga0209051_1000008625 148
501 3300025304 Ga0209257_1013149 Ga0209257_10131494 148
502 3300025927 Ga0207687_10205014 Ga0207687_102050143 148
503 3300025960 Ga0207651_10707367 Ga0207651_107073672 148
504 3300025986 Ga0207658_10917625 Ga0207658_109176252 148
505 3300026023 Ga0207677_10516605 Ga0207677_105166052 148
506 3300026088 Ga0207641_10053797 Ga0207641_100537972 148
507 3300026095 Ga0207676_10032796 Ga0207676_100327962 148
508 3300027312 Ga0209371_1000940 Ga0209371_100094010 148
509 3300027866 Ga0209813_10027757 Ga0209813_100277573 148
510 3300028379 Ga0268266_10159657 Ga0268266_101596573 148
511 3300028786 Ga0307517_10000810 Ga0307517_1000081016 148
512 3300030500 Ga0268256_1000839 Ga0268256_10008399 148
513 3300030522 Ga0307512_10069362 Ga0307512_100693622 148
514 3300031507 Ga0307509_10177394 Ga0307509_101773942 148
515 3300031548 Ga0307408_101718117 Ga0307408_1017181171 148
516 3300031730 Ga0307516_10208068 Ga0307516_102080682 148
517 3300031730 Ga0307516_10349510 Ga0307516_103495102 148
518 3300041407 Ga0439447_075986 Ga0439447_075986_149_601 148
519 3300041452 Ga0451793_0124301 Ga0451793_0124301_149_595 148
520 3300041491 Ga0451833_1010680 Ga0451833_1010680_182_688 148
521 3300041492 Ga0451835_0116812 Ga0451835_0116812_18_515 148
522 3300041997 Ga0439431_0000116 Ga0439431_0000116_3193_3645 148
523 3300042004 Ga0439445_0009703 Ga0439445_0009703_661_1113 148
524 3300042006 Ga0439432_000593 Ga0439432_000593_10319_10771 148
525 3300042009 Ga0439451_003517 Ga0439451_003517_1818_2270 148
526 3300042010 Ga0439452_005477 Ga0439452_005477_2984_3436 148
527 3300042016 Ga0439463_020904 Ga0439463_020904_556_1008 148
528 3300042156 Ga0439446_0008647 Ga0439446_0008647_490_942 148
529 3300046471 Ga0495650_0005914 Ga0495650_0005914_5503_5964 148
530 3300046471 Ga0495650_0013812 Ga0495650_0013812_3270_3725 148
531 3300046524 Ga0495648_0118920 Ga0495648_0118920_665_1168 148
532 3300048917 Ga0496114_0262711 Ga0496114_0262711_212_676 148
533 3300050493 nmdc:mga0k408_227497_c1 nmdc:mga0k408_227497_c1_131_634 148
534 3300050493 nmdc:mga0k408_6998_c1 nmdc:mga0k408_6998_c1_646_1134 148
535 3300050494 nmdc:mga06z11_264210_c1 nmdc:mga06z11_264210_c1_376_864 148
536 3300050495 nmdc:mga04h51_38905_c1 nmdc:mga04h51_38905_c1_437_925 148
537 3300050496 nmdc:mga07m45_1045_c1 nmdc:mga07m45_1045_c1_1392_1880 148
538 3300050496 nmdc:mga07m45_443325_c1 nmdc:mga07m45_443325_c1_266_736 148
539 3300053130 Ga0500642_0032574 Ga0500642_0032574_706_1206 148
540 3300053151 Ga0500604_0010581 Ga0500604_0010581_1394_1894 148
541 3300002987 JGI25159J45721_1021556 JGI25159J45721_10215561 149
542 3300003316 rootH1_10065105 rootH1_100651052 149
543 3300003322 rootL2_10016479 rootL2_100164793 149
544 3300003323 rootH1_10172482 rootH1_101724823 149
545 3300003784 Ga0055534_1003031 Ga0055534_10030313 149
546 3300005288 Ga0065714_10008805 Ga0065714_100088052 149
547 3300005293 Ga0065715_10210477 Ga0065715_102104772 149
548 3300005327 Ga0070658_10202820 Ga0070658_102028203 149
549 3300005327 Ga0070658_10348623 Ga0070658_103486232 149
550 3300005328 Ga0070676_10057235 Ga0070676_100572352 149
551 3300005328 Ga0070676_10392855 Ga0070676_103928552 149
552 3300005330 Ga0070690_100334864 Ga0070690_1003348642 149
553 3300005331 Ga0070670_100003584 Ga0070670_1000035849 149
554 3300005331 Ga0070670_100015006 Ga0070670_1000150063 149
555 3300005331 Ga0070670_100297529 Ga0070670_1002975292 149
556 3300005333 Ga0070677_10015608 Ga0070677_100156082 149
557 3300005333 Ga0070677_10027992 Ga0070677_100279922 149
558 3300005335 Ga0070666_10559709 Ga0070666_105597092 149
559 3300005338 Ga0068868_100547663 Ga0068868_1005476631 149
560 3300005338 Ga0068868_100789163 Ga0068868_1007891632 149
561 3300005344 Ga0070661_100141260 Ga0070661_1001412602 149
562 3300005347 Ga0070668_100143139 Ga0070668_1001431393 149
563 3300005353 Ga0070669_100133329 Ga0070669_1001333292 149
564 3300005353 Ga0070669_100264990 Ga0070669_1002649902 149
565 3300005354 Ga0070675_100007761 Ga0070675_1000077619 149
566 3300005354 Ga0070675_100022306 Ga0070675_1000223068 149
567 3300005355 Ga0070671_100050666 Ga0070671_1000506665 149
568 3300005356 Ga0070674_100001004 Ga0070674_1000010042 149
569 3300005356 Ga0070674_100553972 Ga0070674_1005539722 149
570 3300005364 Ga0070673_100003898 Ga0070673_1000038988 149
571 3300005364 Ga0070673_100015817 Ga0070673_1000158176 149
572 3300005364 Ga0070673_100423584 Ga0070673_1004235842 149
573 3300005366 Ga0070659_100797259 Ga0070659_1007972591 149
574 3300005367 Ga0070667_100090969 Ga0070667_1000909692 149
575 3300005441 Ga0070700_100582016 Ga0070700_1005820162 149
576 3300005445 Ga0070708_100156079 Ga0070708_1001560792 149
577 3300005455 Ga0070663_100529825 Ga0070663_1005298252 149
578 3300005455 Ga0070663_100599054 Ga0070663_1005990542 149
579 3300005456 Ga0070678_100005974 Ga0070678_10000597411 149
580 3300005456 Ga0070678_100014268 Ga0070678_1000142686 149
581 3300005456 Ga0070678_100069235 Ga0070678_1000692352 149
582 3300005456 Ga0070678_100322745 Ga0070678_1003227452 149
583 3300005459 Ga0068867_100032066 Ga0068867_1000320665 149
584 3300005459 Ga0068867_100077768 Ga0068867_1000777682 149
585 3300005459 Ga0068867_100099511 Ga0068867_1000995112 149
586 3300005467 Ga0070706_100001400 Ga0070706_10000140013 149
587 3300005468 Ga0070707_100024364 Ga0070707_1000243645 149
588 3300005471 Ga0070698_100124625 Ga0070698_1001246252 149
589 3300005518 Ga0070699_100067925 Ga0070699_1000679252 149
590 3300005539 Ga0068853_100222578 Ga0068853_1002225782 149
591 3300005543 Ga0070672_100000535 Ga0070672_1000005356 149
592 3300005543 Ga0070672_100002739 Ga0070672_1000027398 149
593 3300005548 Ga0070665_100102402 Ga0070665_1001024022 149
594 3300005548 Ga0070665_100361883 Ga0070665_1003618832 149
595 3300005564 Ga0070664_100222287 Ga0070664_1002222872 149
596 3300005564 Ga0070664_100591957 Ga0070664_1005919572 149
597 3300005577 Ga0068857_100298591 Ga0068857_1002985912 149
598 3300005578 Ga0068854_100020708 Ga0068854_1000207086 149
599 3300005578 Ga0068854_100034288 Ga0068854_1000342883 149
