F492297
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1260 | 399 | 1251 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0087549|Ga0373937_0087549_134_1015 |
| Length | 293 |
| Sequence | MVRSLLEGVRAGGLYNRGSMIARPRAGDPIQTEADMVLEGRVALVTGAASGIGKSIAQRFARAGARVVIADLAIDGAAAAAREIGGDDRAFAVAMDVTDEAAVNAGVAKAIAAYGGIDVLVSNAGVQIVHPLEEFTYAEWRKMLAIHLDGAFLTTRACLPHMYRAGRGSLIYMGSVHSKLASVLKAPYVTAKHGLIGLAKTMAKEGAPHGVRANVICPGFVRTPLVDKQIPEQSRTLGISEEDVVKKVMLKDTVDGEFTTLEDVAEVALMFAAFPTNALTGQSLVVSHGWFMQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 2 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 3 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 4 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 5 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 6 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 7 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 16 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 18 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 22 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 86 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 88 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 89 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 90 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 91 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 92 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 93 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 94 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 97 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 98 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 99 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 100 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 101 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 102 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 103 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 104 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 108 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 109 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 110 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 116 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 118 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 119 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 120 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 121 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 122 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 126 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 129 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 130 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 162 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 163 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 164 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 166 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 243 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 247 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 248 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 249 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 250 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 251 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 252 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 253 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 254 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 255 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 256 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 257 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 258 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 259 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 261 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 262 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 263 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 265 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 266 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 267 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 268 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 270 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 272 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 273 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 274 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 275 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 276 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 279 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 280 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 281 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 282 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 283 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 284 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 285 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 286 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 287 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 288 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 289 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 290 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 291 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 292 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 293 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 340 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 341 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 342 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 343 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 344 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 345 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 347 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 348 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 349 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 350 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 351 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 352 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 353 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 354 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 355 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 356 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 392 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 394 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 395 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 398 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 399 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.81 |
| Metatranscriptomes | 0.48 |
| Isolates | 0.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.25 |
| Nodule | 0.24 |
| Rhizoplane | 6.19 |
| Rhizosphere | 88.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10029246 | 3300001990 | Bacteria | 1729 |
| 2 | JGI24743J22301_10009131 | 3300001991 | Bacteria | 1752 |
| 3 | JGI24750J21931_1005805 | 3300002070 | Bacteria | 1522 |
| 4 | JGI24750J21931_1008019 | 3300002070 | Bacteria | 1336 |
| 5 | JGI24750J21931_1008042 | 3300002070 | Bacteria | 1335 |
| 6 | JGI24738J21930_10009674 | 3300002075 | Bacteria | 2163 |
| 7 | JGI24749J21850_1009644 | 3300002076 | Bacteria | 1349 |
| 8 | JGI24751J29686_10007247 | 3300002459 | Bacteria | 2265 |
| 9 | JGI25151J46595_10001896 | 3300003187 | Bacteria | 13302 |
| 10 | JGI25151J46595_10008596 | 3300003187 | Bacteria | 4895 |
| 11 | JGI25406J46586_10035972 | 3300003203 | Bacteria | 1802 |
| 12 | Ga0006777J48905_1052058 | 3300003308 | Bacteria | 886 |
| 13 | rootL2_10000128 | 3300003322 | Bacteria | 2760 |
| 14 | rootL2_10096177 | 3300003322 | Bacteria | 2983 |
| 15 | Ga0007417J51691_1018296 | 3300003544 | Bacteria | 894 |
| 16 | Ga0007409J51694_1042546 | 3300003575 | Bacteria | 1050 |
| 17 | Ga0007416J51690_1027846 | 3300003577 | Bacteria | 893 |
| 18 | Ga0007429J51699_1048980 | 3300003579 | Bacteria | 893 |
| 19 | Ga0032354_1014430 | 3300003693 | Bacteria | 915 |
| 20 | Ga0055526_1000050 | 3300003771 | Bacteria | 117283 |
| 21 | Ga0055526_1000439 | 3300003771 | Bacteria | 33186 |
| 22 | Ga0055526_1003172 | 3300003771 | Bacteria | 10647 |
| 23 | Ga0055524_1002528 | 3300003775 | Bacteria | 9365 |
| 24 | JGI25405J52794_10002173 | 3300003911 | Bacteria | 3340 |
| 25 | JGI25405J52794_10026052 | 3300003911 | Bacteria | 1200 |
| 26 | Ga0065165_1000074 | 3300005262 | Bacteria | 164454 |
| 27 | Ga0070658_10004584 | 3300005327 | Bacteria | 11229 |
| 28 | Ga0070658_10018021 | 3300005327 | Bacteria | 5646 |
| 29 | Ga0070658_10097543 | 3300005327 | Bacteria | 2427 |
| 30 | Ga0070658_10244094 | 3300005327 | Bacteria | 1523 |
| 31 | Ga0070676_10010057 | 3300005328 | Bacteria | 5123 |
| 32 | Ga0070683_100023208 | 3300005329 | Bacteria | 5548 |
| 33 | Ga0070683_100023385 | 3300005329 | Bacteria | 5527 |
| 34 | Ga0070683_100083307 | 3300005329 | Bacteria | 2996 |
| 35 | Ga0070683_100098650 | 3300005329 | Bacteria | 2749 |
| 36 | Ga0070683_100332799 | 3300005329 | Bacteria | 1446 |
| 37 | Ga0070690_100000674 | 3300005330 | Bacteria | 17423 |
| 38 | Ga0070670_100000050 | 3300005331 | Bacteria | 132470 |
| 39 | Ga0070670_100004483 | 3300005331 | Bacteria | 11699 |
| 40 | Ga0070670_100008183 | 3300005331 | Bacteria | 8905 |
| 41 | Ga0070670_100013048 | 3300005331 | Bacteria | 7116 |
| 42 | Ga0070670_100017710 | 3300005331 | Bacteria | 6111 |
| 43 | Ga0070670_100041018 | 3300005331 | Bacteria | 3977 |
| 44 | Ga0070670_100052202 | 3300005331 | Bacteria | 3511 |
| 45 | Ga0070670_100067683 | 3300005331 | Bacteria | 3064 |
| 46 | Ga0070670_100093329 | 3300005331 | Bacteria | 2589 |
| 47 | Ga0070670_100134931 | 3300005331 | Bacteria | 2133 |
| 48 | Ga0070670_100274822 | 3300005331 | Bacteria | 1471 |
| 49 | Ga0070677_10025236 | 3300005333 | Bacteria | 2217 |
| 50 | Ga0068869_100029810 | 3300005334 | Bacteria | 3826 |
| 51 | Ga0068869_100136013 | 3300005334 | Bacteria | 1893 |
| 52 | Ga0068869_100165283 | 3300005334 | Bacteria | 1725 |
| 53 | Ga0070666_10006295 | 3300005335 | Bacteria | 7300 |
| 54 | Ga0070666_10039156 | 3300005335 | Bacteria | 3158 |
| 55 | Ga0070666_10068767 | 3300005335 | Bacteria | 2407 |
| 56 | Ga0070666_10109250 | 3300005335 | Bacteria | 1911 |
| 57 | Ga0070680_100001629 | 3300005336 | Bacteria | 16406 |
| 58 | Ga0070680_100008891 | 3300005336 | Bacteria | 7698 |
| 59 | Ga0070680_100060995 | 3300005336 | Bacteria | 3087 |
| 60 | Ga0070680_100089522 | 3300005336 | Bacteria | 2547 |
| 61 | Ga0070680_100192066 | 3300005336 | Bacteria | 1721 |
| 62 | Ga0070682_100010513 | 3300005337 | Bacteria | 5252 |
| 63 | Ga0068868_100011665 | 3300005338 | Bacteria | 6402 |
| 64 | Ga0068868_100019088 | 3300005338 | Bacteria | 5134 |
| 65 | Ga0068868_100060114 | 3300005338 | Bacteria | 3007 |
| 66 | Ga0068868_100086216 | 3300005338 | Bacteria | 2524 |
| 67 | Ga0068868_100180189 | 3300005338 | Bacteria | 1752 |
| 68 | Ga0068868_100212160 | 3300005338 | Bacteria | 1618 |
| 69 | Ga0068868_100550762 | 3300005338 | Bacteria | 1016 |
| 70 | Ga0070660_100001625 | 3300005339 | Bacteria | 15452 |
| 71 | Ga0070660_100020185 | 3300005339 | Bacteria | 4893 |
| 72 | Ga0070660_100040098 | 3300005339 | Bacteria | 3562 |
| 73 | Ga0070660_100046364 | 3300005339 | Bacteria | 3332 |
| 74 | Ga0070689_100002174 | 3300005340 | Bacteria | 12697 |
| 75 | Ga0070689_100010550 | 3300005340 | Bacteria | 6585 |
| 76 | Ga0070689_100020981 | 3300005340 | Bacteria | 4856 |
| 77 | Ga0070689_100049384 | 3300005340 | Bacteria | 3248 |
| 78 | Ga0070691_10003094 | 3300005341 | Bacteria | 7459 |
| 79 | Ga0070691_10047334 | 3300005341 | Bacteria | 2044 |
| 80 | Ga0070691_10133501 | 3300005341 | Bacteria | 1260 |
| 81 | Ga0070687_100006156 | 3300005343 | Bacteria | 4901 |
| 82 | Ga0070687_100063831 | 3300005343 | Bacteria | 1954 |
| 83 | Ga0070661_100002772 | 3300005344 | Bacteria | 12020 |
| 84 | Ga0070661_100003649 | 3300005344 | Bacteria | 10597 |
| 85 | Ga0070661_100007395 | 3300005344 | Bacteria | 7571 |
| 86 | Ga0070661_100033514 | 3300005344 | Bacteria | 3720 |
| 87 | Ga0070661_100057987 | 3300005344 | Bacteria | 2837 |
| 88 | Ga0070661_100059977 | 3300005344 | Bacteria | 2791 |
| 89 | Ga0070661_100203485 | 3300005344 | Bacteria | 1513 |
| 90 | Ga0070661_100224573 | 3300005344 | Bacteria | 1441 |
| 91 | Ga0070692_10008674 | 3300005345 | Bacteria | 4544 |
| 92 | Ga0070692_10010322 | 3300005345 | Bacteria | 4245 |
| 93 | Ga0070692_10051666 | 3300005345 | Bacteria | 2139 |
| 94 | Ga0070668_100000170 | 3300005347 | Bacteria | 41682 |
| 95 | Ga0070668_100002125 | 3300005347 | Bacteria | 14489 |
| 96 | Ga0070668_100002930 | 3300005347 | Bacteria | 12612 |
| 97 | Ga0070668_100047493 | 3300005347 | Bacteria | 3301 |
| 98 | Ga0070668_100322886 | 3300005347 | Bacteria | 1300 |
| 99 | Ga0070669_100000639 | 3300005353 | Bacteria | 25933 |
| 100 | Ga0070669_100012580 | 3300005353 | Bacteria | 6002 |
| 101 | Ga0070669_100044328 | 3300005353 | Bacteria | 3241 |
| 102 | Ga0070669_100151400 | 3300005353 | Bacteria | 1796 |
| 103 | Ga0070669_100267038 | 3300005353 | Bacteria | 1367 |
| 104 | Ga0070675_100003246 | 3300005354 | Bacteria | 12316 |
| 105 | Ga0070675_100007594 | 3300005354 | Bacteria | 8389 |
| 106 | Ga0070671_100005745 | 3300005355 | Bacteria | 9880 |
| 107 | Ga0070671_100021914 | 3300005355 | Bacteria | 5219 |
| 108 | Ga0070671_100099596 | 3300005355 | Bacteria | 2438 |
| 109 | Ga0070671_100153362 | 3300005355 | Bacteria | 1946 |
| 110 | Ga0070671_100413862 | 3300005355 | Bacteria | 1154 |
| 111 | Ga0070671_100647719 | 3300005355 | Bacteria | 915 |
| 112 | Ga0070674_100021328 | 3300005356 | Bacteria | 4155 |
| 113 | Ga0070674_100209971 | 3300005356 | Bacteria | 1508 |
| 114 | Ga0070673_100004666 | 3300005364 | Bacteria | 8699 |
| 115 | Ga0070673_100005099 | 3300005364 | Bacteria | 8383 |
| 116 | Ga0070673_100231922 | 3300005364 | Bacteria | 1601 |
| 117 | Ga0070673_100300015 | 3300005364 | Bacteria | 1414 |
| 118 | Ga0070688_100002832 | 3300005365 | Bacteria | 8832 |
| 119 | Ga0070688_100011717 | 3300005365 | Bacteria | 4886 |
| 120 | Ga0070688_100037833 | 3300005365 | Bacteria | 2943 |
| 121 | Ga0070688_100045737 | 3300005365 | Bacteria | 2706 |
| 122 | Ga0070659_100003380 | 3300005366 | Bacteria | 11361 |
| 123 | Ga0070659_100007453 | 3300005366 | Bacteria | 7952 |
| 124 | Ga0070659_100016214 | 3300005366 | Bacteria | 5592 |
| 125 | Ga0070659_100215789 | 3300005366 | Bacteria | 1582 |
| 126 | Ga0070659_100312134 | 3300005366 | Bacteria | 1313 |
| 127 | Ga0070667_100000140 | 3300005367 | Bacteria | 91817 |
| 128 | Ga0070667_100014818 | 3300005367 | Bacteria | 6440 |
| 129 | Ga0070667_100026157 | 3300005367 | Bacteria | 4853 |
| 130 | Ga0070667_100030395 | 3300005367 | Bacteria | 4505 |
| 131 | Ga0070667_100030963 | 3300005367 | Bacteria | 4462 |
| 132 | Ga0070667_100246802 | 3300005367 | Bacteria | 1595 |
| 133 | Ga0070667_100895894 | 3300005367 | Bacteria | 826 |
| 134 | Ga0070703_10054540 | 3300005406 | Bacteria | 1289 |
| 135 | Ga0070709_10016563 | 3300005434 | Bacteria | 4212 |
| 136 | Ga0070709_10017181 | 3300005434 | Bacteria | 4143 |
| 137 | Ga0070709_10027512 | 3300005434 | Bacteria | 3381 |
| 138 | Ga0070709_10073009 | 3300005434 | Bacteria | 2220 |
| 139 | Ga0070709_10106075 | 3300005434 | Bacteria | 1881 |
| 140 | Ga0070709_10151503 | 3300005434 | Bacteria | 1603 |
| 141 | Ga0070709_10174783 | 3300005434 | Bacteria | 1504 |
| 142 | Ga0070709_10215047 | 3300005434 | Bacteria | 1368 |
| 143 | Ga0070714_100004937 | 3300005435 | Bacteria | 10138 |
| 144 | Ga0070714_100024261 | 3300005435 | Bacteria | 4990 |
| 145 | Ga0070714_100027101 | 3300005435 | Bacteria | 4741 |
| 146 | Ga0070714_100032871 | 3300005435 | Bacteria | 4333 |
| 147 | Ga0070714_100296655 | 3300005435 | Bacteria | 1506 |
| 148 | Ga0070713_100012591 | 3300005436 | Bacteria | 6212 |
| 149 | Ga0070713_100023687 | 3300005436 | Bacteria | 4770 |
| 150 | Ga0070713_100031008 | 3300005436 | Bacteria | 4252 |
| 151 | Ga0070713_100037308 | 3300005436 | Bacteria | 3928 |
| 152 | Ga0070713_100313215 | 3300005436 | Bacteria | 1448 |
| 153 | Ga0070713_100456962 | 3300005436 | Bacteria | 1200 |
| 154 | Ga0070710_10005027 | 3300005437 | Bacteria | 6257 |
| 155 | Ga0070710_10034977 | 3300005437 | Bacteria | 2736 |
