F492297

General Info

Members Datasets Scaffolds Average Seq Length
1260 399 1251 256

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0087549|Ga0373937_0087549_134_1015
Length 293
Sequence MVRSLLEGVRAGGLYNRGSMIARPRAGDPIQTEADMVLEGRVALVTGAASGIGKSIAQRFARAGARVVIADLAIDGAAAAAREIGGDDRAFAVAMDVTDEAAVNAGVAKAIAAYGGIDVLVSNAGVQIVHPLEEFTYAEWRKMLAIHLDGAFLTTRACLPHMYRAGRGSLIYMGSVHSKLASVLKAPYVTAKHGLIGLAKTMAKEGAPHGVRANVICPGFVRTPLVDKQIPEQSRTLGISEEDVVKKVMLKDTVDGEFTTLEDVAEVALMFAAFPTNALTGQSLVVSHGWFMQ

Samples

Sample ID Description Type Environment
1 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
2 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
3 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
4 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
5 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
6 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
7 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
16 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
22 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
37 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
71 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
72 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
87 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
88 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
89 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
90 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
91 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
92 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
93 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
94 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
102 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
108 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
109 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
110 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
116 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
118 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
119 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
120 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
121 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
122 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
126 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
129 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
151 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
152 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
155 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
156 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
157 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
164 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
165 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
166 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
171 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
243 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
247 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
248 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
249 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
250 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
251 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
252 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
253 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
254 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
257 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
258 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
259 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
260 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
262 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
263 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
264 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
265 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
266 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
267 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
268 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
269 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
270 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
271 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
272 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
273 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
274 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
275 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
279 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
280 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
281 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
282 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
283 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
284 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
285 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
286 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
287 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
288 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
289 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
290 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
291 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
292 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
293 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
294 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
295 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
296 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
301 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
302 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
303 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
309 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
310 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
311 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
312 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
315 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
316 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
321 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
328 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
331 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
332 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
333 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
334 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
339 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
340 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
341 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
342 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
343 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
344 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
345 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
346 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
347 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
348 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
349 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
350 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
351 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
352 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
364 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
367 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
389 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
392 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
393 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
394 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
398 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
399 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.48
Isolates 0.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.25
Nodule 0.24
Rhizoplane 6.19
Rhizosphere 88.73
Stem 0
Stem Tuber 0
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10029246 3300001990 Bacteria 1729
2 JGI24743J22301_10009131 3300001991 Bacteria 1752
3 JGI24750J21931_1005805 3300002070 Bacteria 1522
4 JGI24750J21931_1008019 3300002070 Bacteria 1336
5 JGI24750J21931_1008042 3300002070 Bacteria 1335
6 JGI24738J21930_10009674 3300002075 Bacteria 2163
7 JGI24749J21850_1009644 3300002076 Bacteria 1349
8 JGI24751J29686_10007247 3300002459 Bacteria 2265
9 JGI25151J46595_10001896 3300003187 Bacteria 13302
10 JGI25151J46595_10008596 3300003187 Bacteria 4895
11 JGI25406J46586_10035972 3300003203 Bacteria 1802
12 Ga0006777J48905_1052058 3300003308 Bacteria 886
13 rootL2_10000128 3300003322 Bacteria 2760
14 rootL2_10096177 3300003322 Bacteria 2983
15 Ga0007417J51691_1018296 3300003544 Bacteria 894
16 Ga0007409J51694_1042546 3300003575 Bacteria 1050
17 Ga0007416J51690_1027846 3300003577 Bacteria 893
18 Ga0007429J51699_1048980 3300003579 Bacteria 893
19 Ga0032354_1014430 3300003693 Bacteria 915
20 Ga0055526_1000050 3300003771 Bacteria 117283
21 Ga0055526_1000439 3300003771 Bacteria 33186
22 Ga0055526_1003172 3300003771 Bacteria 10647
23 Ga0055524_1002528 3300003775 Bacteria 9365
24 JGI25405J52794_10002173 3300003911 Bacteria 3340
25 JGI25405J52794_10026052 3300003911 Bacteria 1200
26 Ga0065165_1000074 3300005262 Bacteria 164454
27 Ga0070658_10004584 3300005327 Bacteria 11229
28 Ga0070658_10018021 3300005327 Bacteria 5646
29 Ga0070658_10097543 3300005327 Bacteria 2427
30 Ga0070658_10244094 3300005327 Bacteria 1523
31 Ga0070676_10010057 3300005328 Bacteria 5123
32 Ga0070683_100023208 3300005329 Bacteria 5548
33 Ga0070683_100023385 3300005329 Bacteria 5527
34 Ga0070683_100083307 3300005329 Bacteria 2996
35 Ga0070683_100098650 3300005329 Bacteria 2749
36 Ga0070683_100332799 3300005329 Bacteria 1446
37 Ga0070690_100000674 3300005330 Bacteria 17423
38 Ga0070670_100000050 3300005331 Bacteria 132470
39 Ga0070670_100004483 3300005331 Bacteria 11699
40 Ga0070670_100008183 3300005331 Bacteria 8905
41 Ga0070670_100013048 3300005331 Bacteria 7116
42 Ga0070670_100017710 3300005331 Bacteria 6111
43 Ga0070670_100041018 3300005331 Bacteria 3977
44 Ga0070670_100052202 3300005331 Bacteria 3511
45 Ga0070670_100067683 3300005331 Bacteria 3064
46 Ga0070670_100093329 3300005331 Bacteria 2589
47 Ga0070670_100134931 3300005331 Bacteria 2133
48 Ga0070670_100274822 3300005331 Bacteria 1471
49 Ga0070677_10025236 3300005333 Bacteria 2217
50 Ga0068869_100029810 3300005334 Bacteria 3826
51 Ga0068869_100136013 3300005334 Bacteria 1893
52 Ga0068869_100165283 3300005334 Bacteria 1725
53 Ga0070666_10006295 3300005335 Bacteria 7300
54 Ga0070666_10039156 3300005335 Bacteria 3158
55 Ga0070666_10068767 3300005335 Bacteria 2407
56 Ga0070666_10109250 3300005335 Bacteria 1911
57 Ga0070680_100001629 3300005336 Bacteria 16406
58 Ga0070680_100008891 3300005336 Bacteria 7698
59 Ga0070680_100060995 3300005336 Bacteria 3087
60 Ga0070680_100089522 3300005336 Bacteria 2547
61 Ga0070680_100192066 3300005336 Bacteria 1721
62 Ga0070682_100010513 3300005337 Bacteria 5252
63 Ga0068868_100011665 3300005338 Bacteria 6402
64 Ga0068868_100019088 3300005338 Bacteria 5134
65 Ga0068868_100060114 3300005338 Bacteria 3007
66 Ga0068868_100086216 3300005338 Bacteria 2524
67 Ga0068868_100180189 3300005338 Bacteria 1752
68 Ga0068868_100212160 3300005338 Bacteria 1618
69 Ga0068868_100550762 3300005338 Bacteria 1016
70 Ga0070660_100001625 3300005339 Bacteria 15452
71 Ga0070660_100020185 3300005339 Bacteria 4893
72 Ga0070660_100040098 3300005339 Bacteria 3562
73 Ga0070660_100046364 3300005339 Bacteria 3332
74 Ga0070689_100002174 3300005340 Bacteria 12697
75 Ga0070689_100010550 3300005340 Bacteria 6585
76 Ga0070689_100020981 3300005340 Bacteria 4856
77 Ga0070689_100049384 3300005340 Bacteria 3248
78 Ga0070691_10003094 3300005341 Bacteria 7459
79 Ga0070691_10047334 3300005341 Bacteria 2044
80 Ga0070691_10133501 3300005341 Bacteria 1260
81 Ga0070687_100006156 3300005343 Bacteria 4901
82 Ga0070687_100063831 3300005343 Bacteria 1954
83 Ga0070661_100002772 3300005344 Bacteria 12020
84 Ga0070661_100003649 3300005344 Bacteria 10597
85 Ga0070661_100007395 3300005344 Bacteria 7571
86 Ga0070661_100033514 3300005344 Bacteria 3720
87 Ga0070661_100057987 3300005344 Bacteria 2837
88 Ga0070661_100059977 3300005344 Bacteria 2791
89 Ga0070661_100203485 3300005344 Bacteria 1513
90 Ga0070661_100224573 3300005344 Bacteria 1441
91 Ga0070692_10008674 3300005345 Bacteria 4544
92 Ga0070692_10010322 3300005345 Bacteria 4245
93 Ga0070692_10051666 3300005345 Bacteria 2139
94 Ga0070668_100000170 3300005347 Bacteria 41682
95 Ga0070668_100002125 3300005347 Bacteria 14489
96 Ga0070668_100002930 3300005347 Bacteria 12612
97 Ga0070668_100047493 3300005347 Bacteria 3301
98 Ga0070668_100322886 3300005347 Bacteria 1300
99 Ga0070669_100000639 3300005353 Bacteria 25933
100 Ga0070669_100012580 3300005353 Bacteria 6002
101 Ga0070669_100044328 3300005353 Bacteria 3241
102 Ga0070669_100151400 3300005353 Bacteria 1796
103 Ga0070669_100267038 3300005353 Bacteria 1367
104 Ga0070675_100003246 3300005354 Bacteria 12316
105 Ga0070675_100007594 3300005354 Bacteria 8389
106 Ga0070671_100005745 3300005355 Bacteria 9880
107 Ga0070671_100021914 3300005355 Bacteria 5219
108 Ga0070671_100099596 3300005355 Bacteria 2438
109 Ga0070671_100153362 3300005355 Bacteria 1946
110 Ga0070671_100413862 3300005355 Bacteria 1154
111 Ga0070671_100647719 3300005355 Bacteria 915
112 Ga0070674_100021328 3300005356 Bacteria 4155
113 Ga0070674_100209971 3300005356 Bacteria 1508
114 Ga0070673_100004666 3300005364 Bacteria 8699
115 Ga0070673_100005099 3300005364 Bacteria 8383
116 Ga0070673_100231922 3300005364 Bacteria 1601
117 Ga0070673_100300015 3300005364 Bacteria 1414
118 Ga0070688_100002832 3300005365 Bacteria 8832
119 Ga0070688_100011717 3300005365 Bacteria 4886
120 Ga0070688_100037833 3300005365 Bacteria 2943
121 Ga0070688_100045737 3300005365 Bacteria 2706
122 Ga0070659_100003380 3300005366 Bacteria 11361
123 Ga0070659_100007453 3300005366 Bacteria 7952
124 Ga0070659_100016214 3300005366 Bacteria 5592
125 Ga0070659_100215789 3300005366 Bacteria 1582
126 Ga0070659_100312134 3300005366 Bacteria 1313
127 Ga0070667_100000140 3300005367 Bacteria 91817
128 Ga0070667_100014818 3300005367 Bacteria 6440
129 Ga0070667_100026157 3300005367 Bacteria 4853
130 Ga0070667_100030395 3300005367 Bacteria 4505
131 Ga0070667_100030963 3300005367 Bacteria 4462
132 Ga0070667_100246802 3300005367 Bacteria 1595
133 Ga0070667_100895894 3300005367 Bacteria 826
134 Ga0070703_10054540 3300005406 Bacteria 1289
135 Ga0070709_10016563 3300005434 Bacteria 4212
136 Ga0070709_10017181 3300005434 Bacteria 4143
137 Ga0070709_10027512 3300005434 Bacteria 3381
138 Ga0070709_10073009 3300005434 Bacteria 2220
139 Ga0070709_10106075 3300005434 Bacteria 1881
140 Ga0070709_10151503 3300005434 Bacteria 1603
141 Ga0070709_10174783 3300005434 Bacteria 1504
142 Ga0070709_10215047 3300005434 Bacteria 1368
143 Ga0070714_100004937 3300005435 Bacteria 10138
144 Ga0070714_100024261 3300005435 Bacteria 4990
145 Ga0070714_100027101 3300005435 Bacteria 4741
146 Ga0070714_100032871 3300005435 Bacteria 4333
147 Ga0070714_100296655 3300005435 Bacteria 1506
148 Ga0070713_100012591 3300005436 Bacteria 6212
149 Ga0070713_100023687 3300005436 Bacteria 4770
150 Ga0070713_100031008 3300005436 Bacteria 4252
151 Ga0070713_100037308 3300005436 Bacteria 3928
152 Ga0070713_100313215 3300005436 Bacteria 1448
153 Ga0070713_100456962 3300005436 Bacteria 1200
154 Ga0070710_10005027 3300005437 Bacteria 6257
155 Ga0070710_10034977 3300005437 Bacteria 2736
156 Ga0070710_10244384 3300005437 Bacteria 1151
157 Ga0070701_10003125 3300005438 Bacteria 6498
158 Ga0070701_10032813 3300005438 Bacteria 2588
159 Ga0070701_10122802 3300005438 Bacteria 1466
160 Ga0070711_100013174 3300005439 Bacteria 5187
161 Ga0070711_100023693 3300005439 Bacteria 3996
162 Ga0070711_100054396 3300005439 Bacteria 2762
163 Ga0070711_100189243 3300005439 Bacteria 1580
164 Ga0070711_100226113 3300005439 Bacteria 1457
165 Ga0070711_100443941 3300005439 Bacteria 1061
166 Ga0070705_100004755 3300005440 Bacteria 6610
167 Ga0070705_100032090 3300005440 Bacteria 2915
168 Ga0070700_100002078 3300005441 Bacteria 10167
169 Ga0070700_100002787 3300005441 Bacteria 8951
170 Ga0070700_100026410 3300005441 Bacteria 3428
171 Ga0070700_100033480 3300005441 Bacteria 3095
172 Ga0070700_100131650 3300005441 Bacteria 1689
173 Ga0070694_100000595 3300005444 Bacteria 19911
174 Ga0070694_100027641 3300005444 Bacteria 3686
175 Ga0070694_100087105 3300005444 Bacteria 2184
176 Ga0070694_100188789 3300005444 Bacteria 1529
177 Ga0070708_100024240 3300005445 Bacteria 5172
178 Ga0070708_100166060 3300005445 Bacteria 2059
179 Ga0070708_100419318 3300005445 Bacteria 1262
180 Ga0070663_100003107 3300005455 Bacteria 9503
181 Ga0070663_100015857 3300005455 Bacteria 4876
182 Ga0070663_100067574 3300005455 Bacteria 2593
183 Ga0070663_100106613 3300005455 Bacteria 2099
184 Ga0070663_100116672 3300005455 Bacteria 2012
185 Ga0070663_100291358 3300005455 Bacteria 1304
186 Ga0070678_100000728 3300005456 Bacteria 16377
187 Ga0070678_100004266 3300005456 Bacteria 8080
188 Ga0070678_100012686 3300005456 Bacteria 5253
189 Ga0070678_100145602 3300005456 Bacteria 1901
190 Ga0070662_100010721 3300005457 Bacteria 6033
191 Ga0070662_100031178 3300005457 Bacteria 3739
192 Ga0070662_100050667 3300005457 Bacteria 2995
193 Ga0070681_10006372 3300005458 Bacteria 11470
194 Ga0070681_10009514 3300005458 Bacteria 9565
195 Ga0070681_10044420 3300005458 Bacteria 4448
196 Ga0070681_10068229 3300005458 Bacteria 3523
197 Ga0070681_10070252 3300005458 Bacteria 3467
198 Ga0070681_10114590 3300005458 Bacteria 2634
199 Ga0070681_10161763 3300005458 Bacteria 2163
200 Ga0070681_10434323 3300005458 Bacteria 1225
201 Ga0068867_100000275 3300005459 Bacteria 33877
202 Ga0068867_100070292 3300005459 Bacteria 2617
203 Ga0068867_100487316 3300005459 Bacteria 1057
204 Ga0068867_100488545 3300005459 Bacteria 1056
205 Ga0070685_10002126 3300005466 Bacteria 10235
206 Ga0070685_10032285 3300005466 Bacteria 2932
207 Ga0070685_10036946 3300005466 Bacteria 2764
208 Ga0070706_100015493 3300005467 Bacteria 7041
209 Ga0070706_100023458 3300005467 Bacteria 5681
210 Ga0070707_100196313 3300005468 Bacteria 1967
211 Ga0070698_100001471 3300005471 Bacteria 26153
212 Ga0070698_100010828 3300005471 Bacteria 9706
213 Ga0070699_100011671 3300005518 Bacteria 7584
214 Ga0070699_100026303 3300005518 Bacteria 5019
215 Ga0070699_100200048 3300005518 Bacteria 1776
216 Ga0070699_100233375 3300005518 Bacteria 1641
217 Ga0070679_100004955 3300005530 Bacteria 12287
218 Ga0070679_100030613 3300005530 Bacteria 5313
219 Ga0070679_100054395 3300005530 Bacteria 3985
220 Ga0070679_100076170 3300005530 Bacteria 3345
221 Ga0070679_100081043 3300005530 Bacteria 3235
222 Ga0070679_100084636 3300005530 Bacteria 3159
223 Ga0070679_100113090 3300005530 Bacteria 2700
224 Ga0070679_100179509 3300005530 Bacteria 2090
225 Ga0070684_100008955 3300005535 Bacteria 7861
226 Ga0070684_100009493 3300005535 Bacteria 7665
227 Ga0070684_100052663 3300005535 Bacteria 3540
228 Ga0070684_100072913 3300005535 Bacteria 3024
229 Ga0070684_100078790 3300005535 Bacteria 2912
230 Ga0070684_100102699 3300005535 Bacteria 2556
231 Ga0070684_100105393 3300005535 Bacteria 2523
232 Ga0070684_100111284 3300005535 Bacteria 2456
233 Ga0070697_100033150 3300005536 Bacteria 4159
234 Ga0068853_100027279 3300005539 Bacteria 4797
235 Ga0068853_100036301 3300005539 Bacteria 4190
236 Ga0068853_100044767 3300005539 Bacteria 3789
237 Ga0068853_100199563 3300005539 Bacteria 1820
238 Ga0068853_100217667 3300005539 Bacteria 1743
239 Ga0070672_100001043 3300005543 Bacteria 16892
240 Ga0070672_100028934 3300005543 Bacteria 4149
241 Ga0070672_100068309 3300005543 Bacteria 2819
242 Ga0070672_100109845 3300005543 Bacteria 2246
243 Ga0070672_100333406 3300005543 Bacteria 1291
244 Ga0070686_100015699 3300005544 Bacteria 4393
245 Ga0070686_100018517 3300005544 Bacteria 4089
246 Ga0070686_100090637 3300005544 Bacteria 2044
247 Ga0070695_100004124 3300005545 Bacteria 8486
248 Ga0070695_100187680 3300005545 Bacteria 1469
249 Ga0070695_100414046 3300005545 Bacteria 1025
250 Ga0070696_100001676 3300005546 Bacteria 14514
251 Ga0070696_100024590 3300005546 Bacteria 4094
252 Ga0070696_100029965 3300005546 Bacteria 3722
253 Ga0070696_100183404 3300005546 Bacteria 1554
254 Ga0070696_100200663 3300005546 Bacteria 1489
255 Ga0070693_100006433 3300005547 Bacteria 5695
256 Ga0070693_100025992 3300005547 Bacteria 3156
257 Ga0070693_100265224 3300005547 Bacteria 1144
258 Ga0070693_100277672 3300005547 Bacteria 1121
259 Ga0070665_100000923 3300005548 Bacteria 37614
260 Ga0070665_100042906 3300005548 Bacteria 4547
261 Ga0070665_100261891 3300005548 Bacteria 1730
262 Ga0070665_100354621 3300005548 Bacteria 1472
263 Ga0070704_100005192 3300005549 Bacteria 7574
264 Ga0070704_100273409 3300005549 Bacteria 1397
265 Ga0068855_100008469 3300005563 Bacteria 12437
266 Ga0068855_100018228 3300005563 Bacteria 8433
267 Ga0068855_100043137 3300005563 Bacteria 5345
268 Ga0068855_100079548 3300005563 Bacteria 3801
269 Ga0068855_100174712 3300005563 Bacteria 2431
270 Ga0070664_100001520 3300005564 Bacteria 18509
271 Ga0070664_100002944 3300005564 Bacteria 13770
272 Ga0070664_100004852 3300005564 Bacteria 10773
273 Ga0070664_100009264 3300005564 Bacteria 7991
274 Ga0070664_100020665 3300005564 Bacteria 5424
275 Ga0070664_100079787 3300005564 Bacteria 2818
276 Ga0070664_100336630 3300005564 Bacteria 1370
277 Ga0070664_100475443 3300005564 Bacteria 1149
278 Ga0068857_100002553 3300005577 Bacteria 14914
279 Ga0068857_100047974 3300005577 Bacteria 3793
280 Ga0068857_100057284 3300005577 Bacteria 3459
281 Ga0068857_100144922 3300005577 Bacteria 2149
282 Ga0068857_100180610 3300005577 Bacteria 1920
283 Ga0068854_100031269 3300005578 Bacteria 3698
284 Ga0068854_100067368 3300005578 Bacteria 2608
285 Ga0068854_100098350 3300005578 Bacteria 2189
286 Ga0068854_100197990 3300005578 Bacteria 1577
287 Ga0068854_100209400 3300005578 Bacteria 1537
288 Ga0068854_100249538 3300005578 Bacteria 1416
289 Ga0068856_100003437 3300005614 Bacteria 16010
290 Ga0068856_100015279 3300005614 Bacteria 7418
291 Ga0068856_100022065 3300005614 Bacteria 6190
292 Ga0068856_100023951 3300005614 Bacteria 5938
293 Ga0068856_100024651 3300005614 Bacteria 5857
294 Ga0068856_100364433 3300005614 Bacteria 1464
295 Ga0068852_100011936 3300005616 Bacteria 6571
296 Ga0068852_100014001 3300005616 Bacteria 6154
297 Ga0068852_100055776 3300005616 Bacteria 3412
298 Ga0068852_100103802 3300005616 Bacteria 2571
299 Ga0068852_100295085 3300005616 Bacteria 1567
300 Ga0068852_100658501 3300005616 Bacteria 1055
301 Ga0068859_100002993 3300005617 Bacteria 17130
302 Ga0068859_100112202 3300005617 Bacteria 2789
303 Ga0068859_100219201 3300005617 Bacteria 1990
304 Ga0068864_100000275 3300005618 Bacteria 45877
305 Ga0068864_100010491 3300005618 Bacteria 7655
306 Ga0068864_100013588 3300005618 Bacteria 6749
307 Ga0068864_100019783 3300005618 Bacteria 5629
308 Ga0068864_100122126 3300005618 Bacteria 2330