600 3300005616 Ga0068852_100094552 Ga0068852_1000945524 149
601 3300005616 Ga0068852_101608748 Ga0068852_1016087482 149
602 3300005618 Ga0068864_100011769 Ga0068864_10001176912 149
603 3300005618 Ga0068864_100018043 Ga0068864_1000180435 149
604 3300005718 Ga0068866_10422358 Ga0068866_104223581 149
605 3300005719 Ga0068861_100036330 Ga0068861_1000363302 149
606 3300005719 Ga0068861_100518491 Ga0068861_1005184912 149
607 3300005834 Ga0068851_10062559 Ga0068851_100625593 149
608 3300005834 Ga0068851_10147537 Ga0068851_101475373 149
609 3300005840 Ga0068870_10125652 Ga0068870_101256523 149
610 3300005844 Ga0068862_100019148 Ga0068862_1000191485 149
611 3300005844 Ga0068862_100559178 Ga0068862_1005591782 149
612 3300006042 Ga0075368_10069954 Ga0075368_100699542 149
613 3300006048 Ga0075363_100011747 Ga0075363_1000117475 149
614 3300006048 Ga0075363_100248920 Ga0075363_1002489202 149
615 3300006051 Ga0075364_10083153 Ga0075364_100831533 149
616 3300006163 Ga0070715_10068721 Ga0070715_100687212 149
617 3300006177 Ga0075362_10002180 Ga0075362_100021802 149
618 3300006177 Ga0075362_10008211 Ga0075362_100082115 149
619 3300006178 Ga0075367_10007898 Ga0075367_100078985 149
620 3300006178 Ga0075367_10053886 Ga0075367_100538862 149
621 3300006178 Ga0075367_10103594 Ga0075367_101035942 149
622 3300006178 Ga0075367_10287260 Ga0075367_102872601 149
623 3300006186 Ga0075369_10033641 Ga0075369_100336412 149
624 3300006186 Ga0075369_10078951 Ga0075369_100789512 149
625 3300006186 Ga0075369_10125905 Ga0075369_101259052 149
626 3300006195 Ga0075366_10024978 Ga0075366_100249782 149
627 3300006195 Ga0075366_10116553 Ga0075366_101165532 149
628 3300006195 Ga0075366_10258602 Ga0075366_102586022 149
629 3300006195 Ga0075366_10586154 Ga0075366_105861542 149
630 3300006237 Ga0097621_100006734 Ga0097621_1000067347 149
631 3300006237 Ga0097621_100396668 Ga0097621_1003966682 149
632 3300006353 Ga0075370_10009745 Ga0075370_100097455 149
633 3300006353 Ga0075370_10016095 Ga0075370_100160952 149
634 3300006353 Ga0075370_10144180 Ga0075370_101441802 149
635 3300006358 Ga0068871_100012983 Ga0068871_1000129832 149
636 3300006358 Ga0068871_100206425 Ga0068871_1002064252 149
637 3300006358 Ga0068871_100256037 Ga0068871_1002560372 149
638 3300006881 Ga0068865_100135512 Ga0068865_1001355124 149
639 3300009036 Ga0105244_10179130 Ga0105244_101791302 149
640 3300009093 Ga0105240_10032391 Ga0105240_100323917 149
641 3300009148 Ga0105243_10004307 Ga0105243_1000430710 149
642 3300009148 Ga0105243_10107881 Ga0105243_101078813 149
643 3300009174 Ga0105241_10378064 Ga0105241_103780641 149
644 3300009176 Ga0105242_11495446 Ga0105242_114954462 149
645 3300009177 Ga0105248_10188936 Ga0105248_101889361 149
646 3300009177 Ga0105248_10284097 Ga0105248_102840972 149
647 3300009177 Ga0105248_11334575 Ga0105248_113345752 149
648 3300009545 Ga0105237_10018505 Ga0105237_100185057 149
649 3300009551 Ga0105238_10859728 Ga0105238_108597282 149
650 3300009553 Ga0105249_10118632 Ga0105249_101186322 149
651 3300010375 Ga0105239_10050731 Ga0105239_100507312 149
652 3300013102 Ga0157371_10000196 Ga0157371_100001963 149
653 3300013102 Ga0157371_10019220 Ga0157371_100192203 149
654 3300013297 Ga0157378_11433377 Ga0157378_114333771 149
655 3300013306 Ga0163162_10056023 Ga0163162_100560232 149
656 3300013308 Ga0157375_10009460 Ga0157375_100094604 149
657 3300013308 Ga0157375_10431437 Ga0157375_104314372 149
658 3300014325 Ga0163163_10906929 Ga0163163_109069292 149
659 3300014326 Ga0157380_10220527 Ga0157380_102205272 149
660 3300014326 Ga0157380_10736337 Ga0157380_107363372 149
661 3300014497 Ga0182008_10000701 Ga0182008_1000070113 149
662 3300014745 Ga0157377_10000022 Ga0157377_10000022119 149
663 3300014745 Ga0157377_10298578 Ga0157377_102985782 149
664 3300014969 Ga0157376_10049020 Ga0157376_100490203 149
665 3300017792 Ga0163161_10164994 Ga0163161_101649942 149
666 3300017792 Ga0163161_10336175 Ga0163161_103361752 149
667 3300025284 Ga0209130_1002187 Ga0209130_10021874 149
668 3300025291 Ga0209675_1001070 Ga0209675_10010706 149
669 3300025292 Ga0209676_1003856 Ga0209676_10038565 149
670 3300025298 Ga0209050_1028919 Ga0209050_10289192 149
671 3300025303 Ga0209051_1023298 Ga0209051_10232983 149
672 3300025304 Ga0209257_1006977 Ga0209257_10069773 149
673 3300025315 Ga0207697_10003968 Ga0207697_100039687 149
674 3300025315 Ga0207697_10036931 Ga0207697_100369313 149
675 3300025321 Ga0207656_10043077 Ga0207656_100430773 149
676 3300025893 Ga0207682_10001045 Ga0207682_1000104514 149
677 3300025893 Ga0207682_10023398 Ga0207682_100233983 149
678 3300025893 Ga0207682_10117120 Ga0207682_101171202 149
679 3300025901 Ga0207688_10111235 Ga0207688_101112351 149
680 3300025901 Ga0207688_10136576 Ga0207688_101365762 149
681 3300025903 Ga0207680_10449111 Ga0207680_104491112 149
682 3300025905 Ga0207685_10119294 Ga0207685_101192942 149
683 3300025907 Ga0207645_10005861 Ga0207645_100058616 149
684 3300025907 Ga0207645_10282969 Ga0207645_102829692 149
685 3300025907 Ga0207645_10299197 Ga0207645_102991972 149
686 3300025907 Ga0207645_10337932 Ga0207645_103379322 149
687 3300025907 Ga0207645_10647845 Ga0207645_106478452 149
688 3300025908 Ga0207643_10170068 Ga0207643_101700681 149
689 3300025909 Ga0207705_10183502 Ga0207705_101835022 149
690 3300025910 Ga0207684_10023526 Ga0207684_100235262 149
691 3300025914 Ga0207671_10080363 Ga0207671_100803634 149
692 3300025918 Ga0207662_10099997 Ga0207662_100999972 149
693 3300025920 Ga0207649_10231166 Ga0207649_102311663 149
694 3300025922 Ga0207646_10205803 Ga0207646_102058032 149
695 3300025923 Ga0207681_10005176 Ga0207681_100051769 149
696 3300025923 Ga0207681_10652647 Ga0207681_106526472 149
697 3300025925 Ga0207650_10011652 Ga0207650_100116528 149
698 3300025925 Ga0207650_10037756 Ga0207650_100377564 149
699 3300025925 Ga0207650_10490911 Ga0207650_104909112 149
700 3300025926 Ga0207659_10000118 Ga0207659_1000011833 149
701 3300025926 Ga0207659_10048380 Ga0207659_100483802 149
702 3300025931 Ga0207644_10035212 Ga0207644_100352122 149
703 3300025931 Ga0207644_10804657 Ga0207644_108046571 149