| 156 | Ga0070710_10244384 | 3300005437 | Bacteria | 1151 |
| 157 | Ga0070701_10003125 | 3300005438 | Bacteria | 6498 |
| 158 | Ga0070701_10032813 | 3300005438 | Bacteria | 2588 |
| 159 | Ga0070701_10122802 | 3300005438 | Bacteria | 1466 |
| 160 | Ga0070711_100013174 | 3300005439 | Bacteria | 5187 |
| 161 | Ga0070711_100023693 | 3300005439 | Bacteria | 3996 |
| 162 | Ga0070711_100054396 | 3300005439 | Bacteria | 2762 |
| 163 | Ga0070711_100189243 | 3300005439 | Bacteria | 1580 |
| 164 | Ga0070711_100226113 | 3300005439 | Bacteria | 1457 |
| 165 | Ga0070711_100443941 | 3300005439 | Bacteria | 1061 |
| 166 | Ga0070705_100004755 | 3300005440 | Bacteria | 6610 |
| 167 | Ga0070705_100032090 | 3300005440 | Bacteria | 2915 |
| 168 | Ga0070700_100002078 | 3300005441 | Bacteria | 10167 |
| 169 | Ga0070700_100002787 | 3300005441 | Bacteria | 8951 |
| 170 | Ga0070700_100026410 | 3300005441 | Bacteria | 3428 |
| 171 | Ga0070700_100033480 | 3300005441 | Bacteria | 3095 |
| 172 | Ga0070700_100131650 | 3300005441 | Bacteria | 1689 |
| 173 | Ga0070694_100000595 | 3300005444 | Bacteria | 19911 |
| 174 | Ga0070694_100027641 | 3300005444 | Bacteria | 3686 |
| 175 | Ga0070694_100087105 | 3300005444 | Bacteria | 2184 |
| 176 | Ga0070694_100188789 | 3300005444 | Bacteria | 1529 |
| 177 | Ga0070708_100024240 | 3300005445 | Bacteria | 5172 |
| 178 | Ga0070708_100166060 | 3300005445 | Bacteria | 2059 |
| 179 | Ga0070708_100419318 | 3300005445 | Bacteria | 1262 |
| 180 | Ga0070663_100003107 | 3300005455 | Bacteria | 9503 |
| 181 | Ga0070663_100015857 | 3300005455 | Bacteria | 4876 |
| 182 | Ga0070663_100067574 | 3300005455 | Bacteria | 2593 |
| 183 | Ga0070663_100106613 | 3300005455 | Bacteria | 2099 |
| 184 | Ga0070663_100116672 | 3300005455 | Bacteria | 2012 |
| 185 | Ga0070663_100291358 | 3300005455 | Bacteria | 1304 |
| 186 | Ga0070678_100000728 | 3300005456 | Bacteria | 16377 |
| 187 | Ga0070678_100004266 | 3300005456 | Bacteria | 8080 |
| 188 | Ga0070678_100012686 | 3300005456 | Bacteria | 5253 |
| 189 | Ga0070678_100145602 | 3300005456 | Bacteria | 1901 |
| 190 | Ga0070662_100010721 | 3300005457 | Bacteria | 6033 |
| 191 | Ga0070662_100031178 | 3300005457 | Bacteria | 3739 |
| 192 | Ga0070662_100050667 | 3300005457 | Bacteria | 2995 |
| 193 | Ga0070681_10006372 | 3300005458 | Bacteria | 11470 |
| 194 | Ga0070681_10009514 | 3300005458 | Bacteria | 9565 |
| 195 | Ga0070681_10044420 | 3300005458 | Bacteria | 4448 |
| 196 | Ga0070681_10068229 | 3300005458 | Bacteria | 3523 |
| 197 | Ga0070681_10070252 | 3300005458 | Bacteria | 3467 |
| 198 | Ga0070681_10114590 | 3300005458 | Bacteria | 2634 |
| 199 | Ga0070681_10161763 | 3300005458 | Bacteria | 2163 |
| 200 | Ga0070681_10434323 | 3300005458 | Bacteria | 1225 |
| 201 | Ga0068867_100000275 | 3300005459 | Bacteria | 33877 |
| 202 | Ga0068867_100070292 | 3300005459 | Bacteria | 2617 |
| 203 | Ga0068867_100487316 | 3300005459 | Bacteria | 1057 |
| 204 | Ga0068867_100488545 | 3300005459 | Bacteria | 1056 |
| 205 | Ga0070685_10002126 | 3300005466 | Bacteria | 10235 |
| 206 | Ga0070685_10032285 | 3300005466 | Bacteria | 2932 |
| 207 | Ga0070685_10036946 | 3300005466 | Bacteria | 2764 |
| 208 | Ga0070706_100015493 | 3300005467 | Bacteria | 7041 |
| 209 | Ga0070706_100023458 | 3300005467 | Bacteria | 5681 |
| 210 | Ga0070707_100196313 | 3300005468 | Bacteria | 1967 |
| 211 | Ga0070698_100001471 | 3300005471 | Bacteria | 26153 |
| 212 | Ga0070698_100010828 | 3300005471 | Bacteria | 9706 |
| 213 | Ga0070699_100011671 | 3300005518 | Bacteria | 7584 |
| 214 | Ga0070699_100026303 | 3300005518 | Bacteria | 5019 |
| 215 | Ga0070699_100200048 | 3300005518 | Bacteria | 1776 |
| 216 | Ga0070699_100233375 | 3300005518 | Bacteria | 1641 |
| 217 | Ga0070679_100004955 | 3300005530 | Bacteria | 12287 |
| 218 | Ga0070679_100030613 | 3300005530 | Bacteria | 5313 |
| 219 | Ga0070679_100054395 | 3300005530 | Bacteria | 3985 |
| 220 | Ga0070679_100076170 | 3300005530 | Bacteria | 3345 |
| 221 | Ga0070679_100081043 | 3300005530 | Bacteria | 3235 |
| 222 | Ga0070679_100084636 | 3300005530 | Bacteria | 3159 |
| 223 | Ga0070679_100113090 | 3300005530 | Bacteria | 2700 |
| 224 | Ga0070679_100179509 | 3300005530 | Bacteria | 2090 |
| 225 | Ga0070684_100008955 | 3300005535 | Bacteria | 7861 |
| 226 | Ga0070684_100009493 | 3300005535 | Bacteria | 7665 |
| 227 | Ga0070684_100052663 | 3300005535 | Bacteria | 3540 |
| 228 | Ga0070684_100072913 | 3300005535 | Bacteria | 3024 |
| 229 | Ga0070684_100078790 | 3300005535 | Bacteria | 2912 |
| 230 | Ga0070684_100102699 | 3300005535 | Bacteria | 2556 |
| 231 | Ga0070684_100105393 | 3300005535 | Bacteria | 2523 |
| 232 | Ga0070684_100111284 | 3300005535 | Bacteria | 2456 |
| 233 | Ga0070697_100033150 | 3300005536 | Bacteria | 4159 |
| 234 | Ga0068853_100027279 | 3300005539 | Bacteria | 4797 |
| 235 | Ga0068853_100036301 | 3300005539 | Bacteria | 4190 |
| 236 | Ga0068853_100044767 | 3300005539 | Bacteria | 3789 |
| 237 | Ga0068853_100199563 | 3300005539 | Bacteria | 1820 |
| 238 | Ga0068853_100217667 | 3300005539 | Bacteria | 1743 |
| 239 | Ga0070672_100001043 | 3300005543 | Bacteria | 16892 |
| 240 | Ga0070672_100028934 | 3300005543 | Bacteria | 4149 |
| 241 | Ga0070672_100068309 | 3300005543 | Bacteria | 2819 |
| 242 | Ga0070672_100109845 | 3300005543 | Bacteria | 2246 |
| 243 | Ga0070672_100333406 | 3300005543 | Bacteria | 1291 |
| 244 | Ga0070686_100015699 | 3300005544 | Bacteria | 4393 |
| 245 | Ga0070686_100018517 | 3300005544 | Bacteria | 4089 |
| 246 | Ga0070686_100090637 | 3300005544 | Bacteria | 2044 |
| 247 | Ga0070695_100004124 | 3300005545 | Bacteria | 8486 |
| 248 | Ga0070695_100187680 | 3300005545 | Bacteria | 1469 |
| 249 | Ga0070695_100414046 | 3300005545 | Bacteria | 1025 |
| 250 | Ga0070696_100001676 | 3300005546 | Bacteria | 14514 |
| 251 | Ga0070696_100024590 | 3300005546 | Bacteria | 4094 |
| 252 | Ga0070696_100029965 | 3300005546 | Bacteria | 3722 |
| 253 | Ga0070696_100183404 | 3300005546 | Bacteria | 1554 |
| 254 | Ga0070696_100200663 | 3300005546 | Bacteria | 1489 |
| 255 | Ga0070693_100006433 | 3300005547 | Bacteria | 5695 |
| 256 | Ga0070693_100025992 | 3300005547 | Bacteria | 3156 |
| 257 | Ga0070693_100265224 | 3300005547 | Bacteria | 1144 |
| 258 | Ga0070693_100277672 | 3300005547 | Bacteria | 1121 |
| 259 | Ga0070665_100000923 | 3300005548 | Bacteria | 37614 |
| 260 | Ga0070665_100042906 | 3300005548 | Bacteria | 4547 |
| 261 | Ga0070665_100261891 | 3300005548 | Bacteria | 1730 |
| 262 | Ga0070665_100354621 | 3300005548 | Bacteria | 1472 |
| 263 | Ga0070704_100005192 | 3300005549 | Bacteria | 7574 |
| 264 | Ga0070704_100273409 | 3300005549 | Bacteria | 1397 |
| 265 | Ga0068855_100008469 | 3300005563 | Bacteria | 12437 |
| 266 | Ga0068855_100018228 | 3300005563 | Bacteria | 8433 |
| 267 | Ga0068855_100043137 | 3300005563 | Bacteria | 5345 |
| 268 | Ga0068855_100079548 | 3300005563 | Bacteria | 3801 |
| 269 | Ga0068855_100174712 | 3300005563 | Bacteria | 2431 |
| 270 | Ga0070664_100001520 | 3300005564 | Bacteria | 18509 |
| 271 | Ga0070664_100002944 | 3300005564 | Bacteria | 13770 |
| 272 | Ga0070664_100004852 | 3300005564 | Bacteria | 10773 |
| 273 | Ga0070664_100009264 | 3300005564 | Bacteria | 7991 |
| 274 | Ga0070664_100020665 | 3300005564 | Bacteria | 5424 |
| 275 | Ga0070664_100079787 | 3300005564 | Bacteria | 2818 |
| 276 | Ga0070664_100336630 | 3300005564 | Bacteria | 1370 |
| 277 | Ga0070664_100475443 | 3300005564 | Bacteria | 1149 |
| 278 | Ga0068857_100002553 | 3300005577 | Bacteria | 14914 |
| 279 | Ga0068857_100047974 | 3300005577 | Bacteria | 3793 |
| 280 | Ga0068857_100057284 | 3300005577 | Bacteria | 3459 |
| 281 | Ga0068857_100144922 | 3300005577 | Bacteria | 2149 |
| 282 | Ga0068857_100180610 | 3300005577 | Bacteria | 1920 |
| 283 | Ga0068854_100031269 | 3300005578 | Bacteria | 3698 |
| 284 | Ga0068854_100067368 | 3300005578 | Bacteria | 2608 |
| 285 | Ga0068854_100098350 | 3300005578 | Bacteria | 2189 |
| 286 | Ga0068854_100197990 | 3300005578 | Bacteria | 1577 |
| 287 | Ga0068854_100209400 | 3300005578 | Bacteria | 1537 |
| 288 | Ga0068854_100249538 | 3300005578 | Bacteria | 1416 |
| 289 | Ga0068856_100003437 | 3300005614 | Bacteria | 16010 |
| 290 | Ga0068856_100015279 | 3300005614 | Bacteria | 7418 |
| 291 | Ga0068856_100022065 | 3300005614 | Bacteria | 6190 |
| 292 | Ga0068856_100023951 | 3300005614 | Bacteria | 5938 |
| 293 | Ga0068856_100024651 | 3300005614 | Bacteria | 5857 |
| 294 | Ga0068856_100364433 | 3300005614 | Bacteria | 1464 |
| 295 | Ga0068852_100011936 | 3300005616 | Bacteria | 6571 |
| 296 | Ga0068852_100014001 | 3300005616 | Bacteria | 6154 |
| 297 | Ga0068852_100055776 | 3300005616 | Bacteria | 3412 |
| 298 | Ga0068852_100103802 | 3300005616 | Bacteria | 2571 |
| 299 | Ga0068852_100295085 | 3300005616 | Bacteria | 1567 |
| 300 | Ga0068852_100658501 | 3300005616 | Bacteria | 1055 |
| 301 | Ga0068859_100002993 | 3300005617 | Bacteria | 17130 |
| 302 | Ga0068859_100112202 | 3300005617 | Bacteria | 2789 |
| 303 | Ga0068859_100219201 | 3300005617 | Bacteria | 1990 |
| 304 | Ga0068864_100000275 | 3300005618 | Bacteria | 45877 |
| 305 | Ga0068864_100010491 | 3300005618 | Bacteria | 7655 |
| 306 | Ga0068864_100013588 | 3300005618 | Bacteria | 6749 |
| 307 | Ga0068864_100019783 | 3300005618 | Bacteria | 5629 |
| 308 | Ga0068864_100122126 | 3300005618 | Bacteria | 2330 |
| 309 | Ga0068864_100149958 | 3300005618 | Bacteria | 2111 |
| 310 | Ga0068866_10006601 | 3300005718 | Bacteria | 4838 |
| 311 | Ga0068861_100004038 | 3300005719 | Bacteria | 9829 |
| 312 | Ga0068861_100012217 | 3300005719 | Bacteria | 5987 |
| 313 | Ga0068861_100124174 | 3300005719 | Bacteria | 2086 |
| 314 | Ga0068861_100124365 | 3300005719 | Bacteria | 2085 |
| 315 | Ga0068851_10002997 | 3300005834 | Bacteria | 7459 |
| 316 | Ga0068851_10007904 | 3300005834 | Bacteria | 4900 |
| 317 | Ga0068851_10040310 | 3300005834 | Bacteria | 2347 |
| 318 | Ga0068851_10074380 | 3300005834 | Bacteria | 1763 |
| 319 | Ga0068851_10128435 | 3300005834 | Bacteria | 1369 |
| 320 | Ga0068870_10015301 | 3300005840 | Bacteria | 3637 |
| 321 | Ga0068863_100000292 | 3300005841 | Bacteria | 51956 |
| 322 | Ga0068863_100001479 | 3300005841 | Bacteria | 23291 |
| 323 | Ga0068863_100128577 | 3300005841 | Bacteria | 2417 |
| 324 | Ga0068863_100299546 | 3300005841 | Bacteria | 1560 |
| 325 | Ga0068863_100551394 | 3300005841 | Bacteria | 1138 |
| 326 | Ga0068858_100001164 | 3300005842 | Bacteria | 27258 |
| 327 | Ga0068858_100004751 | 3300005842 | Bacteria | 13300 |
| 328 | Ga0068858_100018757 | 3300005842 | Bacteria | 6471 |
| 329 | Ga0068858_100036953 | 3300005842 | Bacteria | 4528 |
| 330 | Ga0068858_100042024 | 3300005842 | Bacteria | 4238 |
| 331 | Ga0068858_100056320 | 3300005842 | Bacteria | 3634 |
| 332 | Ga0068858_100206150 | 3300005842 | Bacteria | 1860 |
| 333 | Ga0068860_100000845 | 3300005843 | Bacteria | 34265 |
| 334 | Ga0068860_100001112 | 3300005843 | Bacteria | 29597 |
| 335 | Ga0068860_100014779 | 3300005843 | Bacteria | 7635 |
| 336 | Ga0068860_100256761 | 3300005843 | Bacteria | 1703 |
| 337 | Ga0068860_100978724 | 3300005843 | Bacteria | 863 |
| 338 | Ga0068862_100001028 | 3300005844 | Bacteria | 26829 |
| 339 | Ga0068862_100007003 | 3300005844 | Bacteria | 9360 |
| 340 | Ga0068862_100048918 | 3300005844 | Bacteria | 3610 |
| 341 | Ga0068862_100121350 | 3300005844 | Bacteria | 2304 |
| 342 | Ga0081455_10001860 | 3300005937 | Bacteria | 25395 |
| 343 | Ga0081455_10009744 | 3300005937 | Bacteria | 9841 |
| 344 | Ga0081455_10031798 | 3300005937 | Bacteria | 4767 |
| 345 | Ga0081455_10056258 | 3300005937 | Bacteria | 3341 |
| 346 | Ga0081538_10035782 | 3300005981 | Bacteria | 3255 |
| 347 | Ga0081538_10098511 | 3300005981 | Bacteria | 1481 |
| 348 | Ga0081540_1009789 | 3300005983 | Bacteria | 6562 |
| 349 | Ga0081539_10009313 | 3300005985 | Bacteria | 8243 |
| 350 | Ga0081539_10070877 | 3300005985 | Bacteria | 1869 |
| 351 | Ga0070717_10000603 | 3300006028 | Bacteria | 23074 |
| 352 | Ga0070717_10060335 | 3300006028 | Bacteria | 3141 |
| 353 | Ga0070717_10067436 | 3300006028 | Bacteria | 2977 |
| 354 | Ga0070717_10597256 | 3300006028 | Bacteria | 1001 |
| 355 | Ga0075365_10086667 | 3300006038 | Bacteria | 2128 |
| 356 | Ga0075365_10243504 | 3300006038 | Bacteria | 1263 |
| 357 | Ga0075363_100005387 | 3300006048 | Bacteria | 5686 |
| 358 | Ga0075364_10088814 | 3300006051 | Bacteria | 2049 |
| 359 | Ga0075364_10174241 | 3300006051 | Bacteria | 1454 |
| 360 | Ga0075364_10232699 | 3300006051 | Bacteria | 1251 |
| 361 | Ga0075432_10019769 | 3300006058 | Bacteria | 2302 |
| 362 | Ga0075432_10098210 | 3300006058 | Bacteria | 1080 |
| 363 | Ga0070715_10000159 | 3300006163 | Bacteria | 15732 |
| 364 | Ga0070715_10123102 | 3300006163 | Bacteria | 1239 |
| 365 | Ga0070716_100010521 | 3300006173 | Bacteria | 4640 |
| 366 | Ga0070716_100078273 | 3300006173 | Bacteria | 1965 |
| 367 | Ga0070716_100186501 | 3300006173 | Bacteria | 1367 |
| 368 | Ga0070712_100004130 | 3300006175 | Bacteria | 8923 |
| 369 | Ga0070712_100020375 | 3300006175 | Bacteria | 4340 |
| 370 | Ga0070712_100035681 | 3300006175 | Bacteria | 3376 |
| 371 | Ga0070712_100269546 | 3300006175 | Bacteria | 1367 |
| 372 | Ga0070712_100284587 | 3300006175 | Bacteria | 1333 |
| 373 | Ga0070712_100320342 | 3300006175 | Bacteria | 1260 |
| 374 | Ga0070712_100606662 | 3300006175 | Bacteria | 927 |
| 375 | Ga0075362_10092615 | 3300006177 | Bacteria | 1404 |
| 376 | Ga0075367_10128398 | 3300006178 | Bacteria | 1566 |
| 377 | Ga0075366_10037733 | 3300006195 | Bacteria | 2853 |
| 378 | Ga0097621_100019564 | 3300006237 | Bacteria | 5199 |
| 379 | Ga0097621_100172487 | 3300006237 | Bacteria | 1865 |
| 380 | Ga0097621_100418712 | 3300006237 | Bacteria | 1202 |
| 381 | Ga0097621_100545495 | 3300006237 | Bacteria | 1055 |
| 382 | Ga0068871_100057919 | 3300006358 | Bacteria | 3154 |
| 383 | Ga0068871_100062414 | 3300006358 | Bacteria | 3045 |
| 384 | Ga0068871_100078716 | 3300006358 | Bacteria | 2726 |
| 385 | Ga0068871_100123662 | 3300006358 | Bacteria | 2188 |
| 386 | Ga0075428_100040725 | 3300006844 | Bacteria | 5110 |
| 387 | Ga0075428_100199872 | 3300006844 | Bacteria | 2161 |
| 388 | Ga0075428_100221034 | 3300006844 | Bacteria | 2045 |
| 389 | Ga0075428_100221243 | 3300006844 | Bacteria | 2044 |
| 390 | Ga0075428_100298902 | 3300006844 | Bacteria | 1731 |
| 391 | Ga0075428_100302655 | 3300006844 | Bacteria | 1719 |
| 392 | Ga0075430_100007044 | 3300006846 | Bacteria | 9480 |
| 393 | Ga0075430_100035206 | 3300006846 | Bacteria | 4248 |
| 394 | Ga0075430_100063617 | 3300006846 | Bacteria | 3099 |
| 395 | Ga0075431_100013070 | 3300006847 | Bacteria | 8384 |
| 396 | Ga0075431_100014686 | 3300006847 | Bacteria | 7926 |
| 397 | Ga0075431_100061633 | 3300006847 | Bacteria | 3870 |
| 398 | Ga0075431_100063587 | 3300006847 | Bacteria | 3808 |
| 399 | Ga0075431_100076425 | 3300006847 | Bacteria | 3456 |
| 400 | Ga0075431_100242051 | 3300006847 | Bacteria | 1835 |
| 401 | Ga0075433_10000981 | 3300006852 | Bacteria | 20288 |
| 402 | Ga0075433_10151262 | 3300006852 | Bacteria | 2065 |
| 403 | Ga0075433_10178897 | 3300006852 | Bacteria | 1887 |
| 404 | Ga0075433_10197585 | 3300006852 | Bacteria | 1789 |
| 405 | Ga0075433_10242784 | 3300006852 | Bacteria | 1599 |
| 406 | Ga0075433_10245154 | 3300006852 | Bacteria | 1590 |
| 407 | Ga0075433_10430911 | 3300006852 | Bacteria | 1163 |
| 408 | Ga0075434_100001241 | 3300006871 | Bacteria | 21209 |
| 409 | Ga0075434_100068221 | 3300006871 | Bacteria | 3542 |
| 410 | Ga0075434_100086729 | 3300006871 | Bacteria | 3130 |
| 411 | Ga0075434_100487636 | 3300006871 | Bacteria | 1253 |
| 412 | Ga0075434_101059223 | 3300006871 | Bacteria | 824 |
| 413 | Ga0075429_100242406 | 3300006880 | Bacteria | 1579 |
| 414 | Ga0068865_100003957 | 3300006881 | Bacteria | 8888 |
| 415 | Ga0068865_100009546 | 3300006881 | Bacteria | 6022 |
| 416 | Ga0068865_100054893 | 3300006881 | Bacteria | 2771 |
| 417 | Ga0068865_100152883 | 3300006881 | Bacteria | 1752 |
| 418 | Ga0068865_100259793 | 3300006881 | Bacteria | 1374 |
| 419 | Ga0075436_100127879 | 3300006914 | Bacteria | 1780 |
| 420 | Ga0075436_100188984 | 3300006914 | Bacteria | 1457 |