309 Ga0068864_100149958 3300005618 Bacteria 2111
310 Ga0068866_10006601 3300005718 Bacteria 4838
311 Ga0068861_100004038 3300005719 Bacteria 9829
312 Ga0068861_100012217 3300005719 Bacteria 5987
313 Ga0068861_100124174 3300005719 Bacteria 2086
314 Ga0068861_100124365 3300005719 Bacteria 2085
315 Ga0068851_10002997 3300005834 Bacteria 7459
316 Ga0068851_10007904 3300005834 Bacteria 4900
317 Ga0068851_10040310 3300005834 Bacteria 2347
318 Ga0068851_10074380 3300005834 Bacteria 1763
319 Ga0068851_10128435 3300005834 Bacteria 1369
320 Ga0068870_10015301 3300005840 Bacteria 3637
321 Ga0068863_100000292 3300005841 Bacteria 51956
322 Ga0068863_100001479 3300005841 Bacteria 23291
323 Ga0068863_100128577 3300005841 Bacteria 2417
324 Ga0068863_100299546 3300005841 Bacteria 1560
325 Ga0068863_100551394 3300005841 Bacteria 1138
326 Ga0068858_100001164 3300005842 Bacteria 27258
327 Ga0068858_100004751 3300005842 Bacteria 13300
328 Ga0068858_100018757 3300005842 Bacteria 6471
329 Ga0068858_100036953 3300005842 Bacteria 4528
330 Ga0068858_100042024 3300005842 Bacteria 4238
331 Ga0068858_100056320 3300005842 Bacteria 3634
332 Ga0068858_100206150 3300005842 Bacteria 1860
333 Ga0068860_100000845 3300005843 Bacteria 34265
334 Ga0068860_100001112 3300005843 Bacteria 29597
335 Ga0068860_100014779 3300005843 Bacteria 7635
336 Ga0068860_100256761 3300005843 Bacteria 1703
337 Ga0068860_100978724 3300005843 Bacteria 863
338 Ga0068862_100001028 3300005844 Bacteria 26829
339 Ga0068862_100007003 3300005844 Bacteria 9360
340 Ga0068862_100048918 3300005844 Bacteria 3610
341 Ga0068862_100121350 3300005844 Bacteria 2304
342 Ga0081455_10001860 3300005937 Bacteria 25395
343 Ga0081455_10009744 3300005937 Bacteria 9841
344 Ga0081455_10031798 3300005937 Bacteria 4767
345 Ga0081455_10056258 3300005937 Bacteria 3341
346 Ga0081538_10035782 3300005981 Bacteria 3255
347 Ga0081538_10098511 3300005981 Bacteria 1481
348 Ga0081540_1009789 3300005983 Bacteria 6562
349 Ga0081539_10009313 3300005985 Bacteria 8243
350 Ga0081539_10070877 3300005985 Bacteria 1869
351 Ga0070717_10000603 3300006028 Bacteria 23074
352 Ga0070717_10060335 3300006028 Bacteria 3141
353 Ga0070717_10067436 3300006028 Bacteria 2977
354 Ga0070717_10597256 3300006028 Bacteria 1001
355 Ga0075365_10086667 3300006038 Bacteria 2128
356 Ga0075365_10243504 3300006038 Bacteria 1263
357 Ga0075363_100005387 3300006048 Bacteria 5686
358 Ga0075364_10088814 3300006051 Bacteria 2049
359 Ga0075364_10174241 3300006051 Bacteria 1454
360 Ga0075364_10232699 3300006051 Bacteria 1251
361 Ga0075432_10019769 3300006058 Bacteria 2302
362 Ga0075432_10098210 3300006058 Bacteria 1080
363 Ga0070715_10000159 3300006163 Bacteria 15732
364 Ga0070715_10123102 3300006163 Bacteria 1239
365 Ga0070716_100010521 3300006173 Bacteria 4640
366 Ga0070716_100078273 3300006173 Bacteria 1965
367 Ga0070716_100186501 3300006173 Bacteria 1367
368 Ga0070712_100004130 3300006175 Bacteria 8923
369 Ga0070712_100020375 3300006175 Bacteria 4340
370 Ga0070712_100035681 3300006175 Bacteria 3376
371 Ga0070712_100269546 3300006175 Bacteria 1367
372 Ga0070712_100284587 3300006175 Bacteria 1333
373 Ga0070712_100320342 3300006175 Bacteria 1260
374 Ga0070712_100606662 3300006175 Bacteria 927
375 Ga0075362_10092615 3300006177 Bacteria 1404
376 Ga0075367_10128398 3300006178 Bacteria 1566
377 Ga0075366_10037733 3300006195 Bacteria 2853
378 Ga0097621_100019564 3300006237 Bacteria 5199
379 Ga0097621_100172487 3300006237 Bacteria 1865
380 Ga0097621_100418712 3300006237 Bacteria 1202
381 Ga0097621_100545495 3300006237 Bacteria 1055
382 Ga0068871_100057919 3300006358 Bacteria 3154
383 Ga0068871_100062414 3300006358 Bacteria 3045
384 Ga0068871_100078716 3300006358 Bacteria 2726
385 Ga0068871_100123662 3300006358 Bacteria 2188
386 Ga0075428_100040725 3300006844 Bacteria 5110
387 Ga0075428_100199872 3300006844 Bacteria 2161
388 Ga0075428_100221034 3300006844 Bacteria 2045
389 Ga0075428_100221243 3300006844 Bacteria 2044
390 Ga0075428_100298902 3300006844 Bacteria 1731
391 Ga0075428_100302655 3300006844 Bacteria 1719
392 Ga0075430_100007044 3300006846 Bacteria 9480
393 Ga0075430_100035206 3300006846 Bacteria 4248
394 Ga0075430_100063617 3300006846 Bacteria 3099
395 Ga0075431_100013070 3300006847 Bacteria 8384
396 Ga0075431_100014686 3300006847 Bacteria 7926
397 Ga0075431_100061633 3300006847 Bacteria 3870
398 Ga0075431_100063587 3300006847 Bacteria 3808
399 Ga0075431_100076425 3300006847 Bacteria 3456
400 Ga0075431_100242051 3300006847 Bacteria 1835
401 Ga0075433_10000981 3300006852 Bacteria 20288
402 Ga0075433_10151262 3300006852 Bacteria 2065
403 Ga0075433_10178897 3300006852 Bacteria 1887
404 Ga0075433_10197585 3300006852 Bacteria 1789
405 Ga0075433_10242784 3300006852 Bacteria 1599
406 Ga0075433_10245154 3300006852 Bacteria 1590
407 Ga0075433_10430911 3300006852 Bacteria 1163
408 Ga0075434_100001241 3300006871 Bacteria 21209
409 Ga0075434_100068221 3300006871 Bacteria 3542
410 Ga0075434_100086729 3300006871 Bacteria 3130
411 Ga0075434_100487636 3300006871 Bacteria 1253
412 Ga0075434_101059223 3300006871 Bacteria 824
413 Ga0075429_100242406 3300006880 Bacteria 1579
414 Ga0068865_100003957 3300006881 Bacteria 8888
415 Ga0068865_100009546 3300006881 Bacteria 6022
416 Ga0068865_100054893 3300006881 Bacteria 2771
417 Ga0068865_100152883 3300006881 Bacteria 1752
418 Ga0068865_100259793 3300006881 Bacteria 1374
419 Ga0075436_100127879 3300006914 Bacteria 1780
420 Ga0075436_100188984 3300006914 Bacteria 1457
421 Ga0097620_100002993 3300006931 Bacteria 17130
422 Ga0097620_100112201 3300006931 Bacteria 2789
423 Ga0075435_100219670 3300007076 Bacteria 1614
424 Ga0099794_10048714 3300007265 Bacteria 2034
425 Ga0099795_10000525 3300007788 Bacteria 7210
426 Ga0099795_10011044 3300007788 Bacteria 2682
427 Ga0105244_10014193 3300009036 Bacteria 4617
428 Ga0105244_10116398 3300009036 Bacteria 1297
429 Ga0105250_10039487 3300009092 Bacteria 1892
430 Ga0105240_10010466 3300009093 Bacteria 13036
431 Ga0105240_10014808 3300009093 Bacteria 10629
432 Ga0105240_10030349 3300009093 Bacteria 7026
433 Ga0105240_10031660 3300009093 Bacteria 6854
434 Ga0105240_10121886 3300009093 Bacteria 3139
435 Ga0105240_10331535 3300009093 Bacteria 1731
436 Ga0111539_10028072 3300009094 Bacteria 6871
437 Ga0111539_10059595 3300009094 Bacteria 4526
438 Ga0111539_10062101 3300009094 Bacteria 4424
439 Ga0111539_10069739 3300009094 Bacteria 4151
440 Ga0111539_10072021 3300009094 Bacteria 4077
441 Ga0111539_10091969 3300009094 Bacteria 3565
442 Ga0111539_10130516 3300009094 Bacteria 2942
443 Ga0111539_10153741 3300009094 Bacteria 2693
444 Ga0111539_10369179 3300009094 Bacteria 1670
445 Ga0105245_10020211 3300009098 Bacteria 5836
446 Ga0105245_10046360 3300009098 Bacteria 3884
447 Ga0105245_10064876 3300009098 Bacteria 3301
448 Ga0105245_10218523 3300009098 Bacteria 1838
449 Ga0105245_10317840 3300009098 Bacteria 1533
450 Ga0105247_10010893 3300009101 Bacteria 5493
451 Ga0105247_10148326 3300009101 Bacteria 1543
452 Ga0105247_10215435 3300009101 Bacteria 1297
453 Ga0114129_10011942 3300009147 Bacteria 12351
454 Ga0114129_10022955 3300009147 Bacteria 8851
455 Ga0114129_10061066 3300009147 Bacteria 5268
456 Ga0114129_10061685 3300009147 Bacteria 5240
457 Ga0114129_10102860 3300009147 Bacteria 3950
458 Ga0114129_10298861 3300009147 Bacteria 2146
459 Ga0114129_10480363 3300009147 Bacteria 1626
460 Ga0114129_11359643 3300009147 Bacteria 878
461 Ga0105243_10002331 3300009148 Bacteria 15887
462 Ga0105243_10007058 3300009148 Bacteria 8637
463 Ga0105243_10026946 3300009148 Bacteria 4401
464 Ga0105243_10063327 3300009148 Bacteria 2963
465 Ga0105241_10009508 3300009174 Bacteria 7140
466 Ga0105241_10386389 3300009174 Bacteria 1224
467 Ga0105242_10003922 3300009176 Bacteria 11559
468 Ga0105242_10057719 3300009176 Bacteria 3180
469 Ga0105242_10099932 3300009176 Bacteria 2456
470 Ga0105242_10447400 3300009176 Bacteria 1217
471 Ga0105248_10005206 3300009177 Bacteria 14330
472 Ga0105248_10017766 3300009177 Bacteria 7847
473 Ga0105248_10022900 3300009177 Bacteria 6936
474 Ga0105248_10045266 3300009177 Bacteria 4935
475 Ga0105248_10069700 3300009177 Bacteria 3948
476 Ga0105248_10115363 3300009177 Bacteria 3029
477 Ga0105248_10141427 3300009177 Bacteria 2715
478 Ga0105248_10161153 3300009177 Bacteria 2530
479 Ga0105248_10421495 3300009177 Bacteria 1503
480 Ga0105248_10510953 3300009177 Bacteria 1355
481 Ga0105248_11364523 3300009177 Bacteria 802
482 Ga0105237_10022783 3300009545 Bacteria 6426
483 Ga0105237_10082572 3300009545 Bacteria 3204
484 Ga0105237_10287832 3300009545 Bacteria 1646
485 Ga0105237_10317152 3300009545 Bacteria 1562
486 Ga0105238_10003490 3300009551 Bacteria 15647
487 Ga0105238_10010511 3300009551 Bacteria 9291
488 Ga0105238_10031634 3300009551 Bacteria 5387
489 Ga0105238_10038745 3300009551 Bacteria 4839
490 Ga0105238_10046908 3300009551 Bacteria 4357
491 Ga0105238_10416888 3300009551 Bacteria 1337
492 Ga0105249_10001113 3300009553 Bacteria 23889
493 Ga0105249_10003043 3300009553 Bacteria 14468
494 Ga0105249_10162864 3300009553 Bacteria 2157
495 Ga0105249_10239556 3300009553 Bacteria 1793
496 Ga0105239_10115907 3300010375 Bacteria 2972
497 Ga0105239_10118340 3300010375 Bacteria 2940
498 Ga0105239_10119880 3300010375 Bacteria 2920
499 Ga0105239_10199484 3300010375 Bacteria 2241
500 Ga0105239_10764368 3300010375 Bacteria 1106
501 Ga0105239_11202922 3300010375 Bacteria 873
502 Ga0105246_10018900 3300011119 Bacteria 4395
503 Ga0105246_10020051 3300011119 Bacteria 4285
504 Ga0105246_10089601 3300011119 Bacteria 2214
505 Ga0157373_10010428 3300013100 Bacteria 6835
506 Ga0157373_10010753 3300013100 Bacteria 6734
507 Ga0157373_10167222 3300013100 Bacteria 1548
508 Ga0157371_10023743 3300013102 Bacteria 4483
509 Ga0157371_10033215 3300013102 Bacteria 3708
510 Ga0157371_10072031 3300013102 Bacteria 2447
511 Ga0157371_10150202 3300013102 Bacteria 1661
512 Ga0157370_10002532 3300013104 Bacteria 21969
513 Ga0157370_10004330 3300013104 Bacteria 16316
514 Ga0157370_10015571 3300013104 Bacteria 7730
515 Ga0157370_10018623 3300013104 Bacteria 6980
516 Ga0157370_10026491 3300013104 Bacteria 5724
517 Ga0157370_10058461 3300013104 Bacteria 3665
518 Ga0157370_10168643 3300013104 Bacteria 2035
519 Ga0157369_10007438 3300013105 Bacteria 12612
520 Ga0157369_10032889 3300013105 Bacteria 5700
521 Ga0157369_10051814 3300013105 Bacteria 4442
522 Ga0157369_10061545 3300013105 Bacteria 4046
523 Ga0157369_10105059 3300013105 Bacteria 3007
524 Ga0157369_10143782 3300013105 Bacteria 2522
525 Ga0157369_10148788 3300013105 Bacteria 2475
526 Ga0157369_10219729 3300013105 Bacteria 1989
527 Ga0157374_10008130 3300013296 Bacteria 8965
528 Ga0157374_10008516 3300013296 Bacteria 8774
529 Ga0157374_10062647 3300013296 Bacteria 3487
530 Ga0157374_10126224 3300013296 Bacteria 2473
531 Ga0157374_10158265 3300013296 Bacteria 2206
532 Ga0157374_10227085 3300013296 Bacteria 1833
533 Ga0157374_10281164 3300013296 Bacteria 1643
534 Ga0157374_10363912 3300013296 Bacteria 1439
535 Ga0157378_10018792 3300013297 Bacteria 6077
536 Ga0157378_10033486 3300013297 Bacteria 4543
537 Ga0157378_10046583 3300013297 Bacteria 3854
538 Ga0157378_10070373 3300013297 Bacteria 3141
539 Ga0157378_10095877 3300013297 Bacteria 2702
540 Ga0157378_10281331 3300013297 Bacteria 1603
541 Ga0163162_10007822 3300013306 Bacteria 10420
542 Ga0163162_10034723 3300013306 Bacteria 5020
543 Ga0163162_10193449 3300013306 Bacteria 2162
544 Ga0163162_10195759 3300013306 Bacteria 2150
545 Ga0163162_10322882 3300013306 Bacteria 1676
546 Ga0163162_10335457 3300013306 Bacteria 1644
547 Ga0163162_10341367 3300013306 Bacteria 1630
548 Ga0163162_10354834 3300013306 Bacteria 1599
549 Ga0163162_10401034 3300013306 Bacteria 1504
550 Ga0157372_10003130 3300013307 Bacteria 17832
551 Ga0157372_10011420 3300013307 Bacteria 9446
552 Ga0157372_10012456 3300013307 Bacteria 9065
553 Ga0157372_10034622 3300013307 Bacteria 5554
554 Ga0157372_10051086 3300013307 Bacteria 4600
555 Ga0157372_10082396 3300013307 Bacteria 3642
556 Ga0157372_10103907 3300013307 Bacteria 3247
557 Ga0157372_10128120 3300013307 Bacteria 2919
558 Ga0157372_10240052 3300013307 Bacteria 2103
559 Ga0157372_10312514 3300013307 Bacteria 1829
560 Ga0157372_10333214 3300013307 Bacteria 1767
561 Ga0157372_10404621 3300013307 Bacteria 1590
562 Ga0157372_10545212 3300013307 Bacteria 1352
563 Ga0157375_10020474 3300013308 Bacteria 6044
564 Ga0157375_10181975 3300013308 Bacteria 2253
565 Ga0157375_10292498 3300013308 Bacteria 1792
566 Ga0157375_10428176 3300013308 Bacteria 1489
567 Ga0163163_10004818 3300014325 Bacteria 11591
568 Ga0163163_10007632 3300014325 Bacteria 9554
569 Ga0163163_10027715 3300014325 Bacteria 5431
570 Ga0163163_10054993 3300014325 Bacteria 3934
571 Ga0163163_10155272 3300014325 Bacteria 2333
572 Ga0163163_10490960 3300014325 Bacteria 1289
573 Ga0157380_10008406 3300014326 Bacteria 7365
574 Ga0157380_10037017 3300014326 Bacteria 3780
575 Ga0157380_10067001 3300014326 Bacteria 2889
576 Ga0157380_10455955 3300014326 Bacteria 1229
577 Ga0157377_10007033 3300014745 Bacteria 5405
578 Ga0157379_10007852 3300014968 Bacteria 9242
579 Ga0157379_10030891 3300014968 Bacteria 4771
580 Ga0157379_10061468 3300014968 Bacteria 3358
581 Ga0157379_10072004 3300014968 Bacteria 3092
582 Ga0157379_10326605 3300014968 Bacteria 1401
583 Ga0157376_10025325 3300014969 Bacteria 4672
584 Ga0157376_10028899 3300014969 Bacteria 4412
585 Ga0157376_10089349 3300014969 Bacteria 2664
586 Ga0157376_10439344 3300014969 Bacteria 1270
587 Ga0163161_10031958 3300017792 Bacteria 3754
588 Ga0163161_10117266 3300017792 Bacteria 1996
589 Ga0163161_10201015 3300017792 Bacteria 1536
590 Ga0163161_10216482 3300017792 Bacteria 1481
591 Ga0213872_10000279 3300021361 Bacteria 43537
592 Ga0213872_10000502 3300021361 Bacteria 31150
593 Ga0213872_10000712 3300021361 Bacteria 25019
594 Ga0213872_10002578 3300021361 Bacteria 10554
595 Ga0213872_10028105 3300021361 Bacteria 2580
596 Ga0213876_10232443 3300021384 Bacteria 980
597 Ga0228598_1037143 3300024227 Bacteria 961
598 Ga0209437_105260 3300025233 Bacteria 2212
599 Ga0209646_1000072 3300025246 Bacteria 224823
600 Ga0209148_1000386 3300025254 Bacteria 52794
601 Ga0209565_1023186 3300025263 Bacteria 1277
602 Ga0207666_1005781 3300025271 Bacteria 1587
603 Ga0209025_1000624 3300025294 Bacteria 62814
604 Ga0209025_1000929 3300025294 Bacteria 44729
605 Ga0209025_1060115 3300025294 Bacteria 1429
606 Ga0209564_1000007 3300025295 Bacteria 1028582
607 Ga0209564_1000072 3300025295 Bacteria 289331
608 Ga0209256_1000176 3300025299 Bacteria 126545
609 Ga0207697_10001389 3300025315 Bacteria 13262
610 Ga0207656_10005345 3300025321 Bacteria 4533
611 Ga0207656_10008756 3300025321 Bacteria 3740
612 Ga0207656_10015099 3300025321 Bacteria 2985
613 Ga0207656_10046627 3300025321 Bacteria 1860
614 Ga0207656_10238124 3300025321 Bacteria 889
615 Ga0207655_1016139 3300025728 Bacteria 4104
616 Ga0207682_10000199 3300025893 Bacteria 27325
617 Ga0207682_10108196 3300025893 Bacteria 1222
618 Ga0207692_10004390 3300025898 Bacteria 5583
619 Ga0207692_10057340 3300025898 Bacteria 2002
620 Ga0207692_10333781 3300025898 Bacteria 931
621 Ga0207642_10092999 3300025899 Bacteria 1494
622 Ga0207642_10152269 3300025899 Bacteria 1232
623 Ga0207710_10005521 3300025900 Bacteria 5441
624 Ga0207710_10021773 3300025900 Bacteria 2750
625 Ga0207688_10002037 3300025901 Bacteria 10853
626 Ga0207688_10002110 3300025901 Bacteria 10695
627 Ga0207688_10012316 3300025901 Bacteria 4655
628 Ga0207680_10002416 3300025903 Bacteria 8708
629 Ga0207680_10022090 3300025903 Bacteria 3455
630 Ga0207680_10026989 3300025903 Bacteria 3190
631 Ga0207680_10047487 3300025903 Bacteria 2544
632 Ga0207680_10133850 3300025903 Bacteria 1636
633 Ga0207680_10150519 3300025903 Bacteria 1551
634 Ga0207647_10018037 3300025904 Bacteria 4785
635 Ga0207647_10136734 3300025904 Bacteria 1438
636 Ga0207685_10003238 3300025905 Bacteria 3922
637 Ga0207685_10081428 3300025905 Bacteria 1340
638 Ga0207699_10022753 3300025906 Bacteria 3401
639 Ga0207699_10024177 3300025906 Bacteria 3318
640 Ga0207699_10053258 3300025906 Bacteria 2398
641 Ga0207699_10085922 3300025906 Bacteria 1963
642 Ga0207699_10095416 3300025906 Bacteria 1875
643 Ga0207699_10253341 3300025906 Bacteria 1214
644 Ga0207645_10015977 3300025907 Bacteria 4973
645 Ga0207645_10023307 3300025907 Bacteria 4024
646 Ga0207645_10026627 3300025907 Bacteria 3736
647 Ga0207645_10039569 3300025907 Bacteria 3021
648 Ga0207645_10055884 3300025907 Bacteria 2520
649 Ga0207645_10085880 3300025907 Bacteria 2021
650 Ga0207645_10243356 3300025907 Bacteria 1189
651 Ga0207645_10301151 3300025907 Bacteria 1067
652 Ga0207643_10000285 3300025908 Bacteria 35142
653 Ga0207643_10000872 3300025908 Bacteria 18178
654 Ga0207643_10013410 3300025908 Bacteria 4438
655 Ga0207643_10083901 3300025908 Bacteria 1849
656 Ga0207705_10030823 3300025909 Bacteria 3827
657 Ga0207705_10037392 3300025909 Bacteria 3474
658 Ga0207684_10006392 3300025910 Bacteria 10740
659 Ga0207684_10059972 3300025910 Bacteria 3231
660 Ga0207684_10073880 3300025910 Bacteria 2896
661 Ga0207684_10176364 3300025910 Bacteria 1842
662 Ga0207654_10097298 3300025911 Bacteria 1807
663 Ga0207707_10000993 3300025912 Bacteria 27228
664 Ga0207707_10007140 3300025912 Bacteria 9727
665 Ga0207707_10011673 3300025912 Bacteria 7647
666 Ga0207707_10012952 3300025912 Bacteria 7259
667 Ga0207707_10025294 3300025912 Bacteria 5194
668 Ga0207707_10026682 3300025912 Bacteria 5049
669 Ga0207707_10040679 3300025912 Bacteria 4060
670 Ga0207707_10162531 3300025912 Bacteria 1952
671 Ga0207695_10006493 3300025913 Bacteria 15155
672 Ga0207695_10040712 3300025913 Bacteria 4979
673 Ga0207695_10087600 3300025913 Bacteria 3136
674 Ga0207695_10213503 3300025913 Bacteria 1839
675 Ga0207695_10423272 3300025913 Bacteria 1216
676 Ga0207671_10195738 3300025914 Bacteria 1577
677 Ga0207671_10237712 3300025914 Bacteria 1430
678 Ga0207671_10349954 3300025914 Bacteria 1172
679 Ga0207693_10003527 3300025915 Bacteria 13355
680 Ga0207693_10014239 3300025915 Bacteria 6398
681 Ga0207693_10024667 3300025915 Bacteria 4769
682 Ga0207693_10292137 3300025915 Bacteria 1277
683 Ga0207693_10370698 3300025915 Bacteria 1120
684 Ga0207663_10015515 3300025916 Bacteria 4204
685 Ga0207663_10034041 3300025916 Bacteria 3042
686 Ga0207663_10170581 3300025916 Bacteria 1545
687 Ga0207660_10012309 3300025917 Bacteria 5594
688 Ga0207660_10045654 3300025917 Bacteria 3087
689 Ga0207660_10045893 3300025917 Bacteria 3081
690 Ga0207660_10074565 3300025917 Bacteria 2477
691 Ga0207660_10102775 3300025917 Bacteria 2137
692 Ga0207660_10166533 3300025917 Bacteria 1704
693 Ga0207660_10236524 3300025917 Bacteria 1438
694 Ga0207662_10000929 3300025918 Bacteria 13584
695 Ga0207662_10003667 3300025918 Bacteria 7955
696 Ga0207662_10096112 3300025918 Bacteria 1830
697 Ga0207657_10000882 3300025919 Bacteria 31708
698 Ga0207657_10002238 3300025919 Bacteria 20984
699 Ga0207657_10006109 3300025919 Bacteria 12522
700 Ga0207657_10014997 3300025919 Bacteria 7527
701 Ga0207657_10030389 3300025919 Bacteria 4904
702 Ga0207657_10051541 3300025919 Bacteria 3577
703 Ga0207649_10002511 3300025920 Bacteria 10231
704 Ga0207649_10006622 3300025920 Bacteria 6295
705 Ga0207649_10037866 3300025920 Bacteria 2916
706 Ga0207649_10063142 3300025920 Bacteria 2337
707 Ga0207649_10064299 3300025920 Bacteria 2319
708 Ga0207649_10089484 3300025920 Bacteria 2012
709 Ga0207649_10309828 3300025920 Bacteria 1157
710 Ga0207652_10006566 3300025921 Bacteria 9374
711 Ga0207652_10010460 3300025921 Bacteria 7468
712 Ga0207652_10019084 3300025921 Bacteria 5633
713 Ga0207652_10061698 3300025921 Bacteria 3238
714 Ga0207652_10079971 3300025921 Bacteria 2857
715 Ga0207652_10090872 3300025921 Bacteria 2684
716 Ga0207652_10111889 3300025921 Bacteria 2422
717 Ga0207646_10084014 3300025922 Bacteria 2848
718 Ga0207681_10001443 3300025923 Bacteria 15297
719 Ga0207681_10060289 3300025923 Bacteria 2604
720 Ga0207681_10256457 3300025923 Bacteria 1367
721 Ga0207694_10004100 3300025924 Bacteria 11458
722 Ga0207694_10007945 3300025924 Bacteria 8024
723 Ga0207694_10044084 3300025924 Bacteria 3444
724 Ga0207650_10000133 3300025925 Bacteria 90953
725 Ga0207650_10002222 3300025925 Bacteria 13558
726 Ga0207650_10006091 3300025925 Bacteria 8225
727 Ga0207650_10108529 3300025925 Bacteria 2145
728 Ga0207659_10001360 3300025926 Bacteria 14606
729 Ga0207659_10026579 3300025926 Bacteria 3906
730 Ga0207659_10146489 3300025926 Bacteria 1839
731 Ga0207659_10190888 3300025926 Bacteria 1630
732 Ga0207687_10015863 3300025927 Bacteria 4944
733 Ga0207687_10162814 3300025927 Bacteria 1714
734 Ga0207687_10248115 3300025927 Bacteria 1414
735 Ga0207700_10020365 3300025928 Bacteria 4504
736 Ga0207700_10050938 3300025928 Bacteria 3087
737 Ga0207700_10082293 3300025928 Bacteria 2517
738 Ga0207700_10112191 3300025928 Bacteria 2196
739 Ga0207700_10482378 3300025928 Bacteria 1096
740 Ga0207664_10001046 3300025929 Bacteria 18542
741 Ga0207664_10012686 3300025929 Bacteria 6031
742 Ga0207664_10050774 3300025929 Bacteria 3271
743 Ga0207664_10051133 3300025929 Bacteria 3261
744 Ga0207664_10059671 3300025929 Bacteria 3039
745 Ga0207664_10297437 3300025929 Bacteria 1419
746 Ga0207644_10003477 3300025931 Bacteria 10184
747 Ga0207644_10012046 3300025931 Bacteria 5734
748 Ga0207644_10018949 3300025931 Bacteria 4666
749 Ga0207644_10094661 3300025931 Bacteria 2232
750 Ga0207644_10111199 3300025931 Bacteria 2072
751 Ga0207644_10145787 3300025931 Bacteria 1827
752 Ga0207644_10515210 3300025931 Bacteria 988
753 Ga0207690_10005099 3300025932 Bacteria 7756
754 Ga0207690_10007295 3300025932 Bacteria 6565
755 Ga0207690_10013597 3300025932 Bacteria 4894
756 Ga0207690_10027060 3300025932 Bacteria 3621
757 Ga0207690_10046682 3300025932 Bacteria 2870
758 Ga0207690_10207707 3300025932 Bacteria 1491
759 Ga0207706_10000820 3300025933 Bacteria 32304
760 Ga0207706_10006344 3300025933 Bacteria 10985
761 Ga0207706_10006730 3300025933 Bacteria 10626
762 Ga0207706_10073712 3300025933 Bacteria 3002
763 Ga0207706_10152699 3300025933 Bacteria 2031
764 Ga0207706_10343471 3300025933 Bacteria 1298
765 Ga0207686_10016093 3300025934 Bacteria 4192
766 Ga0207709_10003308 3300025935 Bacteria 9661
767 Ga0207709_10024538 3300025935 Bacteria 3444
768 Ga0207709_10223798 3300025935 Bacteria 1359
769 Ga0207670_10002275 3300025936 Bacteria 10057
770 Ga0207670_10006012 3300025936 Bacteria 6707
771 Ga0207669_10003358 3300025937 Bacteria 6926
772 Ga0207669_10034055 3300025937 Bacteria 2882
773 Ga0207669_10049274 3300025937 Bacteria 2509
774 Ga0207669_10362329 3300025937 Bacteria 1124
775 Ga0207665_10001863 3300025939 Bacteria 14223
776 Ga0207665_10006295 3300025939 Bacteria 7873
777 Ga0207691_10017740 3300025940 Bacteria 6748
778 Ga0207691_10025399 3300025940 Bacteria 5563
779 Ga0207691_10035330 3300025940 Bacteria 4640
780 Ga0207691_10045423 3300025940 Bacteria 4038
781 Ga0207691_10049616 3300025940 Bacteria 3846