704 3300025933 Ga0207706_10020371 Ga0207706_100203715 149
705 3300025935 Ga0207709_10086087 Ga0207709_100860872 149
706 3300025937 Ga0207669_10000706 Ga0207669_1000070613 149
707 3300025938 Ga0207704_10700234 Ga0207704_107002342 149
708 3300025940 Ga0207691_10000238 Ga0207691_1000023840 149
709 3300025940 Ga0207691_10008515 Ga0207691_100085156 149
710 3300025940 Ga0207691_10067518 Ga0207691_100675183 149
711 3300025940 Ga0207691_11231152 Ga0207691_112311521 149
712 3300025941 Ga0207711_10293458 Ga0207711_102934582 149
713 3300025942 Ga0207689_10015594 Ga0207689_100155948 149
714 3300025942 Ga0207689_10241497 Ga0207689_102414973 149
715 3300025945 Ga0207679_10069210 Ga0207679_100692103 149
716 3300025960 Ga0207651_10001131 Ga0207651_1000113112 149
717 3300025960 Ga0207651_10036335 Ga0207651_100363354 149
718 3300025961 Ga0207712_10203261 Ga0207712_102032611 149
719 3300025972 Ga0207668_10147265 Ga0207668_101472652 149
720 3300025981 Ga0207640_10016633 Ga0207640_100166333 149
721 3300025981 Ga0207640_11525890 Ga0207640_115258901 149
722 3300025986 Ga0207658_10159894 Ga0207658_101598943 149
723 3300026041 Ga0207639_10139452 Ga0207639_101394522 149
724 3300026041 Ga0207639_10140530 Ga0207639_101405304 149
725 3300026067 Ga0207678_10251494 Ga0207678_102514943 149
726 3300026088 Ga0207641_10070146 Ga0207641_100701461 149
727 3300026089 Ga0207648_10000032 Ga0207648_1000003215 149
728 3300026089 Ga0207648_10003526 Ga0207648_100035268 149
729 3300026089 Ga0207648_10055085 Ga0207648_100550852 149
730 3300026089 Ga0207648_10067687 Ga0207648_100676872 149
731 3300026089 Ga0207648_11352588 Ga0207648_113525882 149
732 3300026095 Ga0207676_10025653 Ga0207676_100256533 149
733 3300026116 Ga0207674_10023098 Ga0207674_100230988 149
734 3300026116 Ga0207674_10589646 Ga0207674_105896462 149
735 3300026118 Ga0207675_100734278 Ga0207675_1007342782 149
736 3300026121 Ga0207683_10013866 Ga0207683_100138664 149
737 3300026121 Ga0207683_10034729 Ga0207683_100347291 149
738 3300026121 Ga0207683_10172376 Ga0207683_101723762 149
739 3300026121 Ga0207683_10315112 Ga0207683_103151123 149
740 3300026121 Ga0207683_10707199 Ga0207683_107071991 149
741 3300026142 Ga0207698_11134620 Ga0207698_111346202 149
742 3300027876 Ga0209974_10002843 Ga0209974_100028437 149
743 3300028379 Ga0268266_10428228 Ga0268266_104282282 149
744 3300028380 Ga0268265_10025277 Ga0268265_100252773 149
745 3300028380 Ga0268265_10524472 Ga0268265_105244721 149
746 3300028786 Ga0307517_10239786 Ga0307517_102397862 149
747 3300028794 Ga0307515_10385571 Ga0307515_103855712 149
748 3300031548 Ga0307408_100316603 Ga0307408_1003166032 149
749 3300031548 Ga0307408_101898828 Ga0307408_1018988281 149
750 3300031616 Ga0307508_10333326 Ga0307508_103333262 149
751 3300031730 Ga0307516_10190729 Ga0307516_101907292 149
752 3300031730 Ga0307516_10238369 Ga0307516_102383692 149
753 3300031731 Ga0307405_10118214 Ga0307405_101182143 149
754 3300031731 Ga0307405_10439685 Ga0307405_104396852 149
755 3300031731 Ga0307405_10682739 Ga0307405_106827392 149
756 3300031824 Ga0307413_10982182 Ga0307413_109821822 149
757 3300031852 Ga0307410_10183324 Ga0307410_101833242 149
758 3300031901 Ga0307406_10027772 Ga0307406_100277724 149
759 3300031903 Ga0307407_10039868 Ga0307407_100398682 149
760 3300031995 Ga0307409_100592030 Ga0307409_1005920302 149
761 3300032002 Ga0307416_100070299 Ga0307416_1000702995 149
762 3300032002 Ga0307416_100387377 Ga0307416_1003873772 149
763 3300032004 Ga0307414_10518330 Ga0307414_105183302 149
764 3300032004 Ga0307414_10817313 Ga0307414_108173132 149
765 3300032005 Ga0307411_10002725 Ga0307411_100027253 149
766 3300032005 Ga0307411_10406528 Ga0307411_104065282 149
767 3300032126 Ga0307415_100908705 Ga0307415_1009087051 149
768 3300033180 Ga0307510_10115678 Ga0307510_101156783 149
769 3300035089 Ga0373944_0297103 Ga0373944_0297103_94_570 149
770 3300035117 Ga0373953_0099209 Ga0373953_0099209_629_1108 149
771 3300035725 Ga0373947_0698279 Ga0373947_0698279_194_670 149
772 3300036401 Ga0373937_0584925 Ga0373937_0584925_267_743 149
773 3300037068 Ga0373925_0133930 Ga0373925_0133930_50_529 149
774 3300038443 Ga0395901_1034261 Ga0395901_1034261_168_665 149
775 3300041456 Ga0451795_1050550 Ga0451795_1050550_122_616 149
776 3300041509 Ga0451843_1517086 Ga0451843_1517086_21_521 149
777 3300044693 Ga0466961_0127635 Ga0466961_0127635_1091_1564 149
778 3300046473 Ga0495582_0711454 Ga0495582_0711454_63_542 149
779 3300046506 Ga0495583_0044197 Ga0495583_0044197_586_1077 149
780 3300046517 Ga0495630_1217335 Ga0495630_1217335_73_537 149
781 3300046519 Ga0495632_0011776 Ga0495632_0011776_2057_2548 149
782 3300046528 Ga0495642_0121231 Ga0495642_0121231_234_725 149
783 3300046616 Ga0495668_0066901 Ga0495668_0066901_579_1070 149
784 3300046616 Ga0495668_0191610 Ga0495668_0191610_595_1044 149
785 3300046648 Ga0495611_0043832 Ga0495611_0043832_782_1273 149
786 3300046660 Ga0495625_0075490 Ga0495625_0075490_343_834 149
787 3300046660 Ga0495625_0328567 Ga0495625_0328567_131_646 149
788 3300046683 Ga0495658_0052799 Ga0495658_0052799_1225_1704 149
789 3300046683 Ga0495658_0062321 Ga0495658_0062321_843_1319 149
790 3300046692 Ga0495671_0239191 Ga0495671_0239191_323_814 149
791 3300046694 Ga0495649_0013683 Ga0495649_0013683_1244_1735 149
792 3300046794 Ga0495589_0280505 Ga0495589_0280505_77_568 149
793 3300046810 Ga0495660_0034709 Ga0495660_0034709_1409_1900 149
794 3300047319 Ga0495674_0999092 Ga0495674_0999092_95_574 149
795 3300047322 Ga0495680_0234393 Ga0495680_0234393_779_1258 149
796 3300047443 Ga0495687_022632 Ga0495687_022632_1082_1573 149
797 3300047443 Ga0495687_032090 Ga0495687_032090_830_1321 149
798 3300047471 Ga0495684_0110443 Ga0495684_0110443_1142_1621 149
799 3300048906 Ga0496103_0718219 Ga0496103_0718219_63_512 149
800 3300048907 Ga0496104_0090739 Ga0496104_0090739_1017_1493 149
801 3300048908 Ga0496105_0215713 Ga0496105_0215713_641_1117 149
802 3300048911 Ga0496108_0382544 Ga0496108_0382544_211_690 149
803 3300048913 Ga0496110_1233250 Ga0496110_1233250_168_644 149
804 3300048913 Ga0496110_1434843 Ga0496110_1434843_90_539 149