| 421 | Ga0097620_100002993 | 3300006931 | Bacteria | 17130 |
| 422 | Ga0097620_100112201 | 3300006931 | Bacteria | 2789 |
| 423 | Ga0075435_100219670 | 3300007076 | Bacteria | 1614 |
| 424 | Ga0099794_10048714 | 3300007265 | Bacteria | 2034 |
| 425 | Ga0099795_10000525 | 3300007788 | Bacteria | 7210 |
| 426 | Ga0099795_10011044 | 3300007788 | Bacteria | 2682 |
| 427 | Ga0105244_10014193 | 3300009036 | Bacteria | 4617 |
| 428 | Ga0105244_10116398 | 3300009036 | Bacteria | 1297 |
| 429 | Ga0105250_10039487 | 3300009092 | Bacteria | 1892 |
| 430 | Ga0105240_10010466 | 3300009093 | Bacteria | 13036 |
| 431 | Ga0105240_10014808 | 3300009093 | Bacteria | 10629 |
| 432 | Ga0105240_10030349 | 3300009093 | Bacteria | 7026 |
| 433 | Ga0105240_10031660 | 3300009093 | Bacteria | 6854 |
| 434 | Ga0105240_10121886 | 3300009093 | Bacteria | 3139 |
| 435 | Ga0105240_10331535 | 3300009093 | Bacteria | 1731 |
| 436 | Ga0111539_10028072 | 3300009094 | Bacteria | 6871 |
| 437 | Ga0111539_10059595 | 3300009094 | Bacteria | 4526 |
| 438 | Ga0111539_10062101 | 3300009094 | Bacteria | 4424 |
| 439 | Ga0111539_10069739 | 3300009094 | Bacteria | 4151 |
| 440 | Ga0111539_10072021 | 3300009094 | Bacteria | 4077 |
| 441 | Ga0111539_10091969 | 3300009094 | Bacteria | 3565 |
| 442 | Ga0111539_10130516 | 3300009094 | Bacteria | 2942 |
| 443 | Ga0111539_10153741 | 3300009094 | Bacteria | 2693 |
| 444 | Ga0111539_10369179 | 3300009094 | Bacteria | 1670 |
| 445 | Ga0105245_10020211 | 3300009098 | Bacteria | 5836 |
| 446 | Ga0105245_10046360 | 3300009098 | Bacteria | 3884 |
| 447 | Ga0105245_10064876 | 3300009098 | Bacteria | 3301 |
| 448 | Ga0105245_10218523 | 3300009098 | Bacteria | 1838 |
| 449 | Ga0105245_10317840 | 3300009098 | Bacteria | 1533 |
| 450 | Ga0105247_10010893 | 3300009101 | Bacteria | 5493 |
| 451 | Ga0105247_10148326 | 3300009101 | Bacteria | 1543 |
| 452 | Ga0105247_10215435 | 3300009101 | Bacteria | 1297 |
| 453 | Ga0114129_10011942 | 3300009147 | Bacteria | 12351 |
| 454 | Ga0114129_10022955 | 3300009147 | Bacteria | 8851 |
| 455 | Ga0114129_10061066 | 3300009147 | Bacteria | 5268 |
| 456 | Ga0114129_10061685 | 3300009147 | Bacteria | 5240 |
| 457 | Ga0114129_10102860 | 3300009147 | Bacteria | 3950 |
| 458 | Ga0114129_10298861 | 3300009147 | Bacteria | 2146 |
| 459 | Ga0114129_10480363 | 3300009147 | Bacteria | 1626 |
| 460 | Ga0114129_11359643 | 3300009147 | Bacteria | 878 |
| 461 | Ga0105243_10002331 | 3300009148 | Bacteria | 15887 |
| 462 | Ga0105243_10007058 | 3300009148 | Bacteria | 8637 |
| 463 | Ga0105243_10026946 | 3300009148 | Bacteria | 4401 |
| 464 | Ga0105243_10063327 | 3300009148 | Bacteria | 2963 |
| 465 | Ga0105241_10009508 | 3300009174 | Bacteria | 7140 |
| 466 | Ga0105241_10386389 | 3300009174 | Bacteria | 1224 |
| 467 | Ga0105242_10003922 | 3300009176 | Bacteria | 11559 |
| 468 | Ga0105242_10057719 | 3300009176 | Bacteria | 3180 |
| 469 | Ga0105242_10099932 | 3300009176 | Bacteria | 2456 |
| 470 | Ga0105242_10447400 | 3300009176 | Bacteria | 1217 |
| 471 | Ga0105248_10005206 | 3300009177 | Bacteria | 14330 |
| 472 | Ga0105248_10017766 | 3300009177 | Bacteria | 7847 |
| 473 | Ga0105248_10022900 | 3300009177 | Bacteria | 6936 |
| 474 | Ga0105248_10045266 | 3300009177 | Bacteria | 4935 |
| 475 | Ga0105248_10069700 | 3300009177 | Bacteria | 3948 |
| 476 | Ga0105248_10115363 | 3300009177 | Bacteria | 3029 |
| 477 | Ga0105248_10141427 | 3300009177 | Bacteria | 2715 |
| 478 | Ga0105248_10161153 | 3300009177 | Bacteria | 2530 |
| 479 | Ga0105248_10421495 | 3300009177 | Bacteria | 1503 |
| 480 | Ga0105248_10510953 | 3300009177 | Bacteria | 1355 |
| 481 | Ga0105248_11364523 | 3300009177 | Bacteria | 802 |
| 482 | Ga0105237_10022783 | 3300009545 | Bacteria | 6426 |
| 483 | Ga0105237_10082572 | 3300009545 | Bacteria | 3204 |
| 484 | Ga0105237_10287832 | 3300009545 | Bacteria | 1646 |
| 485 | Ga0105237_10317152 | 3300009545 | Bacteria | 1562 |
| 486 | Ga0105238_10003490 | 3300009551 | Bacteria | 15647 |
| 487 | Ga0105238_10010511 | 3300009551 | Bacteria | 9291 |
| 488 | Ga0105238_10031634 | 3300009551 | Bacteria | 5387 |
| 489 | Ga0105238_10038745 | 3300009551 | Bacteria | 4839 |
| 490 | Ga0105238_10046908 | 3300009551 | Bacteria | 4357 |
| 491 | Ga0105238_10416888 | 3300009551 | Bacteria | 1337 |
| 492 | Ga0105249_10001113 | 3300009553 | Bacteria | 23889 |
| 493 | Ga0105249_10003043 | 3300009553 | Bacteria | 14468 |
| 494 | Ga0105249_10162864 | 3300009553 | Bacteria | 2157 |
| 495 | Ga0105249_10239556 | 3300009553 | Bacteria | 1793 |
| 496 | Ga0105239_10115907 | 3300010375 | Bacteria | 2972 |
| 497 | Ga0105239_10118340 | 3300010375 | Bacteria | 2940 |
| 498 | Ga0105239_10119880 | 3300010375 | Bacteria | 2920 |
| 499 | Ga0105239_10199484 | 3300010375 | Bacteria | 2241 |
| 500 | Ga0105239_10764368 | 3300010375 | Bacteria | 1106 |
| 501 | Ga0105239_11202922 | 3300010375 | Bacteria | 873 |
| 502 | Ga0105246_10018900 | 3300011119 | Bacteria | 4395 |
| 503 | Ga0105246_10020051 | 3300011119 | Bacteria | 4285 |
| 504 | Ga0105246_10089601 | 3300011119 | Bacteria | 2214 |
| 505 | Ga0157373_10010428 | 3300013100 | Bacteria | 6835 |
| 506 | Ga0157373_10010753 | 3300013100 | Bacteria | 6734 |
| 507 | Ga0157373_10167222 | 3300013100 | Bacteria | 1548 |
| 508 | Ga0157371_10023743 | 3300013102 | Bacteria | 4483 |
| 509 | Ga0157371_10033215 | 3300013102 | Bacteria | 3708 |
| 510 | Ga0157371_10072031 | 3300013102 | Bacteria | 2447 |
| 511 | Ga0157371_10150202 | 3300013102 | Bacteria | 1661 |
| 512 | Ga0157370_10002532 | 3300013104 | Bacteria | 21969 |
| 513 | Ga0157370_10004330 | 3300013104 | Bacteria | 16316 |
| 514 | Ga0157370_10015571 | 3300013104 | Bacteria | 7730 |
| 515 | Ga0157370_10018623 | 3300013104 | Bacteria | 6980 |
| 516 | Ga0157370_10026491 | 3300013104 | Bacteria | 5724 |
| 517 | Ga0157370_10058461 | 3300013104 | Bacteria | 3665 |
| 518 | Ga0157370_10168643 | 3300013104 | Bacteria | 2035 |
| 519 | Ga0157369_10007438 | 3300013105 | Bacteria | 12612 |
| 520 | Ga0157369_10032889 | 3300013105 | Bacteria | 5700 |
| 521 | Ga0157369_10051814 | 3300013105 | Bacteria | 4442 |
| 522 | Ga0157369_10061545 | 3300013105 | Bacteria | 4046 |
| 523 | Ga0157369_10105059 | 3300013105 | Bacteria | 3007 |
| 524 | Ga0157369_10143782 | 3300013105 | Bacteria | 2522 |
| 525 | Ga0157369_10148788 | 3300013105 | Bacteria | 2475 |
| 526 | Ga0157369_10219729 | 3300013105 | Bacteria | 1989 |
| 527 | Ga0157374_10008130 | 3300013296 | Bacteria | 8965 |
| 528 | Ga0157374_10008516 | 3300013296 | Bacteria | 8774 |
| 529 | Ga0157374_10062647 | 3300013296 | Bacteria | 3487 |
| 530 | Ga0157374_10126224 | 3300013296 | Bacteria | 2473 |
| 531 | Ga0157374_10158265 | 3300013296 | Bacteria | 2206 |
| 532 | Ga0157374_10227085 | 3300013296 | Bacteria | 1833 |
| 533 | Ga0157374_10281164 | 3300013296 | Bacteria | 1643 |
| 534 | Ga0157374_10363912 | 3300013296 | Bacteria | 1439 |
| 535 | Ga0157378_10018792 | 3300013297 | Bacteria | 6077 |
| 536 | Ga0157378_10033486 | 3300013297 | Bacteria | 4543 |
| 537 | Ga0157378_10046583 | 3300013297 | Bacteria | 3854 |
| 538 | Ga0157378_10070373 | 3300013297 | Bacteria | 3141 |
| 539 | Ga0157378_10095877 | 3300013297 | Bacteria | 2702 |
| 540 | Ga0157378_10281331 | 3300013297 | Bacteria | 1603 |
| 541 | Ga0163162_10007822 | 3300013306 | Bacteria | 10420 |
| 542 | Ga0163162_10034723 | 3300013306 | Bacteria | 5020 |
| 543 | Ga0163162_10193449 | 3300013306 | Bacteria | 2162 |
| 544 | Ga0163162_10195759 | 3300013306 | Bacteria | 2150 |
| 545 | Ga0163162_10322882 | 3300013306 | Bacteria | 1676 |
| 546 | Ga0163162_10335457 | 3300013306 | Bacteria | 1644 |
| 547 | Ga0163162_10341367 | 3300013306 | Bacteria | 1630 |
| 548 | Ga0163162_10354834 | 3300013306 | Bacteria | 1599 |
| 549 | Ga0163162_10401034 | 3300013306 | Bacteria | 1504 |
| 550 | Ga0157372_10003130 | 3300013307 | Bacteria | 17832 |
| 551 | Ga0157372_10011420 | 3300013307 | Bacteria | 9446 |
| 552 | Ga0157372_10012456 | 3300013307 | Bacteria | 9065 |
| 553 | Ga0157372_10034622 | 3300013307 | Bacteria | 5554 |
| 554 | Ga0157372_10051086 | 3300013307 | Bacteria | 4600 |
| 555 | Ga0157372_10082396 | 3300013307 | Bacteria | 3642 |
| 556 | Ga0157372_10103907 | 3300013307 | Bacteria | 3247 |
| 557 | Ga0157372_10128120 | 3300013307 | Bacteria | 2919 |
| 558 | Ga0157372_10240052 | 3300013307 | Bacteria | 2103 |
| 559 | Ga0157372_10312514 | 3300013307 | Bacteria | 1829 |
| 560 | Ga0157372_10333214 | 3300013307 | Bacteria | 1767 |
| 561 | Ga0157372_10404621 | 3300013307 | Bacteria | 1590 |
| 562 | Ga0157372_10545212 | 3300013307 | Bacteria | 1352 |
| 563 | Ga0157375_10020474 | 3300013308 | Bacteria | 6044 |
| 564 | Ga0157375_10181975 | 3300013308 | Bacteria | 2253 |
| 565 | Ga0157375_10292498 | 3300013308 | Bacteria | 1792 |
| 566 | Ga0157375_10428176 | 3300013308 | Bacteria | 1489 |
| 567 | Ga0163163_10004818 | 3300014325 | Bacteria | 11591 |
| 568 | Ga0163163_10007632 | 3300014325 | Bacteria | 9554 |
| 569 | Ga0163163_10027715 | 3300014325 | Bacteria | 5431 |
| 570 | Ga0163163_10054993 | 3300014325 | Bacteria | 3934 |
| 571 | Ga0163163_10155272 | 3300014325 | Bacteria | 2333 |
| 572 | Ga0163163_10490960 | 3300014325 | Bacteria | 1289 |
| 573 | Ga0157380_10008406 | 3300014326 | Bacteria | 7365 |
| 574 | Ga0157380_10037017 | 3300014326 | Bacteria | 3780 |
| 575 | Ga0157380_10067001 | 3300014326 | Bacteria | 2889 |
| 576 | Ga0157380_10455955 | 3300014326 | Bacteria | 1229 |
| 577 | Ga0157377_10007033 | 3300014745 | Bacteria | 5405 |
| 578 | Ga0157379_10007852 | 3300014968 | Bacteria | 9242 |
| 579 | Ga0157379_10030891 | 3300014968 | Bacteria | 4771 |
| 580 | Ga0157379_10061468 | 3300014968 | Bacteria | 3358 |
| 581 | Ga0157379_10072004 | 3300014968 | Bacteria | 3092 |
| 582 | Ga0157379_10326605 | 3300014968 | Bacteria | 1401 |
| 583 | Ga0157376_10025325 | 3300014969 | Bacteria | 4672 |
| 584 | Ga0157376_10028899 | 3300014969 | Bacteria | 4412 |
| 585 | Ga0157376_10089349 | 3300014969 | Bacteria | 2664 |
| 586 | Ga0157376_10439344 | 3300014969 | Bacteria | 1270 |
| 587 | Ga0163161_10031958 | 3300017792 | Bacteria | 3754 |
| 588 | Ga0163161_10117266 | 3300017792 | Bacteria | 1996 |
| 589 | Ga0163161_10201015 | 3300017792 | Bacteria | 1536 |
| 590 | Ga0163161_10216482 | 3300017792 | Bacteria | 1481 |
| 591 | Ga0213872_10000279 | 3300021361 | Bacteria | 43537 |
| 592 | Ga0213872_10000502 | 3300021361 | Bacteria | 31150 |
| 593 | Ga0213872_10000712 | 3300021361 | Bacteria | 25019 |
| 594 | Ga0213872_10002578 | 3300021361 | Bacteria | 10554 |
| 595 | Ga0213872_10028105 | 3300021361 | Bacteria | 2580 |
| 596 | Ga0213876_10232443 | 3300021384 | Bacteria | 980 |
| 597 | Ga0228598_1037143 | 3300024227 | Bacteria | 961 |
| 598 | Ga0209437_105260 | 3300025233 | Bacteria | 2212 |
| 599 | Ga0209646_1000072 | 3300025246 | Bacteria | 224823 |
| 600 | Ga0209148_1000386 | 3300025254 | Bacteria | 52794 |
| 601 | Ga0209565_1023186 | 3300025263 | Bacteria | 1277 |
| 602 | Ga0207666_1005781 | 3300025271 | Bacteria | 1587 |
| 603 | Ga0209025_1000624 | 3300025294 | Bacteria | 62814 |
| 604 | Ga0209025_1000929 | 3300025294 | Bacteria | 44729 |
| 605 | Ga0209025_1060115 | 3300025294 | Bacteria | 1429 |
| 606 | Ga0209564_1000007 | 3300025295 | Bacteria | 1028582 |
| 607 | Ga0209564_1000072 | 3300025295 | Bacteria | 289331 |
| 608 | Ga0209256_1000176 | 3300025299 | Bacteria | 126545 |
| 609 | Ga0207697_10001389 | 3300025315 | Bacteria | 13262 |
| 610 | Ga0207656_10005345 | 3300025321 | Bacteria | 4533 |
| 611 | Ga0207656_10008756 | 3300025321 | Bacteria | 3740 |
| 612 | Ga0207656_10015099 | 3300025321 | Bacteria | 2985 |
| 613 | Ga0207656_10046627 | 3300025321 | Bacteria | 1860 |
| 614 | Ga0207656_10238124 | 3300025321 | Bacteria | 889 |
| 615 | Ga0207655_1016139 | 3300025728 | Bacteria | 4104 |
| 616 | Ga0207682_10000199 | 3300025893 | Bacteria | 27325 |
| 617 | Ga0207682_10108196 | 3300025893 | Bacteria | 1222 |
| 618 | Ga0207692_10004390 | 3300025898 | Bacteria | 5583 |
| 619 | Ga0207692_10057340 | 3300025898 | Bacteria | 2002 |
| 620 | Ga0207692_10333781 | 3300025898 | Bacteria | 931 |
| 621 | Ga0207642_10092999 | 3300025899 | Bacteria | 1494 |
| 622 | Ga0207642_10152269 | 3300025899 | Bacteria | 1232 |
| 623 | Ga0207710_10005521 | 3300025900 | Bacteria | 5441 |
| 624 | Ga0207710_10021773 | 3300025900 | Bacteria | 2750 |
| 625 | Ga0207688_10002037 | 3300025901 | Bacteria | 10853 |
| 626 | Ga0207688_10002110 | 3300025901 | Bacteria | 10695 |
| 627 | Ga0207688_10012316 | 3300025901 | Bacteria | 4655 |
| 628 | Ga0207680_10002416 | 3300025903 | Bacteria | 8708 |
| 629 | Ga0207680_10022090 | 3300025903 | Bacteria | 3455 |
| 630 | Ga0207680_10026989 | 3300025903 | Bacteria | 3190 |
| 631 | Ga0207680_10047487 | 3300025903 | Bacteria | 2544 |
| 632 | Ga0207680_10133850 | 3300025903 | Bacteria | 1636 |
| 633 | Ga0207680_10150519 | 3300025903 | Bacteria | 1551 |
| 634 | Ga0207647_10018037 | 3300025904 | Bacteria | 4785 |
| 635 | Ga0207647_10136734 | 3300025904 | Bacteria | 1438 |
| 636 | Ga0207685_10003238 | 3300025905 | Bacteria | 3922 |
| 637 | Ga0207685_10081428 | 3300025905 | Bacteria | 1340 |
| 638 | Ga0207699_10022753 | 3300025906 | Bacteria | 3401 |
| 639 | Ga0207699_10024177 | 3300025906 | Bacteria | 3318 |
| 640 | Ga0207699_10053258 | 3300025906 | Bacteria | 2398 |
| 641 | Ga0207699_10085922 | 3300025906 | Bacteria | 1963 |
| 642 | Ga0207699_10095416 | 3300025906 | Bacteria | 1875 |
| 643 | Ga0207699_10253341 | 3300025906 | Bacteria | 1214 |
| 644 | Ga0207645_10015977 | 3300025907 | Bacteria | 4973 |
| 645 | Ga0207645_10023307 | 3300025907 | Bacteria | 4024 |
| 646 | Ga0207645_10026627 | 3300025907 | Bacteria | 3736 |
| 647 | Ga0207645_10039569 | 3300025907 | Bacteria | 3021 |
| 648 | Ga0207645_10055884 | 3300025907 | Bacteria | 2520 |
| 649 | Ga0207645_10085880 | 3300025907 | Bacteria | 2021 |
| 650 | Ga0207645_10243356 | 3300025907 | Bacteria | 1189 |
| 651 | Ga0207645_10301151 | 3300025907 | Bacteria | 1067 |
| 652 | Ga0207643_10000285 | 3300025908 | Bacteria | 35142 |
| 653 | Ga0207643_10000872 | 3300025908 | Bacteria | 18178 |
| 654 | Ga0207643_10013410 | 3300025908 | Bacteria | 4438 |
| 655 | Ga0207643_10083901 | 3300025908 | Bacteria | 1849 |
| 656 | Ga0207705_10030823 | 3300025909 | Bacteria | 3827 |
| 657 | Ga0207705_10037392 | 3300025909 | Bacteria | 3474 |
| 658 | Ga0207684_10006392 | 3300025910 | Bacteria | 10740 |
| 659 | Ga0207684_10059972 | 3300025910 | Bacteria | 3231 |
| 660 | Ga0207684_10073880 | 3300025910 | Bacteria | 2896 |
| 661 | Ga0207684_10176364 | 3300025910 | Bacteria | 1842 |
| 662 | Ga0207654_10097298 | 3300025911 | Bacteria | 1807 |
| 663 | Ga0207707_10000993 | 3300025912 | Bacteria | 27228 |
| 664 | Ga0207707_10007140 | 3300025912 | Bacteria | 9727 |
| 665 | Ga0207707_10011673 | 3300025912 | Bacteria | 7647 |
| 666 | Ga0207707_10012952 | 3300025912 | Bacteria | 7259 |
| 667 | Ga0207707_10025294 | 3300025912 | Bacteria | 5194 |
| 668 | Ga0207707_10026682 | 3300025912 | Bacteria | 5049 |
| 669 | Ga0207707_10040679 | 3300025912 | Bacteria | 4060 |
| 670 | Ga0207707_10162531 | 3300025912 | Bacteria | 1952 |
| 671 | Ga0207695_10006493 | 3300025913 | Bacteria | 15155 |
| 672 | Ga0207695_10040712 | 3300025913 | Bacteria | 4979 |
| 673 | Ga0207695_10087600 | 3300025913 | Bacteria | 3136 |
| 674 | Ga0207695_10213503 | 3300025913 | Bacteria | 1839 |
| 675 | Ga0207695_10423272 | 3300025913 | Bacteria | 1216 |
| 676 | Ga0207671_10195738 | 3300025914 | Bacteria | 1577 |
| 677 | Ga0207671_10237712 | 3300025914 | Bacteria | 1430 |
| 678 | Ga0207671_10349954 | 3300025914 | Bacteria | 1172 |
| 679 | Ga0207693_10003527 | 3300025915 | Bacteria | 13355 |
| 680 | Ga0207693_10014239 | 3300025915 | Bacteria | 6398 |
| 681 | Ga0207693_10024667 | 3300025915 | Bacteria | 4769 |
| 682 | Ga0207693_10292137 | 3300025915 | Bacteria | 1277 |
| 683 | Ga0207693_10370698 | 3300025915 | Bacteria | 1120 |
| 684 | Ga0207663_10015515 | 3300025916 | Bacteria | 4204 |
| 685 | Ga0207663_10034041 | 3300025916 | Bacteria | 3042 |
| 686 | Ga0207663_10170581 | 3300025916 | Bacteria | 1545 |
| 687 | Ga0207660_10012309 | 3300025917 | Bacteria | 5594 |
| 688 | Ga0207660_10045654 | 3300025917 | Bacteria | 3087 |