782 Ga0207711_10012247 3300025941 Bacteria 7131
783 Ga0207711_10029383 3300025941 Bacteria 4636
784 Ga0207711_10032690 3300025941 Bacteria 4399
785 Ga0207711_10075247 3300025941 Bacteria 2938
786 Ga0207711_10122103 3300025941 Bacteria 2327
787 Ga0207711_10340269 3300025941 Bacteria 1388
788 Ga0207711_10400896 3300025941 Bacteria 1275
789 Ga0207711_10411695 3300025941 Bacteria 1257
790 Ga0207711_10502108 3300025941 Bacteria 1131
791 Ga0207689_10000559 3300025942 Bacteria 35553
792 Ga0207689_10014667 3300025942 Bacteria 6655
793 Ga0207689_10044726 3300025942 Bacteria 3661
794 Ga0207689_10052332 3300025942 Bacteria 3365
795 Ga0207661_10028106 3300025944 Bacteria 4304
796 Ga0207661_10030482 3300025944 Bacteria 4155
797 Ga0207661_10034410 3300025944 Bacteria 3940
798 Ga0207661_10274424 3300025944 Bacteria 1505
799 Ga0207679_10003380 3300025945 Bacteria 9850
800 Ga0207679_10003681 3300025945 Bacteria 9500
801 Ga0207679_10010584 3300025945 Bacteria 5943
802 Ga0207679_10033072 3300025945 Bacteria 3637
803 Ga0207679_10064697 3300025945 Bacteria 2734
804 Ga0207667_10001841 3300025949 Bacteria 26629
805 Ga0207667_10063675 3300025949 Bacteria 3853
806 Ga0207667_10091854 3300025949 Bacteria 3136
807 Ga0207667_10277015 3300025949 Bacteria 1714
808 Ga0207667_10500891 3300025949 Bacteria 1232
809 Ga0207667_10557931 3300025949 Bacteria 1158
810 Ga0207667_10763780 3300025949 Bacteria 965
811 Ga0207651_10002984 3300025960 Bacteria 8189
812 Ga0207651_10117362 3300025960 Bacteria 2010
813 Ga0207651_10157406 3300025960 Bacteria 1777
814 Ga0207651_10237925 3300025960 Bacteria 1482
815 Ga0207651_10497188 3300025960 Bacteria 1054
816 Ga0207651_10731312 3300025960 Bacteria 874
817 Ga0207712_10000689 3300025961 Bacteria 26097
818 Ga0207712_10045875 3300025961 Bacteria 3028
819 Ga0207712_10132703 3300025961 Bacteria 1900
820 Ga0207712_10271093 3300025961 Bacteria 1381
821 Ga0207668_10000275 3300025972 Bacteria 34283
822 Ga0207668_10002130 3300025972 Bacteria 11550
823 Ga0207668_10018888 3300025972 Bacteria 4345
824 Ga0207668_10079489 3300025972 Bacteria 2372
825 Ga0207668_10141487 3300025972 Bacteria 1851
826 Ga0207668_10190862 3300025972 Bacteria 1623
827 Ga0207668_10271282 3300025972 Bacteria 1387
828 Ga0207668_10370634 3300025972 Bacteria 1202
829 Ga0207640_10038374 3300025981 Bacteria 3022
830 Ga0207640_10045477 3300025981 Bacteria 2819
831 Ga0207640_10049413 3300025981 Bacteria 2723
832 Ga0207640_10063362 3300025981 Bacteria 2456
833 Ga0207640_10483660 3300025981 Bacteria 1027
834 Ga0207658_10001145 3300025986 Bacteria 21251
835 Ga0207658_10020076 3300025986 Bacteria 4626
836 Ga0207658_10025067 3300025986 Bacteria 4174
837 Ga0207658_10025918 3300025986 Bacteria 4107
838 Ga0207658_10198488 3300025986 Bacteria 1673
839 Ga0207658_10553520 3300025986 Bacteria 1029
840 Ga0207677_10087500 3300026023 Bacteria 2256
841 Ga0207677_10090482 3300026023 Bacteria 2224
842 Ga0207677_10094049 3300026023 Bacteria 2187
843 Ga0207677_10164628 3300026023 Bacteria 1727
844 Ga0207677_10198376 3300026023 Bacteria 1593
845 Ga0207703_10002292 3300026035 Bacteria 16690
846 Ga0207703_10026290 3300026035 Bacteria 4580
847 Ga0207703_10097426 3300026035 Bacteria 2485
848 Ga0207703_10902203 3300026035 Bacteria 846
849 Ga0207703_10906624 3300026035 Bacteria 844
850 Ga0207639_10012698 3300026041 Bacteria 5874
851 Ga0207639_10030893 3300026041 Bacteria 3933
852 Ga0207639_10036924 3300026041 Bacteria 3625
853 Ga0207639_10048995 3300026041 Bacteria 3201
854 Ga0207639_10099833 3300026041 Bacteria 2343
855 Ga0207639_10132235 3300026041 Bacteria 2067
856 Ga0207639_10351348 3300026041 Bacteria 1317
857 Ga0207639_10796769 3300026041 Bacteria 880
858 Ga0207678_10001637 3300026067 Bacteria 20525
859 Ga0207678_10005238 3300026067 Bacteria 11614
860 Ga0207678_10020833 3300026067 Bacteria 5746
861 Ga0207678_10038735 3300026067 Bacteria 4140
862 Ga0207678_10073617 3300026067 Bacteria 2928
863 Ga0207678_10367688 3300026067 Bacteria 1242
864 Ga0207678_10421032 3300026067 Bacteria 1158
865 Ga0207678_10609596 3300026067 Bacteria 957
866 Ga0207708_10000560 3300026075 Bacteria 28691
867 Ga0207708_10003553 3300026075 Bacteria 11489
868 Ga0207708_10009000 3300026075 Bacteria 7390
869 Ga0207708_10060105 3300026075 Bacteria 2901
870 Ga0207702_10042978 3300026078 Bacteria 3792
871 Ga0207702_10050842 3300026078 Bacteria 3500
872 Ga0207702_10066459 3300026078 Bacteria 3091
873 Ga0207702_10340732 3300026078 Bacteria 1432
874 Ga0207702_10532124 3300026078 Bacteria 1148
875 Ga0207641_10001486 3300026088 Bacteria 22946
876 Ga0207641_10004884 3300026088 Bacteria 11534
877 Ga0207641_10266332 3300026088 Bacteria 1606
878 Ga0207641_10415295 3300026088 Bacteria 1294
879 Ga0207641_10838603 3300026088 Bacteria 911
880 Ga0207648_10001104 3300026089 Bacteria 30219
881 Ga0207648_10001209 3300026089 Bacteria 28896
882 Ga0207648_10026444 3300026089 Bacteria 5156
883 Ga0207648_10044844 3300026089 Bacteria 3880
884 Ga0207648_10088386 3300026089 Bacteria 2706
885 Ga0207648_10285860 3300026089 Bacteria 1476
886 Ga0207648_10426945 3300026089 Bacteria 1204
887 Ga0207676_10002421 3300026095 Bacteria 13294
888 Ga0207676_10005547 3300026095 Bacteria 8928
889 Ga0207676_10007903 3300026095 Bacteria 7566
890 Ga0207676_10096057 3300026095 Bacteria 2445
891 Ga0207676_10714313 3300026095 Bacteria 972
892 Ga0207676_10718003 3300026095 Bacteria 970
893 Ga0207674_10000089 3300026116 Bacteria 99911
894 Ga0207674_10002196 3300026116 Bacteria 24709
895 Ga0207674_10004693 3300026116 Bacteria 16399
896 Ga0207674_10004995 3300026116 Bacteria 15857
897 Ga0207674_10010018 3300026116 Bacteria 10784
898 Ga0207674_10132705 3300026116 Bacteria 2453
899 Ga0207674_10190171 3300026116 Bacteria 2003
900 Ga0207674_10287779 3300026116 Bacteria 1592
901 Ga0207675_100000047 3300026118 Bacteria 85113
902 Ga0207675_100000376 3300026118 Bacteria 42834
903 Ga0207675_100001008 3300026118 Bacteria 27852
904 Ga0207675_100059299 3300026118 Bacteria 3571
905 Ga0207675_100125288 3300026118 Bacteria 2433
906 Ga0207675_100547266 3300026118 Bacteria 1156
907 Ga0207683_10000127 3300026121 Bacteria 62271
908 Ga0207683_10007701 3300026121 Bacteria 9225
909 Ga0207683_10016793 3300026121 Bacteria 6230
910 Ga0207683_10019753 3300026121 Bacteria 5755
911 Ga0207683_10064796 3300026121 Bacteria 3221
912 Ga0207698_10008357 3300026142 Bacteria 6541
913 Ga0207698_10031784 3300026142 Bacteria 3815
914 Ga0207698_10042815 3300026142 Bacteria 3387
915 Ga0207698_10045785 3300026142 Bacteria 3298
916 Ga0207698_10099036 3300026142 Bacteria 2410
917 Ga0207698_10153243 3300026142 Bacteria 2004
918 Ga0209995_1012932 3300027471 Bacteria 1365
919 Ga0209983_1005434 3300027665 Bacteria 2638
920 Ga0209971_1001127 3300027682 Bacteria 6774
921 Ga0207428_10012008 3300027907 Bacteria 7623
922 Ga0207428_10070875 3300027907 Bacteria 2739
923 Ga0207428_10113181 3300027907 Bacteria 2086
924 Ga0207428_10132546 3300027907 Bacteria 1906
925 Ga0207428_10170995 3300027907 Bacteria 1646
926 Ga0207428_10518449 3300027907 Bacteria 864
927 Ga0268266_10006847 3300028379 Bacteria 10381
928 Ga0268266_10028221 3300028379 Bacteria 4771
929 Ga0268266_10038608 3300028379 Bacteria 4065
930 Ga0268265_10000728 3300028380 Bacteria 32178
931 Ga0268265_10004940 3300028380 Bacteria 9166
932 Ga0268265_10045406 3300028380 Bacteria 3278
933 Ga0268265_10126967 3300028380 Bacteria 2112
934 Ga0268265_10730613 3300028380 Bacteria 959
935 Ga0268264_10000358 3300028381 Bacteria 68359
936 Ga0268264_10042905 3300028381 Bacteria 3746
937 Ga0268264_10165288 3300028381 Bacteria 1997
938 Ga0265328_10009096 3300031239 Bacteria 4057
939 Ga0265339_10016519 3300031249 Bacteria 4397
940 Ga0265331_10000002 3300031250 Bacteria 511481
941 Ga0265331_10000355 3300031250 Bacteria 48482
942 Ga0265327_10000033 3300031251 Bacteria 317182
943 Ga0265316_10021653 3300031344 Bacteria 5439
944 Ga0265314_10003660 3300031711 Bacteria 14746
945 Ga0307516_10145603 3300031730 Bacteria 2135
946 Ga0307413_10237381 3300031824 Bacteria 1343
947 Ga0307412_10026142 3300031911 Bacteria 3625
948 Ga0307414_10161608 3300032004 Bacteria 1780
949 Ga0373929_0007593 3300035085 Bacteria 1983
950 Ga0373929_0040769 3300035085 Bacteria 1030
951 Ga0373934_0000639 3300035086 Bacteria 12380
952 Ga0373940_0009937 3300035088 Bacteria 2225
953 Ga0373952_0041093 3300035092 Bacteria 1069
954 Ga0373923_0050607 3300035111 Bacteria 1741
955 Ga0373923_0097413 3300035111 Bacteria 1294
956 Ga0373932_0011564 3300035112 Bacteria 2159
957 Ga0373939_0045629 3300035114 Bacteria 1338
958 Ga0373941_0063328 3300035115 Bacteria 1209
959 Ga0373953_0073359 3300035117 Bacteria 1415
960 Ga0373954_0025888 3300035118 Bacteria 2686
961 Ga0373956_0000135 3300035119 Bacteria 26321
962 Ga0373957_0000933 3300035120 Bacteria 7664
963 Ga0373960_0014938 3300035121 Bacteria 1975
964 Ga0373960_0021024 3300035121 Bacteria 1731
965 Ga0373955_0023281 3300035172 Bacteria 3153
966 Ga0373955_0259703 3300035172 Bacteria 1043
967 Ga0373962_0005595 3300035242 Bacteria 3035
968 Ga0373931_0004770 3300035691 Bacteria 6219
969 Ga0373931_0007171 3300035691 Bacteria 5243
970 Ga0373931_0016109 3300035691 Bacteria 3675
971 Ga0373931_0189881 3300035691 Bacteria 1222
972 Ga0373935_0140496 3300035692 Bacteria 1631
973 Ga0373927_0218147 3300035695 Bacteria 1253
974 Ga0373927_0336775 3300035695 Bacteria 994
975 Ga0373933_0000813 3300035724 Bacteria 19033
976 Ga0373947_0112483 3300035725 Bacteria 1722
977 Ga0373937_0004329 3300036401 Bacteria 12048
978 Ga0373937_0023186 3300036401 Bacteria 5588
979 Ga0373937_0087549 3300036401 Bacteria 2883
980 Ga0373925_0031236 3300037068 Bacteria 3913
981 Ga0373925_0087309 3300037068 Bacteria 2381
982 Ga0395899_0007777 3300037312 Bacteria 8266
983 Ga0395900_0010652 3300037418 Bacteria 9404
984 Ga0395900_0019699 3300037418 Bacteria 6877
985 Ga0395898_0462143 3300037466 Bacteria 1208
986 Ga0395905_0000086 3300037471 Bacteria 153641
987 Ga0395905_0004236 3300037471 Bacteria 14996
988 Ga0395905_0112475 3300037471 Bacteria 2557
989 Ga0395901_0007491 3300038443 Bacteria 11024
990 Ga0395901_0079508 3300038443 Bacteria 3424
991 Ga0395901_0209231 3300038443 Bacteria 2042
992 Ga0395901_0415128 3300038443 Bacteria 1381
993 Ga0242420_009807 3300038996 Bacteria 1579
994 Ga0436360_0220478 3300039438 Bacteria 1158
995 Ga0436361_0032090 3300039447 Bacteria 10247
996 Ga0436361_0421236 3300039447 Bacteria 851
997 Ga0436361_0530365 3300039447 Bacteria 62073
998 Ga0436361_0579013 3300039447 Bacteria 26383
999 Ga0436361_0972320 3300039447 Bacteria 18071
1000 Ga0436361_1044948 3300039447 Bacteria 4449
1001 Ga0436363_1091328 3300039450 Bacteria 1041
1002 Ga0436363_1403698 3300039450 Bacteria 987
1003 Ga0436362_0201408 3300039453 Bacteria 1174
1004 Ga0436362_0326174 3300039453 Bacteria 850
1005 Ga0439465_0001164 3300041413 Bacteria 8448
1006 Ga0451847_0461108 3300041503 Bacteria 1307
1007 Ga0451577_0097984 3300042876 Bacteria 2619
1008 Ga0466968_0074670 3300044735 Bacteria 1481
1009 Ga0451576_0025457 3300045051 Bacteria 6374
1010 Ga0451576_0104326 3300045051 Bacteria 2949
1011 Ga0495590_0000006 3300046457 Bacteria 372949
1012 Ga0495629_0054326 3300046459 Bacteria 2801
1013 Ga0495629_0096585 3300046459 Bacteria 2061
1014 Ga0495638_0000333 3300046460 Bacteria 59483
1015 Ga0495651_0000274 3300046462 Bacteria 40100
1016 Ga0495650_0000194 3300046471 Bacteria 131682
1017 Ga0495650_0008058 3300046471 Bacteria 6220
1018 Ga0495580_0033707 3300046472 Bacteria 3688
1019 Ga0495580_0036032 3300046472 Bacteria 3555
1020 Ga0495580_0072639 3300046472 Bacteria 2402
1021 Ga0495662_0110605 3300046476 Bacteria 1347
1022 Ga0495584_0073030 3300046491 Bacteria 1724
1023 Ga0495584_0095625 3300046491 Bacteria 1500
1024 Ga0495585_0112778 3300046492 Bacteria 1444
1025 Ga0495607_0001831 3300046501 Bacteria 18117
1026 Ga0495583_0000475 3300046506 Bacteria 58746
1027 Ga0495606_0013329 3300046507 Bacteria 6507
1028 Ga0495606_0269849 3300046507 Bacteria 935
1029 Ga0495616_0088407 3300046513 Bacteria 1471
1030 Ga0495618_0128240 3300046514 Bacteria 1624
1031 Ga0495620_0065924 3300046515 Bacteria 1493
1032 Ga0495643_0000358 3300046522 Bacteria 62194
1033 Ga0495648_0000054 3300046524 Bacteria 159674
1034 Ga0495666_0011471 3300046526 Bacteria 4418
1035 Ga0495642_0009074 3300046528 Bacteria 3807
1036 Ga0495642_0122436 3300046528 Bacteria 1116
1037 Ga0495642_0178150 3300046528 Bacteria 925
1038 Ga0495621_0054737 3300046539 Bacteria 1435
1039 Ga0495621_0105795 3300046539 Bacteria 1075
1040 Ga0495621_0128057 3300046539 Bacteria 986
1041 Ga0495597_0000191 3300046542 Bacteria 55786
1042 Ga0495622_0000038 3300046557 Bacteria 119397
1043 Ga0495633_0001301 3300046558 Bacteria 19710
1044 Ga0495633_0089268 3300046558 Bacteria 1433
1045 Ga0495656_0076154 3300046615 Bacteria 1503
1046 Ga0495668_0001151 3300046616 Bacteria 27068
1047 Ga0495668_0002784 3300046616 Bacteria 13927
1048 Ga0495625_0000436 3300046660 Bacteria 62756
1049 Ga0495625_0000558 3300046660 Bacteria 54572
1050 Ga0495657_0022641 3300046675 Bacteria 4498
1051 Ga0495647_0038760 3300046681 Bacteria 1803
1052 Ga0495669_0088311 3300046684 Bacteria 1429
1053 Ga0495669_0109852 3300046684 Bacteria 1287
1054 Ga0495670_0062773 3300046691 Bacteria 1870
1055 Ga0495649_0172884 3300046694 Bacteria 1130
1056 Ga0495600_0255963 3300046809 Bacteria 1113
1057 Ga0495581_0157408 3300047315 Bacteria 1328
1058 Ga0495604_0050123 3300047317 Bacteria 3242
1059 Ga0495674_0267585 3300047319 Bacteria 1403
1060 Ga0495672_0250784 3300047320 Bacteria 859
1061 Ga0495676_0226328 3300047321 Bacteria 1286
1062 Ga0495680_0076772 3300047322 Bacteria 2532
1063 Ga0495683_0213944 3300047323 Bacteria 863
1064 Ga0495687_001334 3300047443 Bacteria 23017
1065 Ga0495687_004548 3300047443 Bacteria 9302
1066 Ga0495684_0144589 3300047471 Bacteria 1782
1067 Ga0495686_0270025 3300047472 Bacteria 949
1068 Ga0495593_0197086 3300047673 Bacteria 1012
1069 Ga0495614_0038867 3300048089 Bacteria 2043
1070 Ga0495614_0058997 3300048089 Bacteria 1648
1071 Ga0496100_0022383 3300048903 Bacteria 3824
1072 Ga0496100_0242447 3300048903 Bacteria 1330
1073 Ga0496101_0023566 3300048904 Bacteria 4254
1074 Ga0496101_0061606 3300048904 Bacteria 2725
1075 Ga0496101_0114106 3300048904 Bacteria 2037
1076 Ga0496101_0138658 3300048904 Bacteria 1852
1077 Ga0496101_0155871 3300048904 Bacteria 1749
1078 Ga0496101_0449248 3300048904 Bacteria 1017
1079 Ga0496101_0679824 3300048904 Bacteria 813
1080 Ga0496102_0012224 3300048905 Bacteria 7423
1081 Ga0496102_0032411 3300048905 Bacteria 4693
1082 Ga0496102_0034017 3300048905 Bacteria 4583
1083 Ga0496102_0034379 3300048905 Bacteria 4558
1084 Ga0496102_0137229 3300048905 Bacteria 2292
1085 Ga0496102_0411198 3300048905 Bacteria 1271
1086 Ga0496103_0004445 3300048906 Bacteria 8503
1087 Ga0496103_0024209 3300048906 Bacteria 3662
1088 Ga0496103_0027729 3300048906 Bacteria 3434
1089 Ga0496103_0058180 3300048906 Bacteria 2401
1090 Ga0496103_0064765 3300048906 Bacteria 2279
1091 Ga0496103_0072089 3300048906 Bacteria 2163
1092 Ga0496103_0263325 3300048906 Bacteria 1109
1093 Ga0496104_0003625 3300048907 Bacteria 13338
1094 Ga0496104_0003891 3300048907 Bacteria 12924
1095 Ga0496104_0049441 3300048907 Bacteria 3965
1096 Ga0496104_0296340 3300048907 Bacteria 1530
1097 Ga0496104_0414017 3300048907 Bacteria 1260
1098 Ga0496104_0674134 3300048907 Bacteria 942
1099 Ga0496105_0001322 3300048908 Bacteria 17343
1100 Ga0496105_0023569 3300048908 Bacteria 4993
1101 Ga0496105_0036542 3300048908 Bacteria 4046
1102 Ga0496105_0220084 3300048908 Bacteria 1546
1103 Ga0496105_0324557 3300048908 Bacteria 1233
1104 Ga0496106_0021775 3300048909 Bacteria 4760
1105 Ga0496106_0079115 3300048909 Bacteria 2524
1106 Ga0496106_0113686 3300048909 Bacteria 2110
1107 Ga0496106_0178145 3300048909 Bacteria 1687
1108 Ga0496107_0002458 3300048910 Bacteria 12020
1109 Ga0496107_0029338 3300048910 Bacteria 3913
1110 Ga0496107_0037478 3300048910 Bacteria 3479
1111 Ga0496107_0054627 3300048910 Bacteria 2882
1112 Ga0496107_0376757 3300048910 Bacteria 1056
1113 Ga0496108_0002238 3300048911 Bacteria 15499
1114 Ga0496108_0069736 3300048911 Bacteria 2966
1115 Ga0496108_0395200 3300048911 Bacteria 1207
1116 Ga0496109_0002809 3300048912 Bacteria 14583
1117 Ga0496109_0006173 3300048912 Bacteria 10068
1118 Ga0496109_0015267 3300048912 Bacteria 6687
1119 Ga0496109_0031863 3300048912 Bacteria 4735
1120 Ga0496109_0043237 3300048912 Bacteria 4083
1121 Ga0496109_0136861 3300048912 Bacteria 2289
1122 Ga0496109_0298500 3300048912 Bacteria 1519
1123 Ga0496109_0453695 3300048912 Bacteria 1211
1124 Ga0496110_0024038 3300048913 Bacteria 5191
1125 Ga0496110_0024415 3300048913 Bacteria 5152
1126 Ga0496110_0030989 3300048913 Bacteria 4612
1127 Ga0496110_0037915 3300048913 Bacteria 4191
1128 Ga0496110_0065317 3300048913 Bacteria 3216
1129 Ga0496110_0226002 3300048913 Bacteria 1702
1130 Ga0496110_0283722 3300048913 Bacteria 1508
1131 Ga0496110_0292335 3300048913 Bacteria 1484
1132 Ga0496111_0017001 3300048914 Bacteria 5021
1133 Ga0496111_0036092 3300048914 Bacteria 3534
1134 Ga0496111_0038968 3300048914 Bacteria 3405
1135 Ga0496111_0124351 3300048914 Bacteria 1906
1136 Ga0496111_0137848 3300048914 Bacteria 1808
1137 Ga0496112_0033514 3300048915 Bacteria 4993
1138 Ga0496112_0047020 3300048915 Bacteria 4233
1139 Ga0496112_0128607 3300048915 Bacteria 2503
1140 Ga0496112_0145141 3300048915 Bacteria 2341
1141 Ga0496112_0214935 3300048915 Bacteria 1879
1142 Ga0496113_0001266 3300048916 Bacteria 13932
1143 Ga0496113_0059870 3300048916 Bacteria 2869
1144 Ga0496113_0152766 3300048916 Bacteria 1822
1145 Ga0496114_0018456 3300048917 Bacteria 5639
1146 Ga0496114_0360228 3300048917 Bacteria 1286
1147 Ga0496115_0022583 3300048918 Bacteria 4877
1148 Ga0496117_0002582 3300048920 Bacteria 22541
1149 Ga0496118_0002912 3300048921 Bacteria 22251
1150 Ga0496118_0138530 3300048921 Bacteria 1548
1151 Ga0496121_0001731 3300048924 Bacteria 35624
1152 Ga0496121_0020294 3300048924 Bacteria 6587
1153 Ga0496124_0000315 3300048927 Bacteria 89492
1154 Ga0496124_0051010 3300048927 Bacteria 3522
1155 Ga0496125_0007726 3300048928 Bacteria 11390
1156 Ga0496125_0100672 3300048928 Bacteria 2129
1157 Ga0495678_003848 3300049459 Bacteria 9024
1158 Ga0495678_005316 3300049459 Bacteria 7144
1159 Ga0501034_0002928 3300049571 Bacteria 19795
1160 Ga0501034_0090019 3300049571 Bacteria 3067
1161 Ga0501036_0141693 3300049572 Bacteria 2028
1162 Ga0501046_0001880 3300049580 Bacteria 19972
1163 Ga0501046_0031358 3300049580 Bacteria 4309
1164 Ga0501047_0047668 3300049581 Bacteria 4139
1165 Ga0501047_0169371 3300049581 Bacteria 2053
1166 Ga0501067_0010788 3300049583 Bacteria 5053
1167 Ga0501067_0094672 3300049583 Bacteria 1658
1168 Ga0501067_0167473 3300049583 Bacteria 1224
1169 Ga0501068_0034944 3300049584 Bacteria 2999
1170 Ga0501068_0195709 3300049584 Bacteria 1282
1171 Ga0501070_0274753 3300049586 Bacteria 1375
1172 Ga0501073_0076383 3300049589 Bacteria 2331
1173 Ga0501250_007422 3300049680 Bacteria 1184
1174 Ga0501079_0369281 3300049741 Bacteria 1125
1175 Ga0501080_0201871 3300049742 Bacteria 1825
1176 Ga0501081_0112261 3300049743 Bacteria 1935
1177 Ga0501083_0024996 3300049744 Bacteria 4137
1178 Ga0501083_0050819 3300049744 Bacteria 2789
1179 Ga0501044_0199410 3300049823 Bacteria 1960
1180 Ga0501044_0599599 3300049823 Bacteria 995
1181 nmdc:mga03683_83289_c1 3300050489 Bacteria 1384
1182 nmdc:mga00v17_75055_c1 3300050491 Bacteria 2102
1183 nmdc:mga0yw44_25520_c1 3300050492 Bacteria 3362
1184 nmdc:mga0yw44_30075_c1 3300050492 Bacteria 3143
1185 nmdc:mga0yw44_62260_c1 3300050492 Bacteria 2291
1186 nmdc:mga0k408_91021_c1 3300050493 Bacteria 1792
1187 nmdc:mga06z11_166450_c1 3300050494 Bacteria 1263
1188 nmdc:mga06z11_223427_c1 3300050494 Bacteria 1101
1189 nmdc:mga06z11_43777_c1 3300050494 Bacteria 2254
1190 nmdc:mga07m45_238953_c1 3300050496 Bacteria 1057
1191 nmdc:mga07m45_291084_c1 3300050496 Bacteria 950
1192 nmdc:mga05p37_1011036_c1 3300050507 Bacteria 882
1193 nmdc:mga05p37_25897_c1 3300050507 Bacteria 7131
1194 nmdc:mga05p37_44460_c1 3300050507 Bacteria 5464
1195 nmdc:mga05p37_565804_c1 3300050507 Bacteria 1291
1196 nmdc:mga05p37_96346_c1 3300050507 Bacteria 3645
1197 nmdc:mga09592_128149_c1 3300050508 Bacteria 2182
1198 nmdc:mga0qj67_15707_c1 3300050509 Bacteria 5735
1199 nmdc:mga0qj67_256687_c1 3300050509 Bacteria 1418
1200 nmdc:mga0qj67_42590_c1 3300050509 Bacteria 3574
1201 nmdc:mga0qj67_48788_c1 3300050509 Bacteria 3345
1202 nmdc:mga06r32_139724_c1 3300050510 Bacteria 2398
1203 nmdc:mga06r32_173683_c1 3300050510 Bacteria 2139
1204 nmdc:mga06r32_219085_c1 3300050510 Bacteria 1891
1205 nmdc:mga06r32_25454_c1 3300050510 Bacteria 4782
1206 nmdc:mga06r32_30438_c1 3300050510 Bacteria 5064
1207 nmdc:mga06r32_73504_c1 3300050510 Bacteria 3312
1208 nmdc:mga08y16_140040_c1 3300050511 Bacteria 2515
1209 nmdc:mga08y16_147138_c1 3300050511 Bacteria 2449
1210 nmdc:mga08y16_152775_c1 3300050511 Bacteria 2399
1211 nmdc:mga08y16_239051_c1 3300050511 Bacteria 1878
1212 nmdc:mga08y16_276208_c1 3300050511 Bacteria 1734
1213 nmdc:mga08y16_286908_c1 3300050511 Bacteria 1697
1214 nmdc:mga08y16_375153_c1 3300050511 Bacteria 1459
1215 nmdc:mga08y16_672347_c1 3300050511 Bacteria 1038
1216 nmdc:mga08y16_68397_c1 3300050511 Bacteria 3703
1217 nmdc:mga08y16_84713_c1 3300050511 Bacteria 3304
1218 nmdc:mga0n895_116657_c1 3300050512 Bacteria 2689
1219 nmdc:mga0n895_182762_c1 3300050512 Bacteria 2128
1220 nmdc:mga0n895_219747_c1 3300050512 Bacteria 1929
1221 nmdc:mga0n895_232339_c1 3300050512 Bacteria 1872
1222 nmdc:mga0n895_39655_c1 3300050512 Bacteria 4571
1223 nmdc:mga0n895_64693_c1 3300050512 Bacteria 3618
1224 nmdc:mga0n895_94644_c1 3300050512 Bacteria 2991
1225 nmdc:mga0rr50_185515_c1 3300050513 Bacteria 1702
1226 nmdc:mga0rr50_307731_c1 3300050513 Bacteria 1327
1227 nmdc:mga0rr50_367324_c1 3300050513 Bacteria 1212
1228 nmdc:mga08x19_109026_c1 3300050514 Bacteria 1845
1229 nmdc:mga08x19_310542_c1 3300050514 Bacteria 1096
1230 nmdc:mga08x19_60991_c1 3300050514 Bacteria 2444
1231 nmdc:mga0a205_2299_c1 3300050515 Bacteria 16862
1232 nmdc:mga0a205_2472_c1 3300050515 Bacteria 16291
1233 nmdc:mga0a205_256485_c1 3300050515 Bacteria 1627
1234 nmdc:mga0a205_61465_c1 3300050515 Bacteria 3629
1235 Ga0495601_0300039 3300053077 Bacteria 1046
1236 Ga0495655_0000902 3300053083 Bacteria 4633
1237 Ga0495655_0020756 3300053083 Bacteria 1478
1238 Ga0495655_0038608 3300053083 Bacteria 1206
1239 Ga0495619_0129091 3300053085 Bacteria 1736
1240 Ga0495619_0294433 3300053085 Bacteria 1124
1241 Ga0500647_0099467 3300053091 Bacteria 1389
1242 Ga0500618_015233 3300053125 Bacteria 1946
1243 Ga0500590_004048 3300053148 Bacteria 6864
1244 Ga0500590_011367 3300053148 Bacteria 4507
1245 Ga0500619_000121 3300053154 Bacteria 20412
1246 Ga0501084_0091452 3300054114 Bacteria 2555
1247 Ga0501084_0185728 3300054114 Bacteria 1755
1248 Ga0501082_0042293 3300060353 Bacteria 3928
1249 Ga0501082_0501645 3300060353 Bacteria 1061
1250 Ga0501082_0606628 3300060353 Bacteria 958
1251 Ga0530510_0108414 3300061734 Bacteria 2033