805 3300048920 Ga0496117_0250160 Ga0496117_0250160_38_523 149
806 3300048921 Ga0496118_0141631 Ga0496118_0141631_164_643 149
807 3300048924 Ga0496121_0702693 Ga0496121_0702693_47_496 149
808 3300048925 Ga0496122_0000320 Ga0496122_0000320_101912_102361 149
809 3300048926 Ga0496123_0000258 Ga0496123_0000258_9453_9902 149
810 3300048927 Ga0496124_0032014 Ga0496124_0032014_3513_3962 149
811 3300048928 Ga0496125_0214881 Ga0496125_0214881_569_1018 149
812 3300048929 Ga0496126_0389710 Ga0496126_0389710_226_675 149
813 3300049460 Ga0495682_0175501 Ga0495682_0175501_85_576 149
814 3300050489 nmdc:mga03683_122194_c1 nmdc:mga03683_122194_c1_167_658 149
815 3300050490 nmdc:mga03n38_301283_c1 nmdc:mga03n38_301283_c1_10_501 149
816 3300050490 nmdc:mga03n38_5373_c1 nmdc:mga03n38_5373_c1_2718_3209 149
817 3300050490 nmdc:mga03n38_93999_c1 nmdc:mga03n38_93999_c1_409_870 149
818 3300050491 nmdc:mga00v17_497083_c1 nmdc:mga00v17_497083_c1_37_528 149
819 3300050492 nmdc:mga0yw44_467056_c1 nmdc:mga0yw44_467056_c1_354_845 149
820 3300050493 nmdc:mga0k408_15900_c1 nmdc:mga0k408_15900_c1_2909_3400 149
821 3300050493 nmdc:mga0k408_1682_c1 nmdc:mga0k408_1682_c1_10077_10568 149
822 3300050493 nmdc:mga0k408_45759_c1 nmdc:mga0k408_45759_c1_1634_2113 149
823 3300050493 nmdc:mga0k408_555600_c1 nmdc:mga0k408_555600_c1_180_668 149
824 3300050493 nmdc:mga0k408_569995_c1 nmdc:mga0k408_569995_c1_151_612 149
825 3300050494 nmdc:mga06z11_104541_c1 nmdc:mga06z11_104541_c1_85_576 149
826 3300050494 nmdc:mga06z11_52528_c1 nmdc:mga06z11_52528_c1_1443_1934 149
827 3300050494 nmdc:mga06z11_9203_c1 nmdc:mga06z11_9203_c1_626_1087 149
828 3300050495 nmdc:mga04h51_120818_c1 nmdc:mga04h51_120818_c1_11_502 149
829 3300050496 nmdc:mga07m45_220705_c1 nmdc:mga07m45_220705_c1_349_840 149
830 3300050496 nmdc:mga07m45_24407_c1 nmdc:mga07m45_24407_c1_1233_1694 149
831 3300050496 nmdc:mga07m45_54386_c1 nmdc:mga07m45_54386_c1_63_554 149
832 3300050516 nmdc:mga0sz30_80685_c1 nmdc:mga0sz30_80685_c1_405_896 149
833 3300053093 Ga0500651_0023247 Ga0500651_0023247_3137_3622 149
834 3300053093 Ga0500651_0304391 Ga0500651_0304391_16_507 149
835 3300053134 Ga0500658_0003329 Ga0500658_0003329_3506_3997 149
836 3300053136 Ga0500559_0004739 Ga0500559_0004739_5124_5573 149
837 3300053136 Ga0500559_0100995 Ga0500559_0100995_628_1080 149
838 3300053139 Ga0500568_0016575 Ga0500568_0016575_213_704 149
839 3300053140 Ga0500573_0058921 Ga0500573_0058921_1277_1726 149
840 iso_pu_bacteria 2643221570 2643865861 149
841 iso_pu_bacteria 2643221596 2643993152 149
842 iso_pu_bacteria 2643221652 2644294266 149
843 iso_pu_bacteria 2990710928 2990712412 149
844 3300003323 rootH1_10016782 rootH1_100167824 150
845 3300003374 JGI25161J50226_1009984 JGI25161J50226_10099841 150
846 3300003775 Ga0055524_1000253 Ga0055524_100025321 150
847 3300003791 Ga0055530_10046583 Ga0055530_100465831 150
848 3300003792 Ga0055540_1014702 Ga0055540_10147022 150
849 3300003794 Ga0055531_10006988 Ga0055531_100069882 150
850 3300004625 Ga0055543_1020669 Ga0055543_10206691 150
851 3300005262 Ga0065165_1000270 Ga0065165_100027078 150
852 3300005353 Ga0070669_101089507 Ga0070669_1010895072 150
853 3300005355 Ga0070671_100667071 Ga0070671_1006670712 150
854 3300005364 Ga0070673_100639941 Ga0070673_1006399412 150
855 3300005548 Ga0070665_100273946 Ga0070665_1002739463 150
856 3300005616 Ga0068852_101088389 Ga0068852_1010883892 150
857 3300006195 Ga0075366_10089809 Ga0075366_100898092 150
858 3300006353 Ga0075370_10058418 Ga0075370_100584182 150
859 3300006944 Ga0099823_1004645 Ga0099823_10046452 150
860 3300006946 Ga0079104_1000040 Ga0079104_1000040169 150
861 3300009093 Ga0105240_10015568 Ga0105240_100155686 150
862 3300009545 Ga0105237_10020678 Ga0105237_100206786 150
863 3300009551 Ga0105238_10001855 Ga0105238_100018556 150
864 3300010375 Ga0105239_10000531 Ga0105239_1000053121 150
865 3300012475 Ga0157317_1007125 Ga0157317_10071251 150
866 3300012497 Ga0157319_1000006 Ga0157319_1000006198 150
867 3300014326 Ga0157380_11237216 Ga0157380_112372162 150
868 3300025284 Ga0209130_1078882 Ga0209130_10788821 150
869 3300025291 Ga0209675_1024852 Ga0209675_10248522 150
870 3300025298 Ga0209050_1014743 Ga0209050_10147433 150
871 3300025298 Ga0209050_1015584 Ga0209050_10155844 150
872 3300025299 Ga0209256_1000053 Ga0209256_1000053182 150
873 3300025299 Ga0209256_1000113 Ga0209256_1000113135 150
874 3300025299 Ga0209256_1000529 Ga0209256_100052925 150
875 3300025303 Ga0209051_1008691 Ga0209051_10086914 150
876 3300025304 Ga0209257_1000372 Ga0209257_100037273 150
877 3300025304 Ga0209257_1006120 Ga0209257_10061208 150
878 3300025923 Ga0207681_10751564 Ga0207681_107515642 150
879 3300025937 Ga0207669_10244550 Ga0207669_102445502 150
880 3300026089 Ga0207648_10263659 Ga0207648_102636592 150
881 3300026121 Ga0207683_10102351 Ga0207683_101023512 150
882 3300026142 Ga0207698_11167246 Ga0207698_111672461 150
883 3300027111 Ga0209281_1000074 Ga0209281_1000074246 150
884 3300027296 Ga0209389_1038041 Ga0209389_10380414 150
885 3300027312 Ga0209371_1028280 Ga0209371_10282801 150
886 3300028573 Ga0265334_10044721 Ga0265334_100447212 150
887 3300030500 Ga0268256_1032192 Ga0268256_10321921 150
888 3300031235 Ga0265330_10000054 Ga0265330_1000005480 150
889 3300031238 Ga0265332_10000002 Ga0265332_10000002274 150
890 3300031241 Ga0265325_10003978 Ga0265325_1000397810 150
891 3300031456 Ga0307513_10318603 Ga0307513_103186032 150
892 3300031548 Ga0307408_100039175 Ga0307408_1000391752 150
893 3300031711 Ga0265314_10000012 Ga0265314_10000012111 150
894 3300031711 Ga0265314_10356704 Ga0265314_103567042 150
895 3300031730 Ga0307516_10193842 Ga0307516_101938422 150
896 3300032004 Ga0307414_11178332 Ga0307414_111783321 150
897 3300035691 Ga0373931_0089697 Ga0373931_0089697_1194_1685 150
898 3300037312 Ga0395899_0287566 Ga0395899_0287566_448_909 150
899 3300042011 Ga0439454_012713 Ga0439454_012713_617_1135 150
900 3300042115 Ga0450911_000399 Ga0450911_000399_10073_10546 150
901 3300042127 Ga0450890_000920 Ga0450890_000920_2279_2797 150
902 3300042136 Ga0450900_040229 Ga0450900_040229_97_615 150