| 689 | Ga0207660_10045893 | 3300025917 | Bacteria | 3081 |
| 690 | Ga0207660_10074565 | 3300025917 | Bacteria | 2477 |
| 691 | Ga0207660_10102775 | 3300025917 | Bacteria | 2137 |
| 692 | Ga0207660_10166533 | 3300025917 | Bacteria | 1704 |
| 693 | Ga0207660_10236524 | 3300025917 | Bacteria | 1438 |
| 694 | Ga0207662_10000929 | 3300025918 | Bacteria | 13584 |
| 695 | Ga0207662_10003667 | 3300025918 | Bacteria | 7955 |
| 696 | Ga0207662_10096112 | 3300025918 | Bacteria | 1830 |
| 697 | Ga0207657_10000882 | 3300025919 | Bacteria | 31708 |
| 698 | Ga0207657_10002238 | 3300025919 | Bacteria | 20984 |
| 699 | Ga0207657_10006109 | 3300025919 | Bacteria | 12522 |
| 700 | Ga0207657_10014997 | 3300025919 | Bacteria | 7527 |
| 701 | Ga0207657_10030389 | 3300025919 | Bacteria | 4904 |
| 702 | Ga0207657_10051541 | 3300025919 | Bacteria | 3577 |
| 703 | Ga0207649_10002511 | 3300025920 | Bacteria | 10231 |
| 704 | Ga0207649_10006622 | 3300025920 | Bacteria | 6295 |
| 705 | Ga0207649_10037866 | 3300025920 | Bacteria | 2916 |
| 706 | Ga0207649_10063142 | 3300025920 | Bacteria | 2337 |
| 707 | Ga0207649_10064299 | 3300025920 | Bacteria | 2319 |
| 708 | Ga0207649_10089484 | 3300025920 | Bacteria | 2012 |
| 709 | Ga0207649_10309828 | 3300025920 | Bacteria | 1157 |
| 710 | Ga0207652_10006566 | 3300025921 | Bacteria | 9374 |
| 711 | Ga0207652_10010460 | 3300025921 | Bacteria | 7468 |
| 712 | Ga0207652_10019084 | 3300025921 | Bacteria | 5633 |
| 713 | Ga0207652_10061698 | 3300025921 | Bacteria | 3238 |
| 714 | Ga0207652_10079971 | 3300025921 | Bacteria | 2857 |
| 715 | Ga0207652_10090872 | 3300025921 | Bacteria | 2684 |
| 716 | Ga0207652_10111889 | 3300025921 | Bacteria | 2422 |
| 717 | Ga0207646_10084014 | 3300025922 | Bacteria | 2848 |
| 718 | Ga0207681_10001443 | 3300025923 | Bacteria | 15297 |
| 719 | Ga0207681_10060289 | 3300025923 | Bacteria | 2604 |
| 720 | Ga0207681_10256457 | 3300025923 | Bacteria | 1367 |
| 721 | Ga0207694_10004100 | 3300025924 | Bacteria | 11458 |
| 722 | Ga0207694_10007945 | 3300025924 | Bacteria | 8024 |
| 723 | Ga0207694_10044084 | 3300025924 | Bacteria | 3444 |
| 724 | Ga0207650_10000133 | 3300025925 | Bacteria | 90953 |
| 725 | Ga0207650_10002222 | 3300025925 | Bacteria | 13558 |
| 726 | Ga0207650_10006091 | 3300025925 | Bacteria | 8225 |
| 727 | Ga0207650_10108529 | 3300025925 | Bacteria | 2145 |
| 728 | Ga0207659_10001360 | 3300025926 | Bacteria | 14606 |
| 729 | Ga0207659_10026579 | 3300025926 | Bacteria | 3906 |
| 730 | Ga0207659_10146489 | 3300025926 | Bacteria | 1839 |
| 731 | Ga0207659_10190888 | 3300025926 | Bacteria | 1630 |
| 732 | Ga0207687_10015863 | 3300025927 | Bacteria | 4944 |
| 733 | Ga0207687_10162814 | 3300025927 | Bacteria | 1714 |
| 734 | Ga0207687_10248115 | 3300025927 | Bacteria | 1414 |
| 735 | Ga0207700_10020365 | 3300025928 | Bacteria | 4504 |
| 736 | Ga0207700_10050938 | 3300025928 | Bacteria | 3087 |
| 737 | Ga0207700_10082293 | 3300025928 | Bacteria | 2517 |
| 738 | Ga0207700_10112191 | 3300025928 | Bacteria | 2196 |
| 739 | Ga0207700_10482378 | 3300025928 | Bacteria | 1096 |
| 740 | Ga0207664_10001046 | 3300025929 | Bacteria | 18542 |
| 741 | Ga0207664_10012686 | 3300025929 | Bacteria | 6031 |
| 742 | Ga0207664_10050774 | 3300025929 | Bacteria | 3271 |
| 743 | Ga0207664_10051133 | 3300025929 | Bacteria | 3261 |
| 744 | Ga0207664_10059671 | 3300025929 | Bacteria | 3039 |
| 745 | Ga0207664_10297437 | 3300025929 | Bacteria | 1419 |
| 746 | Ga0207644_10003477 | 3300025931 | Bacteria | 10184 |
| 747 | Ga0207644_10012046 | 3300025931 | Bacteria | 5734 |
| 748 | Ga0207644_10018949 | 3300025931 | Bacteria | 4666 |
| 749 | Ga0207644_10094661 | 3300025931 | Bacteria | 2232 |
| 750 | Ga0207644_10111199 | 3300025931 | Bacteria | 2072 |
| 751 | Ga0207644_10145787 | 3300025931 | Bacteria | 1827 |
| 752 | Ga0207644_10515210 | 3300025931 | Bacteria | 988 |
| 753 | Ga0207690_10005099 | 3300025932 | Bacteria | 7756 |
| 754 | Ga0207690_10007295 | 3300025932 | Bacteria | 6565 |
| 755 | Ga0207690_10013597 | 3300025932 | Bacteria | 4894 |
| 756 | Ga0207690_10027060 | 3300025932 | Bacteria | 3621 |
| 757 | Ga0207690_10046682 | 3300025932 | Bacteria | 2870 |
| 758 | Ga0207690_10207707 | 3300025932 | Bacteria | 1491 |
| 759 | Ga0207706_10000820 | 3300025933 | Bacteria | 32304 |
| 760 | Ga0207706_10006344 | 3300025933 | Bacteria | 10985 |
| 761 | Ga0207706_10006730 | 3300025933 | Bacteria | 10626 |
| 762 | Ga0207706_10073712 | 3300025933 | Bacteria | 3002 |
| 763 | Ga0207706_10152699 | 3300025933 | Bacteria | 2031 |
| 764 | Ga0207706_10343471 | 3300025933 | Bacteria | 1298 |
| 765 | Ga0207686_10016093 | 3300025934 | Bacteria | 4192 |
| 766 | Ga0207709_10003308 | 3300025935 | Bacteria | 9661 |
| 767 | Ga0207709_10024538 | 3300025935 | Bacteria | 3444 |
| 768 | Ga0207709_10223798 | 3300025935 | Bacteria | 1359 |
| 769 | Ga0207670_10002275 | 3300025936 | Bacteria | 10057 |
| 770 | Ga0207670_10006012 | 3300025936 | Bacteria | 6707 |
| 771 | Ga0207669_10003358 | 3300025937 | Bacteria | 6926 |
| 772 | Ga0207669_10034055 | 3300025937 | Bacteria | 2882 |
| 773 | Ga0207669_10049274 | 3300025937 | Bacteria | 2509 |
| 774 | Ga0207669_10362329 | 3300025937 | Bacteria | 1124 |
| 775 | Ga0207665_10001863 | 3300025939 | Bacteria | 14223 |
| 776 | Ga0207665_10006295 | 3300025939 | Bacteria | 7873 |
| 777 | Ga0207691_10017740 | 3300025940 | Bacteria | 6748 |
| 778 | Ga0207691_10025399 | 3300025940 | Bacteria | 5563 |
| 779 | Ga0207691_10035330 | 3300025940 | Bacteria | 4640 |
| 780 | Ga0207691_10045423 | 3300025940 | Bacteria | 4038 |
| 781 | Ga0207691_10049616 | 3300025940 | Bacteria | 3846 |
| 782 | Ga0207711_10012247 | 3300025941 | Bacteria | 7131 |
| 783 | Ga0207711_10029383 | 3300025941 | Bacteria | 4636 |
| 784 | Ga0207711_10032690 | 3300025941 | Bacteria | 4399 |
| 785 | Ga0207711_10075247 | 3300025941 | Bacteria | 2938 |
| 786 | Ga0207711_10122103 | 3300025941 | Bacteria | 2327 |
| 787 | Ga0207711_10340269 | 3300025941 | Bacteria | 1388 |
| 788 | Ga0207711_10400896 | 3300025941 | Bacteria | 1275 |
| 789 | Ga0207711_10411695 | 3300025941 | Bacteria | 1257 |
| 790 | Ga0207711_10502108 | 3300025941 | Bacteria | 1131 |
| 791 | Ga0207689_10000559 | 3300025942 | Bacteria | 35553 |
| 792 | Ga0207689_10014667 | 3300025942 | Bacteria | 6655 |
| 793 | Ga0207689_10044726 | 3300025942 | Bacteria | 3661 |
| 794 | Ga0207689_10052332 | 3300025942 | Bacteria | 3365 |
| 795 | Ga0207661_10028106 | 3300025944 | Bacteria | 4304 |
| 796 | Ga0207661_10030482 | 3300025944 | Bacteria | 4155 |
| 797 | Ga0207661_10034410 | 3300025944 | Bacteria | 3940 |
| 798 | Ga0207661_10274424 | 3300025944 | Bacteria | 1505 |
| 799 | Ga0207679_10003380 | 3300025945 | Bacteria | 9850 |
| 800 | Ga0207679_10003681 | 3300025945 | Bacteria | 9500 |
| 801 | Ga0207679_10010584 | 3300025945 | Bacteria | 5943 |
| 802 | Ga0207679_10033072 | 3300025945 | Bacteria | 3637 |
| 803 | Ga0207679_10064697 | 3300025945 | Bacteria | 2734 |
| 804 | Ga0207667_10001841 | 3300025949 | Bacteria | 26629 |
| 805 | Ga0207667_10063675 | 3300025949 | Bacteria | 3853 |
| 806 | Ga0207667_10091854 | 3300025949 | Bacteria | 3136 |
| 807 | Ga0207667_10277015 | 3300025949 | Bacteria | 1714 |
| 808 | Ga0207667_10500891 | 3300025949 | Bacteria | 1232 |
| 809 | Ga0207667_10557931 | 3300025949 | Bacteria | 1158 |
| 810 | Ga0207667_10763780 | 3300025949 | Bacteria | 965 |
| 811 | Ga0207651_10002984 | 3300025960 | Bacteria | 8189 |
| 812 | Ga0207651_10117362 | 3300025960 | Bacteria | 2010 |
| 813 | Ga0207651_10157406 | 3300025960 | Bacteria | 1777 |
| 814 | Ga0207651_10237925 | 3300025960 | Bacteria | 1482 |
| 815 | Ga0207651_10497188 | 3300025960 | Bacteria | 1054 |
| 816 | Ga0207651_10731312 | 3300025960 | Bacteria | 874 |
| 817 | Ga0207712_10000689 | 3300025961 | Bacteria | 26097 |
| 818 | Ga0207712_10045875 | 3300025961 | Bacteria | 3028 |
| 819 | Ga0207712_10132703 | 3300025961 | Bacteria | 1900 |
| 820 | Ga0207712_10271093 | 3300025961 | Bacteria | 1381 |
| 821 | Ga0207668_10000275 | 3300025972 | Bacteria | 34283 |
| 822 | Ga0207668_10002130 | 3300025972 | Bacteria | 11550 |
| 823 | Ga0207668_10018888 | 3300025972 | Bacteria | 4345 |
| 824 | Ga0207668_10079489 | 3300025972 | Bacteria | 2372 |
| 825 | Ga0207668_10141487 | 3300025972 | Bacteria | 1851 |
| 826 | Ga0207668_10190862 | 3300025972 | Bacteria | 1623 |
| 827 | Ga0207668_10271282 | 3300025972 | Bacteria | 1387 |
| 828 | Ga0207668_10370634 | 3300025972 | Bacteria | 1202 |
| 829 | Ga0207640_10038374 | 3300025981 | Bacteria | 3022 |
| 830 | Ga0207640_10045477 | 3300025981 | Bacteria | 2819 |
| 831 | Ga0207640_10049413 | 3300025981 | Bacteria | 2723 |
| 832 | Ga0207640_10063362 | 3300025981 | Bacteria | 2456 |
| 833 | Ga0207640_10483660 | 3300025981 | Bacteria | 1027 |
| 834 | Ga0207658_10001145 | 3300025986 | Bacteria | 21251 |
| 835 | Ga0207658_10020076 | 3300025986 | Bacteria | 4626 |
| 836 | Ga0207658_10025067 | 3300025986 | Bacteria | 4174 |
| 837 | Ga0207658_10025918 | 3300025986 | Bacteria | 4107 |
| 838 | Ga0207658_10198488 | 3300025986 | Bacteria | 1673 |
| 839 | Ga0207658_10553520 | 3300025986 | Bacteria | 1029 |
| 840 | Ga0207677_10087500 | 3300026023 | Bacteria | 2256 |
| 841 | Ga0207677_10090482 | 3300026023 | Bacteria | 2224 |
| 842 | Ga0207677_10094049 | 3300026023 | Bacteria | 2187 |
| 843 | Ga0207677_10164628 | 3300026023 | Bacteria | 1727 |
| 844 | Ga0207677_10198376 | 3300026023 | Bacteria | 1593 |
| 845 | Ga0207703_10002292 | 3300026035 | Bacteria | 16690 |
| 846 | Ga0207703_10026290 | 3300026035 | Bacteria | 4580 |
| 847 | Ga0207703_10097426 | 3300026035 | Bacteria | 2485 |
| 848 | Ga0207703_10902203 | 3300026035 | Bacteria | 846 |
| 849 | Ga0207703_10906624 | 3300026035 | Bacteria | 844 |
| 850 | Ga0207639_10012698 | 3300026041 | Bacteria | 5874 |
| 851 | Ga0207639_10030893 | 3300026041 | Bacteria | 3933 |
| 852 | Ga0207639_10036924 | 3300026041 | Bacteria | 3625 |
| 853 | Ga0207639_10048995 | 3300026041 | Bacteria | 3201 |
| 854 | Ga0207639_10099833 | 3300026041 | Bacteria | 2343 |
| 855 | Ga0207639_10132235 | 3300026041 | Bacteria | 2067 |
| 856 | Ga0207639_10351348 | 3300026041 | Bacteria | 1317 |
| 857 | Ga0207639_10796769 | 3300026041 | Bacteria | 880 |
| 858 | Ga0207678_10001637 | 3300026067 | Bacteria | 20525 |
| 859 | Ga0207678_10005238 | 3300026067 | Bacteria | 11614 |
| 860 | Ga0207678_10020833 | 3300026067 | Bacteria | 5746 |
| 861 | Ga0207678_10038735 | 3300026067 | Bacteria | 4140 |
| 862 | Ga0207678_10073617 | 3300026067 | Bacteria | 2928 |
| 863 | Ga0207678_10367688 | 3300026067 | Bacteria | 1242 |
| 864 | Ga0207678_10421032 | 3300026067 | Bacteria | 1158 |
| 865 | Ga0207678_10609596 | 3300026067 | Bacteria | 957 |
| 866 | Ga0207708_10000560 | 3300026075 | Bacteria | 28691 |
| 867 | Ga0207708_10003553 | 3300026075 | Bacteria | 11489 |
| 868 | Ga0207708_10009000 | 3300026075 | Bacteria | 7390 |
| 869 | Ga0207708_10060105 | 3300026075 | Bacteria | 2901 |
| 870 | Ga0207702_10042978 | 3300026078 | Bacteria | 3792 |
| 871 | Ga0207702_10050842 | 3300026078 | Bacteria | 3500 |
| 872 | Ga0207702_10066459 | 3300026078 | Bacteria | 3091 |
| 873 | Ga0207702_10340732 | 3300026078 | Bacteria | 1432 |
| 874 | Ga0207702_10532124 | 3300026078 | Bacteria | 1148 |
| 875 | Ga0207641_10001486 | 3300026088 | Bacteria | 22946 |
| 876 | Ga0207641_10004884 | 3300026088 | Bacteria | 11534 |
| 877 | Ga0207641_10266332 | 3300026088 | Bacteria | 1606 |
| 878 | Ga0207641_10415295 | 3300026088 | Bacteria | 1294 |
| 879 | Ga0207641_10838603 | 3300026088 | Bacteria | 911 |
| 880 | Ga0207648_10001104 | 3300026089 | Bacteria | 30219 |
| 881 | Ga0207648_10001209 | 3300026089 | Bacteria | 28896 |
| 882 | Ga0207648_10026444 | 3300026089 | Bacteria | 5156 |
| 883 | Ga0207648_10044844 | 3300026089 | Bacteria | 3880 |
| 884 | Ga0207648_10088386 | 3300026089 | Bacteria | 2706 |
| 885 | Ga0207648_10285860 | 3300026089 | Bacteria | 1476 |
| 886 | Ga0207648_10426945 | 3300026089 | Bacteria | 1204 |
| 887 | Ga0207676_10002421 | 3300026095 | Bacteria | 13294 |
| 888 | Ga0207676_10005547 | 3300026095 | Bacteria | 8928 |
| 889 | Ga0207676_10007903 | 3300026095 | Bacteria | 7566 |
| 890 | Ga0207676_10096057 | 3300026095 | Bacteria | 2445 |
| 891 | Ga0207676_10714313 | 3300026095 | Bacteria | 972 |
| 892 | Ga0207676_10718003 | 3300026095 | Bacteria | 970 |
| 893 | Ga0207674_10000089 | 3300026116 | Bacteria | 99911 |
| 894 | Ga0207674_10002196 | 3300026116 | Bacteria | 24709 |
| 895 | Ga0207674_10004693 | 3300026116 | Bacteria | 16399 |
| 896 | Ga0207674_10004995 | 3300026116 | Bacteria | 15857 |
| 897 | Ga0207674_10010018 | 3300026116 | Bacteria | 10784 |
| 898 | Ga0207674_10132705 | 3300026116 | Bacteria | 2453 |
| 899 | Ga0207674_10190171 | 3300026116 | Bacteria | 2003 |
| 900 | Ga0207674_10287779 | 3300026116 | Bacteria | 1592 |
| 901 | Ga0207675_100000047 | 3300026118 | Bacteria | 85113 |
| 902 | Ga0207675_100000376 | 3300026118 | Bacteria | 42834 |
| 903 | Ga0207675_100001008 | 3300026118 | Bacteria | 27852 |
| 904 | Ga0207675_100059299 | 3300026118 | Bacteria | 3571 |
| 905 | Ga0207675_100125288 | 3300026118 | Bacteria | 2433 |
| 906 | Ga0207675_100547266 | 3300026118 | Bacteria | 1156 |
| 907 | Ga0207683_10000127 | 3300026121 | Bacteria | 62271 |
| 908 | Ga0207683_10007701 | 3300026121 | Bacteria | 9225 |
| 909 | Ga0207683_10016793 | 3300026121 | Bacteria | 6230 |
| 910 | Ga0207683_10019753 | 3300026121 | Bacteria | 5755 |
| 911 | Ga0207683_10064796 | 3300026121 | Bacteria | 3221 |
| 912 | Ga0207698_10008357 | 3300026142 | Bacteria | 6541 |
| 913 | Ga0207698_10031784 | 3300026142 | Bacteria | 3815 |
| 914 | Ga0207698_10042815 | 3300026142 | Bacteria | 3387 |
| 915 | Ga0207698_10045785 | 3300026142 | Bacteria | 3298 |
| 916 | Ga0207698_10099036 | 3300026142 | Bacteria | 2410 |
| 917 | Ga0207698_10153243 | 3300026142 | Bacteria | 2004 |
| 918 | Ga0209995_1012932 | 3300027471 | Bacteria | 1365 |
| 919 | Ga0209983_1005434 | 3300027665 | Bacteria | 2638 |
| 920 | Ga0209971_1001127 | 3300027682 | Bacteria | 6774 |
| 921 | Ga0207428_10012008 | 3300027907 | Bacteria | 7623 |
| 922 | Ga0207428_10070875 | 3300027907 | Bacteria | 2739 |
| 923 | Ga0207428_10113181 | 3300027907 | Bacteria | 2086 |
| 924 | Ga0207428_10132546 | 3300027907 | Bacteria | 1906 |
| 925 | Ga0207428_10170995 | 3300027907 | Bacteria | 1646 |
| 926 | Ga0207428_10518449 | 3300027907 | Bacteria | 864 |
| 927 | Ga0268266_10006847 | 3300028379 | Bacteria | 10381 |
| 928 | Ga0268266_10028221 | 3300028379 | Bacteria | 4771 |
| 929 | Ga0268266_10038608 | 3300028379 | Bacteria | 4065 |
| 930 | Ga0268265_10000728 | 3300028380 | Bacteria | 32178 |
| 931 | Ga0268265_10004940 | 3300028380 | Bacteria | 9166 |
| 932 | Ga0268265_10045406 | 3300028380 | Bacteria | 3278 |
| 933 | Ga0268265_10126967 | 3300028380 | Bacteria | 2112 |
| 934 | Ga0268265_10730613 | 3300028380 | Bacteria | 959 |
| 935 | Ga0268264_10000358 | 3300028381 | Bacteria | 68359 |
| 936 | Ga0268264_10042905 | 3300028381 | Bacteria | 3746 |
| 937 | Ga0268264_10165288 | 3300028381 | Bacteria | 1997 |
| 938 | Ga0265328_10009096 | 3300031239 | Bacteria | 4057 |
| 939 | Ga0265339_10016519 | 3300031249 | Bacteria | 4397 |
| 940 | Ga0265331_10000002 | 3300031250 | Bacteria | 511481 |
| 941 | Ga0265331_10000355 | 3300031250 | Bacteria | 48482 |
| 942 | Ga0265327_10000033 | 3300031251 | Bacteria | 317182 |
| 943 | Ga0265316_10021653 | 3300031344 | Bacteria | 5439 |
| 944 | Ga0265314_10003660 | 3300031711 | Bacteria | 14746 |
| 945 | Ga0307516_10145603 | 3300031730 | Bacteria | 2135 |
| 946 | Ga0307413_10237381 | 3300031824 | Bacteria | 1343 |
| 947 | Ga0307412_10026142 | 3300031911 | Bacteria | 3625 |
| 948 | Ga0307414_10161608 | 3300032004 | Bacteria | 1780 |
| 949 | Ga0373929_0007593 | 3300035085 | Bacteria | 1983 |
| 950 | Ga0373929_0040769 | 3300035085 | Bacteria | 1030 |
| 951 | Ga0373934_0000639 | 3300035086 | Bacteria | 12380 |
| 952 | Ga0373940_0009937 | 3300035088 | Bacteria | 2225 |
| 953 | Ga0373952_0041093 | 3300035092 | Bacteria | 1069 |
| 954 | Ga0373923_0050607 | 3300035111 | Bacteria | 1741 |
| 955 | Ga0373923_0097413 | 3300035111 | Bacteria | 1294 |
| 956 | Ga0373932_0011564 | 3300035112 | Bacteria | 2159 |
| 957 | Ga0373939_0045629 | 3300035114 | Bacteria | 1338 |