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0250784 Ga0495672_0250784_24_626 199
2 3300013105 Ga0157369_10148788 Ga0157369_101487883 219
3 3300013307 Ga0157372_10082396 Ga0157372_100823965 219
4 3300046809 Ga0495600_0255963 Ga0495600_0255963_243_1028 221
5 3300025893 Ga0207682_10108196 Ga0207682_101081961 222
6 3300049583 Ga0501067_0094672 Ga0501067_0094672_646_1428 224
7 3300049589 Ga0501073_0076383 Ga0501073_0076383_1011_1793 224
8 3300049744 Ga0501083_0024996 Ga0501083_0024996_1558_2340 224
9 3300060353 Ga0501082_0042293 Ga0501082_0042293_1293_2075 224
10 3300039453 Ga0436362_0326174 Ga0436362_0326174_30_812 226
11 3300032004 Ga0307414_10161608 Ga0307414_101616082 228
12 3300005344 Ga0070661_100203485 Ga0070661_1002034852 231
13 3300025263 Ga0209565_1023186 Ga0209565_10231861 231
14 3300025920 Ga0207649_10309828 Ga0207649_103098282 231
15 3300026116 Ga0207674_10287779 Ga0207674_102877792 231
16 3300003187 JGI25151J46595_10001896 JGI25151J46595_100018963 233
17 3300003203 JGI25406J46586_10035972 JGI25406J46586_100359722 233
18 3300005334 Ga0068869_100136013 Ga0068869_1001360132 233
19 3300005441 Ga0070700_100131650 Ga0070700_1001316501 233
20 3300005985 Ga0081539_10009313 Ga0081539_100093135 233
21 3300025294 Ga0209025_1000929 Ga0209025_100092927 233
22 3300025908 Ga0207643_10013410 Ga0207643_100134104 233
23 3300046472 Ga0495580_0033707 Ga0495580_0033707_332_1114 233
24 3300048924 Ga0496121_0020294 Ga0496121_0020294_2569_3351 233
25 3300003187 JGI25151J46595_10008596 JGI25151J46595_100085963 234
26 3300006852 Ga0075433_10197585 Ga0075433_101975852 234
27 3300006871 Ga0075434_100068221 Ga0075434_1000682214 234
28 3300024227 Ga0228598_1037143 Ga0228598_10371431 234
29 3300025294 Ga0209025_1000624 Ga0209025_10006243 234
30 3300027907 Ga0207428_10012008 Ga0207428_100120082 234
31 3300048907 Ga0496104_0296340 Ga0496104_0296340_723_1502 234
32 3300050511 nmdc:mga08y16_140040_c1 nmdc:mga08y16_140040_c1_1063_1845 234
33 3300050512 nmdc:mga0n895_64693_c1 nmdc:mga0n895_64693_c1_1745_2527 234
34 3300050515 nmdc:mga0a205_2299_c1 nmdc:mga0a205_2299_c1_15639_16421 234
35 3300005331 Ga0070670_100067683 Ga0070670_1000676832 236
36 3300005338 Ga0068868_100060114 Ga0068868_1000601142 236
37 3300005344 Ga0070661_100224573 Ga0070661_1002245731 236
38 3300005440 Ga0070705_100032090 Ga0070705_1000320901 236
39 3300005455 Ga0070663_100106613 Ga0070663_1001066132 236
40 3300005578 Ga0068854_100249538 Ga0068854_1002495382 236
41 3300005616 Ga0068852_100295085 Ga0068852_1002950852 236
42 3300005834 Ga0068851_10040310 Ga0068851_100403102 236
43 3300006048 Ga0075363_100005387 Ga0075363_1000053876 236
44 3300006051 Ga0075364_10232699 Ga0075364_102326992 236
45 3300006058 Ga0075432_10019769 Ga0075432_100197692 236
46 3300006177 Ga0075362_10092615 Ga0075362_100926152 236
47 3300006195 Ga0075366_10037733 Ga0075366_100377332 236
48 3300009093 Ga0105240_10014808 Ga0105240_100148083 236
49 3300009545 Ga0105237_10287832 Ga0105237_102878321 236
50 3300013105 Ga0157369_10105059 Ga0157369_101050593 236
51 3300025321 Ga0207656_10046627 Ga0207656_100466272 236
52 3300025913 Ga0207695_10423272 Ga0207695_104232722 236
53 3300025914 Ga0207671_10237712 Ga0207671_102377122 236
54 3300025981 Ga0207640_10063362 Ga0207640_100633623 236
55 3300026023 Ga0207677_10164628 Ga0207677_101646282 236
56 3300046515 Ga0495620_0065924 Ga0495620_0065924_278_1057 236
57 3300046539 Ga0495621_0128057 Ga0495621_0128057_106_885 236
58 3300046660 Ga0495625_0000436 Ga0495625_0000436_36269_37051 236
59 3300046691 Ga0495670_0062773 Ga0495670_0062773_345_1124 236
60 3300048911 Ga0496108_0395200 Ga0496108_0395200_145_924 236
61 3300048913 Ga0496110_0226002 Ga0496110_0226002_485_1264 236
62 3300050491 nmdc:mga00v17_75055_c1 nmdc:mga00v17_75055_c1_1012_1794 236
63 3300050492 nmdc:mga0yw44_25520_c1 nmdc:mga0yw44_25520_c1_1698_2480 236
64 3300050493 nmdc:mga0k408_91021_c1 nmdc:mga0k408_91021_c1_874_1656 236
65 3300005331 Ga0070670_100000050 Ga0070670_10000005060 237
66 3300005335 Ga0070666_10068767 Ga0070666_100687672 237
67 3300005347 Ga0070668_100000170 Ga0070668_10000017025 237
68 3300005367 Ga0070667_100000140 Ga0070667_10000014081 237
69 3300005548 Ga0070665_100000923 Ga0070665_10000092312 237
70 3300005618 Ga0068864_100000275 Ga0068864_10000027520 237
71 3300005719 Ga0068861_100124365 Ga0068861_1001243652 237
72 3300005841 Ga0068863_100000292 Ga0068863_10000029241 237
73 3300005842 Ga0068858_100004751 Ga0068858_10000475112 237
74 3300005843 Ga0068860_100000845 Ga0068860_10000084520 237
75 3300005844 Ga0068862_100001028 Ga0068862_10000102814 237
76 3300009177 Ga0105248_10017766 Ga0105248_1001776610 237
77 3300009553 Ga0105249_10001113 Ga0105249_100011133 237
78 3300013306 Ga0163162_10195759 Ga0163162_101957592 237
79 3300014968 Ga0157379_10007852 Ga0157379_100078524 237
80 3300025903 Ga0207680_10026989 Ga0207680_100269892 237
81 3300025925 Ga0207650_10000133 Ga0207650_1000013317 237
82 3300025941 Ga0207711_10012247 Ga0207711_1001224710 237
83 3300025961 Ga0207712_10000689 Ga0207712_1000068924 237
84 3300025972 Ga0207668_10000275 Ga0207668_1000027533 237
85 3300025986 Ga0207658_10001145 Ga0207658_1000114517 237
86 3300026088 Ga0207641_10004884 Ga0207641_1000488412 237
87 3300026095 Ga0207676_10005547 Ga0207676_100055473 237
88 3300026118 Ga0207675_100125288 Ga0207675_1001252882 237
89 3300028379 Ga0268266_10006847 Ga0268266_100068472 237
90 3300028380 Ga0268265_10004940 Ga0268265_1000494011 237
91 3300028381 Ga0268264_10000358 Ga0268264_1000035860 237
92 3300031730 Ga0307516_10145603 Ga0307516_101456032 237
93 3300060353 Ga0501082_0501645 Ga0501082_0501645_17_796 237
94 3300006852 Ga0075433_10178897 Ga0075433_101788972 238
95 3300007076 Ga0075435_100219670 Ga0075435_1002196701 238
96 3300009094 Ga0111539_10369179 Ga0111539_103691792 238
97 3300009147 Ga0114129_10102860 Ga0114129_101028603 238
98 3300050511 nmdc:mga08y16_68397_c1 nmdc:mga08y16_68397_c1_1168_1947 238
99 3300050513 nmdc:mga0rr50_185515_c1 nmdc:mga0rr50_185515_c1_295_1077 238
100 3300050515 nmdc:mga0a205_256485_c1 nmdc:mga0a205_256485_c1_13_795 238
101 3300003775 Ga0055524_1002528 Ga0055524_10025287 240
102 3300005471 Ga0070698_100010828 Ga0070698_10001082811 240
103 3300005981 Ga0081538_10035782 Ga0081538_100357821 240
104 3300025294 Ga0209025_1060115 Ga0209025_10601152 240
105 3300025299 Ga0209256_1000176 Ga0209256_100017631 240
106 3300025945 Ga0207679_10033072 Ga0207679_100330722 240
107 3300005434 Ga0070709_10174783 Ga0070709_101747832 241
108 3300005436 Ga0070713_100037308 Ga0070713_1000373082 241
109 3300005437 Ga0070710_10034977 Ga0070710_100349772 241
110 3300005439 Ga0070711_100013174 Ga0070711_1000131742 241
111 3300006028 Ga0070717_10067436 Ga0070717_100674362 241
112 3300006173 Ga0070716_100186501 Ga0070716_1001865011 241
113 3300006175 Ga0070712_100035681 Ga0070712_1000356812 241
114 3300025905 Ga0207685_10081428 Ga0207685_100814282 241
115 3300025906 Ga0207699_10095416 Ga0207699_100954162 241
116 3300025915 Ga0207693_10003527 Ga0207693_1000352711 241
117 3300025916 Ga0207663_10034041 Ga0207663_100340412 241
118 3300005543 Ga0070672_100001043 Ga0070672_1000010433 242
119 3300013297 Ga0157378_10281331 Ga0157378_102813312 242
120 3300014969 Ga0157376_10028899 Ga0157376_100288994 242
121 3300025940 Ga0207691_10045423 Ga0207691_100454233 242
122 3300005335 Ga0070666_10039156 Ga0070666_100391563 243
123 3300005347 Ga0070668_100322886 Ga0070668_1003228861 243
124 3300005367 Ga0070667_100030963 Ga0070667_1000309634 243
125 3300005456 Ga0070678_100000728 Ga0070678_1000007287 243
126 3300005459 Ga0068867_100488545 Ga0068867_1004885451 243
127 3300005842 Ga0068858_100018757 Ga0068858_1000187576 243
128 3300009177 Ga0105248_10510953 Ga0105248_105109532 243
129 3300025903 Ga0207680_10022090 Ga0207680_100220903 243
130 3300025937 Ga0207669_10003358 Ga0207669_100033582 243
131 3300025941 Ga0207711_10502108 Ga0207711_105021081 243
132 3300025972 Ga0207668_10271282 Ga0207668_102712821 243
133 3300026023 Ga0207677_10087500 Ga0207677_100875003 243
134 3300026035 Ga0207703_10026290 Ga0207703_100262903 243
135 3300026089 Ga0207648_10044844 Ga0207648_100448443 243
136 3300026121 Ga0207683_10064796 Ga0207683_100647963 243
137 3300028379 Ga0268266_10028221 Ga0268266_100282215 243
138 3300049680 Ga0501250_007422 Ga0501250_007422_60_842 243
139 3300005327 Ga0070658_10244094 Ga0070658_102440942 245
140 3300005434 Ga0070709_10017181 Ga0070709_100171812 245
141 3300005436 Ga0070713_100012591 Ga0070713_1000125912 245
142 3300005471 Ga0070698_100001471 Ga0070698_10000147113 245
143 3300005546 Ga0070696_100024590 Ga0070696_1000245903 245
144 3300006028 Ga0070717_10000603 Ga0070717_1000060311 245
145 3300006175 Ga0070712_100269546 Ga0070712_1002695462 245
146 3300025906 Ga0207699_10085922 Ga0207699_100859222 245
147 3300025915 Ga0207693_10292137 Ga0207693_102921371 245
148 3300025915 Ga0207693_10370698 Ga0207693_103706981 245
149 3300025928 Ga0207700_10112191 Ga0207700_101121913 245
150 3300005330 Ga0070690_100000674 Ga0070690_10000067411 246
151 3300005335 Ga0070666_10006295 Ga0070666_100062959 246
152 3300005338 Ga0068868_100019088 Ga0068868_1000190885 246
153 3300005340 Ga0070689_100010550 Ga0070689_1000105505 246
154 3300005354 Ga0070675_100003246 Ga0070675_1000032463 246
155 3300005355 Ga0070671_100005745 Ga0070671_10000574510 246
156 3300005364 Ga0070673_100004666 Ga0070673_1000046662 246
157 3300005365 Ga0070688_100011717 Ga0070688_1000117172 246
158 3300005367 Ga0070667_100030395 Ga0070667_1000303955 246
159 3300005439 Ga0070711_100189243 Ga0070711_1001892432 246
160 3300005458 Ga0070681_10068229 Ga0070681_100682293 246
161 3300005458 Ga0070681_10434323 Ga0070681_104343231 246
162 3300005543 Ga0070672_100109845 Ga0070672_1001098452 246
163 3300005616 Ga0068852_100055776 Ga0068852_1000557762 246
164 3300005617 Ga0068859_100002993 Ga0068859_10000299312 246
165 3300005618 Ga0068864_100013588 Ga0068864_1000135883 246
166 3300005841 Ga0068863_100001479 Ga0068863_10000147912 246
167 3300005842 Ga0068858_100001164 Ga0068858_10000116414 246
168 3300006358 Ga0068871_100057919 Ga0068871_1000579194 246
169 3300006931 Ga0097620_100002993 Ga0097620_10000299312 246
170 3300009177 Ga0105248_10115363 Ga0105248_101153633 246
171 3300013105 Ga0157369_10051814 Ga0157369_100518143 246
172 3300013306 Ga0163162_10193449 Ga0163162_101934492 246
173 3300014325 Ga0163163_10004818 Ga0163163_1000481811 246
174 3300025899 Ga0207642_10092999 Ga0207642_100929992 246
175 3300025903 Ga0207680_10047487 Ga0207680_100474873 246
176 3300025907 Ga0207645_10026627 Ga0207645_100266275 246
177 3300025921 Ga0207652_10079971 Ga0207652_100799712 246
178 3300025926 Ga0207659_10001360 Ga0207659_100013607 246
179 3300025931 Ga0207644_10003477 Ga0207644_100034779 246
180 3300025936 Ga0207670_10006012 Ga0207670_100060124 246
181 3300025941 Ga0207711_10411695 Ga0207711_104116952 246
182 3300025986 Ga0207658_10025918 Ga0207658_100259185 246
183 3300026035 Ga0207703_10002292 Ga0207703_100022923 246
184 3300026088 Ga0207641_10001486 Ga0207641_1000148613 246
185 3300026089 Ga0207648_10285860 Ga0207648_102858602 246
186 3300026095 Ga0207676_10002421 Ga0207676_100024217 246
187 3300026142 Ga0207698_10153243 Ga0207698_101532432 246
188 3300048907 Ga0496104_0674134 Ga0496104_0674134_62_847 246
189 3300048909 Ga0496106_0079115 Ga0496106_0079115_580_1365 246
190 3300048912 Ga0496109_0043237 Ga0496109_0043237_1106_1891 246
191 3300048913 Ga0496110_0283722 Ga0496110_0283722_686_1471 246
192 3300005331 Ga0070670_100052202 Ga0070670_1000522025 247
193 3300039438 Ga0436360_0220478 Ga0436360_0220478_189_944 249
194 3300048904 Ga0496101_0679824 Ga0496101_0679824_22_771 249
195 3300005331 Ga0070670_100274822 Ga0070670_1002748222 250
196 3300005539 Ga0068853_100217667 Ga0068853_1002176672 250
197 3300006881 Ga0068865_100152883 Ga0068865_1001528833 250
198 3300014326 Ga0157380_10455955 Ga0157380_104559552 250
199 3300017792 Ga0163161_10216482 Ga0163161_102164821 250
200 3300025931 Ga0207644_10515210 Ga0207644_105152101 250
201 3300025937 Ga0207669_10049274 Ga0207669_100492743 250
202 3300025941 Ga0207711_10400896 Ga0207711_104008962 250
203 3300025972 Ga0207668_10190862 Ga0207668_101908622 250
204 3300026089 Ga0207648_10088386 Ga0207648_100883864 250
205 3300028380 Ga0268265_10126967 Ga0268265_101269673 250
206 3300046471 Ga0495650_0000194 Ga0495650_0000194_35092_35874 250
207 3300041503 Ga0451847_0461108 Ga0451847_0461108_56_817 251
208 3300046459 Ga0495629_0054326 Ga0495629_0054326_55_816 251
209 3300053148 Ga0500590_004048 Ga0500590_004048_2922_3683 251
210 3300039450 Ga0436363_1091328 Ga0436363_1091328_233_1012 252
211 3300045051 Ga0451576_0025457 Ga0451576_0025457_3923_4705 252
212 iso_pu_bacteria 2953994433 2953996336 252
213 iso_pu_bacteria 2767802442 2770195882 253
214 iso_pu_bacteria 2775506902 2776269411 253
215 iso_pu_bacteria 2775506904 2776282341 253
216 iso_pu_bacteria 2513237088 2513598224 254
217 iso_pu_bacteria 2515154114 2515646586 254
218 iso_pu_bacteria 2582581283 2585165055 254
219 iso_pu_bacteria 8024486573 8024488839 254
220 iso_pu_bacteria 8046767195 8046774800 254
221 3300005336 Ga0070680_100060995 Ga0070680_1000609953 255
222 3300005345 Ga0070692_10010322 Ga0070692_100103222 255
223 3300005347 Ga0070668_100002930 Ga0070668_10000293012 255
224 3300005353 Ga0070669_100000639 Ga0070669_1000006397 255
225 3300005441 Ga0070700_100002078 Ga0070700_1000020786 255
226 3300005444 Ga0070694_100087105 Ga0070694_1000871052 255
227 3300005459 Ga0068867_100000275 Ga0068867_1000002752 255
228 3300005543 Ga0070672_100333406 Ga0070672_1003334062 255
229 3300005618 Ga0068864_100019783 Ga0068864_1000197832 255
230 3300005719 Ga0068861_100004038 Ga0068861_1000040385 255
231 3300005844 Ga0068862_100007003 Ga0068862_1000070039 255
232 3300006844 Ga0075428_100302655 Ga0075428_1003026552 255
233 3300009094 Ga0111539_10028072 Ga0111539_100280725 255
234 3300009148 Ga0105243_10002331 Ga0105243_100023317 255
235 3300009553 Ga0105249_10003043 Ga0105249_1000304312 255
236 3300013306 Ga0163162_10322882 Ga0163162_103228822 255
237 3300014326 Ga0157380_10008406 Ga0157380_100084064 255
238 3300025917 Ga0207660_10045654 Ga0207660_100456543 255
239 3300025923 Ga0207681_10001443 Ga0207681_1000144310 255
240 3300025935 Ga0207709_10003308 Ga0207709_100033088 255
241 3300025940 Ga0207691_10049616 Ga0207691_100496163 255
242 3300025961 Ga0207712_10132703 Ga0207712_101327032 255
243 3300025972 Ga0207668_10002130 Ga0207668_100021302 255
244 3300026075 Ga0207708_10000560 Ga0207708_100005607 255
245 3300026089 Ga0207648_10001209 Ga0207648_100012097 255
246 3300026118 Ga0207675_100001008 Ga0207675_10000100814 255
247 3300027907 Ga0207428_10170995 Ga0207428_101709952 255
248 3300028380 Ga0268265_10000728 Ga0268265_1000072819 255
249 3300041413 Ga0439465_0001164 Ga0439465_0001164_4443_5279 255
250 3300048927 Ga0496124_0000315 Ga0496124_0000315_33801_34577 255
251 3300050511 nmdc:mga08y16_375153_c1 nmdc:mga08y16_375153_c1_535_1305 255
252 3300005985 Ga0081539_10070877 Ga0081539_100708771 256
253 3300025949 Ga0207667_10063675 Ga0207667_100636752 256
254 3300025960 Ga0207651_10731312 Ga0207651_107313121 256
255 3300025981 Ga0207640_10483660 Ga0207640_104836601 256
256 3300037471 Ga0395905_0112475 Ga0395905_0112475_1719_2492 256
257 3300060353 Ga0501082_0606628 Ga0501082_0606628_20_790 256
258 3300002070 JGI24750J21931_1008019 JGI24750J21931_10080192 257
259 3300002070 JGI24750J21931_1008042 JGI24750J21931_10080422 257
260 3300003771 Ga0055526_1003172 Ga0055526_10031724 257
261 3300003911 JGI25405J52794_10002173 JGI25405J52794_100021732 257
262 3300003911 JGI25405J52794_10026052 JGI25405J52794_100260521 257
263 3300005331 Ga0070670_100004483 Ga0070670_1000044836 257
264 3300005331 Ga0070670_100134931 Ga0070670_1001349313 257
265 3300005334 Ga0068869_100165283 Ga0068869_1001652832 257
266 3300005336 Ga0070680_100001629 Ga0070680_10000162912 257
267 3300005336 Ga0070680_100192066 Ga0070680_1001920662 257
268 3300005338 Ga0068868_100212160 Ga0068868_1002121602 257
269 3300005340 Ga0070689_100020981 Ga0070689_1000209814 257
270 3300005341 Ga0070691_10133501 Ga0070691_101335011 257
271 3300005344 Ga0070661_100007395 Ga0070661_1000073953 257
272 3300005353 Ga0070669_100044328 Ga0070669_1000443282 257
273 3300005355 Ga0070671_100099596 Ga0070671_1000995963 257
274 3300005364 Ga0070673_100300015 Ga0070673_1003000152 257
275 3300005365 Ga0070688_100045737 Ga0070688_1000457373 257
276 3300005367 Ga0070667_100246802 Ga0070667_1002468023 257
277 3300005367 Ga0070667_100895894 Ga0070667_1008958941 257
278 3300005436 Ga0070713_100031008 Ga0070713_1000310083 257
279 3300005436 Ga0070713_100313215 Ga0070713_1003132152 257
280 3300005437 Ga0070710_10005027 Ga0070710_100050277 257
281 3300005438 Ga0070701_10122802 Ga0070701_101228022 257
282 3300005439 Ga0070711_100054396 Ga0070711_1000543962 257
283 3300005439 Ga0070711_100226113 Ga0070711_1002261132 257
284 3300005439 Ga0070711_100443941 Ga0070711_1004439411 257
285 3300005441 Ga0070700_100002787 Ga0070700_1000027877 257
286 3300005455 Ga0070663_100116672 Ga0070663_1001166723 257
287 3300005456 Ga0070678_100012686 Ga0070678_1000126863 257
288 3300005457 Ga0070662_100031178 Ga0070662_1000311783 257
289 3300005458 Ga0070681_10044420 Ga0070681_100444204 257
290 3300005458 Ga0070681_10070252 Ga0070681_100702524 257
291 3300005458 Ga0070681_10114590 Ga0070681_101145901 257
292 3300005459 Ga0068867_100070292 Ga0068867_1000702923 257
293 3300005466 Ga0070685_10036946 Ga0070685_100369461 257
294 3300005518 Ga0070699_100011671 Ga0070699_1000116718 257
295 3300005518 Ga0070699_100200048 Ga0070699_1002000482 257
296 3300005530 Ga0070679_100081043 Ga0070679_1000810432 257
297 3300005535 Ga0070684_100072913 Ga0070684_1000729132 257
298 3300005535 Ga0070684_100105393 Ga0070684_1001053933 257
299 3300005544 Ga0070686_100090637 Ga0070686_1000906372 257
300 3300005545 Ga0070695_100414046 Ga0070695_1004140461 257
301 3300005546 Ga0070696_100200663 Ga0070696_1002006632 257
302 3300005547 Ga0070693_100277672 Ga0070693_1002776721 257
303 3300005548 Ga0070665_100354621 Ga0070665_1003546211 257
304 3300005549 Ga0070704_100273409 Ga0070704_1002734092 257
305 3300005563 Ga0068855_100174712 Ga0068855_1001747123 257
306 3300005564 Ga0070664_100475443 Ga0070664_1004754432 257
307 3300005577 Ga0068857_100144922 Ga0068857_1001449222 257
308 3300005578 Ga0068854_100197990 Ga0068854_1001979902 257
309 3300005614 Ga0068856_100364433 Ga0068856_1003644332 257
310 3300005616 Ga0068852_100103802 Ga0068852_1001038023 257
311 3300005618 Ga0068864_100122126 Ga0068864_1001221262 257
312 3300005834 Ga0068851_10128435 Ga0068851_101284351 257
313 3300005841 Ga0068863_100299546 Ga0068863_1002995462 257
314 3300005841 Ga0068863_100551394 Ga0068863_1005513942 257
315 3300005842 Ga0068858_100056320 Ga0068858_1000563202 257
316 3300005843 Ga0068860_100014779 Ga0068860_1000147796 257
317 3300005937 Ga0081455_10001860 Ga0081455_1000186010 257
318 3300005937 Ga0081455_10009744 Ga0081455_100097449 257
319 3300005937 Ga0081455_10031798 Ga0081455_100317984 257
320 3300005981 Ga0081538_10098511 Ga0081538_100985111 257
321 3300005983 Ga0081540_1009789 Ga0081540_10097892 257