903 3300044683 Ga0466965_0308511 Ga0466965_0308511_315_809 150
904 3300044694 Ga0466963_0314390 Ga0466963_0314390_416_934 150
905 3300046691 Ga0495670_0160628 Ga0495670_0160628_84_590 150
906 3300048927 Ga0496124_0019585 Ga0496124_0019585_466_984 150
907 3300048928 Ga0496125_0058522 Ga0496125_0058522_1660_2133 150
908 3300048929 Ga0496126_0185739 Ga0496126_0185739_1248_1721 150
909 3300049571 Ga0501034_0434374 Ga0501034_0434374_189_650 150
910 3300049571 Ga0501034_0863935 Ga0501034_0863935_17_490 150
911 3300049573 Ga0501037_0164582 Ga0501037_0164582_246_716 150
912 3300049823 Ga0501044_0246292 Ga0501044_0246292_894_1364 150
913 3300050493 nmdc:mga0k408_114918_c1 nmdc:mga0k408_114918_c1_755_1273 150
914 3300050496 nmdc:mga07m45_290700_c1 nmdc:mga07m45_290700_c1_95_613 150
915 3300053156 Ga0500622_0001100 Ga0500622_0001100_5538_6044 150
916 iso_pu_bacteria 2643221609 2644060455 150
917 iso_pu_bacteria 2643221611 2644073777 150
918 iso_pu_bacteria 2643221628 2644159994 150
919 iso_pu_bacteria 2738543012 2739242484 150
920 iso_pu_bacteria 2816332133 2816473194 150
921 iso_pu_bacteria 2945972063 2945976298 150
922 3300001979 JGI24740J21852_10002313 JGI24740J21852_100023134 151
923 3300001989 JGI24739J22299_10042561 JGI24739J22299_100425612 151
924 3300002739 JGI25158J39367_1014260 JGI25158J39367_10142602 151
925 3300002739 JGI25158J39367_1017354 JGI25158J39367_10173541 151
926 3300002773 JGI25152J39213_1002086 JGI25152J39213_10020866 151
927 3300002773 JGI25152J39213_1003149 JGI25152J39213_10031493 151
928 3300002773 JGI25152J39213_1011911 JGI25152J39213_10119113 151
929 3300002774 JGI25150J39212_1000609 JGI25150J39212_10006097 151
930 3300002774 JGI25150J39212_1015273 JGI25150J39212_10152732 151
931 3300002987 JGI25159J45721_1003702 JGI25159J45721_10037025 151
932 3300002987 JGI25159J45721_1005109 JGI25159J45721_10051093 151
933 3300003187 JGI25151J46595_10003523 JGI25151J46595_100035235 151
934 3300003187 JGI25151J46595_10003837 JGI25151J46595_100038372 151
935 3300003187 JGI25151J46595_10007545 JGI25151J46595_100075455 151
936 3300003187 JGI25151J46595_10044085 JGI25151J46595_100440852 151
937 3300003215 JGI25153J46596_10007592 JGI25153J46596_100075925 151
938 3300003215 JGI25153J46596_10036140 JGI25153J46596_100361402 151
939 3300003316 rootH1_10066517 rootH1_100665171 151
940 3300003320 rootH2_10007251 rootH2_100072512 151
941 3300003322 rootL2_10196900 rootL2_101969003 151
942 3300003323 rootH1_10096611 rootH1_100966112 151
943 3300003354 JGI25160J50197_1005413 JGI25160J50197_10054135 151
944 3300003354 JGI25160J50197_1009233 JGI25160J50197_10092333 151
945 3300003374 JGI25161J50226_1002087 JGI25161J50226_10020873 151
946 3300003374 JGI25161J50226_1003898 JGI25161J50226_10038982 151
947 3300003578 Ga0006562J51391_1156325 Ga0006562J51391_11563252 151
948 3300003760 Ga0055527_1018589 Ga0055527_10185891 151
949 3300003761 Ga0055535_1000662 Ga0055535_100066223 151
950 3300003762 Ga0055542_1000009 Ga0055542_1000009370 151
951 3300003771 Ga0055526_1008063 Ga0055526_10080635 151
952 3300003771 Ga0055526_1010870 Ga0055526_10108703 151
953 3300003773 Ga0055537_1000108 Ga0055537_100010848 151
954 3300003773 Ga0055537_1003033 Ga0055537_10030335 151
955 3300003773 Ga0055537_1003352 Ga0055537_10033523 151
956 3300003775 Ga0055524_1006035 Ga0055524_10060355 151
957 3300003775 Ga0055524_1008753 Ga0055524_10087533 151
958 3300003781 Ga0055536_1005750 Ga0055536_10057502 151
959 3300003781 Ga0055536_1006473 Ga0055536_10064734 151
960 3300003781 Ga0055536_1009306 Ga0055536_10093062 151
961 3300003784 Ga0055534_1000109 Ga0055534_100010948 151
962 3300003784 Ga0055534_1002348 Ga0055534_10023486 151
963 3300003784 Ga0055534_1006754 Ga0055534_10067543 151
964 3300003790 Ga0055528_1000173 Ga0055528_100017348 151
965 3300003790 Ga0055528_1006487 Ga0055528_10064875 151
966 3300003790 Ga0055528_1007185 Ga0055528_10071853 151
967 3300003790 Ga0055528_1027916 Ga0055528_10279161 151
968 3300003791 Ga0055530_10001357 Ga0055530_1000135712 151
969 3300003791 Ga0055530_10011736 Ga0055530_100117363 151
970 3300003792 Ga0055540_1001177 Ga0055540_10011779 151
971 3300003792 Ga0055540_1001272 Ga0055540_100127213 151
972 3300003792 Ga0055540_1003479 Ga0055540_10034793 151
973 3300003794 Ga0055531_10001459 Ga0055531_1000145914 151
974 3300003794 Ga0055531_10003853 Ga0055531_100038536 151
975 3300003794 Ga0055531_10008746 Ga0055531_100087463 151
976 3300004625 Ga0055543_1003320 Ga0055543_10033205 151
977 3300004625 Ga0055543_1003901 Ga0055543_10039013 151
978 3300005262 Ga0065165_1007482 Ga0065165_10074825 151
979 3300005262 Ga0065165_1015198 Ga0065165_10151983 151
980 3300005288 Ga0065714_10006079 Ga0065714_100060794 151
981 3300005289 Ga0065704_10075643 Ga0065704_100756432 151
982 3300005327 Ga0070658_10294256 Ga0070658_102942562 151
983 3300005344 Ga0070661_100048100 Ga0070661_1000481003 151
984 3300005353 Ga0070669_100405460 Ga0070669_1004054602 151
985 3300005366 Ga0070659_100416211 Ga0070659_1004162112 151
986 3300005456 Ga0070678_101041865 Ga0070678_1010418651 151
987 3300005457 Ga0070662_100361123 Ga0070662_1003611232 151
988 3300005459 Ga0068867_100096795 Ga0068867_1000967953 151
989 3300005539 Ga0068853_100014608 Ga0068853_1000146086 151
990 3300005539 Ga0068853_100246202 Ga0068853_1002462022 151
991 3300005563 Ga0068855_100245462 Ga0068855_1002454623 151
992 3300005564 Ga0070664_100106113 Ga0070664_1001061133 151
993 3300005577 Ga0068857_100170387 Ga0068857_1001703872 151
994 3300005578 Ga0068854_100266909 Ga0068854_1002669092 151
995 3300005578 Ga0068854_101059543 Ga0068854_1010595431 151
996 3300006038 Ga0075365_10029510 Ga0075365_100295104 151
997 3300006042 Ga0075368_10039873 Ga0075368_100398732 151
998 3300006051 Ga0075364_10009592 Ga0075364_100095924 151
999 3300006051 Ga0075364_10036051 Ga0075364_100360512 151
1000 3300006051 Ga0075364_10513618 Ga0075364_105136182 151
1001 3300006058 Ga0075432_10006244 Ga0075432_100062444 151
1002 3300006177 Ga0075362_10005196 Ga0075362_100051963 151
1003 3300006178 Ga0075367_10410774 Ga0075367_104107742 151