| 958 | Ga0373941_0063328 | 3300035115 | Bacteria | 1209 |
| 959 | Ga0373953_0073359 | 3300035117 | Bacteria | 1415 |
| 960 | Ga0373954_0025888 | 3300035118 | Bacteria | 2686 |
| 961 | Ga0373956_0000135 | 3300035119 | Bacteria | 26321 |
| 962 | Ga0373957_0000933 | 3300035120 | Bacteria | 7664 |
| 963 | Ga0373960_0014938 | 3300035121 | Bacteria | 1975 |
| 964 | Ga0373960_0021024 | 3300035121 | Bacteria | 1731 |
| 965 | Ga0373955_0023281 | 3300035172 | Bacteria | 3153 |
| 966 | Ga0373955_0259703 | 3300035172 | Bacteria | 1043 |
| 967 | Ga0373962_0005595 | 3300035242 | Bacteria | 3035 |
| 968 | Ga0373931_0004770 | 3300035691 | Bacteria | 6219 |
| 969 | Ga0373931_0007171 | 3300035691 | Bacteria | 5243 |
| 970 | Ga0373931_0016109 | 3300035691 | Bacteria | 3675 |
| 971 | Ga0373931_0189881 | 3300035691 | Bacteria | 1222 |
| 972 | Ga0373935_0140496 | 3300035692 | Bacteria | 1631 |
| 973 | Ga0373927_0218147 | 3300035695 | Bacteria | 1253 |
| 974 | Ga0373927_0336775 | 3300035695 | Bacteria | 994 |
| 975 | Ga0373933_0000813 | 3300035724 | Bacteria | 19033 |
| 976 | Ga0373947_0112483 | 3300035725 | Bacteria | 1722 |
| 977 | Ga0373937_0004329 | 3300036401 | Bacteria | 12048 |
| 978 | Ga0373937_0023186 | 3300036401 | Bacteria | 5588 |
| 979 | Ga0373937_0087549 | 3300036401 | Bacteria | 2883 |
| 980 | Ga0373925_0031236 | 3300037068 | Bacteria | 3913 |
| 981 | Ga0373925_0087309 | 3300037068 | Bacteria | 2381 |
| 982 | Ga0395899_0007777 | 3300037312 | Bacteria | 8266 |
| 983 | Ga0395900_0010652 | 3300037418 | Bacteria | 9404 |
| 984 | Ga0395900_0019699 | 3300037418 | Bacteria | 6877 |
| 985 | Ga0395898_0462143 | 3300037466 | Bacteria | 1208 |
| 986 | Ga0395905_0000086 | 3300037471 | Bacteria | 153641 |
| 987 | Ga0395905_0004236 | 3300037471 | Bacteria | 14996 |
| 988 | Ga0395905_0112475 | 3300037471 | Bacteria | 2557 |
| 989 | Ga0395901_0007491 | 3300038443 | Bacteria | 11024 |
| 990 | Ga0395901_0079508 | 3300038443 | Bacteria | 3424 |
| 991 | Ga0395901_0209231 | 3300038443 | Bacteria | 2042 |
| 992 | Ga0395901_0415128 | 3300038443 | Bacteria | 1381 |
| 993 | Ga0242420_009807 | 3300038996 | Bacteria | 1579 |
| 994 | Ga0436360_0220478 | 3300039438 | Bacteria | 1158 |
| 995 | Ga0436361_0032090 | 3300039447 | Bacteria | 10247 |
| 996 | Ga0436361_0421236 | 3300039447 | Bacteria | 851 |
| 997 | Ga0436361_0530365 | 3300039447 | Bacteria | 62073 |
| 998 | Ga0436361_0579013 | 3300039447 | Bacteria | 26383 |
| 999 | Ga0436361_0972320 | 3300039447 | Bacteria | 18071 |
| 1000 | Ga0436361_1044948 | 3300039447 | Bacteria | 4449 |
| 1001 | Ga0436363_1091328 | 3300039450 | Bacteria | 1041 |
| 1002 | Ga0436363_1403698 | 3300039450 | Bacteria | 987 |
| 1003 | Ga0436362_0201408 | 3300039453 | Bacteria | 1174 |
| 1004 | Ga0436362_0326174 | 3300039453 | Bacteria | 850 |
| 1005 | Ga0439465_0001164 | 3300041413 | Bacteria | 8448 |
| 1006 | Ga0451847_0461108 | 3300041503 | Bacteria | 1307 |
| 1007 | Ga0451577_0097984 | 3300042876 | Bacteria | 2619 |
| 1008 | Ga0466968_0074670 | 3300044735 | Bacteria | 1481 |
| 1009 | Ga0451576_0025457 | 3300045051 | Bacteria | 6374 |
| 1010 | Ga0451576_0104326 | 3300045051 | Bacteria | 2949 |
| 1011 | Ga0495590_0000006 | 3300046457 | Bacteria | 372949 |
| 1012 | Ga0495629_0054326 | 3300046459 | Bacteria | 2801 |
| 1013 | Ga0495629_0096585 | 3300046459 | Bacteria | 2061 |
| 1014 | Ga0495638_0000333 | 3300046460 | Bacteria | 59483 |
| 1015 | Ga0495651_0000274 | 3300046462 | Bacteria | 40100 |
| 1016 | Ga0495650_0000194 | 3300046471 | Bacteria | 131682 |
| 1017 | Ga0495650_0008058 | 3300046471 | Bacteria | 6220 |
| 1018 | Ga0495580_0033707 | 3300046472 | Bacteria | 3688 |
| 1019 | Ga0495580_0036032 | 3300046472 | Bacteria | 3555 |
| 1020 | Ga0495580_0072639 | 3300046472 | Bacteria | 2402 |
| 1021 | Ga0495662_0110605 | 3300046476 | Bacteria | 1347 |
| 1022 | Ga0495584_0073030 | 3300046491 | Bacteria | 1724 |
| 1023 | Ga0495584_0095625 | 3300046491 | Bacteria | 1500 |
| 1024 | Ga0495585_0112778 | 3300046492 | Bacteria | 1444 |
| 1025 | Ga0495607_0001831 | 3300046501 | Bacteria | 18117 |
| 1026 | Ga0495583_0000475 | 3300046506 | Bacteria | 58746 |
| 1027 | Ga0495606_0013329 | 3300046507 | Bacteria | 6507 |
| 1028 | Ga0495606_0269849 | 3300046507 | Bacteria | 935 |
| 1029 | Ga0495616_0088407 | 3300046513 | Bacteria | 1471 |
| 1030 | Ga0495618_0128240 | 3300046514 | Bacteria | 1624 |
| 1031 | Ga0495620_0065924 | 3300046515 | Bacteria | 1493 |
| 1032 | Ga0495643_0000358 | 3300046522 | Bacteria | 62194 |
| 1033 | Ga0495648_0000054 | 3300046524 | Bacteria | 159674 |
| 1034 | Ga0495666_0011471 | 3300046526 | Bacteria | 4418 |
| 1035 | Ga0495642_0009074 | 3300046528 | Bacteria | 3807 |
| 1036 | Ga0495642_0122436 | 3300046528 | Bacteria | 1116 |
| 1037 | Ga0495642_0178150 | 3300046528 | Bacteria | 925 |
| 1038 | Ga0495621_0054737 | 3300046539 | Bacteria | 1435 |
| 1039 | Ga0495621_0105795 | 3300046539 | Bacteria | 1075 |
| 1040 | Ga0495621_0128057 | 3300046539 | Bacteria | 986 |
| 1041 | Ga0495597_0000191 | 3300046542 | Bacteria | 55786 |
| 1042 | Ga0495622_0000038 | 3300046557 | Bacteria | 119397 |
| 1043 | Ga0495633_0001301 | 3300046558 | Bacteria | 19710 |
| 1044 | Ga0495633_0089268 | 3300046558 | Bacteria | 1433 |
| 1045 | Ga0495656_0076154 | 3300046615 | Bacteria | 1503 |
| 1046 | Ga0495668_0001151 | 3300046616 | Bacteria | 27068 |
| 1047 | Ga0495668_0002784 | 3300046616 | Bacteria | 13927 |
| 1048 | Ga0495625_0000436 | 3300046660 | Bacteria | 62756 |
| 1049 | Ga0495625_0000558 | 3300046660 | Bacteria | 54572 |
| 1050 | Ga0495657_0022641 | 3300046675 | Bacteria | 4498 |
| 1051 | Ga0495647_0038760 | 3300046681 | Bacteria | 1803 |
| 1052 | Ga0495669_0088311 | 3300046684 | Bacteria | 1429 |
| 1053 | Ga0495669_0109852 | 3300046684 | Bacteria | 1287 |
| 1054 | Ga0495670_0062773 | 3300046691 | Bacteria | 1870 |
| 1055 | Ga0495649_0172884 | 3300046694 | Bacteria | 1130 |
| 1056 | Ga0495600_0255963 | 3300046809 | Bacteria | 1113 |
| 1057 | Ga0495581_0157408 | 3300047315 | Bacteria | 1328 |
| 1058 | Ga0495604_0050123 | 3300047317 | Bacteria | 3242 |
| 1059 | Ga0495674_0267585 | 3300047319 | Bacteria | 1403 |
| 1060 | Ga0495672_0250784 | 3300047320 | Bacteria | 859 |
| 1061 | Ga0495676_0226328 | 3300047321 | Bacteria | 1286 |
| 1062 | Ga0495680_0076772 | 3300047322 | Bacteria | 2532 |
| 1063 | Ga0495683_0213944 | 3300047323 | Bacteria | 863 |
| 1064 | Ga0495687_001334 | 3300047443 | Bacteria | 23017 |
| 1065 | Ga0495687_004548 | 3300047443 | Bacteria | 9302 |
| 1066 | Ga0495684_0144589 | 3300047471 | Bacteria | 1782 |
| 1067 | Ga0495686_0270025 | 3300047472 | Bacteria | 949 |
| 1068 | Ga0495593_0197086 | 3300047673 | Bacteria | 1012 |
| 1069 | Ga0495614_0038867 | 3300048089 | Bacteria | 2043 |
| 1070 | Ga0495614_0058997 | 3300048089 | Bacteria | 1648 |
| 1071 | Ga0496100_0022383 | 3300048903 | Bacteria | 3824 |
| 1072 | Ga0496100_0242447 | 3300048903 | Bacteria | 1330 |
| 1073 | Ga0496101_0023566 | 3300048904 | Bacteria | 4254 |
| 1074 | Ga0496101_0061606 | 3300048904 | Bacteria | 2725 |
| 1075 | Ga0496101_0114106 | 3300048904 | Bacteria | 2037 |
| 1076 | Ga0496101_0138658 | 3300048904 | Bacteria | 1852 |
| 1077 | Ga0496101_0155871 | 3300048904 | Bacteria | 1749 |
| 1078 | Ga0496101_0449248 | 3300048904 | Bacteria | 1017 |
| 1079 | Ga0496101_0679824 | 3300048904 | Bacteria | 813 |
| 1080 | Ga0496102_0012224 | 3300048905 | Bacteria | 7423 |
| 1081 | Ga0496102_0032411 | 3300048905 | Bacteria | 4693 |
| 1082 | Ga0496102_0034017 | 3300048905 | Bacteria | 4583 |
| 1083 | Ga0496102_0034379 | 3300048905 | Bacteria | 4558 |
| 1084 | Ga0496102_0137229 | 3300048905 | Bacteria | 2292 |
| 1085 | Ga0496102_0411198 | 3300048905 | Bacteria | 1271 |
| 1086 | Ga0496103_0004445 | 3300048906 | Bacteria | 8503 |
| 1087 | Ga0496103_0024209 | 3300048906 | Bacteria | 3662 |
| 1088 | Ga0496103_0027729 | 3300048906 | Bacteria | 3434 |
| 1089 | Ga0496103_0058180 | 3300048906 | Bacteria | 2401 |
| 1090 | Ga0496103_0064765 | 3300048906 | Bacteria | 2279 |
| 1091 | Ga0496103_0072089 | 3300048906 | Bacteria | 2163 |
| 1092 | Ga0496103_0263325 | 3300048906 | Bacteria | 1109 |
| 1093 | Ga0496104_0003625 | 3300048907 | Bacteria | 13338 |
| 1094 | Ga0496104_0003891 | 3300048907 | Bacteria | 12924 |
| 1095 | Ga0496104_0049441 | 3300048907 | Bacteria | 3965 |
| 1096 | Ga0496104_0296340 | 3300048907 | Bacteria | 1530 |
| 1097 | Ga0496104_0414017 | 3300048907 | Bacteria | 1260 |
| 1098 | Ga0496104_0674134 | 3300048907 | Bacteria | 942 |
| 1099 | Ga0496105_0001322 | 3300048908 | Bacteria | 17343 |
| 1100 | Ga0496105_0023569 | 3300048908 | Bacteria | 4993 |
| 1101 | Ga0496105_0036542 | 3300048908 | Bacteria | 4046 |
| 1102 | Ga0496105_0220084 | 3300048908 | Bacteria | 1546 |
| 1103 | Ga0496105_0324557 | 3300048908 | Bacteria | 1233 |
| 1104 | Ga0496106_0021775 | 3300048909 | Bacteria | 4760 |
| 1105 | Ga0496106_0079115 | 3300048909 | Bacteria | 2524 |
| 1106 | Ga0496106_0113686 | 3300048909 | Bacteria | 2110 |
| 1107 | Ga0496106_0178145 | 3300048909 | Bacteria | 1687 |
| 1108 | Ga0496107_0002458 | 3300048910 | Bacteria | 12020 |
| 1109 | Ga0496107_0029338 | 3300048910 | Bacteria | 3913 |
| 1110 | Ga0496107_0037478 | 3300048910 | Bacteria | 3479 |
| 1111 | Ga0496107_0054627 | 3300048910 | Bacteria | 2882 |
| 1112 | Ga0496107_0376757 | 3300048910 | Bacteria | 1056 |
| 1113 | Ga0496108_0002238 | 3300048911 | Bacteria | 15499 |
| 1114 | Ga0496108_0069736 | 3300048911 | Bacteria | 2966 |
| 1115 | Ga0496108_0395200 | 3300048911 | Bacteria | 1207 |
| 1116 | Ga0496109_0002809 | 3300048912 | Bacteria | 14583 |
| 1117 | Ga0496109_0006173 | 3300048912 | Bacteria | 10068 |
| 1118 | Ga0496109_0015267 | 3300048912 | Bacteria | 6687 |
| 1119 | Ga0496109_0031863 | 3300048912 | Bacteria | 4735 |
| 1120 | Ga0496109_0043237 | 3300048912 | Bacteria | 4083 |
| 1121 | Ga0496109_0136861 | 3300048912 | Bacteria | 2289 |
| 1122 | Ga0496109_0298500 | 3300048912 | Bacteria | 1519 |
| 1123 | Ga0496109_0453695 | 3300048912 | Bacteria | 1211 |
| 1124 | Ga0496110_0024038 | 3300048913 | Bacteria | 5191 |
| 1125 | Ga0496110_0024415 | 3300048913 | Bacteria | 5152 |
| 1126 | Ga0496110_0030989 | 3300048913 | Bacteria | 4612 |
| 1127 | Ga0496110_0037915 | 3300048913 | Bacteria | 4191 |
| 1128 | Ga0496110_0065317 | 3300048913 | Bacteria | 3216 |
| 1129 | Ga0496110_0226002 | 3300048913 | Bacteria | 1702 |
| 1130 | Ga0496110_0283722 | 3300048913 | Bacteria | 1508 |
| 1131 | Ga0496110_0292335 | 3300048913 | Bacteria | 1484 |
| 1132 | Ga0496111_0017001 | 3300048914 | Bacteria | 5021 |
| 1133 | Ga0496111_0036092 | 3300048914 | Bacteria | 3534 |
| 1134 | Ga0496111_0038968 | 3300048914 | Bacteria | 3405 |
| 1135 | Ga0496111_0124351 | 3300048914 | Bacteria | 1906 |
| 1136 | Ga0496111_0137848 | 3300048914 | Bacteria | 1808 |
| 1137 | Ga0496112_0033514 | 3300048915 | Bacteria | 4993 |
| 1138 | Ga0496112_0047020 | 3300048915 | Bacteria | 4233 |
| 1139 | Ga0496112_0128607 | 3300048915 | Bacteria | 2503 |
| 1140 | Ga0496112_0145141 | 3300048915 | Bacteria | 2341 |
| 1141 | Ga0496112_0214935 | 3300048915 | Bacteria | 1879 |
| 1142 | Ga0496113_0001266 | 3300048916 | Bacteria | 13932 |
| 1143 | Ga0496113_0059870 | 3300048916 | Bacteria | 2869 |
| 1144 | Ga0496113_0152766 | 3300048916 | Bacteria | 1822 |
| 1145 | Ga0496114_0018456 | 3300048917 | Bacteria | 5639 |
| 1146 | Ga0496114_0360228 | 3300048917 | Bacteria | 1286 |
| 1147 | Ga0496115_0022583 | 3300048918 | Bacteria | 4877 |
| 1148 | Ga0496117_0002582 | 3300048920 | Bacteria | 22541 |
| 1149 | Ga0496118_0002912 | 3300048921 | Bacteria | 22251 |
| 1150 | Ga0496118_0138530 | 3300048921 | Bacteria | 1548 |
| 1151 | Ga0496121_0001731 | 3300048924 | Bacteria | 35624 |
| 1152 | Ga0496121_0020294 | 3300048924 | Bacteria | 6587 |
| 1153 | Ga0496124_0000315 | 3300048927 | Bacteria | 89492 |
| 1154 | Ga0496124_0051010 | 3300048927 | Bacteria | 3522 |
| 1155 | Ga0496125_0007726 | 3300048928 | Bacteria | 11390 |
| 1156 | Ga0496125_0100672 | 3300048928 | Bacteria | 2129 |
| 1157 | Ga0495678_003848 | 3300049459 | Bacteria | 9024 |
| 1158 | Ga0495678_005316 | 3300049459 | Bacteria | 7144 |
| 1159 | Ga0501034_0002928 | 3300049571 | Bacteria | 19795 |
| 1160 | Ga0501034_0090019 | 3300049571 | Bacteria | 3067 |
| 1161 | Ga0501036_0141693 | 3300049572 | Bacteria | 2028 |
| 1162 | Ga0501046_0001880 | 3300049580 | Bacteria | 19972 |
| 1163 | Ga0501046_0031358 | 3300049580 | Bacteria | 4309 |
| 1164 | Ga0501047_0047668 | 3300049581 | Bacteria | 4139 |
| 1165 | Ga0501047_0169371 | 3300049581 | Bacteria | 2053 |
| 1166 | Ga0501067_0010788 | 3300049583 | Bacteria | 5053 |
| 1167 | Ga0501067_0094672 | 3300049583 | Bacteria | 1658 |
| 1168 | Ga0501067_0167473 | 3300049583 | Bacteria | 1224 |
| 1169 | Ga0501068_0034944 | 3300049584 | Bacteria | 2999 |
| 1170 | Ga0501068_0195709 | 3300049584 | Bacteria | 1282 |
| 1171 | Ga0501070_0274753 | 3300049586 | Bacteria | 1375 |
| 1172 | Ga0501073_0076383 | 3300049589 | Bacteria | 2331 |
| 1173 | Ga0501250_007422 | 3300049680 | Bacteria | 1184 |
| 1174 | Ga0501079_0369281 | 3300049741 | Bacteria | 1125 |
| 1175 | Ga0501080_0201871 | 3300049742 | Bacteria | 1825 |
| 1176 | Ga0501081_0112261 | 3300049743 | Bacteria | 1935 |
| 1177 | Ga0501083_0024996 | 3300049744 | Bacteria | 4137 |
| 1178 | Ga0501083_0050819 | 3300049744 | Bacteria | 2789 |
| 1179 | Ga0501044_0199410 | 3300049823 | Bacteria | 1960 |
| 1180 | Ga0501044_0599599 | 3300049823 | Bacteria | 995 |
| 1181 | nmdc:mga03683_83289_c1 | 3300050489 | Bacteria | 1384 |
| 1182 | nmdc:mga00v17_75055_c1 | 3300050491 | Bacteria | 2102 |
| 1183 | nmdc:mga0yw44_25520_c1 | 3300050492 | Bacteria | 3362 |
| 1184 | nmdc:mga0yw44_30075_c1 | 3300050492 | Bacteria | 3143 |
| 1185 | nmdc:mga0yw44_62260_c1 | 3300050492 | Bacteria | 2291 |
| 1186 | nmdc:mga0k408_91021_c1 | 3300050493 | Bacteria | 1792 |
| 1187 | nmdc:mga06z11_166450_c1 | 3300050494 | Bacteria | 1263 |
| 1188 | nmdc:mga06z11_223427_c1 | 3300050494 | Bacteria | 1101 |
| 1189 | nmdc:mga06z11_43777_c1 | 3300050494 | Bacteria | 2254 |
| 1190 | nmdc:mga07m45_238953_c1 | 3300050496 | Bacteria | 1057 |
| 1191 | nmdc:mga07m45_291084_c1 | 3300050496 | Bacteria | 950 |
| 1192 | nmdc:mga05p37_1011036_c1 | 3300050507 | Bacteria | 882 |
| 1193 | nmdc:mga05p37_25897_c1 | 3300050507 | Bacteria | 7131 |
| 1194 | nmdc:mga05p37_44460_c1 | 3300050507 | Bacteria | 5464 |
| 1195 | nmdc:mga05p37_565804_c1 | 3300050507 | Bacteria | 1291 |
| 1196 | nmdc:mga05p37_96346_c1 | 3300050507 | Bacteria | 3645 |
| 1197 | nmdc:mga09592_128149_c1 | 3300050508 | Bacteria | 2182 |
| 1198 | nmdc:mga0qj67_15707_c1 | 3300050509 | Bacteria | 5735 |
| 1199 | nmdc:mga0qj67_256687_c1 | 3300050509 | Bacteria | 1418 |
| 1200 | nmdc:mga0qj67_42590_c1 | 3300050509 | Bacteria | 3574 |
| 1201 | nmdc:mga0qj67_48788_c1 | 3300050509 | Bacteria | 3345 |
| 1202 | nmdc:mga06r32_139724_c1 | 3300050510 | Bacteria | 2398 |
| 1203 | nmdc:mga06r32_173683_c1 | 3300050510 | Bacteria | 2139 |
| 1204 | nmdc:mga06r32_219085_c1 | 3300050510 | Bacteria | 1891 |
| 1205 | nmdc:mga06r32_25454_c1 | 3300050510 | Bacteria | 4782 |
| 1206 | nmdc:mga06r32_30438_c1 | 3300050510 | Bacteria | 5064 |
| 1207 | nmdc:mga06r32_73504_c1 | 3300050510 | Bacteria | 3312 |
| 1208 | nmdc:mga08y16_140040_c1 | 3300050511 | Bacteria | 2515 |
| 1209 | nmdc:mga08y16_147138_c1 | 3300050511 | Bacteria | 2449 |
| 1210 | nmdc:mga08y16_152775_c1 | 3300050511 | Bacteria | 2399 |
| 1211 | nmdc:mga08y16_239051_c1 | 3300050511 | Bacteria | 1878 |
| 1212 | nmdc:mga08y16_276208_c1 | 3300050511 | Bacteria | 1734 |
| 1213 | nmdc:mga08y16_286908_c1 | 3300050511 | Bacteria | 1697 |
| 1214 | nmdc:mga08y16_375153_c1 | 3300050511 | Bacteria | 1459 |
| 1215 | nmdc:mga08y16_672347_c1 | 3300050511 | Bacteria | 1038 |
| 1216 | nmdc:mga08y16_68397_c1 | 3300050511 | Bacteria | 3703 |
| 1217 | nmdc:mga08y16_84713_c1 | 3300050511 | Bacteria | 3304 |
| 1218 | nmdc:mga0n895_116657_c1 | 3300050512 | Bacteria | 2689 |
| 1219 | nmdc:mga0n895_182762_c1 | 3300050512 | Bacteria | 2128 |
| 1220 | nmdc:mga0n895_219747_c1 | 3300050512 | Bacteria | 1929 |
| 1221 | nmdc:mga0n895_232339_c1 | 3300050512 | Bacteria | 1872 |
| 1222 | nmdc:mga0n895_39655_c1 | 3300050512 | Bacteria | 4571 |