322 3300006028 Ga0070717_10060335 Ga0070717_100603352 257
323 3300006038 Ga0075365_10086667 Ga0075365_100866672 257
324 3300006038 Ga0075365_10243504 Ga0075365_102435042 257
325 3300006051 Ga0075364_10088814 Ga0075364_100888141 257
326 3300006051 Ga0075364_10174241 Ga0075364_101742412 257
327 3300006173 Ga0070716_100078273 Ga0070716_1000782732 257
328 3300006175 Ga0070712_100020375 Ga0070712_1000203756 257
329 3300006175 Ga0070712_100320342 Ga0070712_1003203422 257
330 3300006178 Ga0075367_10128398 Ga0075367_101283981 257
331 3300006237 Ga0097621_100019564 Ga0097621_1000195645 257
332 3300006358 Ga0068871_100062414 Ga0068871_1000624143 257
333 3300006358 Ga0068871_100078716 Ga0068871_1000787162 257
334 3300006844 Ga0075428_100040725 Ga0075428_1000407256 257
335 3300006844 Ga0075428_100199872 Ga0075428_1001998723 257
336 3300006844 Ga0075428_100298902 Ga0075428_1002989022 257
337 3300006846 Ga0075430_100007044 Ga0075430_1000070449 257
338 3300006846 Ga0075430_100035206 Ga0075430_1000352063 257
339 3300006846 Ga0075430_100063617 Ga0075430_1000636174 257
340 3300006847 Ga0075431_100013070 Ga0075431_1000130709 257
341 3300006847 Ga0075431_100014686 Ga0075431_1000146864 257
342 3300006847 Ga0075431_100063587 Ga0075431_1000635874 257
343 3300006847 Ga0075431_100242051 Ga0075431_1002420513 257
344 3300006852 Ga0075433_10151262 Ga0075433_101512622 257
345 3300006852 Ga0075433_10430911 Ga0075433_104309113 257
346 3300006871 Ga0075434_100086729 Ga0075434_1000867294 257
347 3300006880 Ga0075429_100242406 Ga0075429_1002424062 257
348 3300006881 Ga0068865_100003957 Ga0068865_1000039577 257
349 3300007788 Ga0099795_10011044 Ga0099795_100110442 257
350 3300009093 Ga0105240_10031660 Ga0105240_100316607 257
351 3300009093 Ga0105240_10331535 Ga0105240_103315352 257
352 3300009094 Ga0111539_10062101 Ga0111539_100621014 257
353 3300009094 Ga0111539_10072021 Ga0111539_100720213 257
354 3300009094 Ga0111539_10130516 Ga0111539_101305163 257
355 3300009098 Ga0105245_10046360 Ga0105245_100463602 257
356 3300009098 Ga0105245_10218523 Ga0105245_102185232 257
357 3300009101 Ga0105247_10148326 Ga0105247_101483262 257
358 3300009101 Ga0105247_10215435 Ga0105247_102154352 257
359 3300009147 Ga0114129_10011942 Ga0114129_100119424 257
360 3300009147 Ga0114129_10022955 Ga0114129_100229557 257
361 3300009147 Ga0114129_10061066 Ga0114129_100610662 257
362 3300009147 Ga0114129_10061685 Ga0114129_100616855 257
363 3300009148 Ga0105243_10026946 Ga0105243_100269463 257
364 3300009176 Ga0105242_10447400 Ga0105242_104474002 257
365 3300009177 Ga0105248_10069700 Ga0105248_100697004 257
366 3300009177 Ga0105248_10141427 Ga0105248_101414273 257
367 3300009177 Ga0105248_10421495 Ga0105248_104214952 257
368 3300009177 Ga0105248_11364523 Ga0105248_113645231 257
369 3300009553 Ga0105249_10162864 Ga0105249_101628643 257
370 3300010375 Ga0105239_10118340 Ga0105239_101183402 257
371 3300010375 Ga0105239_10199484 Ga0105239_101994842 257
372 3300010375 Ga0105239_10764368 Ga0105239_107643681 257
373 3300011119 Ga0105246_10020051 Ga0105246_100200514 257
374 3300013104 Ga0157370_10004330 Ga0157370_1000433013 257
375 3300013105 Ga0157369_10061545 Ga0157369_100615451 257
376 3300013296 Ga0157374_10126224 Ga0157374_101262241 257
377 3300013296 Ga0157374_10158265 Ga0157374_101582652 257
378 3300013296 Ga0157374_10281164 Ga0157374_102811642 257
379 3300013297 Ga0157378_10046583 Ga0157378_100465833 257
380 3300013297 Ga0157378_10095877 Ga0157378_100958771 257
381 3300013306 Ga0163162_10335457 Ga0163162_103354571 257
382 3300013306 Ga0163162_10341367 Ga0163162_103413672 257
383 3300013306 Ga0163162_10354834 Ga0163162_103548342 257
384 3300013306 Ga0163162_10401034 Ga0163162_104010342 257
385 3300013308 Ga0157375_10181975 Ga0157375_101819752 257
386 3300013308 Ga0157375_10292498 Ga0157375_102924982 257
387 3300013308 Ga0157375_10428176 Ga0157375_104281763 257
388 3300014325 Ga0163163_10027715 Ga0163163_100277152 257
389 3300014326 Ga0157380_10067001 Ga0157380_100670012 257
390 3300014968 Ga0157379_10072004 Ga0157379_100720045 257
391 3300014968 Ga0157379_10326605 Ga0157379_103266052 257
392 3300014969 Ga0157376_10439344 Ga0157376_104393442 257
393 3300021361 Ga0213872_10000279 Ga0213872_1000027936 257
394 3300021361 Ga0213872_10000502 Ga0213872_1000050227 257
395 3300021361 Ga0213872_10002578 Ga0213872_100025788 257
396 3300021361 Ga0213872_10028105 Ga0213872_100281051 257
397 3300021384 Ga0213876_10232443 Ga0213876_102324431 257
398 3300025233 Ga0209437_105260 Ga0209437_1052602 257
399 3300025246 Ga0209646_1000072 Ga0209646_100007225 257
400 3300025295 Ga0209564_1000072 Ga0209564_1000072272 257
401 3300025898 Ga0207692_10057340 Ga0207692_100573402 257
402 3300025899 Ga0207642_10152269 Ga0207642_101522692 257
403 3300025900 Ga0207710_10005521 Ga0207710_100055214 257
404 3300025901 Ga0207688_10002037 Ga0207688_1000203710 257
405 3300025904 Ga0207647_10136734 Ga0207647_101367341 257
406 3300025905 Ga0207685_10003238 Ga0207685_100032384 257
407 3300025906 Ga0207699_10024177 Ga0207699_100241771 257
408 3300025907 Ga0207645_10023307 Ga0207645_100233075 257
409 3300025907 Ga0207645_10301151 Ga0207645_103011511 257
410 3300025908 Ga0207643_10000872 Ga0207643_100008728 257
411 3300025910 Ga0207684_10059972 Ga0207684_100599722 257
412 3300025912 Ga0207707_10000993 Ga0207707_1000099312 257
413 3300025912 Ga0207707_10007140 Ga0207707_100071409 257
414 3300025912 Ga0207707_10040679 Ga0207707_100406792 257
415 3300025912 Ga0207707_10162531 Ga0207707_101625312 257
416 3300025913 Ga0207695_10213503 Ga0207695_102135032 257
417 3300025915 Ga0207693_10024667 Ga0207693_100246672 257
418 3300025916 Ga0207663_10170581 Ga0207663_101705812 257
419 3300025917 Ga0207660_10166533 Ga0207660_101665332 257
420 3300025918 Ga0207662_10096112 Ga0207662_100961122 257
421 3300025919 Ga0207657_10030389 Ga0207657_100303894 257
422 3300025920 Ga0207649_10006622 Ga0207649_100066227 257
423 3300025921 Ga0207652_10010460 Ga0207652_100104606 257
424 3300025921 Ga0207652_10061698 Ga0207652_100616982 257
425 3300025925 Ga0207650_10002222 Ga0207650_100022226 257
426 3300025925 Ga0207650_10006091 Ga0207650_100060915 257
427 3300025925 Ga0207650_10108529 Ga0207650_101085293 257
428 3300025926 Ga0207659_10190888 Ga0207659_101908881 257
429 3300025927 Ga0207687_10248115 Ga0207687_102481152 257
430 3300025928 Ga0207700_10050938 Ga0207700_100509384 257
431 3300025928 Ga0207700_10082293 Ga0207700_100822932 257
432 3300025928 Ga0207700_10482378 Ga0207700_104823781 257
433 3300025931 Ga0207644_10111199 Ga0207644_101111992 257
434 3300025932 Ga0207690_10207707 Ga0207690_102077072 257
435 3300025933 Ga0207706_10006344 Ga0207706_100063447 257
436 3300025939 Ga0207665_10006295 Ga0207665_100062953 257
437 3300025940 Ga0207691_10025399 Ga0207691_100253996 257
438 3300025941 Ga0207711_10122103 Ga0207711_101221032 257
439 3300025941 Ga0207711_10340269 Ga0207711_103402692 257
440 3300025942 Ga0207689_10044726 Ga0207689_100447262 257
441 3300025944 Ga0207661_10030482 Ga0207661_100304827 257
442 3300025944 Ga0207661_10034410 Ga0207661_100344102 257
443 3300025949 Ga0207667_10557931 Ga0207667_105579312 257
444 3300025960 Ga0207651_10497188 Ga0207651_104971882 257
445 3300025961 Ga0207712_10271093 Ga0207712_102710932 257
446 3300025972 Ga0207668_10370634 Ga0207668_103706341 257
447 3300025981 Ga0207640_10049413 Ga0207640_100494134 257
448 3300026067 Ga0207678_10005238 Ga0207678_100052388 257
449 3300026067 Ga0207678_10073617 Ga0207678_100736172 257
450 3300026067 Ga0207678_10609596 Ga0207678_106095962 257
451 3300026075 Ga0207708_10060105 Ga0207708_100601055 257
452 3300026089 Ga0207648_10026444 Ga0207648_100264445 257
453 3300026095 Ga0207676_10714313 Ga0207676_107143131 257
454 3300026118 Ga0207675_100059299 Ga0207675_1000592992 257
455 3300026121 Ga0207683_10007701 Ga0207683_100077011 257
456 3300026121 Ga0207683_10019753 Ga0207683_100197534 257
457 3300027907 Ga0207428_10132546 Ga0207428_101325461 257
458 3300031250 Ga0265331_10000002 Ga0265331_1000000249 257
459 3300031250 Ga0265331_10000355 Ga0265331_1000035530 257
460 3300031251 Ga0265327_10000033 Ga0265327_1000003348 257
461 3300031711 Ga0265314_10003660 Ga0265314_100036603 257
462 3300035111 Ga0373923_0097413 Ga0373923_0097413_410_1189 257
463 3300035172 Ga0373955_0259703 Ga0373955_0259703_166_945 257
464 3300035691 Ga0373931_0189881 Ga0373931_0189881_289_1068 257
465 3300035692 Ga0373935_0140496 Ga0373935_0140496_619_1398 257
466 3300037068 Ga0373925_0031236 Ga0373925_0031236_1974_2753 257
467 3300037312 Ga0395899_0007777 Ga0395899_0007777_37_819 257
468 3300037418 Ga0395900_0019699 Ga0395900_0019699_5830_6612 257
469 3300037466 Ga0395898_0462143 Ga0395898_0462143_190_969 257
470 3300038443 Ga0395901_0007491 Ga0395901_0007491_10205_10987 257
471 3300038443 Ga0395901_0209231 Ga0395901_0209231_322_1101 257
472 3300039447 Ga0436361_0032090 Ga0436361_0032090_8326_9105 257
473 3300039447 Ga0436361_0421236 Ga0436361_0421236_37_816 257
474 3300039447 Ga0436361_0579013 Ga0436361_0579013_22342_23121 257
475 3300039447 Ga0436361_0972320 Ga0436361_0972320_8256_9035 257
476 3300039447 Ga0436361_1044948 Ga0436361_1044948_2607_3386 257
477 3300039450 Ga0436363_1403698 Ga0436363_1403698_186_968 257
478 3300039453 Ga0436362_0201408 Ga0436362_0201408_112_891 257
479 3300046457 Ga0495590_0000006 Ga0495590_0000006_157296_158075 257
480 3300046459 Ga0495629_0096585 Ga0495629_0096585_1171_1950 257
481 3300046460 Ga0495638_0000333 Ga0495638_0000333_49113_49892 257
482 3300046471 Ga0495650_0008058 Ga0495650_0008058_3272_4051 257
483 3300046472 Ga0495580_0036032 Ga0495580_0036032_644_1423 257
484 3300046476 Ga0495662_0110605 Ga0495662_0110605_267_1046 257
485 3300046492 Ga0495585_0112778 Ga0495585_0112778_163_942 257
486 3300046501 Ga0495607_0001831 Ga0495607_0001831_12642_13421 257
487 3300046506 Ga0495583_0000475 Ga0495583_0000475_49281_50060 257
488 3300046507 Ga0495606_0013329 Ga0495606_0013329_2233_3012 257
489 3300046513 Ga0495616_0088407 Ga0495616_0088407_446_1225 257
490 3300046514 Ga0495618_0128240 Ga0495618_0128240_206_985 257
491 3300046522 Ga0495643_0000358 Ga0495643_0000358_52773_53552 257
492 3300046524 Ga0495648_0000054 Ga0495648_0000054_150209_150988 257
493 3300046526 Ga0495666_0011471 Ga0495666_0011471_2199_2978 257
494 3300046528 Ga0495642_0009074 Ga0495642_0009074_1829_2608 257
495 3300046528 Ga0495642_0122436 Ga0495642_0122436_122_901 257
496 3300046528 Ga0495642_0178150 Ga0495642_0178150_60_839 257
497 3300046539 Ga0495621_0054737 Ga0495621_0054737_529_1308 257
498 3300046542 Ga0495597_0000191 Ga0495597_0000191_52750_53529 257
499 3300046557 Ga0495622_0000038 Ga0495622_0000038_8656_9435 257
500 3300046558 Ga0495633_0001301 Ga0495633_0001301_9352_10131 257
501 3300046558 Ga0495633_0089268 Ga0495633_0089268_99_878 257
502 3300046615 Ga0495656_0076154 Ga0495656_0076154_72_851 257
503 3300046616 Ga0495668_0001151 Ga0495668_0001151_8932_9711 257
504 3300046660 Ga0495625_0000558 Ga0495625_0000558_4300_5079 257
505 3300046681 Ga0495647_0038760 Ga0495647_0038760_82_864 257
506 3300046684 Ga0495669_0088311 Ga0495669_0088311_63_842 257
507 3300046684 Ga0495669_0109852 Ga0495669_0109852_100_879 257
508 3300046694 Ga0495649_0172884 Ga0495649_0172884_120_899 257
509 3300047315 Ga0495581_0157408 Ga0495581_0157408_278_1057 257
510 3300047319 Ga0495674_0267585 Ga0495674_0267585_529_1308 257
511 3300047321 Ga0495676_0226328 Ga0495676_0226328_202_981 257
512 3300047322 Ga0495680_0076772 Ga0495680_0076772_745_1524 257
513 3300047323 Ga0495683_0213944 Ga0495683_0213944_57_836 257
514 3300047443 Ga0495687_001334 Ga0495687_001334_8641_9420 257
515 3300047443 Ga0495687_004548 Ga0495687_004548_5935_6714 257
516 3300047471 Ga0495684_0144589 Ga0495684_0144589_372_1151 257
517 3300047472 Ga0495686_0270025 Ga0495686_0270025_77_856 257
518 3300047673 Ga0495593_0197086 Ga0495593_0197086_220_999 257
519 3300048089 Ga0495614_0038867 Ga0495614_0038867_1169_1948 257
520 3300048089 Ga0495614_0058997 Ga0495614_0058997_840_1619 257
521 3300048903 Ga0496100_0242447 Ga0496100_0242447_287_1066 257
522 3300048904 Ga0496101_0023566 Ga0496101_0023566_1761_2540 257
523 3300048904 Ga0496101_0061606 Ga0496101_0061606_749_1528 257
524 3300048904 Ga0496101_0114106 Ga0496101_0114106_126_905 257
525 3300048904 Ga0496101_0155871 Ga0496101_0155871_218_994 257
526 3300048905 Ga0496102_0032411 Ga0496102_0032411_2732_3508 257
527 3300048905 Ga0496102_0034017 Ga0496102_0034017_1159_1938 257
528 3300048905 Ga0496102_0137229 Ga0496102_0137229_381_1160 257
529 3300048906 Ga0496103_0027729 Ga0496103_0027729_2374_3150 257
530 3300048906 Ga0496103_0058180 Ga0496103_0058180_641_1420 257
531 3300048906 Ga0496103_0263325 Ga0496103_0263325_136_915 257
532 3300048907 Ga0496104_0003625 Ga0496104_0003625_11411_12190 257
533 3300048907 Ga0496104_0003891 Ga0496104_0003891_649_1428 257
534 3300048907 Ga0496104_0049441 Ga0496104_0049441_583_1362 257
535 3300048908 Ga0496105_0001322 Ga0496105_0001322_6606_7385 257
536 3300048908 Ga0496105_0036542 Ga0496105_0036542_621_1400 257
537 3300048909 Ga0496106_0113686 Ga0496106_0113686_731_1510 257
538 3300048910 Ga0496107_0002458 Ga0496107_0002458_8541_9320 257
539 3300048910 Ga0496107_0037478 Ga0496107_0037478_1428_2207 257
540 3300048911 Ga0496108_0002238 Ga0496108_0002238_838_1617 257
541 3300048912 Ga0496109_0002809 Ga0496109_0002809_9870_10649 257
542 3300048912 Ga0496109_0031863 Ga0496109_0031863_3141_3920 257
543 3300048913 Ga0496110_0024415 Ga0496110_0024415_2509_3288 257
544 3300048913 Ga0496110_0065317 Ga0496110_0065317_377_1156 257
545 3300048914 Ga0496111_0038968 Ga0496111_0038968_201_980 257
546 3300048914 Ga0496111_0124351 Ga0496111_0124351_89_868 257
547 3300048914 Ga0496111_0137848 Ga0496111_0137848_1004_1783 257
548 3300048915 Ga0496112_0033514 Ga0496112_0033514_2566_3345 257
549 3300048915 Ga0496112_0214935 Ga0496112_0214935_378_1154 257
550 3300048916 Ga0496113_0001266 Ga0496113_0001266_1672_2451 257
551 3300048916 Ga0496113_0059870 Ga0496113_0059870_1987_2766 257
552 3300048916 Ga0496113_0152766 Ga0496113_0152766_340_1119 257
553 3300048917 Ga0496114_0360228 Ga0496114_0360228_373_1152 257
554 3300048918 Ga0496115_0022583 Ga0496115_0022583_2538_3317 257
555 3300049459 Ga0495678_003848 Ga0495678_003848_1728_2507 257
556 3300049459 Ga0495678_005316 Ga0495678_005316_1514_2293 257
557 3300049571 Ga0501034_0002928 Ga0501034_0002928_5314_6096 257
558 3300049571 Ga0501034_0090019 Ga0501034_0090019_783_1565 257
559 3300049580 Ga0501046_0031358 Ga0501046_0031358_1888_2667 257
560 3300049584 Ga0501068_0034944 Ga0501068_0034944_430_1212 257
561 3300049584 Ga0501068_0195709 Ga0501068_0195709_293_1072 257
562 3300049741 Ga0501079_0369281 Ga0501079_0369281_232_1011 257
563 3300049743 Ga0501081_0112261 Ga0501081_0112261_76_855 257
564 3300050489 nmdc:mga03683_83289_c1 nmdc:mga03683_83289_c1_497_1276 257
565 3300050492 nmdc:mga0yw44_30075_c1 nmdc:mga0yw44_30075_c1_569_1348 257
566 3300050492 nmdc:mga0yw44_62260_c1 nmdc:mga0yw44_62260_c1_114_893 257
567 3300050494 nmdc:mga06z11_166450_c1 nmdc:mga06z11_166450_c1_99_881 257
568 3300050494 nmdc:mga06z11_223427_c1 nmdc:mga06z11_223427_c1_279_1058 257
569 3300050494 nmdc:mga06z11_43777_c1 nmdc:mga06z11_43777_c1_1217_1996 257
570 3300050496 nmdc:mga07m45_238953_c1 nmdc:mga07m45_238953_c1_116_895 257
571 3300050507 nmdc:mga05p37_1011036_c1 nmdc:mga05p37_1011036_c1_40_819 257
572 3300050507 nmdc:mga05p37_25897_c1 nmdc:mga05p37_25897_c1_5178_5957 257
573 3300050507 nmdc:mga05p37_44460_c1 nmdc:mga05p37_44460_c1_916_1695 257
574 3300050507 nmdc:mga05p37_96346_c1 nmdc:mga05p37_96346_c1_1601_2380 257
575 3300050508 nmdc:mga09592_128149_c1 nmdc:mga09592_128149_c1_792_1571 257
576 3300050509 nmdc:mga0qj67_15707_c1 nmdc:mga0qj67_15707_c1_2244_3023 257
577 3300050509 nmdc:mga0qj67_256687_c1 nmdc:mga0qj67_256687_c1_134_913 257
578 3300050509 nmdc:mga0qj67_42590_c1 nmdc:mga0qj67_42590_c1_612_1391 257
579 3300050509 nmdc:mga0qj67_48788_c1 nmdc:mga0qj67_48788_c1_1104_1883 257
580 3300050510 nmdc:mga06r32_173683_c1 nmdc:mga06r32_173683_c1_706_1485 257
581 3300050510 nmdc:mga06r32_219085_c1 nmdc:mga06r32_219085_c1_25_804 257
582 3300050510 nmdc:mga06r32_25454_c1 nmdc:mga06r32_25454_c1_1903_2682 257
583 3300050510 nmdc:mga06r32_30438_c1 nmdc:mga06r32_30438_c1_1515_2294 257
584 3300050511 nmdc:mga08y16_152775_c1 nmdc:mga08y16_152775_c1_357_1136 257
585 3300050511 nmdc:mga08y16_286908_c1 nmdc:mga08y16_286908_c1_811_1590 257
586 3300050511 nmdc:mga08y16_84713_c1 nmdc:mga08y16_84713_c1_2379_3158 257
587 3300050512 nmdc:mga0n895_182762_c1 nmdc:mga0n895_182762_c1_1119_1898 257
588 3300050512 nmdc:mga0n895_219747_c1 nmdc:mga0n895_219747_c1_309_1088 257
589 3300050512 nmdc:mga0n895_232339_c1 nmdc:mga0n895_232339_c1_440_1219 257
590 3300050512 nmdc:mga0n895_94644_c1 nmdc:mga0n895_94644_c1_714_1493 257
591 3300050513 nmdc:mga0rr50_367324_c1 nmdc:mga0rr50_367324_c1_118_897 257
592 3300050514 nmdc:mga08x19_310542_c1 nmdc:mga08x19_310542_c1_254_1033 257
593 3300053077 Ga0495601_0300039 Ga0495601_0300039_123_902 257
594 3300053083 Ga0495655_0020756 Ga0495655_0020756_78_857 257
595 3300053083 Ga0495655_0038608 Ga0495655_0038608_322_1101 257
596 3300053085 Ga0495619_0129091 Ga0495619_0129091_912_1691 257
597 3300053091 Ga0500647_0099467 Ga0500647_0099467_517_1299 257
598 3300053154 Ga0500619_000121 Ga0500619_000121_2310_3089 257
599 3300054114 Ga0501084_0185728 Ga0501084_0185728_757_1536 257
600 3300061734 Ga0530510_0108414 Ga0530510_0108414_59_838 257
601 3300001990 JGI24737J22298_10029246 JGI24737J22298_100292461 258
602 3300001991 JGI24743J22301_10009131 JGI24743J22301_100091311 258
603 3300002070 JGI24750J21931_1005805 JGI24750J21931_10058052 258
604 3300002075 JGI24738J21930_10009674 JGI24738J21930_100096743 258
605 3300002076 JGI24749J21850_1009644 JGI24749J21850_10096442 258
606 3300002459 JGI24751J29686_10007247 JGI24751J29686_100072473 258
607 3300003308 Ga0006777J48905_1052058 Ga0006777J48905_10520581 258
608 3300003322 rootL2_10000128 rootL2_100001283 258
609 3300003322 rootL2_10096177 rootL2_100961772 258
610 3300003544 Ga0007417J51691_1018296 Ga0007417J51691_10182961 258
611 3300003575 Ga0007409J51694_1042546 Ga0007409J51694_10425461 258
612 3300003577 Ga0007416J51690_1027846 Ga0007416J51690_10278461 258
613 3300003579 Ga0007429J51699_1048980 Ga0007429J51699_10489801 258
614 3300003693 Ga0032354_1014430 Ga0032354_10144301 258
615 3300003771 Ga0055526_1000050 Ga0055526_1000050101 258
616 3300003771 Ga0055526_1000439 Ga0055526_10004397 258
617 3300005262 Ga0065165_1000074 Ga0065165_100007499 258
618 3300005327 Ga0070658_10004584 Ga0070658_100045842 258
619 3300005327 Ga0070658_10018021 Ga0070658_100180214 258
620 3300005327 Ga0070658_10097543 Ga0070658_100975434 258
621 3300005328 Ga0070676_10010057 Ga0070676_100100577 258
622 3300005329 Ga0070683_100023208 Ga0070683_1000232086 258
623 3300005329 Ga0070683_100023385 Ga0070683_1000233855 258
624 3300005329 Ga0070683_100083307 Ga0070683_1000833073 258
625 3300005329 Ga0070683_100098650 Ga0070683_1000986502 258
626 3300005329 Ga0070683_100332799 Ga0070683_1003327992 258
627 3300005331 Ga0070670_100008183 Ga0070670_1000081839 258
628 3300005331 Ga0070670_100013048 Ga0070670_1000130484 258