1004 3300006186 Ga0075369_10034024 Ga0075369_100340243 151
1005 3300006195 Ga0075366_10004447 Ga0075366_100044471 151
1006 3300006195 Ga0075366_10011444 Ga0075366_100114445 151
1007 3300006195 Ga0075366_10015312 Ga0075366_100153124 151
1008 3300006195 Ga0075366_10214657 Ga0075366_102146572 151
1009 3300006237 Ga0097621_100275860 Ga0097621_1002758601 151
1010 3300006353 Ga0075370_10001469 Ga0075370_100014695 151
1011 3300006353 Ga0075370_10006236 Ga0075370_100062365 151
1012 3300006353 Ga0075370_10007736 Ga0075370_100077364 151
1013 3300006353 Ga0075370_10062392 Ga0075370_100623922 151
1014 3300006353 Ga0075370_10064153 Ga0075370_100641532 151
1015 3300006353 Ga0075370_10245908 Ga0075370_102459082 151
1016 3300006948 Ga0099826_10000510 Ga0099826_1000051011 151
1017 3300006948 Ga0099826_10130486 Ga0099826_101304862 151
1018 3300009036 Ga0105244_10003834 Ga0105244_100038343 151
1019 3300009036 Ga0105244_10120607 Ga0105244_101206072 151
1020 3300009093 Ga0105240_10196814 Ga0105240_101968141 151
1021 3300009093 Ga0105240_10215319 Ga0105240_102153192 151
1022 3300009098 Ga0105245_10119233 Ga0105245_101192333 151
1023 3300009148 Ga0105243_10000884 Ga0105243_1000088416 151
1024 3300009148 Ga0105243_10005624 Ga0105243_1000562410 151
1025 3300009148 Ga0105243_11391317 Ga0105243_113913172 151
1026 3300009545 Ga0105237_10030172 Ga0105237_100301724 151
1027 3300009551 Ga0105238_10174918 Ga0105238_101749182 151
1028 3300009551 Ga0105238_11113166 Ga0105238_111131662 151
1029 3300009553 Ga0105249_12312655 Ga0105249_123126551 151
1030 3300010375 Ga0105239_10208877 Ga0105239_102088773 151
1031 3300010375 Ga0105239_10892832 Ga0105239_108928322 151
1032 3300011119 Ga0105246_10016577 Ga0105246_100165773 151
1033 3300011119 Ga0105246_10029657 Ga0105246_100296572 151
1034 3300011119 Ga0105246_10659367 Ga0105246_106593671 151
1035 3300012502 Ga0157347_1001297 Ga0157347_10012972 151
1036 3300012502 Ga0157347_1039672 Ga0157347_10396721 151
1037 3300013100 Ga0157373_10058443 Ga0157373_100584433 151
1038 3300013100 Ga0157373_10114794 Ga0157373_101147942 151
1039 3300013102 Ga0157371_10049015 Ga0157371_100490153 151
1040 3300013104 Ga0157370_10278494 Ga0157370_102784942 151
1041 3300013105 Ga0157369_10009831 Ga0157369_1000983111 151
1042 3300014497 Ga0182008_10000250 Ga0182008_1000025016 151
1043 3300014497 Ga0182008_10001970 Ga0182008_100019705 151
1044 3300014969 Ga0157376_10965693 Ga0157376_109656932 151
1045 3300015261 Ga0182006_1001323 Ga0182006_100132311 151
1046 3300015261 Ga0182006_1088819 Ga0182006_10888192 151
1047 3300015262 Ga0182007_10001221 Ga0182007_100012215 151
1048 3300015265 Ga0182005_1129294 Ga0182005_11292941 151
1049 3300017792 Ga0163161_10000332 Ga0163161_1000033215 151
1050 3300017792 Ga0163161_10023778 Ga0163161_100237785 151
1051 3300017792 Ga0163161_10110606 Ga0163161_101106062 151
1052 3300017792 Ga0163161_10277537 Ga0163161_102775372 151
1053 3300025208 Ga0209436_116173 Ga0209436_1161732 151
1054 3300025228 Ga0209672_100443 Ga0209672_1004439 151
1055 3300025229 Ga0209147_101320 Ga0209147_1013203 151
1056 3300025242 Ga0209258_100009 Ga0209258_100009284 151
1057 3300025245 Ga0207425_1000977 Ga0207425_10009778 151
1058 3300025254 Ga0209148_1000007 Ga0209148_1000007284 151
1059 3300025258 Ga0209129_1000013 Ga0209129_1000013357 151
1060 3300025258 Ga0209129_1002210 Ga0209129_10022102 151
1061 3300025263 Ga0209565_1000138 Ga0209565_100013837 151
1062 3300025263 Ga0209565_1000243 Ga0209565_100024323 151
1063 3300025263 Ga0209565_1000880 Ga0209565_10008803 151
1064 3300025273 Ga0209673_1000064 Ga0209673_100006437 151
1065 3300025273 Ga0209673_1000188 Ga0209673_100018816 151
1066 3300025273 Ga0209673_1000260 Ga0209673_100026075 151
1067 3300025273 Ga0209673_1001331 Ga0209673_10013318 151
1068 3300025284 Ga0209130_1000705 Ga0209130_100070516 151
1069 3300025284 Ga0209130_1001526 Ga0209130_10015269 151
1070 3300025291 Ga0209675_1000036 Ga0209675_100003637 151
1071 3300025291 Ga0209675_1000086 Ga0209675_100008637 151
1072 3300025291 Ga0209675_1004601 Ga0209675_10046013 151
1073 3300025291 Ga0209675_1006645 Ga0209675_10066453 151
1074 3300025292 Ga0209676_1000004 Ga0209676_1000004217 151
1075 3300025292 Ga0209676_1000105 Ga0209676_10001053 151
1076 3300025292 Ga0209676_1000287 Ga0209676_10002872 151
1077 3300025292 Ga0209676_1007209 Ga0209676_10072093 151
1078 3300025294 Ga0209025_1000168 Ga0209025_100016882 151
1079 3300025294 Ga0209025_1000220 Ga0209025_100022049 151
1080 3300025294 Ga0209025_1001388 Ga0209025_100138812 151
1081 3300025294 Ga0209025_1019541 Ga0209025_10195412 151
1082 3300025294 Ga0209025_1020869 Ga0209025_10208693 151
1083 3300025294 Ga0209025_1047983 Ga0209025_10479832 151
1084 3300025295 Ga0209564_1000222 Ga0209564_100022225 151
1085 3300025295 Ga0209564_1000287 Ga0209564_100028723 151
1086 3300025297 Ga0209758_1000134 Ga0209758_100013467 151
1087 3300025297 Ga0209758_1020433 Ga0209758_10204332 151
1088 3300025297 Ga0209758_1144446 Ga0209758_11444461 151
1089 3300025298 Ga0209050_1000002 Ga0209050_1000002727 151
1090 3300025298 Ga0209050_1000405 Ga0209050_100040563 151
1091 3300025298 Ga0209050_1005672 Ga0209050_10056729 151
1092 3300025299 Ga0209256_1000060 Ga0209256_1000060134 151
1093 3300025299 Ga0209256_1000222 Ga0209256_100022279 151
1094 3300025302 Ga0207426_1000095 Ga0207426_100009562 151
1095 3300025302 Ga0207426_1000100 Ga0207426_1000100134 151
1096 3300025303 Ga0209051_1000002 Ga0209051_1000002495 151
1097 3300025303 Ga0209051_1000064 Ga0209051_1000064218 151
1098 3300025303 Ga0209051_1000248 Ga0209051_100024871 151
1099 3300025303 Ga0209051_1000473 Ga0209051_100047326 151
1100 3300025303 Ga0209051_1005090 Ga0209051_10050902 151
1101 3300025304 Ga0209257_1000002 Ga0209257_1000002636 151
1102 3300025304 Ga0209257_1000109 Ga0209257_1000109218 151
1103 3300025304 Ga0209257_1000286 Ga0209257_100028614 151
1104 3300025304 Ga0209257_1003016 Ga0209257_100301616 151
1105 3300025304 Ga0209257_1023588 Ga0209257_10235882 151
1106 3300025321 Ga0207656_10003839 Ga0207656_100038392 151
1107 3300025728 Ga0207655_1005321 Ga0207655_10053216 151