| 1223 | nmdc:mga0n895_64693_c1 | 3300050512 | Bacteria | 3618 |
| 1224 | nmdc:mga0n895_94644_c1 | 3300050512 | Bacteria | 2991 |
| 1225 | nmdc:mga0rr50_185515_c1 | 3300050513 | Bacteria | 1702 |
| 1226 | nmdc:mga0rr50_307731_c1 | 3300050513 | Bacteria | 1327 |
| 1227 | nmdc:mga0rr50_367324_c1 | 3300050513 | Bacteria | 1212 |
| 1228 | nmdc:mga08x19_109026_c1 | 3300050514 | Bacteria | 1845 |
| 1229 | nmdc:mga08x19_310542_c1 | 3300050514 | Bacteria | 1096 |
| 1230 | nmdc:mga08x19_60991_c1 | 3300050514 | Bacteria | 2444 |
| 1231 | nmdc:mga0a205_2299_c1 | 3300050515 | Bacteria | 16862 |
| 1232 | nmdc:mga0a205_2472_c1 | 3300050515 | Bacteria | 16291 |
| 1233 | nmdc:mga0a205_256485_c1 | 3300050515 | Bacteria | 1627 |
| 1234 | nmdc:mga0a205_61465_c1 | 3300050515 | Bacteria | 3629 |
| 1235 | Ga0495601_0300039 | 3300053077 | Bacteria | 1046 |
| 1236 | Ga0495655_0000902 | 3300053083 | Bacteria | 4633 |
| 1237 | Ga0495655_0020756 | 3300053083 | Bacteria | 1478 |
| 1238 | Ga0495655_0038608 | 3300053083 | Bacteria | 1206 |
| 1239 | Ga0495619_0129091 | 3300053085 | Bacteria | 1736 |
| 1240 | Ga0495619_0294433 | 3300053085 | Bacteria | 1124 |
| 1241 | Ga0500647_0099467 | 3300053091 | Bacteria | 1389 |
| 1242 | Ga0500618_015233 | 3300053125 | Bacteria | 1946 |
| 1243 | Ga0500590_004048 | 3300053148 | Bacteria | 6864 |
| 1244 | Ga0500590_011367 | 3300053148 | Bacteria | 4507 |
| 1245 | Ga0500619_000121 | 3300053154 | Bacteria | 20412 |
| 1246 | Ga0501084_0091452 | 3300054114 | Bacteria | 2555 |
| 1247 | Ga0501084_0185728 | 3300054114 | Bacteria | 1755 |
| 1248 | Ga0501082_0042293 | 3300060353 | Bacteria | 3928 |
| 1249 | Ga0501082_0501645 | 3300060353 | Bacteria | 1061 |
| 1250 | Ga0501082_0606628 | 3300060353 | Bacteria | 958 |
| 1251 | Ga0530510_0108414 | 3300061734 | Bacteria | 2033 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047320 | Ga0495672_0250784 | Ga0495672_0250784_24_626 | 199 |
| 2 | 3300013105 | Ga0157369_10148788 | Ga0157369_101487883 | 219 |
| 3 | 3300013307 | Ga0157372_10082396 | Ga0157372_100823965 | 219 |
| 4 | 3300046809 | Ga0495600_0255963 | Ga0495600_0255963_243_1028 | 221 |
| 5 | 3300025893 | Ga0207682_10108196 | Ga0207682_101081961 | 222 |
| 6 | 3300049583 | Ga0501067_0094672 | Ga0501067_0094672_646_1428 | 224 |
| 7 | 3300049589 | Ga0501073_0076383 | Ga0501073_0076383_1011_1793 | 224 |
| 8 | 3300049744 | Ga0501083_0024996 | Ga0501083_0024996_1558_2340 | 224 |
| 9 | 3300060353 | Ga0501082_0042293 | Ga0501082_0042293_1293_2075 | 224 |
| 10 | 3300039453 | Ga0436362_0326174 | Ga0436362_0326174_30_812 | 226 |
| 11 | 3300032004 | Ga0307414_10161608 | Ga0307414_101616082 | 228 |
| 12 | 3300005344 | Ga0070661_100203485 | Ga0070661_1002034852 | 231 |
| 13 | 3300025263 | Ga0209565_1023186 | Ga0209565_10231861 | 231 |
| 14 | 3300025920 | Ga0207649_10309828 | Ga0207649_103098282 | 231 |
| 15 | 3300026116 | Ga0207674_10287779 | Ga0207674_102877792 | 231 |
| 16 | 3300003187 | JGI25151J46595_10001896 | JGI25151J46595_100018963 | 233 |
| 17 | 3300003203 | JGI25406J46586_10035972 | JGI25406J46586_100359722 | 233 |
| 18 | 3300005334 | Ga0068869_100136013 | Ga0068869_1001360132 | 233 |
| 19 | 3300005441 | Ga0070700_100131650 | Ga0070700_1001316501 | 233 |
| 20 | 3300005985 | Ga0081539_10009313 | Ga0081539_100093135 | 233 |
| 21 | 3300025294 | Ga0209025_1000929 | Ga0209025_100092927 | 233 |
| 22 | 3300025908 | Ga0207643_10013410 | Ga0207643_100134104 | 233 |
| 23 | 3300046472 | Ga0495580_0033707 | Ga0495580_0033707_332_1114 | 233 |
| 24 | 3300048924 | Ga0496121_0020294 | Ga0496121_0020294_2569_3351 | 233 |
| 25 | 3300003187 | JGI25151J46595_10008596 | JGI25151J46595_100085963 | 234 |
| 26 | 3300006852 | Ga0075433_10197585 | Ga0075433_101975852 | 234 |
| 27 | 3300006871 | Ga0075434_100068221 | Ga0075434_1000682214 | 234 |
| 28 | 3300024227 | Ga0228598_1037143 | Ga0228598_10371431 | 234 |
| 29 | 3300025294 | Ga0209025_1000624 | Ga0209025_10006243 | 234 |
| 30 | 3300027907 | Ga0207428_10012008 | Ga0207428_100120082 | 234 |
| 31 | 3300048907 | Ga0496104_0296340 | Ga0496104_0296340_723_1502 | 234 |
| 32 | 3300050511 | nmdc:mga08y16_140040_c1 | nmdc:mga08y16_140040_c1_1063_1845 | 234 |
| 33 | 3300050512 | nmdc:mga0n895_64693_c1 | nmdc:mga0n895_64693_c1_1745_2527 | 234 |
| 34 | 3300050515 | nmdc:mga0a205_2299_c1 | nmdc:mga0a205_2299_c1_15639_16421 | 234 |
| 35 | 3300005331 | Ga0070670_100067683 | Ga0070670_1000676832 | 236 |
| 36 | 3300005338 | Ga0068868_100060114 | Ga0068868_1000601142 | 236 |
| 37 | 3300005344 | Ga0070661_100224573 | Ga0070661_1002245731 | 236 |
| 38 | 3300005440 | Ga0070705_100032090 | Ga0070705_1000320901 | 236 |
| 39 | 3300005455 | Ga0070663_100106613 | Ga0070663_1001066132 | 236 |
| 40 | 3300005578 | Ga0068854_100249538 | Ga0068854_1002495382 | 236 |
| 41 | 3300005616 | Ga0068852_100295085 | Ga0068852_1002950852 | 236 |
| 42 | 3300005834 | Ga0068851_10040310 | Ga0068851_100403102 | 236 |
| 43 | 3300006048 | Ga0075363_100005387 | Ga0075363_1000053876 | 236 |
| 44 | 3300006051 | Ga0075364_10232699 | Ga0075364_102326992 | 236 |
| 45 | 3300006058 | Ga0075432_10019769 | Ga0075432_100197692 | 236 |
| 46 | 3300006177 | Ga0075362_10092615 | Ga0075362_100926152 | 236 |
| 47 | 3300006195 | Ga0075366_10037733 | Ga0075366_100377332 | 236 |
| 48 | 3300009093 | Ga0105240_10014808 | Ga0105240_100148083 | 236 |
| 49 | 3300009545 | Ga0105237_10287832 | Ga0105237_102878321 | 236 |
| 50 | 3300013105 | Ga0157369_10105059 | Ga0157369_101050593 | 236 |
| 51 | 3300025321 | Ga0207656_10046627 | Ga0207656_100466272 | 236 |
| 52 | 3300025913 | Ga0207695_10423272 | Ga0207695_104232722 | 236 |
| 53 | 3300025914 | Ga0207671_10237712 | Ga0207671_102377122 | 236 |
| 54 | 3300025981 | Ga0207640_10063362 | Ga0207640_100633623 | 236 |
| 55 | 3300026023 | Ga0207677_10164628 | Ga0207677_101646282 | 236 |
| 56 | 3300046515 | Ga0495620_0065924 | Ga0495620_0065924_278_1057 | 236 |
| 57 | 3300046539 | Ga0495621_0128057 | Ga0495621_0128057_106_885 | 236 |
| 58 | 3300046660 | Ga0495625_0000436 | Ga0495625_0000436_36269_37051 | 236 |
| 59 | 3300046691 | Ga0495670_0062773 | Ga0495670_0062773_345_1124 | 236 |
| 60 | 3300048911 | Ga0496108_0395200 | Ga0496108_0395200_145_924 | 236 |
| 61 | 3300048913 | Ga0496110_0226002 | Ga0496110_0226002_485_1264 | 236 |
| 62 | 3300050491 | nmdc:mga00v17_75055_c1 | nmdc:mga00v17_75055_c1_1012_1794 | 236 |
| 63 | 3300050492 | nmdc:mga0yw44_25520_c1 | nmdc:mga0yw44_25520_c1_1698_2480 | 236 |
| 64 | 3300050493 | nmdc:mga0k408_91021_c1 | nmdc:mga0k408_91021_c1_874_1656 | 236 |
| 65 | 3300005331 | Ga0070670_100000050 | Ga0070670_10000005060 | 237 |
| 66 | 3300005335 | Ga0070666_10068767 | Ga0070666_100687672 | 237 |
| 67 | 3300005347 | Ga0070668_100000170 | Ga0070668_10000017025 | 237 |
| 68 | 3300005367 | Ga0070667_100000140 | Ga0070667_10000014081 | 237 |
| 69 | 3300005548 | Ga0070665_100000923 | Ga0070665_10000092312 | 237 |
| 70 | 3300005618 | Ga0068864_100000275 | Ga0068864_10000027520 | 237 |
| 71 | 3300005719 | Ga0068861_100124365 | Ga0068861_1001243652 | 237 |
| 72 | 3300005841 | Ga0068863_100000292 | Ga0068863_10000029241 | 237 |
| 73 | 3300005842 | Ga0068858_100004751 | Ga0068858_10000475112 | 237 |
| 74 | 3300005843 | Ga0068860_100000845 | Ga0068860_10000084520 | 237 |
| 75 | 3300005844 | Ga0068862_100001028 | Ga0068862_10000102814 | 237 |
| 76 | 3300009177 | Ga0105248_10017766 | Ga0105248_1001776610 | 237 |
| 77 | 3300009553 | Ga0105249_10001113 | Ga0105249_100011133 | 237 |
| 78 | 3300013306 | Ga0163162_10195759 | Ga0163162_101957592 | 237 |
| 79 | 3300014968 | Ga0157379_10007852 | Ga0157379_100078524 | 237 |
| 80 | 3300025903 | Ga0207680_10026989 | Ga0207680_100269892 | 237 |
| 81 | 3300025925 | Ga0207650_10000133 | Ga0207650_1000013317 | 237 |
| 82 | 3300025941 | Ga0207711_10012247 | Ga0207711_1001224710 | 237 |
| 83 | 3300025961 | Ga0207712_10000689 | Ga0207712_1000068924 | 237 |
| 84 | 3300025972 | Ga0207668_10000275 | Ga0207668_1000027533 | 237 |
| 85 | 3300025986 | Ga0207658_10001145 | Ga0207658_1000114517 | 237 |
| 86 | 3300026088 | Ga0207641_10004884 | Ga0207641_1000488412 | 237 |
| 87 | 3300026095 | Ga0207676_10005547 | Ga0207676_100055473 | 237 |
| 88 | 3300026118 | Ga0207675_100125288 | Ga0207675_1001252882 | 237 |
| 89 | 3300028379 | Ga0268266_10006847 | Ga0268266_100068472 | 237 |
| 90 | 3300028380 | Ga0268265_10004940 | Ga0268265_1000494011 | 237 |
| 91 | 3300028381 | Ga0268264_10000358 | Ga0268264_1000035860 | 237 |
| 92 | 3300031730 | Ga0307516_10145603 | Ga0307516_101456032 | 237 |
| 93 | 3300060353 | Ga0501082_0501645 | Ga0501082_0501645_17_796 | 237 |
| 94 | 3300006852 | Ga0075433_10178897 | Ga0075433_101788972 | 238 |
| 95 | 3300007076 | Ga0075435_100219670 | Ga0075435_1002196701 | 238 |
| 96 | 3300009094 | Ga0111539_10369179 | Ga0111539_103691792 | 238 |
| 97 | 3300009147 | Ga0114129_10102860 | Ga0114129_101028603 | 238 |
| 98 | 3300050511 | nmdc:mga08y16_68397_c1 | nmdc:mga08y16_68397_c1_1168_1947 | 238 |
| 99 | 3300050513 | nmdc:mga0rr50_185515_c1 | nmdc:mga0rr50_185515_c1_295_1077 | 238 |
| 100 | 3300050515 | nmdc:mga0a205_256485_c1 | nmdc:mga0a205_256485_c1_13_795 | 238 |
| 101 | 3300003775 | Ga0055524_1002528 | Ga0055524_10025287 | 240 |
| 102 | 3300005471 | Ga0070698_100010828 | Ga0070698_10001082811 | 240 |
| 103 | 3300005981 | Ga0081538_10035782 | Ga0081538_100357821 | 240 |
| 104 | 3300025294 | Ga0209025_1060115 | Ga0209025_10601152 | 240 |
| 105 | 3300025299 | Ga0209256_1000176 | Ga0209256_100017631 | 240 |
| 106 | 3300025945 | Ga0207679_10033072 | Ga0207679_100330722 | 240 |
| 107 | 3300005434 | Ga0070709_10174783 | Ga0070709_101747832 | 241 |
| 108 | 3300005436 | Ga0070713_100037308 | Ga0070713_1000373082 | 241 |
| 109 | 3300005437 | Ga0070710_10034977 | Ga0070710_100349772 | 241 |
| 110 | 3300005439 | Ga0070711_100013174 | Ga0070711_1000131742 | 241 |
| 111 | 3300006028 | Ga0070717_10067436 | Ga0070717_100674362 | 241 |
| 112 | 3300006173 | Ga0070716_100186501 | Ga0070716_1001865011 | 241 |
| 113 | 3300006175 | Ga0070712_100035681 | Ga0070712_1000356812 | 241 |
| 114 | 3300025905 | Ga0207685_10081428 | Ga0207685_100814282 | 241 |
| 115 | 3300025906 | Ga0207699_10095416 | Ga0207699_100954162 | 241 |
| 116 | 3300025915 | Ga0207693_10003527 | Ga0207693_1000352711 | 241 |
| 117 | 3300025916 | Ga0207663_10034041 | Ga0207663_100340412 | 241 |
| 118 | 3300005543 | Ga0070672_100001043 | Ga0070672_1000010433 | 242 |
| 119 | 3300013297 | Ga0157378_10281331 | Ga0157378_102813312 | 242 |
| 120 | 3300014969 | Ga0157376_10028899 | Ga0157376_100288994 | 242 |
| 121 | 3300025940 | Ga0207691_10045423 | Ga0207691_100454233 | 242 |
| 122 | 3300005335 | Ga0070666_10039156 | Ga0070666_100391563 | 243 |
| 123 | 3300005347 | Ga0070668_100322886 | Ga0070668_1003228861 | 243 |
| 124 | 3300005367 | Ga0070667_100030963 | Ga0070667_1000309634 | 243 |
| 125 | 3300005456 | Ga0070678_100000728 | Ga0070678_1000007287 | 243 |
| 126 | 3300005459 | Ga0068867_100488545 | Ga0068867_1004885451 | 243 |
| 127 | 3300005842 | Ga0068858_100018757 | Ga0068858_1000187576 | 243 |
| 128 | 3300009177 | Ga0105248_10510953 | Ga0105248_105109532 | 243 |
| 129 | 3300025903 | Ga0207680_10022090 | Ga0207680_100220903 | 243 |
| 130 | 3300025937 | Ga0207669_10003358 | Ga0207669_100033582 | 243 |
| 131 | 3300025941 | Ga0207711_10502108 | Ga0207711_105021081 | 243 |
| 132 | 3300025972 | Ga0207668_10271282 | Ga0207668_102712821 | 243 |
| 133 | 3300026023 | Ga0207677_10087500 | Ga0207677_100875003 | 243 |
| 134 | 3300026035 | Ga0207703_10026290 | Ga0207703_100262903 | 243 |
| 135 | 3300026089 | Ga0207648_10044844 | Ga0207648_100448443 | 243 |
| 136 | 3300026121 | Ga0207683_10064796 | Ga0207683_100647963 | 243 |
| 137 | 3300028379 | Ga0268266_10028221 | Ga0268266_100282215 | 243 |
| 138 | 3300049680 | Ga0501250_007422 | Ga0501250_007422_60_842 | 243 |
| 139 | 3300005327 | Ga0070658_10244094 | Ga0070658_102440942 | 245 |
| 140 | 3300005434 | Ga0070709_10017181 | Ga0070709_100171812 | 245 |
| 141 | 3300005436 | Ga0070713_100012591 | Ga0070713_1000125912 | 245 |
| 142 | 3300005471 | Ga0070698_100001471 | Ga0070698_10000147113 | 245 |
| 143 | 3300005546 | Ga0070696_100024590 | Ga0070696_1000245903 | 245 |
| 144 | 3300006028 | Ga0070717_10000603 | Ga0070717_1000060311 | 245 |
| 145 | 3300006175 | Ga0070712_100269546 | Ga0070712_1002695462 | 245 |
| 146 | 3300025906 | Ga0207699_10085922 | Ga0207699_100859222 | 245 |
| 147 | 3300025915 | Ga0207693_10292137 | Ga0207693_102921371 | 245 |
| 148 | 3300025915 | Ga0207693_10370698 | Ga0207693_103706981 | 245 |
| 149 | 3300025928 | Ga0207700_10112191 | Ga0207700_101121913 | 245 |
| 150 | 3300005330 | Ga0070690_100000674 | Ga0070690_10000067411 | 246 |
| 151 | 3300005335 | Ga0070666_10006295 | Ga0070666_100062959 | 246 |
| 152 | 3300005338 | Ga0068868_100019088 | Ga0068868_1000190885 | 246 |
| 153 | 3300005340 | Ga0070689_100010550 | Ga0070689_1000105505 | 246 |
| 154 | 3300005354 | Ga0070675_100003246 | Ga0070675_1000032463 | 246 |
| 155 | 3300005355 | Ga0070671_100005745 | Ga0070671_10000574510 | 246 |
| 156 | 3300005364 | Ga0070673_100004666 | Ga0070673_1000046662 | 246 |
| 157 | 3300005365 | Ga0070688_100011717 | Ga0070688_1000117172 | 246 |
| 158 | 3300005367 | Ga0070667_100030395 | Ga0070667_1000303955 | 246 |
| 159 | 3300005439 | Ga0070711_100189243 | Ga0070711_1001892432 | 246 |
| 160 | 3300005458 | Ga0070681_10068229 | Ga0070681_100682293 | 246 |
| 161 | 3300005458 | Ga0070681_10434323 | Ga0070681_104343231 | 246 |
| 162 | 3300005543 | Ga0070672_100109845 | Ga0070672_1001098452 | 246 |
| 163 | 3300005616 | Ga0068852_100055776 | Ga0068852_1000557762 | 246 |
| 164 | 3300005617 | Ga0068859_100002993 | Ga0068859_10000299312 | 246 |
| 165 | 3300005618 | Ga0068864_100013588 | Ga0068864_1000135883 | 246 |
| 166 | 3300005841 | Ga0068863_100001479 | Ga0068863_10000147912 | 246 |
| 167 | 3300005842 | Ga0068858_100001164 | Ga0068858_10000116414 | 246 |
| 168 | 3300006358 | Ga0068871_100057919 | Ga0068871_1000579194 | 246 |
| 169 | 3300006931 | Ga0097620_100002993 | Ga0097620_10000299312 | 246 |
| 170 | 3300009177 | Ga0105248_10115363 | Ga0105248_101153633 | 246 |
| 171 | 3300013105 | Ga0157369_10051814 | Ga0157369_100518143 | 246 |
| 172 | 3300013306 | Ga0163162_10193449 | Ga0163162_101934492 | 246 |
| 173 | 3300014325 | Ga0163163_10004818 | Ga0163163_1000481811 | 246 |
| 174 | 3300025899 | Ga0207642_10092999 | Ga0207642_100929992 | 246 |
| 175 | 3300025903 | Ga0207680_10047487 | Ga0207680_100474873 | 246 |
| 176 | 3300025907 | Ga0207645_10026627 | Ga0207645_100266275 | 246 |
| 177 | 3300025921 | Ga0207652_10079971 | Ga0207652_100799712 | 246 |
| 178 | 3300025926 | Ga0207659_10001360 | Ga0207659_100013607 | 246 |
| 179 | 3300025931 | Ga0207644_10003477 | Ga0207644_100034779 | 246 |
| 180 | 3300025936 | Ga0207670_10006012 | Ga0207670_100060124 | 246 |
| 181 | 3300025941 | Ga0207711_10411695 | Ga0207711_104116952 | 246 |
| 182 | 3300025986 | Ga0207658_10025918 | Ga0207658_100259185 | 246 |
| 183 | 3300026035 | Ga0207703_10002292 | Ga0207703_100022923 | 246 |
| 184 | 3300026088 | Ga0207641_10001486 | Ga0207641_1000148613 | 246 |
| 185 | 3300026089 | Ga0207648_10285860 | Ga0207648_102858602 | 246 |
| 186 | 3300026095 | Ga0207676_10002421 | Ga0207676_100024217 | 246 |
| 187 | 3300026142 | Ga0207698_10153243 | Ga0207698_101532432 | 246 |
| 188 | 3300048907 | Ga0496104_0674134 | Ga0496104_0674134_62_847 | 246 |
| 189 | 3300048909 | Ga0496106_0079115 | Ga0496106_0079115_580_1365 | 246 |
| 190 | 3300048912 | Ga0496109_0043237 | Ga0496109_0043237_1106_1891 | 246 |
| 191 | 3300048913 | Ga0496110_0283722 | Ga0496110_0283722_686_1471 | 246 |
| 192 | 3300005331 | Ga0070670_100052202 | Ga0070670_1000522025 | 247 |
| 193 | 3300039438 | Ga0436360_0220478 | Ga0436360_0220478_189_944 | 249 |
| 194 | 3300048904 | Ga0496101_0679824 | Ga0496101_0679824_22_771 | 249 |
| 195 | 3300005331 | Ga0070670_100274822 | Ga0070670_1002748222 | 250 |
| 196 | 3300005539 | Ga0068853_100217667 | Ga0068853_1002176672 | 250 |
| 197 | 3300006881 | Ga0068865_100152883 | Ga0068865_1001528833 | 250 |
| 198 | 3300014326 | Ga0157380_10455955 | Ga0157380_104559552 | 250 |
| 199 | 3300017792 | Ga0163161_10216482 | Ga0163161_102164821 | 250 |