629 3300005331 Ga0070670_100017710 Ga0070670_1000177105 258
630 3300005331 Ga0070670_100041018 Ga0070670_1000410183 258
631 3300005331 Ga0070670_100093329 Ga0070670_1000933292 258
632 3300005333 Ga0070677_10025236 Ga0070677_100252362 258
633 3300005334 Ga0068869_100029810 Ga0068869_1000298102 258
634 3300005335 Ga0070666_10109250 Ga0070666_101092501 258
635 3300005336 Ga0070680_100008891 Ga0070680_1000088912 258
636 3300005336 Ga0070680_100089522 Ga0070680_1000895224 258
637 3300005337 Ga0070682_100010513 Ga0070682_1000105135 258
638 3300005338 Ga0068868_100011665 Ga0068868_1000116655 258
639 3300005338 Ga0068868_100086216 Ga0068868_1000862162 258
640 3300005338 Ga0068868_100180189 Ga0068868_1001801892 258
641 3300005338 Ga0068868_100550762 Ga0068868_1005507621 258
642 3300005339 Ga0070660_100001625 Ga0070660_1000016253 258
643 3300005339 Ga0070660_100020185 Ga0070660_1000201852 258
644 3300005339 Ga0070660_100040098 Ga0070660_1000400982 258
645 3300005339 Ga0070660_100046364 Ga0070660_1000463643 258
646 3300005340 Ga0070689_100002174 Ga0070689_1000021748 258
647 3300005340 Ga0070689_100049384 Ga0070689_1000493843 258
648 3300005341 Ga0070691_10003094 Ga0070691_100030945 258
649 3300005341 Ga0070691_10047334 Ga0070691_100473342 258
650 3300005343 Ga0070687_100006156 Ga0070687_1000061563 258
651 3300005343 Ga0070687_100063831 Ga0070687_1000638311 258
652 3300005344 Ga0070661_100002772 Ga0070661_10000277211 258
653 3300005344 Ga0070661_100003649 Ga0070661_1000036496 258
654 3300005344 Ga0070661_100033514 Ga0070661_1000335146 258
655 3300005344 Ga0070661_100057987 Ga0070661_1000579873 258
656 3300005344 Ga0070661_100059977 Ga0070661_1000599772 258
657 3300005345 Ga0070692_10008674 Ga0070692_100086743 258
658 3300005345 Ga0070692_10051666 Ga0070692_100516661 258
659 3300005347 Ga0070668_100002125 Ga0070668_1000021257 258
660 3300005347 Ga0070668_100047493 Ga0070668_1000474933 258
661 3300005353 Ga0070669_100012580 Ga0070669_1000125804 258
662 3300005353 Ga0070669_100151400 Ga0070669_1001514002 258
663 3300005353 Ga0070669_100267038 Ga0070669_1002670382 258
664 3300005354 Ga0070675_100007594 Ga0070675_1000075944 258
665 3300005355 Ga0070671_100021914 Ga0070671_1000219145 258
666 3300005355 Ga0070671_100153362 Ga0070671_1001533621 258
667 3300005355 Ga0070671_100413862 Ga0070671_1004138621 258
668 3300005355 Ga0070671_100647719 Ga0070671_1006477191 258
669 3300005356 Ga0070674_100021328 Ga0070674_1000213282 258
670 3300005356 Ga0070674_100209971 Ga0070674_1002099712 258
671 3300005364 Ga0070673_100005099 Ga0070673_1000050997 258
672 3300005364 Ga0070673_100231922 Ga0070673_1002319222 258
673 3300005365 Ga0070688_100002832 Ga0070688_1000028326 258
674 3300005365 Ga0070688_100037833 Ga0070688_1000378333 258
675 3300005366 Ga0070659_100003380 Ga0070659_1000033809 258
676 3300005366 Ga0070659_100007453 Ga0070659_1000074534 258
677 3300005366 Ga0070659_100016214 Ga0070659_1000162145 258
678 3300005366 Ga0070659_100215789 Ga0070659_1002157892 258
679 3300005366 Ga0070659_100312134 Ga0070659_1003121341 258
680 3300005367 Ga0070667_100014818 Ga0070667_1000148184 258
681 3300005367 Ga0070667_100026157 Ga0070667_1000261575 258
682 3300005406 Ga0070703_10054540 Ga0070703_100545402 258
683 3300005434 Ga0070709_10016563 Ga0070709_100165631 258
684 3300005434 Ga0070709_10027512 Ga0070709_100275124 258
685 3300005434 Ga0070709_10073009 Ga0070709_100730092 258
686 3300005434 Ga0070709_10106075 Ga0070709_101060752 258
687 3300005434 Ga0070709_10151503 Ga0070709_101515031 258
688 3300005434 Ga0070709_10215047 Ga0070709_102150472 258
689 3300005435 Ga0070714_100004937 Ga0070714_1000049373 258
690 3300005435 Ga0070714_100024261 Ga0070714_1000242613 258
691 3300005435 Ga0070714_100027101 Ga0070714_1000271015 258
692 3300005435 Ga0070714_100032871 Ga0070714_1000328714 258
693 3300005435 Ga0070714_100296655 Ga0070714_1002966552 258
694 3300005436 Ga0070713_100023687 Ga0070713_1000236873 258
695 3300005436 Ga0070713_100456962 Ga0070713_1004569621 258
696 3300005437 Ga0070710_10244384 Ga0070710_102443842 258
697 3300005438 Ga0070701_10003125 Ga0070701_100031258 258
698 3300005438 Ga0070701_10032813 Ga0070701_100328132 258
699 3300005439 Ga0070711_100023693 Ga0070711_1000236932 258
700 3300005440 Ga0070705_100004755 Ga0070705_1000047552 258
701 3300005441 Ga0070700_100026410 Ga0070700_1000264102 258
702 3300005441 Ga0070700_100033480 Ga0070700_1000334803 258
703 3300005444 Ga0070694_100000595 Ga0070694_1000005959 258
704 3300005444 Ga0070694_100027641 Ga0070694_1000276413 258
705 3300005444 Ga0070694_100188789 Ga0070694_1001887891 258
706 3300005445 Ga0070708_100024240 Ga0070708_1000242404 258
707 3300005445 Ga0070708_100166060 Ga0070708_1001660602 258
708 3300005445 Ga0070708_100419318 Ga0070708_1004193181 258
709 3300005455 Ga0070663_100003107 Ga0070663_1000031078 258
710 3300005455 Ga0070663_100015857 Ga0070663_1000158573 258
711 3300005455 Ga0070663_100067574 Ga0070663_1000675742 258
712 3300005455 Ga0070663_100291358 Ga0070663_1002913581 258
713 3300005456 Ga0070678_100004266 Ga0070678_1000042662 258
714 3300005456 Ga0070678_100145602 Ga0070678_1001456023 258
715 3300005457 Ga0070662_100010721 Ga0070662_1000107213 258
716 3300005457 Ga0070662_100050667 Ga0070662_1000506674 258
717 3300005458 Ga0070681_10006372 Ga0070681_100063723 258
718 3300005458 Ga0070681_10009514 Ga0070681_100095148 258
719 3300005458 Ga0070681_10161763 Ga0070681_101617633 258
720 3300005459 Ga0068867_100487316 Ga0068867_1004873161 258
721 3300005466 Ga0070685_10002126 Ga0070685_100021262 258
722 3300005466 Ga0070685_10032285 Ga0070685_100322853 258
723 3300005467 Ga0070706_100015493 Ga0070706_1000154932 258
724 3300005467 Ga0070706_100023458 Ga0070706_1000234582 258
725 3300005468 Ga0070707_100196313 Ga0070707_1001963132 258
726 3300005518 Ga0070699_100026303 Ga0070699_1000263033 258
727 3300005518 Ga0070699_100233375 Ga0070699_1002333752 258
728 3300005530 Ga0070679_100004955 Ga0070679_1000049556 258
729 3300005530 Ga0070679_100030613 Ga0070679_1000306134 258
730 3300005530 Ga0070679_100054395 Ga0070679_1000543953 258
731 3300005530 Ga0070679_100076170 Ga0070679_1000761702 258
732 3300005530 Ga0070679_100084636 Ga0070679_1000846364 258
733 3300005530 Ga0070679_100113090 Ga0070679_1001130903 258
734 3300005530 Ga0070679_100179509 Ga0070679_1001795092 258
735 3300005535 Ga0070684_100008955 Ga0070684_1000089556 258
736 3300005535 Ga0070684_100009493 Ga0070684_1000094931 258
737 3300005535 Ga0070684_100052663 Ga0070684_1000526635 258
738 3300005535 Ga0070684_100078790 Ga0070684_1000787901 258
739 3300005535 Ga0070684_100102699 Ga0070684_1001026991 258
740 3300005535 Ga0070684_100111284 Ga0070684_1001112842 258
741 3300005536 Ga0070697_100033150 Ga0070697_1000331504 258
742 3300005539 Ga0068853_100027279 Ga0068853_1000272794 258
743 3300005539 Ga0068853_100036301 Ga0068853_1000363016 258
744 3300005539 Ga0068853_100044767 Ga0068853_1000447672 258
745 3300005539 Ga0068853_100199563 Ga0068853_1001995632 258
746 3300005543 Ga0070672_100028934 Ga0070672_1000289342 258
747 3300005543 Ga0070672_100068309 Ga0070672_1000683092 258
748 3300005544 Ga0070686_100015699 Ga0070686_1000156992 258
749 3300005544 Ga0070686_100018517 Ga0070686_1000185175 258
750 3300005545 Ga0070695_100004124 Ga0070695_1000041247 258
751 3300005545 Ga0070695_100187680 Ga0070695_1001876801 258
752 3300005546 Ga0070696_100001676 Ga0070696_10000167613 258
753 3300005546 Ga0070696_100029965 Ga0070696_1000299653 258
754 3300005546 Ga0070696_100183404 Ga0070696_1001834042 258
755 3300005547 Ga0070693_100006433 Ga0070693_1000064336 258
756 3300005547 Ga0070693_100025992 Ga0070693_1000259922 258
757 3300005547 Ga0070693_100265224 Ga0070693_1002652242 258
758 3300005548 Ga0070665_100042906 Ga0070665_1000429064 258
759 3300005548 Ga0070665_100261891 Ga0070665_1002618912 258
760 3300005549 Ga0070704_100005192 Ga0070704_1000051928 258
761 3300005563 Ga0068855_100008469 Ga0068855_10000846910 258
762 3300005563 Ga0068855_100018228 Ga0068855_1000182288 258
763 3300005563 Ga0068855_100043137 Ga0068855_1000431373 258
764 3300005563 Ga0068855_100079548 Ga0068855_1000795483 258
765 3300005564 Ga0070664_100001520 Ga0070664_1000015208 258
766 3300005564 Ga0070664_100002944 Ga0070664_10000294413 258
767 3300005564 Ga0070664_100004852 Ga0070664_1000048528 258
768 3300005564 Ga0070664_100009264 Ga0070664_1000092644 258
769 3300005564 Ga0070664_100020665 Ga0070664_1000206654 258
770 3300005564 Ga0070664_100079787 Ga0070664_1000797874 258
771 3300005564 Ga0070664_100336630 Ga0070664_1003366302 258
772 3300005577 Ga0068857_100002553 Ga0068857_1000025534 258
773 3300005577 Ga0068857_100047974 Ga0068857_1000479742 258
774 3300005577 Ga0068857_100057284 Ga0068857_1000572843 258
775 3300005577 Ga0068857_100180610 Ga0068857_1001806102 258
776 3300005578 Ga0068854_100031269 Ga0068854_1000312695 258
777 3300005578 Ga0068854_100067368 Ga0068854_1000673682 258
778 3300005578 Ga0068854_100098350 Ga0068854_1000983502 258
779 3300005578 Ga0068854_100209400 Ga0068854_1002094002 258
780 3300005614 Ga0068856_100003437 Ga0068856_1000034373 258
781 3300005614 Ga0068856_100015279 Ga0068856_1000152798 258
782 3300005614 Ga0068856_100022065 Ga0068856_1000220656 258
783 3300005614 Ga0068856_100023951 Ga0068856_1000239514 258
784 3300005614 Ga0068856_100024651 Ga0068856_1000246515 258
785 3300005616 Ga0068852_100011936 Ga0068852_1000119363 258
786 3300005616 Ga0068852_100014001 Ga0068852_1000140017 258
787 3300005616 Ga0068852_100658501 Ga0068852_1006585011 258
788 3300005617 Ga0068859_100112202 Ga0068859_1001122024 258
789 3300005617 Ga0068859_100219201 Ga0068859_1002192013 258
790 3300005618 Ga0068864_100010491 Ga0068864_1000104915 258
791 3300005618 Ga0068864_100149958 Ga0068864_1001499582 258
792 3300005718 Ga0068866_10006601 Ga0068866_100066012 258
793 3300005719 Ga0068861_100012217 Ga0068861_1000122174 258
794 3300005719 Ga0068861_100124174 Ga0068861_1001241742 258
795 3300005834 Ga0068851_10002997 Ga0068851_100029974 258
796 3300005834 Ga0068851_10007904 Ga0068851_100079042 258
797 3300005834 Ga0068851_10074380 Ga0068851_100743802 258
798 3300005840 Ga0068870_10015301 Ga0068870_100153012 258
799 3300005841 Ga0068863_100128577 Ga0068863_1001285772 258
800 3300005842 Ga0068858_100036953 Ga0068858_1000369536 258
801 3300005842 Ga0068858_100042024 Ga0068858_1000420246 258
802 3300005842 Ga0068858_100206150 Ga0068858_1002061502 258
803 3300005843 Ga0068860_100001112 Ga0068860_1000011122 258
804 3300005843 Ga0068860_100256761 Ga0068860_1002567612 258
805 3300005843 Ga0068860_100978724 Ga0068860_1009787241 258
806 3300005844 Ga0068862_100048918 Ga0068862_1000489185 258
807 3300005844 Ga0068862_100121350 Ga0068862_1001213502 258
808 3300005937 Ga0081455_10056258 Ga0081455_100562582 258
809 3300006028 Ga0070717_10597256 Ga0070717_105972561 258
810 3300006058 Ga0075432_10098210 Ga0075432_100982101 258
811 3300006163 Ga0070715_10000159 Ga0070715_1000015912 258
812 3300006163 Ga0070715_10123102 Ga0070715_101231021 258
813 3300006173 Ga0070716_100010521 Ga0070716_1000105213 258
814 3300006175 Ga0070712_100004130 Ga0070712_1000041306 258
815 3300006175 Ga0070712_100284587 Ga0070712_1002845871 258
816 3300006175 Ga0070712_100606662 Ga0070712_1006066621 258
817 3300006237 Ga0097621_100172487 Ga0097621_1001724873 258
818 3300006237 Ga0097621_100418712 Ga0097621_1004187122 258
819 3300006237 Ga0097621_100545495 Ga0097621_1005454951 258
820 3300006358 Ga0068871_100123662 Ga0068871_1001236622 258
821 3300006844 Ga0075428_100221034 Ga0075428_1002210344 258
822 3300006844 Ga0075428_100221243 Ga0075428_1002212432 258
823 3300006847 Ga0075431_100061633 Ga0075431_1000616335 258
824 3300006847 Ga0075431_100076425 Ga0075431_1000764253 258
825 3300006852 Ga0075433_10000981 Ga0075433_1000098119 258
826 3300006852 Ga0075433_10242784 Ga0075433_102427841 258
827 3300006852 Ga0075433_10245154 Ga0075433_102451542 258
828 3300006871 Ga0075434_100001241 Ga0075434_1000012413 258
829 3300006871 Ga0075434_100487636 Ga0075434_1004876362 258
830 3300006871 Ga0075434_101059223 Ga0075434_1010592231 258
831 3300006881 Ga0068865_100009546 Ga0068865_1000095466 258
832 3300006881 Ga0068865_100054893 Ga0068865_1000548932 258
833 3300006881 Ga0068865_100259793 Ga0068865_1002597933 258
834 3300006914 Ga0075436_100127879 Ga0075436_1001278792 258
835 3300006914 Ga0075436_100188984 Ga0075436_1001889842 258
836 3300006931 Ga0097620_100112201 Ga0097620_1001122011 258
837 3300007265 Ga0099794_10048714 Ga0099794_100487142 258
838 3300007788 Ga0099795_10000525 Ga0099795_100005259 258
839 3300009036 Ga0105244_10014193 Ga0105244_100141932 258
840 3300009036 Ga0105244_10116398 Ga0105244_101163982 258
841 3300009092 Ga0105250_10039487 Ga0105250_100394873 258
842 3300009093 Ga0105240_10010466 Ga0105240_100104663 258
843 3300009093 Ga0105240_10030349 Ga0105240_100303494 258
844 3300009093 Ga0105240_10121886 Ga0105240_101218864 258
845 3300009094 Ga0111539_10059595 Ga0111539_100595953 258
846 3300009094 Ga0111539_10069739 Ga0111539_100697393 258
847 3300009094 Ga0111539_10091969 Ga0111539_100919694 258
848 3300009094 Ga0111539_10153741 Ga0111539_101537413 258
849 3300009098 Ga0105245_10020211 Ga0105245_100202114 258
850 3300009098 Ga0105245_10064876 Ga0105245_100648763 258
851 3300009098 Ga0105245_10317840 Ga0105245_103178402 258
852 3300009101 Ga0105247_10010893 Ga0105247_100108934 258
853 3300009147 Ga0114129_10298861 Ga0114129_102988614 258
854 3300009147 Ga0114129_10480363 Ga0114129_104803631 258
855 3300009147 Ga0114129_11359643 Ga0114129_113596431 258
856 3300009148 Ga0105243_10007058 Ga0105243_100070585 258
857 3300009148 Ga0105243_10063327 Ga0105243_100633272 258
858 3300009174 Ga0105241_10009508 Ga0105241_100095084 258
859 3300009174 Ga0105241_10386389 Ga0105241_103863892 258
860 3300009176 Ga0105242_10003922 Ga0105242_100039227 258
861 3300009176 Ga0105242_10057719 Ga0105242_100577192 258
862 3300009176 Ga0105242_10099932 Ga0105242_100999322 258
863 3300009177 Ga0105248_10005206 Ga0105248_1000520611 258
864 3300009177 Ga0105248_10022900 Ga0105248_100229005 258
865 3300009177 Ga0105248_10045266 Ga0105248_100452661 258
866 3300009177 Ga0105248_10161153 Ga0105248_101611531 258
867 3300009545 Ga0105237_10022783 Ga0105237_100227836 258
868 3300009545 Ga0105237_10082572 Ga0105237_100825725 258
869 3300009545 Ga0105237_10317152 Ga0105237_103171522 258
870 3300009551 Ga0105238_10003490 Ga0105238_100034908 258
871 3300009551 Ga0105238_10010511 Ga0105238_100105112 258
872 3300009551 Ga0105238_10031634 Ga0105238_100316345 258
873 3300009551 Ga0105238_10038745 Ga0105238_100387455 258
874 3300009551 Ga0105238_10046908 Ga0105238_100469082 258
875 3300009551 Ga0105238_10416888 Ga0105238_104168882 258
876 3300009553 Ga0105249_10239556 Ga0105249_102395562 258
877 3300010375 Ga0105239_10115907 Ga0105239_101159074 258
878 3300010375 Ga0105239_10119880 Ga0105239_101198804 258
879 3300010375 Ga0105239_11202922 Ga0105239_112029221 258
880 3300011119 Ga0105246_10018900 Ga0105246_100189003 258
881 3300011119 Ga0105246_10089601 Ga0105246_100896013 258
882 3300013100 Ga0157373_10010428 Ga0157373_100104283 258
883 3300013100 Ga0157373_10010753 Ga0157373_100107533 258
884 3300013100 Ga0157373_10167222 Ga0157373_101672222 258
885 3300013102 Ga0157371_10023743 Ga0157371_100237435 258
886 3300013102 Ga0157371_10033215 Ga0157371_100332154 258
887 3300013102 Ga0157371_10072031 Ga0157371_100720312 258
888 3300013102 Ga0157371_10150202 Ga0157371_101502021 258
889 3300013104 Ga0157370_10002532 Ga0157370_1000253220 258
890 3300013104 Ga0157370_10015571 Ga0157370_100155713 258
891 3300013104 Ga0157370_10018623 Ga0157370_100186233 258
892 3300013104 Ga0157370_10026491 Ga0157370_100264914 258
893 3300013104 Ga0157370_10058461 Ga0157370_100584612 258
894 3300013104 Ga0157370_10168643 Ga0157370_101686432 258
895 3300013105 Ga0157369_10007438 Ga0157369_100074384 258
896 3300013105 Ga0157369_10032889 Ga0157369_100328894 258
897 3300013105 Ga0157369_10143782 Ga0157369_101437821 258
898 3300013105 Ga0157369_10219729 Ga0157369_102197293 258
899 3300013296 Ga0157374_10008130 Ga0157374_100081308 258
900 3300013296 Ga0157374_10008516 Ga0157374_100085163 258
901 3300013296 Ga0157374_10062647 Ga0157374_100626473 258
902 3300013296 Ga0157374_10227085 Ga0157374_102270852 258
903 3300013296 Ga0157374_10363912 Ga0157374_103639121 258
904 3300013297 Ga0157378_10018792 Ga0157378_100187923 258
905 3300013297 Ga0157378_10033486 Ga0157378_100334867 258
906 3300013297 Ga0157378_10070373 Ga0157378_100703734 258
907 3300013306 Ga0163162_10007822 Ga0163162_100078229 258
908 3300013306 Ga0163162_10034723 Ga0163162_100347232 258
909 3300013307 Ga0157372_10003130 Ga0157372_1000313012 258
910 3300013307 Ga0157372_10011420 Ga0157372_100114206 258
911 3300013307 Ga0157372_10012456 Ga0157372_100124563 258
912 3300013307 Ga0157372_10034622 Ga0157372_100346223 258
913 3300013307 Ga0157372_10051086 Ga0157372_100510862 258
914 3300013307 Ga0157372_10103907 Ga0157372_101039072 258
915 3300013307 Ga0157372_10128120 Ga0157372_101281202 258
916 3300013307 Ga0157372_10240052 Ga0157372_102400522 258
917 3300013307 Ga0157372_10312514 Ga0157372_103125141 258
918 3300013307 Ga0157372_10333214 Ga0157372_103332142 258
919 3300013307 Ga0157372_10404621 Ga0157372_104046212 258
920 3300013307 Ga0157372_10545212 Ga0157372_105452122 258
921 3300013308 Ga0157375_10020474 Ga0157375_100204746 258
922 3300014325 Ga0163163_10007632 Ga0163163_100076323 258
923 3300014325 Ga0163163_10054993 Ga0163163_100549932 258
924 3300014325 Ga0163163_10155272 Ga0163163_101552721 258
925 3300014325 Ga0163163_10490960 Ga0163163_104909602 258
926 3300014326 Ga0157380_10037017 Ga0157380_100370171 258
927 3300014745 Ga0157377_10007033 Ga0157377_100070335 258
928 3300014968 Ga0157379_10030891 Ga0157379_100308912 258
929 3300014968 Ga0157379_10061468 Ga0157379_100614682 258
930 3300014969 Ga0157376_10025325 Ga0157376_100253253 258
931 3300014969 Ga0157376_10089349 Ga0157376_100893493 258
932 3300017792 Ga0163161_10031958 Ga0163161_100319585 258
933 3300017792 Ga0163161_10117266 Ga0163161_101172663 258
934 3300017792 Ga0163161_10201015 Ga0163161_102010151 258
935 3300021361 Ga0213872_10000712 Ga0213872_1000071222 258
936 3300025254 Ga0209148_1000386 Ga0209148_100038613 258
937 3300025271 Ga0207666_1005781 Ga0207666_10057812 258
938 3300025295 Ga0209564_1000007 Ga0209564_1000007464 258
939 3300025315 Ga0207697_10001389 Ga0207697_1000138911 258
940 3300025321 Ga0207656_10005345 Ga0207656_100053452 258
941 3300025321 Ga0207656_10008756 Ga0207656_100087563 258
942 3300025321 Ga0207656_10015099 Ga0207656_100150992 258
943 3300025321 Ga0207656_10238124 Ga0207656_102381241 258
944 3300025728 Ga0207655_1016139 Ga0207655_10161394 258
945 3300025893 Ga0207682_10000199 Ga0207682_100001992 258
946 3300025898 Ga0207692_10004390 Ga0207692_100043905 258
947 3300025898 Ga0207692_10333781 Ga0207692_103337811 258
948 3300025900 Ga0207710_10021773 Ga0207710_100217733 258
949 3300025901 Ga0207688_10002110 Ga0207688_100021103 258
950 3300025901 Ga0207688_10012316 Ga0207688_100123166 258
951 3300025903 Ga0207680_10002416 Ga0207680_100024167 258
952 3300025903 Ga0207680_10133850 Ga0207680_101338502 258