1108 3300025914 Ga0207671_10326508 Ga0207671_103265082 151
1109 3300025920 Ga0207649_10222314 Ga0207649_102223141 151
1110 3300025924 Ga0207694_10147242 Ga0207694_101472423 151
1111 3300025932 Ga0207690_10430994 Ga0207690_104309942 151
1112 3300025933 Ga0207706_10029788 Ga0207706_100297882 151
1113 3300025933 Ga0207706_10062210 Ga0207706_100622102 151
1114 3300025934 Ga0207686_10865575 Ga0207686_108655751 151
1115 3300025935 Ga0207709_10000604 Ga0207709_1000060411 151
1116 3300025935 Ga0207709_10014639 Ga0207709_100146393 151
1117 3300025935 Ga0207709_10593571 Ga0207709_105935712 151
1118 3300025945 Ga0207679_10186959 Ga0207679_101869593 151
1119 3300025949 Ga0207667_10014800 Ga0207667_100148003 151
1120 3300025981 Ga0207640_10150578 Ga0207640_101505782 151
1121 3300025981 Ga0207640_10478832 Ga0207640_104788322 151
1122 3300025981 Ga0207640_11039078 Ga0207640_110390781 151
1123 3300026041 Ga0207639_10031874 Ga0207639_100318742 151
1124 3300026041 Ga0207639_10747635 Ga0207639_107476352 151
1125 3300026116 Ga0207674_10189806 Ga0207674_101898062 151
1126 3300026121 Ga0207683_10949912 Ga0207683_109499122 151
1127 3300026121 Ga0207683_12004388 Ga0207683_120043881 151
1128 3300027666 Ga0209282_1025173 Ga0209282_10251732 151
1129 3300027866 Ga0209813_10050527 Ga0209813_100505272 151
1130 3300027907 Ga0207428_10229984 Ga0207428_102299842 151
1131 3300027907 Ga0207428_10432644 Ga0207428_104326442 151
1132 3300028380 Ga0268265_10006770 Ga0268265_100067709 151
1133 3300028794 Ga0307515_10184870 Ga0307515_101848702 151
1134 3300028794 Ga0307515_10268025 Ga0307515_102680252 151
1135 3300030522 Ga0307512_10291665 Ga0307512_102916651 151
1136 3300030731 Ga0316177_1126994 Ga0316177_11269943 151
1137 3300030733 Ga0314311_1074524 Ga0314311_10745249 151
1138 3300030734 Ga0316179_1073255 Ga0316179_10732554 151
1139 3300030736 Ga0316180_1159712 Ga0316180_11597122 151
1140 3300030742 Ga0316183_1087890 Ga0316183_108789014 151
1141 3300030745 Ga0316182_1123892 Ga0316182_11238921 151
1142 3300031251 Ga0265327_10000186 Ga0265327_1000018673 151
1143 3300031548 Ga0307408_100997816 Ga0307408_1009978161 151
1144 3300031731 Ga0307405_10049069 Ga0307405_100490692 151
1145 3300031731 Ga0307405_10138418 Ga0307405_101384182 151
1146 3300031731 Ga0307405_10247467 Ga0307405_102474672 151
1147 3300031852 Ga0307410_10119839 Ga0307410_101198392 151
1148 3300031901 Ga0307406_10000467 Ga0307406_1000046720 151
1149 3300031901 Ga0307406_10001774 Ga0307406_100017743 151
1150 3300031903 Ga0307407_10543428 Ga0307407_105434282 151
1151 3300031911 Ga0307412_10045997 Ga0307412_100459973 151
1152 3300031911 Ga0307412_10190949 Ga0307412_101909492 151
1153 3300031911 Ga0307412_10247660 Ga0307412_102476602 151
1154 3300031911 Ga0307412_10251851 Ga0307412_102518512 151
1155 3300032002 Ga0307416_100566115 Ga0307416_1005661152 151
1156 3300032005 Ga0307411_10505469 Ga0307411_105054692 151
1157 3300032005 Ga0307411_11029771 Ga0307411_110297712 151
1158 3300032005 Ga0307411_11304708 Ga0307411_113047082 151
1159 3300041452 Ga0451793_0053218 Ga0451793_0053218_241_696 151
1160 3300041498 Ga0451841_0569011 Ga0451841_0569011_83_538 151
1161 3300042876 Ga0451577_0038274 Ga0451577_0038274_1168_1647 151
1162 3300042876 Ga0451577_0501386 Ga0451577_0501386_398_877 151
1163 3300044673 Ga0453683_0073668 Ga0453683_0073668_1205_1684 151
1164 3300045051 Ga0451576_0167326 Ga0451576_0167326_384_863 151
1165 3300046453 Ga0495627_035541 Ga0495627_035541_466_921 151
1166 3300046459 Ga0495629_0311230 Ga0495629_0311230_585_1040 151
1167 3300046460 Ga0495638_0035673 Ga0495638_0035673_1626_2081 151
1168 3300046506 Ga0495583_0353486 Ga0495583_0353486_112_567 151
1169 3300046512 Ga0495610_0078883 Ga0495610_0078883_1040_1495 151
1170 3300046512 Ga0495610_0113459 Ga0495610_0113459_189_644 151
1171 3300046513 Ga0495616_0000346 Ga0495616_0000346_20920_21375 151
1172 3300046515 Ga0495620_0044562 Ga0495620_0044562_1250_1705 151
1173 3300046518 Ga0495631_0000146 Ga0495631_0000146_15524_15979 151
1174 3300046520 Ga0495637_0012308 Ga0495637_0012308_739_1194 151
1175 3300046530 Ga0495654_0068165 Ga0495654_0068165_1184_1639 151
1176 3300046530 Ga0495654_0128131 Ga0495654_0128131_474_929 151
1177 3300046538 Ga0495609_0041124 Ga0495609_0041124_437_892 151
1178 3300046539 Ga0495621_0004688 Ga0495621_0004688_3279_3734 151
1179 3300046557 Ga0495622_0123800 Ga0495622_0123800_94_549 151
1180 3300046660 Ga0495625_0000254 Ga0495625_0000254_65007_65501 151
1181 3300046660 Ga0495625_0025317 Ga0495625_0025317_2224_2679 151
1182 3300046665 Ga0495661_0107487 Ga0495661_0107487_473_928 151
1183 3300046674 Ga0495588_0128275 Ga0495588_0128275_591_1046 151
1184 3300046674 Ga0495588_0540591 Ga0495588_0540591_50_505 151
1185 3300046691 Ga0495670_0097284 Ga0495670_0097284_484_939 151
1186 3300046691 Ga0495670_0105937 Ga0495670_0105937_788_1243 151
1187 3300046692 Ga0495671_0001736 Ga0495671_0001736_5418_5873 151
1188 3300047321 Ga0495676_0442978 Ga0495676_0442978_184_639 151
1189 3300047673 Ga0495593_0003398 Ga0495593_0003398_1497_1952 151
1190 3300048089 Ga0495614_0004586 Ga0495614_0004586_4323_4778 151
1191 3300048904 Ga0496101_0004342 Ga0496101_0004342_1643_2098 151
1192 3300048919 Ga0496116_0028666 Ga0496116_0028666_2526_2981 151
1193 3300048919 Ga0496116_0058825 Ga0496116_0058825_24_479 151
1194 3300048919 Ga0496116_0072703 Ga0496116_0072703_1589_2044 151
1195 3300048920 Ga0496117_0031641 Ga0496117_0031641_3442_3897 151
1196 3300048920 Ga0496117_0034303 Ga0496117_0034303_1571_2026 151
1197 3300048920 Ga0496117_0103645 Ga0496117_0103645_199_654 151
1198 3300048920 Ga0496117_0108662 Ga0496117_0108662_677_1132 151
1199 3300048921 Ga0496118_0007154 Ga0496118_0007154_4810_5265 151
1200 3300048921 Ga0496118_0062718 Ga0496118_0062718_1102_1557 151
1201 3300048921 Ga0496118_0151133 Ga0496118_0151133_520_975 151
1202 3300048924 Ga0496121_0049523 Ga0496121_0049523_239_694 151
1203 3300048924 Ga0496121_0138815 Ga0496121_0138815_71_526 151
1204 3300048925 Ga0496122_0072076 Ga0496122_0072076_516_1007 151
1205 3300048925 Ga0496122_0132058 Ga0496122_0132058_1087_1542 151