| 200 | 3300025931 | Ga0207644_10515210 | Ga0207644_105152101 | 250 |
| 201 | 3300025937 | Ga0207669_10049274 | Ga0207669_100492743 | 250 |
| 202 | 3300025941 | Ga0207711_10400896 | Ga0207711_104008962 | 250 |
| 203 | 3300025972 | Ga0207668_10190862 | Ga0207668_101908622 | 250 |
| 204 | 3300026089 | Ga0207648_10088386 | Ga0207648_100883864 | 250 |
| 205 | 3300028380 | Ga0268265_10126967 | Ga0268265_101269673 | 250 |
| 206 | 3300046471 | Ga0495650_0000194 | Ga0495650_0000194_35092_35874 | 250 |
| 207 | 3300041503 | Ga0451847_0461108 | Ga0451847_0461108_56_817 | 251 |
| 208 | 3300046459 | Ga0495629_0054326 | Ga0495629_0054326_55_816 | 251 |
| 209 | 3300053148 | Ga0500590_004048 | Ga0500590_004048_2922_3683 | 251 |
| 210 | 3300039450 | Ga0436363_1091328 | Ga0436363_1091328_233_1012 | 252 |
| 211 | 3300045051 | Ga0451576_0025457 | Ga0451576_0025457_3923_4705 | 252 |
| 212 | iso_pu_bacteria | 2953994433 | 2953996336 | 252 |
| 213 | iso_pu_bacteria | 2767802442 | 2770195882 | 253 |
| 214 | iso_pu_bacteria | 2775506902 | 2776269411 | 253 |
| 215 | iso_pu_bacteria | 2775506904 | 2776282341 | 253 |
| 216 | iso_pu_bacteria | 2513237088 | 2513598224 | 254 |
| 217 | iso_pu_bacteria | 2515154114 | 2515646586 | 254 |
| 218 | iso_pu_bacteria | 2582581283 | 2585165055 | 254 |
| 219 | iso_pu_bacteria | 8024486573 | 8024488839 | 254 |
| 220 | iso_pu_bacteria | 8046767195 | 8046774800 | 254 |
| 221 | 3300005336 | Ga0070680_100060995 | Ga0070680_1000609953 | 255 |
| 222 | 3300005345 | Ga0070692_10010322 | Ga0070692_100103222 | 255 |
| 223 | 3300005347 | Ga0070668_100002930 | Ga0070668_10000293012 | 255 |
| 224 | 3300005353 | Ga0070669_100000639 | Ga0070669_1000006397 | 255 |
| 225 | 3300005441 | Ga0070700_100002078 | Ga0070700_1000020786 | 255 |
| 226 | 3300005444 | Ga0070694_100087105 | Ga0070694_1000871052 | 255 |
| 227 | 3300005459 | Ga0068867_100000275 | Ga0068867_1000002752 | 255 |
| 228 | 3300005543 | Ga0070672_100333406 | Ga0070672_1003334062 | 255 |
| 229 | 3300005618 | Ga0068864_100019783 | Ga0068864_1000197832 | 255 |
| 230 | 3300005719 | Ga0068861_100004038 | Ga0068861_1000040385 | 255 |
| 231 | 3300005844 | Ga0068862_100007003 | Ga0068862_1000070039 | 255 |
| 232 | 3300006844 | Ga0075428_100302655 | Ga0075428_1003026552 | 255 |
| 233 | 3300009094 | Ga0111539_10028072 | Ga0111539_100280725 | 255 |
| 234 | 3300009148 | Ga0105243_10002331 | Ga0105243_100023317 | 255 |
| 235 | 3300009553 | Ga0105249_10003043 | Ga0105249_1000304312 | 255 |
| 236 | 3300013306 | Ga0163162_10322882 | Ga0163162_103228822 | 255 |
| 237 | 3300014326 | Ga0157380_10008406 | Ga0157380_100084064 | 255 |
| 238 | 3300025917 | Ga0207660_10045654 | Ga0207660_100456543 | 255 |
| 239 | 3300025923 | Ga0207681_10001443 | Ga0207681_1000144310 | 255 |
| 240 | 3300025935 | Ga0207709_10003308 | Ga0207709_100033088 | 255 |
| 241 | 3300025940 | Ga0207691_10049616 | Ga0207691_100496163 | 255 |
| 242 | 3300025961 | Ga0207712_10132703 | Ga0207712_101327032 | 255 |
| 243 | 3300025972 | Ga0207668_10002130 | Ga0207668_100021302 | 255 |
| 244 | 3300026075 | Ga0207708_10000560 | Ga0207708_100005607 | 255 |
| 245 | 3300026089 | Ga0207648_10001209 | Ga0207648_100012097 | 255 |
| 246 | 3300026118 | Ga0207675_100001008 | Ga0207675_10000100814 | 255 |
| 247 | 3300027907 | Ga0207428_10170995 | Ga0207428_101709952 | 255 |
| 248 | 3300028380 | Ga0268265_10000728 | Ga0268265_1000072819 | 255 |
| 249 | 3300041413 | Ga0439465_0001164 | Ga0439465_0001164_4443_5279 | 255 |
| 250 | 3300048927 | Ga0496124_0000315 | Ga0496124_0000315_33801_34577 | 255 |
| 251 | 3300050511 | nmdc:mga08y16_375153_c1 | nmdc:mga08y16_375153_c1_535_1305 | 255 |
| 252 | 3300005985 | Ga0081539_10070877 | Ga0081539_100708771 | 256 |
| 253 | 3300025949 | Ga0207667_10063675 | Ga0207667_100636752 | 256 |
| 254 | 3300025960 | Ga0207651_10731312 | Ga0207651_107313121 | 256 |
| 255 | 3300025981 | Ga0207640_10483660 | Ga0207640_104836601 | 256 |
| 256 | 3300037471 | Ga0395905_0112475 | Ga0395905_0112475_1719_2492 | 256 |
| 257 | 3300060353 | Ga0501082_0606628 | Ga0501082_0606628_20_790 | 256 |
| 258 | 3300002070 | JGI24750J21931_1008019 | JGI24750J21931_10080192 | 257 |
| 259 | 3300002070 | JGI24750J21931_1008042 | JGI24750J21931_10080422 | 257 |
| 260 | 3300003771 | Ga0055526_1003172 | Ga0055526_10031724 | 257 |
| 261 | 3300003911 | JGI25405J52794_10002173 | JGI25405J52794_100021732 | 257 |
| 262 | 3300003911 | JGI25405J52794_10026052 | JGI25405J52794_100260521 | 257 |
| 263 | 3300005331 | Ga0070670_100004483 | Ga0070670_1000044836 | 257 |
| 264 | 3300005331 | Ga0070670_100134931 | Ga0070670_1001349313 | 257 |
| 265 | 3300005334 | Ga0068869_100165283 | Ga0068869_1001652832 | 257 |
| 266 | 3300005336 | Ga0070680_100001629 | Ga0070680_10000162912 | 257 |
| 267 | 3300005336 | Ga0070680_100192066 | Ga0070680_1001920662 | 257 |
| 268 | 3300005338 | Ga0068868_100212160 | Ga0068868_1002121602 | 257 |
| 269 | 3300005340 | Ga0070689_100020981 | Ga0070689_1000209814 | 257 |
| 270 | 3300005341 | Ga0070691_10133501 | Ga0070691_101335011 | 257 |
| 271 | 3300005344 | Ga0070661_100007395 | Ga0070661_1000073953 | 257 |
| 272 | 3300005353 | Ga0070669_100044328 | Ga0070669_1000443282 | 257 |
| 273 | 3300005355 | Ga0070671_100099596 | Ga0070671_1000995963 | 257 |
| 274 | 3300005364 | Ga0070673_100300015 | Ga0070673_1003000152 | 257 |
| 275 | 3300005365 | Ga0070688_100045737 | Ga0070688_1000457373 | 257 |
| 276 | 3300005367 | Ga0070667_100246802 | Ga0070667_1002468023 | 257 |
| 277 | 3300005367 | Ga0070667_100895894 | Ga0070667_1008958941 | 257 |
| 278 | 3300005436 | Ga0070713_100031008 | Ga0070713_1000310083 | 257 |
| 279 | 3300005436 | Ga0070713_100313215 | Ga0070713_1003132152 | 257 |
| 280 | 3300005437 | Ga0070710_10005027 | Ga0070710_100050277 | 257 |
| 281 | 3300005438 | Ga0070701_10122802 | Ga0070701_101228022 | 257 |
| 282 | 3300005439 | Ga0070711_100054396 | Ga0070711_1000543962 | 257 |
| 283 | 3300005439 | Ga0070711_100226113 | Ga0070711_1002261132 | 257 |
| 284 | 3300005439 | Ga0070711_100443941 | Ga0070711_1004439411 | 257 |
| 285 | 3300005441 | Ga0070700_100002787 | Ga0070700_1000027877 | 257 |
| 286 | 3300005455 | Ga0070663_100116672 | Ga0070663_1001166723 | 257 |
| 287 | 3300005456 | Ga0070678_100012686 | Ga0070678_1000126863 | 257 |
| 288 | 3300005457 | Ga0070662_100031178 | Ga0070662_1000311783 | 257 |
| 289 | 3300005458 | Ga0070681_10044420 | Ga0070681_100444204 | 257 |
| 290 | 3300005458 | Ga0070681_10070252 | Ga0070681_100702524 | 257 |
| 291 | 3300005458 | Ga0070681_10114590 | Ga0070681_101145901 | 257 |
| 292 | 3300005459 | Ga0068867_100070292 | Ga0068867_1000702923 | 257 |
| 293 | 3300005466 | Ga0070685_10036946 | Ga0070685_100369461 | 257 |
| 294 | 3300005518 | Ga0070699_100011671 | Ga0070699_1000116718 | 257 |
| 295 | 3300005518 | Ga0070699_100200048 | Ga0070699_1002000482 | 257 |
| 296 | 3300005530 | Ga0070679_100081043 | Ga0070679_1000810432 | 257 |
| 297 | 3300005535 | Ga0070684_100072913 | Ga0070684_1000729132 | 257 |
| 298 | 3300005535 | Ga0070684_100105393 | Ga0070684_1001053933 | 257 |
| 299 | 3300005544 | Ga0070686_100090637 | Ga0070686_1000906372 | 257 |
| 300 | 3300005545 | Ga0070695_100414046 | Ga0070695_1004140461 | 257 |
| 301 | 3300005546 | Ga0070696_100200663 | Ga0070696_1002006632 | 257 |
| 302 | 3300005547 | Ga0070693_100277672 | Ga0070693_1002776721 | 257 |
| 303 | 3300005548 | Ga0070665_100354621 | Ga0070665_1003546211 | 257 |
| 304 | 3300005549 | Ga0070704_100273409 | Ga0070704_1002734092 | 257 |
| 305 | 3300005563 | Ga0068855_100174712 | Ga0068855_1001747123 | 257 |
| 306 | 3300005564 | Ga0070664_100475443 | Ga0070664_1004754432 | 257 |
| 307 | 3300005577 | Ga0068857_100144922 | Ga0068857_1001449222 | 257 |
| 308 | 3300005578 | Ga0068854_100197990 | Ga0068854_1001979902 | 257 |
| 309 | 3300005614 | Ga0068856_100364433 | Ga0068856_1003644332 | 257 |
| 310 | 3300005616 | Ga0068852_100103802 | Ga0068852_1001038023 | 257 |
| 311 | 3300005618 | Ga0068864_100122126 | Ga0068864_1001221262 | 257 |
| 312 | 3300005834 | Ga0068851_10128435 | Ga0068851_101284351 | 257 |
| 313 | 3300005841 | Ga0068863_100299546 | Ga0068863_1002995462 | 257 |
| 314 | 3300005841 | Ga0068863_100551394 | Ga0068863_1005513942 | 257 |
| 315 | 3300005842 | Ga0068858_100056320 | Ga0068858_1000563202 | 257 |
| 316 | 3300005843 | Ga0068860_100014779 | Ga0068860_1000147796 | 257 |
| 317 | 3300005937 | Ga0081455_10001860 | Ga0081455_1000186010 | 257 |
| 318 | 3300005937 | Ga0081455_10009744 | Ga0081455_100097449 | 257 |
| 319 | 3300005937 | Ga0081455_10031798 | Ga0081455_100317984 | 257 |
| 320 | 3300005981 | Ga0081538_10098511 | Ga0081538_100985111 | 257 |
| 321 | 3300005983 | Ga0081540_1009789 | Ga0081540_10097892 | 257 |
| 322 | 3300006028 | Ga0070717_10060335 | Ga0070717_100603352 | 257 |
| 323 | 3300006038 | Ga0075365_10086667 | Ga0075365_100866672 | 257 |
| 324 | 3300006038 | Ga0075365_10243504 | Ga0075365_102435042 | 257 |
| 325 | 3300006051 | Ga0075364_10088814 | Ga0075364_100888141 | 257 |
| 326 | 3300006051 | Ga0075364_10174241 | Ga0075364_101742412 | 257 |
| 327 | 3300006173 | Ga0070716_100078273 | Ga0070716_1000782732 | 257 |
| 328 | 3300006175 | Ga0070712_100020375 | Ga0070712_1000203756 | 257 |
| 329 | 3300006175 | Ga0070712_100320342 | Ga0070712_1003203422 | 257 |
| 330 | 3300006178 | Ga0075367_10128398 | Ga0075367_101283981 | 257 |
| 331 | 3300006237 | Ga0097621_100019564 | Ga0097621_1000195645 | 257 |
| 332 | 3300006358 | Ga0068871_100062414 | Ga0068871_1000624143 | 257 |
| 333 | 3300006358 | Ga0068871_100078716 | Ga0068871_1000787162 | 257 |
| 334 | 3300006844 | Ga0075428_100040725 | Ga0075428_1000407256 | 257 |
| 335 | 3300006844 | Ga0075428_100199872 | Ga0075428_1001998723 | 257 |
| 336 | 3300006844 | Ga0075428_100298902 | Ga0075428_1002989022 | 257 |
| 337 | 3300006846 | Ga0075430_100007044 | Ga0075430_1000070449 | 257 |
| 338 | 3300006846 | Ga0075430_100035206 | Ga0075430_1000352063 | 257 |
| 339 | 3300006846 | Ga0075430_100063617 | Ga0075430_1000636174 | 257 |
| 340 | 3300006847 | Ga0075431_100013070 | Ga0075431_1000130709 | 257 |
| 341 | 3300006847 | Ga0075431_100014686 | Ga0075431_1000146864 | 257 |
| 342 | 3300006847 | Ga0075431_100063587 | Ga0075431_1000635874 | 257 |
| 343 | 3300006847 | Ga0075431_100242051 | Ga0075431_1002420513 | 257 |
| 344 | 3300006852 | Ga0075433_10151262 | Ga0075433_101512622 | 257 |
| 345 | 3300006852 | Ga0075433_10430911 | Ga0075433_104309113 | 257 |
| 346 | 3300006871 | Ga0075434_100086729 | Ga0075434_1000867294 | 257 |
| 347 | 3300006880 | Ga0075429_100242406 | Ga0075429_1002424062 | 257 |
| 348 | 3300006881 | Ga0068865_100003957 | Ga0068865_1000039577 | 257 |
| 349 | 3300007788 | Ga0099795_10011044 | Ga0099795_100110442 | 257 |
| 350 | 3300009093 | Ga0105240_10031660 | Ga0105240_100316607 | 257 |
| 351 | 3300009093 | Ga0105240_10331535 | Ga0105240_103315352 | 257 |
| 352 | 3300009094 | Ga0111539_10062101 | Ga0111539_100621014 | 257 |
| 353 | 3300009094 | Ga0111539_10072021 | Ga0111539_100720213 | 257 |
| 354 | 3300009094 | Ga0111539_10130516 | Ga0111539_101305163 | 257 |
| 355 | 3300009098 | Ga0105245_10046360 | Ga0105245_100463602 | 257 |
| 356 | 3300009098 | Ga0105245_10218523 | Ga0105245_102185232 | 257 |
| 357 | 3300009101 | Ga0105247_10148326 | Ga0105247_101483262 | 257 |
| 358 | 3300009101 | Ga0105247_10215435 | Ga0105247_102154352 | 257 |
| 359 | 3300009147 | Ga0114129_10011942 | Ga0114129_100119424 | 257 |
| 360 | 3300009147 | Ga0114129_10022955 | Ga0114129_100229557 | 257 |
| 361 | 3300009147 | Ga0114129_10061066 | Ga0114129_100610662 | 257 |
| 362 | 3300009147 | Ga0114129_10061685 | Ga0114129_100616855 | 257 |
| 363 | 3300009148 | Ga0105243_10026946 | Ga0105243_100269463 | 257 |
| 364 | 3300009176 | Ga0105242_10447400 | Ga0105242_104474002 | 257 |
| 365 | 3300009177 | Ga0105248_10069700 | Ga0105248_100697004 | 257 |
| 366 | 3300009177 | Ga0105248_10141427 | Ga0105248_101414273 | 257 |
| 367 | 3300009177 | Ga0105248_10421495 | Ga0105248_104214952 | 257 |
| 368 | 3300009177 | Ga0105248_11364523 | Ga0105248_113645231 | 257 |
| 369 | 3300009553 | Ga0105249_10162864 | Ga0105249_101628643 | 257 |
| 370 | 3300010375 | Ga0105239_10118340 | Ga0105239_101183402 | 257 |
| 371 | 3300010375 | Ga0105239_10199484 | Ga0105239_101994842 | 257 |
| 372 | 3300010375 | Ga0105239_10764368 | Ga0105239_107643681 | 257 |
| 373 | 3300011119 | Ga0105246_10020051 | Ga0105246_100200514 | 257 |
| 374 | 3300013104 | Ga0157370_10004330 | Ga0157370_1000433013 | 257 |
| 375 | 3300013105 | Ga0157369_10061545 | Ga0157369_100615451 | 257 |
| 376 | 3300013296 | Ga0157374_10126224 | Ga0157374_101262241 | 257 |
| 377 | 3300013296 | Ga0157374_10158265 | Ga0157374_101582652 | 257 |
| 378 | 3300013296 | Ga0157374_10281164 | Ga0157374_102811642 | 257 |
| 379 | 3300013297 | Ga0157378_10046583 | Ga0157378_100465833 | 257 |
| 380 | 3300013297 | Ga0157378_10095877 | Ga0157378_100958771 | 257 |
| 381 | 3300013306 | Ga0163162_10335457 | Ga0163162_103354571 | 257 |
| 382 | 3300013306 | Ga0163162_10341367 | Ga0163162_103413672 | 257 |
| 383 | 3300013306 | Ga0163162_10354834 | Ga0163162_103548342 | 257 |
| 384 | 3300013306 | Ga0163162_10401034 | Ga0163162_104010342 | 257 |
| 385 | 3300013308 | Ga0157375_10181975 | Ga0157375_101819752 | 257 |
| 386 | 3300013308 | Ga0157375_10292498 | Ga0157375_102924982 | 257 |
| 387 | 3300013308 | Ga0157375_10428176 | Ga0157375_104281763 | 257 |
| 388 | 3300014325 | Ga0163163_10027715 | Ga0163163_100277152 | 257 |
| 389 | 3300014326 | Ga0157380_10067001 | Ga0157380_100670012 | 257 |
| 390 | 3300014968 | Ga0157379_10072004 | Ga0157379_100720045 | 257 |
| 391 | 3300014968 | Ga0157379_10326605 | Ga0157379_103266052 | 257 |
| 392 | 3300014969 | Ga0157376_10439344 | Ga0157376_104393442 | 257 |
| 393 | 3300021361 | Ga0213872_10000279 | Ga0213872_1000027936 | 257 |
| 394 | 3300021361 | Ga0213872_10000502 | Ga0213872_1000050227 | 257 |
| 395 | 3300021361 | Ga0213872_10002578 | Ga0213872_100025788 | 257 |
| 396 | 3300021361 | Ga0213872_10028105 | Ga0213872_100281051 | 257 |
| 397 | 3300021384 | Ga0213876_10232443 | Ga0213876_102324431 | 257 |
| 398 | 3300025233 | Ga0209437_105260 | Ga0209437_1052602 | 257 |
| 399 | 3300025246 | Ga0209646_1000072 | Ga0209646_100007225 | 257 |
| 400 | 3300025295 | Ga0209564_1000072 | Ga0209564_1000072272 | 257 |
| 401 | 3300025898 | Ga0207692_10057340 | Ga0207692_100573402 | 257 |
| 402 | 3300025899 | Ga0207642_10152269 | Ga0207642_101522692 | 257 |
| 403 | 3300025900 | Ga0207710_10005521 | Ga0207710_100055214 | 257 |
| 404 | 3300025901 | Ga0207688_10002037 | Ga0207688_1000203710 | 257 |
| 405 | 3300025904 | Ga0207647_10136734 | Ga0207647_101367341 | 257 |
| 406 | 3300025905 | Ga0207685_10003238 | Ga0207685_100032384 | 257 |
| 407 | 3300025906 | Ga0207699_10024177 | Ga0207699_100241771 | 257 |
| 408 | 3300025907 | Ga0207645_10023307 | Ga0207645_100233075 | 257 |
| 409 | 3300025907 | Ga0207645_10301151 | Ga0207645_103011511 | 257 |
| 410 | 3300025908 | Ga0207643_10000872 | Ga0207643_100008728 | 257 |
| 411 | 3300025910 | Ga0207684_10059972 | Ga0207684_100599722 | 257 |
| 412 | 3300025912 | Ga0207707_10000993 | Ga0207707_1000099312 | 257 |
| 413 | 3300025912 | Ga0207707_10007140 | Ga0207707_100071409 | 257 |
| 414 | 3300025912 | Ga0207707_10040679 | Ga0207707_100406792 | 257 |
| 415 | 3300025912 | Ga0207707_10162531 | Ga0207707_101625312 | 257 |
| 416 | 3300025913 | Ga0207695_10213503 | Ga0207695_102135032 | 257 |
| 417 | 3300025915 | Ga0207693_10024667 | Ga0207693_100246672 | 257 |
| 418 | 3300025916 | Ga0207663_10170581 | Ga0207663_101705812 | 257 |
| 419 | 3300025917 | Ga0207660_10166533 | Ga0207660_101665332 | 257 |
| 420 | 3300025918 | Ga0207662_10096112 | Ga0207662_100961122 | 257 |
| 421 | 3300025919 | Ga0207657_10030389 | Ga0207657_100303894 | 257 |
| 422 | 3300025920 | Ga0207649_10006622 | Ga0207649_100066227 | 257 |
| 423 | 3300025921 | Ga0207652_10010460 | Ga0207652_100104606 | 257 |
| 424 | 3300025921 | Ga0207652_10061698 | Ga0207652_100616982 | 257 |
| 425 | 3300025925 | Ga0207650_10002222 | Ga0207650_100022226 | 257 |
| 426 | 3300025925 | Ga0207650_10006091 | Ga0207650_100060915 | 257 |
| 427 | 3300025925 | Ga0207650_10108529 | Ga0207650_101085293 | 257 |