953 3300025903 Ga0207680_10150519 Ga0207680_101505192 258
954 3300025904 Ga0207647_10018037 Ga0207647_100180375 258
955 3300025906 Ga0207699_10022753 Ga0207699_100227532 258
956 3300025906 Ga0207699_10053258 Ga0207699_100532581 258
957 3300025906 Ga0207699_10253341 Ga0207699_102533412 258
958 3300025907 Ga0207645_10015977 Ga0207645_100159773 258
959 3300025907 Ga0207645_10039569 Ga0207645_100395692 258
960 3300025907 Ga0207645_10055884 Ga0207645_100558842 258
961 3300025907 Ga0207645_10085880 Ga0207645_100858802 258
962 3300025907 Ga0207645_10243356 Ga0207645_102433561 258
963 3300025908 Ga0207643_10000285 Ga0207643_100002857 258
964 3300025908 Ga0207643_10083901 Ga0207643_100839013 258
965 3300025909 Ga0207705_10030823 Ga0207705_100308235 258
966 3300025909 Ga0207705_10037392 Ga0207705_100373921 258
967 3300025910 Ga0207684_10006392 Ga0207684_1000639210 258
968 3300025910 Ga0207684_10073880 Ga0207684_100738804 258
969 3300025910 Ga0207684_10176364 Ga0207684_101763642 258
970 3300025911 Ga0207654_10097298 Ga0207654_100972983 258
971 3300025912 Ga0207707_10011673 Ga0207707_100116735 258
972 3300025912 Ga0207707_10012952 Ga0207707_100129523 258
973 3300025912 Ga0207707_10025294 Ga0207707_100252942 258
974 3300025912 Ga0207707_10026682 Ga0207707_100266824 258
975 3300025913 Ga0207695_10006493 Ga0207695_1000649314 258
976 3300025913 Ga0207695_10040712 Ga0207695_100407122 258
977 3300025913 Ga0207695_10087600 Ga0207695_100876001 258
978 3300025914 Ga0207671_10195738 Ga0207671_101957382 258
979 3300025914 Ga0207671_10349954 Ga0207671_103499541 258
980 3300025915 Ga0207693_10014239 Ga0207693_100142396 258
981 3300025916 Ga0207663_10015515 Ga0207663_100155153 258
982 3300025917 Ga0207660_10012309 Ga0207660_100123093 258
983 3300025917 Ga0207660_10045893 Ga0207660_100458932 258
984 3300025917 Ga0207660_10074565 Ga0207660_100745654 258
985 3300025917 Ga0207660_10102775 Ga0207660_101027752 258
986 3300025917 Ga0207660_10236524 Ga0207660_102365242 258
987 3300025918 Ga0207662_10000929 Ga0207662_100009299 258
988 3300025918 Ga0207662_10003667 Ga0207662_100036678 258
989 3300025919 Ga0207657_10000882 Ga0207657_100008824 258
990 3300025919 Ga0207657_10002238 Ga0207657_100022385 258
991 3300025919 Ga0207657_10006109 Ga0207657_100061094 258
992 3300025919 Ga0207657_10014997 Ga0207657_100149972 258
993 3300025919 Ga0207657_10051541 Ga0207657_100515413 258
994 3300025920 Ga0207649_10002511 Ga0207649_100025118 258
995 3300025920 Ga0207649_10037866 Ga0207649_100378662 258
996 3300025920 Ga0207649_10063142 Ga0207649_100631422 258
997 3300025920 Ga0207649_10064299 Ga0207649_100642992 258
998 3300025920 Ga0207649_10089484 Ga0207649_100894842 258
999 3300025921 Ga0207652_10006566 Ga0207652_100065666 258
1000 3300025921 Ga0207652_10019084 Ga0207652_100190843 258
1001 3300025921 Ga0207652_10090872 Ga0207652_100908722 258
1002 3300025921 Ga0207652_10111889 Ga0207652_101118893 258
1003 3300025922 Ga0207646_10084014 Ga0207646_100840142 258
1004 3300025923 Ga0207681_10060289 Ga0207681_100602892 258
1005 3300025923 Ga0207681_10256457 Ga0207681_102564572 258
1006 3300025924 Ga0207694_10004100 Ga0207694_100041004 258
1007 3300025924 Ga0207694_10007945 Ga0207694_100079455 258
1008 3300025924 Ga0207694_10044084 Ga0207694_100440842 258
1009 3300025926 Ga0207659_10026579 Ga0207659_100265794 258
1010 3300025926 Ga0207659_10146489 Ga0207659_101464891 258
1011 3300025927 Ga0207687_10015863 Ga0207687_100158636 258
1012 3300025927 Ga0207687_10162814 Ga0207687_101628142 258
1013 3300025928 Ga0207700_10020365 Ga0207700_100203654 258
1014 3300025929 Ga0207664_10001046 Ga0207664_1000104617 258
1015 3300025929 Ga0207664_10012686 Ga0207664_100126862 258
1016 3300025929 Ga0207664_10050774 Ga0207664_100507741 258
1017 3300025929 Ga0207664_10051133 Ga0207664_100511332 258
1018 3300025929 Ga0207664_10059671 Ga0207664_100596714 258
1019 3300025929 Ga0207664_10297437 Ga0207664_102974372 258
1020 3300025931 Ga0207644_10012046 Ga0207644_100120463 258
1021 3300025931 Ga0207644_10018949 Ga0207644_100189495 258
1022 3300025931 Ga0207644_10094661 Ga0207644_100946612 258
1023 3300025931 Ga0207644_10145787 Ga0207644_101457872 258
1024 3300025932 Ga0207690_10005099 Ga0207690_100050993 258
1025 3300025932 Ga0207690_10007295 Ga0207690_100072955 258
1026 3300025932 Ga0207690_10013597 Ga0207690_100135972 258
1027 3300025932 Ga0207690_10027060 Ga0207690_100270602 258
1028 3300025932 Ga0207690_10046682 Ga0207690_100466824 258
1029 3300025933 Ga0207706_10000820 Ga0207706_100008205 258
1030 3300025933 Ga0207706_10006730 Ga0207706_100067308 258
1031 3300025933 Ga0207706_10073712 Ga0207706_100737122 258
1032 3300025933 Ga0207706_10152699 Ga0207706_101526992 258
1033 3300025933 Ga0207706_10343471 Ga0207706_103434712 258
1034 3300025934 Ga0207686_10016093 Ga0207686_100160933 258
1035 3300025935 Ga0207709_10024538 Ga0207709_100245382 258
1036 3300025935 Ga0207709_10223798 Ga0207709_102237983 258
1037 3300025936 Ga0207670_10002275 Ga0207670_100022754 258
1038 3300025937 Ga0207669_10034055 Ga0207669_100340555 258
1039 3300025937 Ga0207669_10362329 Ga0207669_103623292 258
1040 3300025939 Ga0207665_10001863 Ga0207665_100018638 258
1041 3300025940 Ga0207691_10017740 Ga0207691_100177405 258
1042 3300025940 Ga0207691_10035330 Ga0207691_100353302 258
1043 3300025941 Ga0207711_10029383 Ga0207711_100293834 258
1044 3300025941 Ga0207711_10032690 Ga0207711_100326904 258
1045 3300025941 Ga0207711_10075247 Ga0207711_100752472 258
1046 3300025942 Ga0207689_10000559 Ga0207689_1000055931 258
1047 3300025942 Ga0207689_10014667 Ga0207689_100146676 258
1048 3300025942 Ga0207689_10052332 Ga0207689_100523323 258
1049 3300025944 Ga0207661_10028106 Ga0207661_100281064 258
1050 3300025944 Ga0207661_10274424 Ga0207661_102744241 258
1051 3300025945 Ga0207679_10003380 Ga0207679_100033803 258
1052 3300025945 Ga0207679_10003681 Ga0207679_100036814 258
1053 3300025945 Ga0207679_10010584 Ga0207679_100105844 258
1054 3300025945 Ga0207679_10064697 Ga0207679_100646972 258
1055 3300025949 Ga0207667_10001841 Ga0207667_1000184121 258
1056 3300025949 Ga0207667_10091854 Ga0207667_100918542 258
1057 3300025949 Ga0207667_10277015 Ga0207667_102770151 258
1058 3300025949 Ga0207667_10500891 Ga0207667_105008912 258
1059 3300025949 Ga0207667_10763780 Ga0207667_107637802 258
1060 3300025960 Ga0207651_10002984 Ga0207651_100029845 258
1061 3300025960 Ga0207651_10117362 Ga0207651_101173621 258
1062 3300025960 Ga0207651_10157406 Ga0207651_101574062 258
1063 3300025960 Ga0207651_10237925 Ga0207651_102379251 258
1064 3300025961 Ga0207712_10045875 Ga0207712_100458752 258
1065 3300025972 Ga0207668_10018888 Ga0207668_100188884 258
1066 3300025972 Ga0207668_10079489 Ga0207668_100794892 258
1067 3300025972 Ga0207668_10141487 Ga0207668_101414872 258
1068 3300025981 Ga0207640_10038374 Ga0207640_100383741 258
1069 3300025981 Ga0207640_10045477 Ga0207640_100454772 258
1070 3300025986 Ga0207658_10020076 Ga0207658_100200765 258
1071 3300025986 Ga0207658_10025067 Ga0207658_100250674 258
1072 3300025986 Ga0207658_10198488 Ga0207658_101984882 258
1073 3300025986 Ga0207658_10553520 Ga0207658_105535202 258
1074 3300026023 Ga0207677_10090482 Ga0207677_100904822 258
1075 3300026023 Ga0207677_10094049 Ga0207677_100940492 258
1076 3300026023 Ga0207677_10198376 Ga0207677_101983761 258
1077 3300026035 Ga0207703_10097426 Ga0207703_100974262 258
1078 3300026035 Ga0207703_10902203 Ga0207703_109022031 258
1079 3300026035 Ga0207703_10906624 Ga0207703_109066241 258
1080 3300026041 Ga0207639_10012698 Ga0207639_100126986 258
1081 3300026041 Ga0207639_10030893 Ga0207639_100308933 258
1082 3300026041 Ga0207639_10036924 Ga0207639_100369241 258
1083 3300026041 Ga0207639_10048995 Ga0207639_100489952 258
1084 3300026041 Ga0207639_10099833 Ga0207639_100998331 258
1085 3300026041 Ga0207639_10132235 Ga0207639_101322352 258
1086 3300026041 Ga0207639_10351348 Ga0207639_103513481 258
1087 3300026041 Ga0207639_10796769 Ga0207639_107967691 258
1088 3300026067 Ga0207678_10001637 Ga0207678_1000163715 258
1089 3300026067 Ga0207678_10020833 Ga0207678_100208335 258
1090 3300026067 Ga0207678_10038735 Ga0207678_100387353 258
1091 3300026067 Ga0207678_10367688 Ga0207678_103676882 258
1092 3300026067 Ga0207678_10421032 Ga0207678_104210322 258
1093 3300026075 Ga0207708_10003553 Ga0207708_1000355312 258
1094 3300026075 Ga0207708_10009000 Ga0207708_100090005 258
1095 3300026078 Ga0207702_10042978 Ga0207702_100429783 258
1096 3300026078 Ga0207702_10050842 Ga0207702_100508422 258
1097 3300026078 Ga0207702_10066459 Ga0207702_100664594 258
1098 3300026078 Ga0207702_10340732 Ga0207702_103407322 258
1099 3300026078 Ga0207702_10532124 Ga0207702_105321241 258
1100 3300026088 Ga0207641_10266332 Ga0207641_102663322 258
1101 3300026088 Ga0207641_10415295 Ga0207641_104152953 258
1102 3300026088 Ga0207641_10838603 Ga0207641_108386031 258
1103 3300026089 Ga0207648_10001104 Ga0207648_100011043 258
1104 3300026089 Ga0207648_10426945 Ga0207648_104269451 258
1105 3300026095 Ga0207676_10007903 Ga0207676_100079035 258
1106 3300026095 Ga0207676_10096057 Ga0207676_100960571 258
1107 3300026095 Ga0207676_10718003 Ga0207676_107180031 258
1108 3300026116 Ga0207674_10000089 Ga0207674_1000008978 258
1109 3300026116 Ga0207674_10002196 Ga0207674_1000219615 258
1110 3300026116 Ga0207674_10004693 Ga0207674_1000469311 258
1111 3300026116 Ga0207674_10004995 Ga0207674_100049952 258
1112 3300026116 Ga0207674_10010018 Ga0207674_100100183 258
1113 3300026116 Ga0207674_10132705 Ga0207674_101327052 258
1114 3300026116 Ga0207674_10190171 Ga0207674_101901712 258
1115 3300026118 Ga0207675_100000047 Ga0207675_10000004731 258
1116 3300026118 Ga0207675_100000376 Ga0207675_10000037633 258
1117 3300026118 Ga0207675_100547266 Ga0207675_1005472662 258
1118 3300026121 Ga0207683_10000127 Ga0207683_1000012728 258
1119 3300026121 Ga0207683_10016793 Ga0207683_100167934 258
1120 3300026142 Ga0207698_10008357 Ga0207698_100083573 258
1121 3300026142 Ga0207698_10031784 Ga0207698_100317845 258
1122 3300026142 Ga0207698_10042815 Ga0207698_100428152 258
1123 3300026142 Ga0207698_10045785 Ga0207698_100457855 258
1124 3300026142 Ga0207698_10099036 Ga0207698_100990361 258
1125 3300027471 Ga0209995_1012932 Ga0209995_10129322 258
1126 3300027665 Ga0209983_1005434 Ga0209983_10054342 258
1127 3300027682 Ga0209971_1001127 Ga0209971_10011273 258
1128 3300027907 Ga0207428_10070875 Ga0207428_100708753 258
1129 3300027907 Ga0207428_10113181 Ga0207428_101131811 258
1130 3300027907 Ga0207428_10518449 Ga0207428_105184491 258
1131 3300028379 Ga0268266_10038608 Ga0268266_100386084 258
1132 3300028380 Ga0268265_10045406 Ga0268265_100454061 258
1133 3300028380 Ga0268265_10730613 Ga0268265_107306131 258
1134 3300028381 Ga0268264_10042905 Ga0268264_100429056 258
1135 3300028381 Ga0268264_10165288 Ga0268264_101652882 258
1136 3300031239 Ga0265328_10009096 Ga0265328_100090962 258
1137 3300031249 Ga0265339_10016519 Ga0265339_100165194 258
1138 3300031344 Ga0265316_10021653 Ga0265316_100216532 258
1139 3300031824 Ga0307413_10237381 Ga0307413_102373811 258
1140 3300031911 Ga0307412_10026142 Ga0307412_100261424 258
1141 3300035085 Ga0373929_0007593 Ga0373929_0007593_727_1503 258
1142 3300035085 Ga0373929_0040769 Ga0373929_0040769_64_840 258
1143 3300035086 Ga0373934_0000639 Ga0373934_0000639_5686_6468 258
1144 3300035088 Ga0373940_0009937 Ga0373940_0009937_1263_2039 258
1145 3300035092 Ga0373952_0041093 Ga0373952_0041093_176_952 258
1146 3300035111 Ga0373923_0050607 Ga0373923_0050607_119_901 258
1147 3300035112 Ga0373932_0011564 Ga0373932_0011564_567_1343 258
1148 3300035114 Ga0373939_0045629 Ga0373939_0045629_219_995 258
1149 3300035115 Ga0373941_0063328 Ga0373941_0063328_156_932 258
1150 3300035117 Ga0373953_0073359 Ga0373953_0073359_561_1385 258
1151 3300035118 Ga0373954_0025888 Ga0373954_0025888_1748_2530 258
1152 3300035119 Ga0373956_0000135 Ga0373956_0000135_5767_6549 258
1153 3300035120 Ga0373957_0000933 Ga0373957_0000933_5678_6460 258
1154 3300035121 Ga0373960_0014938 Ga0373960_0014938_740_1516 258
1155 3300035121 Ga0373960_0021024 Ga0373960_0021024_853_1629 258
1156 3300035172 Ga0373955_0023281 Ga0373955_0023281_1559_2341 258
1157 3300035242 Ga0373962_0005595 Ga0373962_0005595_163_939 258
1158 3300035691 Ga0373931_0004770 Ga0373931_0004770_672_1448 258
1159 3300035691 Ga0373931_0007171 Ga0373931_0007171_2781_3557 258
1160 3300035691 Ga0373931_0016109 Ga0373931_0016109_1938_2714 258
1161 3300035695 Ga0373927_0218147 Ga0373927_0218147_443_1222 258
1162 3300035695 Ga0373927_0336775 Ga0373927_0336775_61_861 258
1163 3300035724 Ga0373933_0000813 Ga0373933_0000813_3462_4244 258
1164 3300035725 Ga0373947_0112483 Ga0373947_0112483_485_1270 258
1165 3300036401 Ga0373937_0004329 Ga0373937_0004329_5224_6006 258
1166 3300036401 Ga0373937_0023186 Ga0373937_0023186_3460_4236 258
1167 3300036401 Ga0373937_0087549 Ga0373937_0087549_134_1015 258
1168 3300037068 Ga0373925_0087309 Ga0373925_0087309_1429_2205 258
1169 3300037418 Ga0395900_0010652 Ga0395900_0010652_7111_7887 258
1170 3300037471 Ga0395905_0000086 Ga0395905_0000086_6512_7294 258
1171 3300037471 Ga0395905_0004236 Ga0395905_0004236_7950_8726 258
1172 3300038443 Ga0395901_0079508 Ga0395901_0079508_704_1480 258
1173 3300038443 Ga0395901_0415128 Ga0395901_0415128_263_1045 258
1174 3300038996 Ga0242420_009807 Ga0242420_009807_26_805 258
1175 3300039447 Ga0436361_0530365 Ga0436361_0530365_41680_42462 258
1176 3300042876 Ga0451577_0097984 Ga0451577_0097984_1425_2204 258
1177 3300044735 Ga0466968_0074670 Ga0466968_0074670_535_1332 258
1178 3300045051 Ga0451576_0104326 Ga0451576_0104326_875_1675 258
1179 3300046462 Ga0495651_0000274 Ga0495651_0000274_34084_34866 258
1180 3300046472 Ga0495580_0072639 Ga0495580_0072639_1431_2213 258
1181 3300046491 Ga0495584_0073030 Ga0495584_0073030_677_1453 258
1182 3300046491 Ga0495584_0095625 Ga0495584_0095625_263_1045 258
1183 3300046507 Ga0495606_0269849 Ga0495606_0269849_51_833 258
1184 3300046539 Ga0495621_0105795 Ga0495621_0105795_122_898 258
1185 3300046616 Ga0495668_0002784 Ga0495668_0002784_820_1602 258
1186 3300046675 Ga0495657_0022641 Ga0495657_0022641_2814_3596 258
1187 3300047317 Ga0495604_0050123 Ga0495604_0050123_313_1095 258
1188 3300048903 Ga0496100_0022383 Ga0496100_0022383_2463_3239 258
1189 3300048904 Ga0496101_0138658 Ga0496101_0138658_246_1022 258
1190 3300048904 Ga0496101_0449248 Ga0496101_0449248_203_982 258
1191 3300048905 Ga0496102_0012224 Ga0496102_0012224_457_1233 258
1192 3300048905 Ga0496102_0034379 Ga0496102_0034379_1768_2550 258
1193 3300048905 Ga0496102_0411198 Ga0496102_0411198_278_1054 258
1194 3300048906 Ga0496103_0004445 Ga0496103_0004445_2965_3747 258
1195 3300048906 Ga0496103_0024209 Ga0496103_0024209_1527_2303 258
1196 3300048906 Ga0496103_0064765 Ga0496103_0064765_407_1183 258
1197 3300048906 Ga0496103_0072089 Ga0496103_0072089_310_1092 258
1198 3300048907 Ga0496104_0414017 Ga0496104_0414017_77_853 258
1199 3300048908 Ga0496105_0023569 Ga0496105_0023569_2312_3088 258
1200 3300048908 Ga0496105_0220084 Ga0496105_0220084_263_1039 258
1201 3300048908 Ga0496105_0324557 Ga0496105_0324557_393_1169 258
1202 3300048909 Ga0496106_0021775 Ga0496106_0021775_3529_4305 258
1203 3300048909 Ga0496106_0178145 Ga0496106_0178145_749_1525 258
1204 3300048910 Ga0496107_0029338 Ga0496107_0029338_2370_3146 258
1205 3300048910 Ga0496107_0054627 Ga0496107_0054627_2034_2810 258
1206 3300048910 Ga0496107_0376757 Ga0496107_0376757_29_805 258
1207 3300048911 Ga0496108_0069736 Ga0496108_0069736_1765_2541 258
1208 3300048912 Ga0496109_0006173 Ga0496109_0006173_8796_9572 258
1209 3300048912 Ga0496109_0015267 Ga0496109_0015267_3659_4435 258
1210 3300048912 Ga0496109_0136861 Ga0496109_0136861_1296_2072 258
1211 3300048912 Ga0496109_0298500 Ga0496109_0298500_306_1088 258
1212 3300048912 Ga0496109_0453695 Ga0496109_0453695_96_878 258
1213 3300048913 Ga0496110_0024038 Ga0496110_0024038_2034_2810 258
1214 3300048913 Ga0496110_0030989 Ga0496110_0030989_258_1034 258
1215 3300048913 Ga0496110_0037915 Ga0496110_0037915_1015_1797 258
1216 3300048913 Ga0496110_0292335 Ga0496110_0292335_421_1200 258
1217 3300048914 Ga0496111_0017001 Ga0496111_0017001_1373_2149 258
1218 3300048914 Ga0496111_0036092 Ga0496111_0036092_1360_2136 258
1219 3300048915 Ga0496112_0047020 Ga0496112_0047020_551_1333 258
1220 3300048915 Ga0496112_0128607 Ga0496112_0128607_1399_2175 258
1221 3300048915 Ga0496112_0145141 Ga0496112_0145141_1528_2304 258
1222 3300048917 Ga0496114_0018456 Ga0496114_0018456_2359_3135 258
1223 3300048920 Ga0496117_0002582 Ga0496117_0002582_21194_21976 258
1224 3300048921 Ga0496118_0002912 Ga0496118_0002912_10083_10865 258
1225 3300048921 Ga0496118_0138530 Ga0496118_0138530_437_1219 258
1226 3300048924 Ga0496121_0001731 Ga0496121_0001731_34121_34900 258
1227 3300048927 Ga0496124_0051010 Ga0496124_0051010_2039_2818 258
1228 3300048928 Ga0496125_0007726 Ga0496125_0007726_6499_7278 258
1229 3300048928 Ga0496125_0100672 Ga0496125_0100672_317_1096 258
1230 3300049572 Ga0501036_0141693 Ga0501036_0141693_92_874 258
1231 3300049580 Ga0501046_0001880 Ga0501046_0001880_16747_17523 258
1232 3300049581 Ga0501047_0047668 Ga0501047_0047668_481_1257 258
1233 3300049581 Ga0501047_0169371 Ga0501047_0169371_620_1396 258
1234 3300049583 Ga0501067_0010788 Ga0501067_0010788_1924_2700 258
1235 3300049583 Ga0501067_0167473 Ga0501067_0167473_259_1077 258
1236 3300049586 Ga0501070_0274753 Ga0501070_0274753_237_1019 258
1237 3300049742 Ga0501080_0201871 Ga0501080_0201871_505_1284 258
1238 3300049744 Ga0501083_0050819 Ga0501083_0050819_1650_2429 258
1239 3300049823 Ga0501044_0199410 Ga0501044_0199410_712_1488 258
1240 3300049823 Ga0501044_0599599 Ga0501044_0599599_52_828 258
1241 3300050496 nmdc:mga07m45_291084_c1 nmdc:mga07m45_291084_c1_53_835 258
1242 3300050507 nmdc:mga05p37_565804_c1 nmdc:mga05p37_565804_c1_165_941 258
1243 3300050510 nmdc:mga06r32_139724_c1 nmdc:mga06r32_139724_c1_817_1593 258
1244 3300050510 nmdc:mga06r32_73504_c1 nmdc:mga06r32_73504_c1_1447_2223 258
1245 3300050511 nmdc:mga08y16_147138_c1 nmdc:mga08y16_147138_c1_1236_2012 258
1246 3300050511 nmdc:mga08y16_239051_c1 nmdc:mga08y16_239051_c1_378_1154 258
1247 3300050511 nmdc:mga08y16_276208_c1 nmdc:mga08y16_276208_c1_205_981 258
1248 3300050511 nmdc:mga08y16_672347_c1 nmdc:mga08y16_672347_c1_113_889 258
1249 3300050512 nmdc:mga0n895_116657_c1 nmdc:mga0n895_116657_c1_271_1047 258
1250 3300050512 nmdc:mga0n895_39655_c1 nmdc:mga0n895_39655_c1_1042_1818 258
1251 3300050513 nmdc:mga0rr50_307731_c1 nmdc:mga0rr50_307731_c1_515_1291 258
1252 3300050514 nmdc:mga08x19_109026_c1 nmdc:mga08x19_109026_c1_399_1178 258
1253 3300050514 nmdc:mga08x19_60991_c1 nmdc:mga08x19_60991_c1_32_808 258
1254 3300050515 nmdc:mga0a205_2472_c1 nmdc:mga0a205_2472_c1_13765_14541 258
1255 3300050515 nmdc:mga0a205_61465_c1 nmdc:mga0a205_61465_c1_631_1407 258
1256 3300053083 Ga0495655_0000902 Ga0495655_0000902_2104_2880 258
1257 3300053085 Ga0495619_0294433 Ga0495619_0294433_182_964 258
1258 3300053125 Ga0500618_015233 Ga0500618_015233_650_1432 258
1259 3300053148 Ga0500590_011367 Ga0500590_011367_2221_3003 258
1260 3300054114 Ga0501084_0091452 Ga0501084_0091452_139_918 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