1206 3300048926 Ga0496123_0073492 Ga0496123_0073492_1353_1808 151
1207 3300048926 Ga0496123_0084018 Ga0496123_0084018_1406_1861 151
1208 3300048927 Ga0496124_0084256 Ga0496124_0084256_1019_1474 151
1209 3300048927 Ga0496124_0092301 Ga0496124_0092301_202_657 151
1210 3300048927 Ga0496124_0160561 Ga0496124_0160561_542_997 151
1211 3300048928 Ga0496125_0022796 Ga0496125_0022796_2680_3135 151
1212 3300048928 Ga0496125_0050508 Ga0496125_0050508_2832_3287 151
1213 3300048928 Ga0496125_0219538 Ga0496125_0219538_238_729 151
1214 3300049459 Ga0495678_187751 Ga0495678_187751_91_582 151
1215 3300049679 Ga0501249_004010 Ga0501249_004010_2115_2612 151
1216 3300049759 Ga0501262_000047 Ga0501262_000047_425_928 151
1217 3300050489 nmdc:mga03683_2164_c2 nmdc:mga03683_2164_c2_1103_1597 151
1218 3300050490 nmdc:mga03n38_962_c1 nmdc:mga03n38_962_c1_6842_7336 151
1219 3300050491 nmdc:mga00v17_141610_c1 nmdc:mga00v17_141610_c1_1023_1517 151
1220 3300050491 nmdc:mga00v17_17913_c1 nmdc:mga00v17_17913_c1_2884_3378 151
1221 3300050491 nmdc:mga00v17_467037_c1 nmdc:mga00v17_467037_c1_352_807 151
1222 3300050491 nmdc:mga00v17_77136_c1 nmdc:mga00v17_77136_c1_1506_2000 151
1223 3300050492 nmdc:mga0yw44_44737_c1 nmdc:mga0yw44_44737_c1_1412_1915 151
1224 3300050493 nmdc:mga0k408_128491_c1 nmdc:mga0k408_128491_c1_83_538 151
1225 3300050493 nmdc:mga0k408_220108_c2 nmdc:mga0k408_220108_c2_118_573 151
1226 3300050493 nmdc:mga0k408_50999_c1 nmdc:mga0k408_50999_c1_221_715 151
1227 3300050493 nmdc:mga0k408_78539_c1 nmdc:mga0k408_78539_c1_1411_1914 151
1228 3300050495 nmdc:mga04h51_116994_c1 nmdc:mga04h51_116994_c1_249_743 151
1229 3300050496 nmdc:mga07m45_1052_c1 nmdc:mga07m45_1052_c1_1841_2296 151
1230 3300050496 nmdc:mga07m45_187455_c1 nmdc:mga07m45_187455_c1_445_900 151
1231 3300050496 nmdc:mga07m45_256134_c1 nmdc:mga07m45_256134_c1_422_916 151
1232 3300050496 nmdc:mga07m45_479976_c1 nmdc:mga07m45_479976_c1_70_528 151
1233 3300050496 nmdc:mga07m45_577170_c1 nmdc:mga07m45_577170_c1_164_619 151
1234 3300050496 nmdc:mga07m45_595_c2 nmdc:mga07m45_595_c2_13315_13770 151
1235 3300050496 nmdc:mga07m45_981_c1 nmdc:mga07m45_981_c1_10566_11060 151
1236 3300053079 Ga0500610_0014869 Ga0500610_0014869_1452_1907 151
1237 3300053079 Ga0500610_0030679 Ga0500610_0030679_511_966 151
1238 3300053079 Ga0500610_0128132 Ga0500610_0128132_205_660 151
1239 3300053087 Ga0500643_072680 Ga0500643_072680_163_618 151
1240 3300053088 Ga0500644_0003434 Ga0500644_0003434_2627_3085 151
1241 3300053091 Ga0500647_0136843 Ga0500647_0136843_437_892 151
1242 3300053093 Ga0500651_0003756 Ga0500651_0003756_702_1157 151
1243 3300053107 Ga0500560_216069 Ga0500560_216069_14_469 151
1244 3300053108 Ga0500562_035386 Ga0500562_035386_112_570 151
1245 3300053109 Ga0500569_257867 Ga0500569_257867_94_549 151
1246 3300053110 Ga0500571_000381 Ga0500571_000381_15463_15918 151
1247 3300053117 Ga0500593_004216 Ga0500593_004216_4126_4581 151
1248 3300053120 Ga0500597_123433 Ga0500597_123433_276_731 151
1249 3300053121 Ga0500607_001809 Ga0500607_001809_2216_2671 151
1250 3300053121 Ga0500607_054656 Ga0500607_054656_1437_1892 151
1251 3300053122 Ga0500608_055736 Ga0500608_055736_1170_1625 151
1252 3300053122 Ga0500608_120170 Ga0500608_120170_139_594 151
1253 3300053122 Ga0500608_141312 Ga0500608_141312_222_677 151
1254 3300053128 Ga0500626_024197 Ga0500626_024197_1379_1834 151
1255 3300053133 Ga0500655_002877 Ga0500655_002877_1812_2267 151
1256 3300053134 Ga0500658_0000192 Ga0500658_0000192_11083_11538 151
1257 3300053134 Ga0500658_0000417 Ga0500658_0000417_6601_7056 151
1258 3300053136 Ga0500559_0021048 Ga0500559_0021048_1454_1909 151
1259 3300053137 Ga0500561_0089930 Ga0500561_0089930_140_595 151
1260 3300053138 Ga0500564_028526 Ga0500564_028526_226_681 151
1261 3300053139 Ga0500568_0003566 Ga0500568_0003566_2987_3442 151
1262 3300053139 Ga0500568_0211802 Ga0500568_0211802_79_537 151
1263 3300053141 Ga0500574_001773 Ga0500574_001773_1913_2368 151
1264 3300053142 Ga0500577_0164507 Ga0500577_0164507_175_633 151
1265 3300053153 Ga0500616_0055380 Ga0500616_0055380_737_1192 151
1266 3300053154 Ga0500619_133770 Ga0500619_133770_350_805 151
1267 3300053158 Ga0500627_0000737 Ga0500627_0000737_4441_4896 151
1268 3300053161 Ga0500634_0133993 Ga0500634_0133993_432_887 151
1269 3300053162 Ga0500638_085214 Ga0500638_085214_154_609 151
1270 3300053729 Ga0500625_191069 Ga0500625_191069_174_629 151
1271 3300053735 Ga0500596_041041 Ga0500596_041041_185_640 151
1272 iso_pu_bacteria 2547132374 2548497452 151
1273 iso_pu_bacteria 2643221717 2644647427 151
1274 iso_pu_bacteria 2738541307 2738884670 151

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

59

117

0.97

PF13463

HTH_27

Winged helix DNA-binding domain

61

126

0.94

PF01047

MarR

MarR family

61

117

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9389 38 97
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9381 38 88
5j6x-assembly2.cif.gz_B crystal structure of the apo-zalpha of zebrafish pkz 0.9252 38 98
5duk-assembly1.cif.gz_B n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9136 38 88
5f7p-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes 0.9133 39 96
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9532 35 95 1.10.10.10
af_K7LWV0_206_275_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9512 52 82 1.10.10.10
af_Q58793_322_389_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9406 36 99 1.10.10.10
5dukA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9396 38 78 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9389 38 97 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4R1VTS1-F1-model_v4 deleted 0.9323 20 146
AF-N8QEA3-F1-model_v4 HTH marR-type domain-containing protein 0.9256 20 142 GO:0003700
GO:0006950
AF-A0A109BED7-F1-model_v4 deleted 0.9243 16 151
AF-A0A3D3PI80-F1-model_v4 MarR family transcriptional regulator 0.9235 1 138 GO:0003700
GO:0006950
AF-A0A4S8F2F3-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9131 1 142 GO:0003700
GO:0006950

Feature Viewer

pLDDT pTM Quality
90.78 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map