234

0.98

PF08659

KR

KR domain

42

217

0.88

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

47

290

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dt1-assembly1.cif.gz_C crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.9739 2 257
4trr-assembly2.cif.gz_G crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 0.9716 5 257
8dt1-assembly1.cif.gz_C crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad 0.9664 2 257
6zzq-assembly1.cif.gz_A crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and acetoacetate 0.9653 3 254
5cej-assembly1.cif.gz_A the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.50a resolution 0.9638 2 253
ID Description Score Start End Superfamily
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9716 5 257 3.40.50.720
4trrG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9631 5 257 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 6 179 3.40.50.720
4trrC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9617 2 257 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9537 6 249 3.40.50.720
ID Description Score Start End GO Terms
AF-T0YFG4-F1-model_v4 D-beta-hydroxybutyrate dehydrogenase 0.9839 5 235 GO:0016491
AF-A0A2H0I9M2-F1-model_v4 3-hydroxybutyrate dehydrogenase (EC 1.1.1.30) 0.9806 5 257 GO:0003858
AF-A0A504F657-F1-model_v4 deleted 0.9794 1 257
AF-T1AIA8-F1-model_v4 3-hydroxybutyrate dehydrogenase 0.9789 2 244 GO:0003858
AF-A0A504F657-F1-model_v4 deleted 0.9756 1 257

Feature Viewer

pLDDT pTM Quality
95.57 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map