| 428 | 3300025926 | Ga0207659_10190888 | Ga0207659_101908881 | 257 |
| 429 | 3300025927 | Ga0207687_10248115 | Ga0207687_102481152 | 257 |
| 430 | 3300025928 | Ga0207700_10050938 | Ga0207700_100509384 | 257 |
| 431 | 3300025928 | Ga0207700_10082293 | Ga0207700_100822932 | 257 |
| 432 | 3300025928 | Ga0207700_10482378 | Ga0207700_104823781 | 257 |
| 433 | 3300025931 | Ga0207644_10111199 | Ga0207644_101111992 | 257 |
| 434 | 3300025932 | Ga0207690_10207707 | Ga0207690_102077072 | 257 |
| 435 | 3300025933 | Ga0207706_10006344 | Ga0207706_100063447 | 257 |
| 436 | 3300025939 | Ga0207665_10006295 | Ga0207665_100062953 | 257 |
| 437 | 3300025940 | Ga0207691_10025399 | Ga0207691_100253996 | 257 |
| 438 | 3300025941 | Ga0207711_10122103 | Ga0207711_101221032 | 257 |
| 439 | 3300025941 | Ga0207711_10340269 | Ga0207711_103402692 | 257 |
| 440 | 3300025942 | Ga0207689_10044726 | Ga0207689_100447262 | 257 |
| 441 | 3300025944 | Ga0207661_10030482 | Ga0207661_100304827 | 257 |
| 442 | 3300025944 | Ga0207661_10034410 | Ga0207661_100344102 | 257 |
| 443 | 3300025949 | Ga0207667_10557931 | Ga0207667_105579312 | 257 |
| 444 | 3300025960 | Ga0207651_10497188 | Ga0207651_104971882 | 257 |
| 445 | 3300025961 | Ga0207712_10271093 | Ga0207712_102710932 | 257 |
| 446 | 3300025972 | Ga0207668_10370634 | Ga0207668_103706341 | 257 |
| 447 | 3300025981 | Ga0207640_10049413 | Ga0207640_100494134 | 257 |
| 448 | 3300026067 | Ga0207678_10005238 | Ga0207678_100052388 | 257 |
| 449 | 3300026067 | Ga0207678_10073617 | Ga0207678_100736172 | 257 |
| 450 | 3300026067 | Ga0207678_10609596 | Ga0207678_106095962 | 257 |
| 451 | 3300026075 | Ga0207708_10060105 | Ga0207708_100601055 | 257 |
| 452 | 3300026089 | Ga0207648_10026444 | Ga0207648_100264445 | 257 |
| 453 | 3300026095 | Ga0207676_10714313 | Ga0207676_107143131 | 257 |
| 454 | 3300026118 | Ga0207675_100059299 | Ga0207675_1000592992 | 257 |
| 455 | 3300026121 | Ga0207683_10007701 | Ga0207683_100077011 | 257 |
| 456 | 3300026121 | Ga0207683_10019753 | Ga0207683_100197534 | 257 |
| 457 | 3300027907 | Ga0207428_10132546 | Ga0207428_101325461 | 257 |
| 458 | 3300031250 | Ga0265331_10000002 | Ga0265331_1000000249 | 257 |
| 459 | 3300031250 | Ga0265331_10000355 | Ga0265331_1000035530 | 257 |
| 460 | 3300031251 | Ga0265327_10000033 | Ga0265327_1000003348 | 257 |
| 461 | 3300031711 | Ga0265314_10003660 | Ga0265314_100036603 | 257 |
| 462 | 3300035111 | Ga0373923_0097413 | Ga0373923_0097413_410_1189 | 257 |
| 463 | 3300035172 | Ga0373955_0259703 | Ga0373955_0259703_166_945 | 257 |
| 464 | 3300035691 | Ga0373931_0189881 | Ga0373931_0189881_289_1068 | 257 |
| 465 | 3300035692 | Ga0373935_0140496 | Ga0373935_0140496_619_1398 | 257 |
| 466 | 3300037068 | Ga0373925_0031236 | Ga0373925_0031236_1974_2753 | 257 |
| 467 | 3300037312 | Ga0395899_0007777 | Ga0395899_0007777_37_819 | 257 |
| 468 | 3300037418 | Ga0395900_0019699 | Ga0395900_0019699_5830_6612 | 257 |
| 469 | 3300037466 | Ga0395898_0462143 | Ga0395898_0462143_190_969 | 257 |
| 470 | 3300038443 | Ga0395901_0007491 | Ga0395901_0007491_10205_10987 | 257 |
| 471 | 3300038443 | Ga0395901_0209231 | Ga0395901_0209231_322_1101 | 257 |
| 472 | 3300039447 | Ga0436361_0032090 | Ga0436361_0032090_8326_9105 | 257 |
| 473 | 3300039447 | Ga0436361_0421236 | Ga0436361_0421236_37_816 | 257 |
| 474 | 3300039447 | Ga0436361_0579013 | Ga0436361_0579013_22342_23121 | 257 |
| 475 | 3300039447 | Ga0436361_0972320 | Ga0436361_0972320_8256_9035 | 257 |
| 476 | 3300039447 | Ga0436361_1044948 | Ga0436361_1044948_2607_3386 | 257 |
| 477 | 3300039450 | Ga0436363_1403698 | Ga0436363_1403698_186_968 | 257 |
| 478 | 3300039453 | Ga0436362_0201408 | Ga0436362_0201408_112_891 | 257 |
| 479 | 3300046457 | Ga0495590_0000006 | Ga0495590_0000006_157296_158075 | 257 |
| 480 | 3300046459 | Ga0495629_0096585 | Ga0495629_0096585_1171_1950 | 257 |
| 481 | 3300046460 | Ga0495638_0000333 | Ga0495638_0000333_49113_49892 | 257 |
| 482 | 3300046471 | Ga0495650_0008058 | Ga0495650_0008058_3272_4051 | 257 |
| 483 | 3300046472 | Ga0495580_0036032 | Ga0495580_0036032_644_1423 | 257 |
| 484 | 3300046476 | Ga0495662_0110605 | Ga0495662_0110605_267_1046 | 257 |
| 485 | 3300046492 | Ga0495585_0112778 | Ga0495585_0112778_163_942 | 257 |
| 486 | 3300046501 | Ga0495607_0001831 | Ga0495607_0001831_12642_13421 | 257 |
| 487 | 3300046506 | Ga0495583_0000475 | Ga0495583_0000475_49281_50060 | 257 |
| 488 | 3300046507 | Ga0495606_0013329 | Ga0495606_0013329_2233_3012 | 257 |
| 489 | 3300046513 | Ga0495616_0088407 | Ga0495616_0088407_446_1225 | 257 |
| 490 | 3300046514 | Ga0495618_0128240 | Ga0495618_0128240_206_985 | 257 |
| 491 | 3300046522 | Ga0495643_0000358 | Ga0495643_0000358_52773_53552 | 257 |
| 492 | 3300046524 | Ga0495648_0000054 | Ga0495648_0000054_150209_150988 | 257 |
| 493 | 3300046526 | Ga0495666_0011471 | Ga0495666_0011471_2199_2978 | 257 |
| 494 | 3300046528 | Ga0495642_0009074 | Ga0495642_0009074_1829_2608 | 257 |
| 495 | 3300046528 | Ga0495642_0122436 | Ga0495642_0122436_122_901 | 257 |
| 496 | 3300046528 | Ga0495642_0178150 | Ga0495642_0178150_60_839 | 257 |
| 497 | 3300046539 | Ga0495621_0054737 | Ga0495621_0054737_529_1308 | 257 |
| 498 | 3300046542 | Ga0495597_0000191 | Ga0495597_0000191_52750_53529 | 257 |
| 499 | 3300046557 | Ga0495622_0000038 | Ga0495622_0000038_8656_9435 | 257 |
| 500 | 3300046558 | Ga0495633_0001301 | Ga0495633_0001301_9352_10131 | 257 |
| 501 | 3300046558 | Ga0495633_0089268 | Ga0495633_0089268_99_878 | 257 |
| 502 | 3300046615 | Ga0495656_0076154 | Ga0495656_0076154_72_851 | 257 |
| 503 | 3300046616 | Ga0495668_0001151 | Ga0495668_0001151_8932_9711 | 257 |
| 504 | 3300046660 | Ga0495625_0000558 | Ga0495625_0000558_4300_5079 | 257 |
| 505 | 3300046681 | Ga0495647_0038760 | Ga0495647_0038760_82_864 | 257 |
| 506 | 3300046684 | Ga0495669_0088311 | Ga0495669_0088311_63_842 | 257 |
| 507 | 3300046684 | Ga0495669_0109852 | Ga0495669_0109852_100_879 | 257 |
| 508 | 3300046694 | Ga0495649_0172884 | Ga0495649_0172884_120_899 | 257 |
| 509 | 3300047315 | Ga0495581_0157408 | Ga0495581_0157408_278_1057 | 257 |
| 510 | 3300047319 | Ga0495674_0267585 | Ga0495674_0267585_529_1308 | 257 |
| 511 | 3300047321 | Ga0495676_0226328 | Ga0495676_0226328_202_981 | 257 |
| 512 | 3300047322 | Ga0495680_0076772 | Ga0495680_0076772_745_1524 | 257 |
| 513 | 3300047323 | Ga0495683_0213944 | Ga0495683_0213944_57_836 | 257 |
| 514 | 3300047443 | Ga0495687_001334 | Ga0495687_001334_8641_9420 | 257 |
| 515 | 3300047443 | Ga0495687_004548 | Ga0495687_004548_5935_6714 | 257 |
| 516 | 3300047471 | Ga0495684_0144589 | Ga0495684_0144589_372_1151 | 257 |
| 517 | 3300047472 | Ga0495686_0270025 | Ga0495686_0270025_77_856 | 257 |
| 518 | 3300047673 | Ga0495593_0197086 | Ga0495593_0197086_220_999 | 257 |
| 519 | 3300048089 | Ga0495614_0038867 | Ga0495614_0038867_1169_1948 | 257 |
| 520 | 3300048089 | Ga0495614_0058997 | Ga0495614_0058997_840_1619 | 257 |
| 521 | 3300048903 | Ga0496100_0242447 | Ga0496100_0242447_287_1066 | 257 |
| 522 | 3300048904 | Ga0496101_0023566 | Ga0496101_0023566_1761_2540 | 257 |
| 523 | 3300048904 | Ga0496101_0061606 | Ga0496101_0061606_749_1528 | 257 |
| 524 | 3300048904 | Ga0496101_0114106 | Ga0496101_0114106_126_905 | 257 |
| 525 | 3300048904 | Ga0496101_0155871 | Ga0496101_0155871_218_994 | 257 |
| 526 | 3300048905 | Ga0496102_0032411 | Ga0496102_0032411_2732_3508 | 257 |
| 527 | 3300048905 | Ga0496102_0034017 | Ga0496102_0034017_1159_1938 | 257 |
| 528 | 3300048905 | Ga0496102_0137229 | Ga0496102_0137229_381_1160 | 257 |
| 529 | 3300048906 | Ga0496103_0027729 | Ga0496103_0027729_2374_3150 | 257 |
| 530 | 3300048906 | Ga0496103_0058180 | Ga0496103_0058180_641_1420 | 257 |
| 531 | 3300048906 | Ga0496103_0263325 | Ga0496103_0263325_136_915 | 257 |
| 532 | 3300048907 | Ga0496104_0003625 | Ga0496104_0003625_11411_12190 | 257 |
| 533 | 3300048907 | Ga0496104_0003891 | Ga0496104_0003891_649_1428 | 257 |
| 534 | 3300048907 | Ga0496104_0049441 | Ga0496104_0049441_583_1362 | 257 |
| 535 | 3300048908 | Ga0496105_0001322 | Ga0496105_0001322_6606_7385 | 257 |
| 536 | 3300048908 | Ga0496105_0036542 | Ga0496105_0036542_621_1400 | 257 |
| 537 | 3300048909 | Ga0496106_0113686 | Ga0496106_0113686_731_1510 | 257 |
| 538 | 3300048910 | Ga0496107_0002458 | Ga0496107_0002458_8541_9320 | 257 |
| 539 | 3300048910 | Ga0496107_0037478 | Ga0496107_0037478_1428_2207 | 257 |
| 540 | 3300048911 | Ga0496108_0002238 | Ga0496108_0002238_838_1617 | 257 |
| 541 | 3300048912 | Ga0496109_0002809 | Ga0496109_0002809_9870_10649 | 257 |
| 542 | 3300048912 | Ga0496109_0031863 | Ga0496109_0031863_3141_3920 | 257 |
| 543 | 3300048913 | Ga0496110_0024415 | Ga0496110_0024415_2509_3288 | 257 |
| 544 | 3300048913 | Ga0496110_0065317 | Ga0496110_0065317_377_1156 | 257 |
| 545 | 3300048914 | Ga0496111_0038968 | Ga0496111_0038968_201_980 | 257 |
| 546 | 3300048914 | Ga0496111_0124351 | Ga0496111_0124351_89_868 | 257 |
| 547 | 3300048914 | Ga0496111_0137848 | Ga0496111_0137848_1004_1783 | 257 |
| 548 | 3300048915 | Ga0496112_0033514 | Ga0496112_0033514_2566_3345 | 257 |
| 549 | 3300048915 | Ga0496112_0214935 | Ga0496112_0214935_378_1154 | 257 |
| 550 | 3300048916 | Ga0496113_0001266 | Ga0496113_0001266_1672_2451 | 257 |
| 551 | 3300048916 | Ga0496113_0059870 | Ga0496113_0059870_1987_2766 | 257 |
| 552 | 3300048916 | Ga0496113_0152766 | Ga0496113_0152766_340_1119 | 257 |
| 553 | 3300048917 | Ga0496114_0360228 | Ga0496114_0360228_373_1152 | 257 |
| 554 | 3300048918 | Ga0496115_0022583 | Ga0496115_0022583_2538_3317 | 257 |
| 555 | 3300049459 | Ga0495678_003848 | Ga0495678_003848_1728_2507 | 257 |
| 556 | 3300049459 | Ga0495678_005316 | Ga0495678_005316_1514_2293 | 257 |
| 557 | 3300049571 | Ga0501034_0002928 | Ga0501034_0002928_5314_6096 | 257 |
| 558 | 3300049571 | Ga0501034_0090019 | Ga0501034_0090019_783_1565 | 257 |
| 559 | 3300049580 | Ga0501046_0031358 | Ga0501046_0031358_1888_2667 | 257 |
| 560 | 3300049584 | Ga0501068_0034944 | Ga0501068_0034944_430_1212 | 257 |
| 561 | 3300049584 | Ga0501068_0195709 | Ga0501068_0195709_293_1072 | 257 |
| 562 | 3300049741 | Ga0501079_0369281 | Ga0501079_0369281_232_1011 | 257 |
| 563 | 3300049743 | Ga0501081_0112261 | Ga0501081_0112261_76_855 | 257 |
| 564 | 3300050489 | nmdc:mga03683_83289_c1 | nmdc:mga03683_83289_c1_497_1276 | 257 |
| 565 | 3300050492 | nmdc:mga0yw44_30075_c1 | nmdc:mga0yw44_30075_c1_569_1348 | 257 |
| 566 | 3300050492 | nmdc:mga0yw44_62260_c1 | nmdc:mga0yw44_62260_c1_114_893 | 257 |
| 567 | 3300050494 | nmdc:mga06z11_166450_c1 | nmdc:mga06z11_166450_c1_99_881 | 257 |
| 568 | 3300050494 | nmdc:mga06z11_223427_c1 | nmdc:mga06z11_223427_c1_279_1058 | 257 |
| 569 | 3300050494 | nmdc:mga06z11_43777_c1 | nmdc:mga06z11_43777_c1_1217_1996 | 257 |
| 570 | 3300050496 | nmdc:mga07m45_238953_c1 | nmdc:mga07m45_238953_c1_116_895 | 257 |
| 571 | 3300050507 | nmdc:mga05p37_1011036_c1 | nmdc:mga05p37_1011036_c1_40_819 | 257 |
| 572 | 3300050507 | nmdc:mga05p37_25897_c1 | nmdc:mga05p37_25897_c1_5178_5957 | 257 |
| 573 | 3300050507 | nmdc:mga05p37_44460_c1 | nmdc:mga05p37_44460_c1_916_1695 | 257 |
| 574 | 3300050507 | nmdc:mga05p37_96346_c1 | nmdc:mga05p37_96346_c1_1601_2380 | 257 |
| 575 | 3300050508 | nmdc:mga09592_128149_c1 | nmdc:mga09592_128149_c1_792_1571 | 257 |
| 576 | 3300050509 | nmdc:mga0qj67_15707_c1 | nmdc:mga0qj67_15707_c1_2244_3023 | 257 |
| 577 | 3300050509 | nmdc:mga0qj67_256687_c1 | nmdc:mga0qj67_256687_c1_134_913 | 257 |
| 578 | 3300050509 | nmdc:mga0qj67_42590_c1 | nmdc:mga0qj67_42590_c1_612_1391 | 257 |
| 579 | 3300050509 | nmdc:mga0qj67_48788_c1 | nmdc:mga0qj67_48788_c1_1104_1883 | 257 |
| 580 | 3300050510 | nmdc:mga06r32_173683_c1 | nmdc:mga06r32_173683_c1_706_1485 | 257 |
| 581 | 3300050510 | nmdc:mga06r32_219085_c1 | nmdc:mga06r32_219085_c1_25_804 | 257 |
| 582 | 3300050510 | nmdc:mga06r32_25454_c1 | nmdc:mga06r32_25454_c1_1903_2682 | 257 |
| 583 | 3300050510 | nmdc:mga06r32_30438_c1 | nmdc:mga06r32_30438_c1_1515_2294 | 257 |
| 584 | 3300050511 | nmdc:mga08y16_152775_c1 | nmdc:mga08y16_152775_c1_357_1136 | 257 |
| 585 | 3300050511 | nmdc:mga08y16_286908_c1 | nmdc:mga08y16_286908_c1_811_1590 | 257 |
| 586 | 3300050511 | nmdc:mga08y16_84713_c1 | nmdc:mga08y16_84713_c1_2379_3158 | 257 |
| 587 | 3300050512 | nmdc:mga0n895_182762_c1 | nmdc:mga0n895_182762_c1_1119_1898 | 257 |
| 588 | 3300050512 | nmdc:mga0n895_219747_c1 | nmdc:mga0n895_219747_c1_309_1088 | 257 |
| 589 | 3300050512 | nmdc:mga0n895_232339_c1 | nmdc:mga0n895_232339_c1_440_1219 | 257 |
| 590 | 3300050512 | nmdc:mga0n895_94644_c1 | nmdc:mga0n895_94644_c1_714_1493 | 257 |
| 591 | 3300050513 | nmdc:mga0rr50_367324_c1 | nmdc:mga0rr50_367324_c1_118_897 | 257 |
| 592 | 3300050514 | nmdc:mga08x19_310542_c1 | nmdc:mga08x19_310542_c1_254_1033 | 257 |
| 593 | 3300053077 | Ga0495601_0300039 | Ga0495601_0300039_123_902 | 257 |
| 594 | 3300053083 | Ga0495655_0020756 | Ga0495655_0020756_78_857 | 257 |
| 595 | 3300053083 | Ga0495655_0038608 | Ga0495655_0038608_322_1101 | 257 |
| 596 | 3300053085 | Ga0495619_0129091 | Ga0495619_0129091_912_1691 | 257 |
| 597 | 3300053091 | Ga0500647_0099467 | Ga0500647_0099467_517_1299 | 257 |
| 598 | 3300053154 | Ga0500619_000121 | Ga0500619_000121_2310_3089 | 257 |
| 599 | 3300054114 | Ga0501084_0185728 | Ga0501084_0185728_757_1536 | 257 |
| 600 | 3300061734 | Ga0530510_0108414 | Ga0530510_0108414_59_838 | 257 |
| 601 | 3300001990 | JGI24737J22298_10029246 | JGI24737J22298_100292461 | 258 |
| 602 | 3300001991 | JGI24743J22301_10009131 | JGI24743J22301_100091311 | 258 |
| 603 | 3300002070 | JGI24750J21931_1005805 | JGI24750J21931_10058052 | 258 |
| 604 | 3300002075 | JGI24738J21930_10009674 | JGI24738J21930_100096743 | 258 |
| 605 | 3300002076 | JGI24749J21850_1009644 | JGI24749J21850_10096442 | 258 |
| 606 | 3300002459 | JGI24751J29686_10007247 | JGI24751J29686_100072473 | 258 |
| 607 | 3300003308 | Ga0006777J48905_1052058 | Ga0006777J48905_10520581 | 258 |
| 608 | 3300003322 | rootL2_10000128 | rootL2_100001283 | 258 |
| 609 | 3300003322 | rootL2_10096177 | rootL2_100961772 | 258 |
| 610 | 3300003544 | Ga0007417J51691_1018296 | Ga0007417J51691_10182961 | 258 |
| 611 | 3300003575 | Ga0007409J51694_1042546 | Ga0007409J51694_10425461 | 258 |
| 612 | 3300003577 | Ga0007416J51690_1027846 | Ga0007416J51690_10278461 | 258 |
| 613 | 3300003579 | Ga0007429J51699_1048980 | Ga0007429J51699_10489801 | 258 |
| 614 | 3300003693 | Ga0032354_1014430 | Ga0032354_10144301 | 258 |
| 615 | 3300003771 | Ga0055526_1000050 | Ga0055526_1000050101 | 258 |
| 616 | 3300003771 | Ga0055526_1000439 | Ga0055526_10004397 | 258 |
| 617 | 3300005262 | Ga0065165_1000074 | Ga0065165_100007499 | 258 |
| 618 | 3300005327 | Ga0070658_10004584 | Ga0070658_100045842 | 258 |
| 619 | 3300005327 | Ga0070658_10018021 | Ga0070658_100180214 | 258 |
| 620 | 3300005327 | Ga0070658_10097543 | Ga0070658_100975434 | 258 |
| 621 | 3300005328 | Ga0070676_10010057 | Ga0070676_100100577 | 258 |
| 622 | 3300005329 | Ga0070683_100023208 | Ga0070683_1000232086 | 258 |
| 623 | 3300005329 | Ga0070683_100023385 | Ga0070683_1000233855 | 258 |
| 624 | 3300005329 | Ga0070683_100083307 | Ga0070683_1000833073 | 258 |
| 625 | 3300005329 | Ga0070683_100098650 | Ga0070683_1000986502 | 258 |
| 626 | 3300005329 | Ga0070683_100332799 | Ga0070683_1003327992 | 258 |
| 627 | 3300005331 | Ga0070670_100008183 | Ga0070670_1000081839 | 258 |
| 628 | 3300005331 | Ga0070670_100013048 | Ga0070670_1000130484 | 258 |
| 629 | 3300005331 | Ga0070670_100017710 | Ga0070670_1000177105 | 258 |
| 630 | 3300005331 | Ga0070670_100041018 | Ga0070670_1000410183 | 258 |
| 631 | 3300005331 | Ga0070670_100093329 | Ga0070670_1000933292 | 258 |
| 632 | 3300005333 | Ga0070677_10025236 | Ga0070677_100252362 | 258 |
| 633 | 3300005334 | Ga0068869_100029810 | Ga0068869_1000298102 | 258 |
| 634 | 3300005335 | Ga0070666_10109250 | Ga0070666_101092501 | 258 |
| 635 | 3300005336 | Ga0070680_100008891 | Ga0070680_1000088912 | 258 |
| 636 | 3300005336 | Ga0070680_100089522 | Ga0070680_1000895224 | 258 |
| 637 | 3300005337 | Ga0070682_100010513 | Ga0070682_1000105135 | 258 |
| 638 | 3300005338 | Ga0068868_100011665 | Ga0068868_1000116655 | 258 |
| 639 | 3300005338 | Ga0068868_100086216 | Ga0068868_1000862162 | 258 |
| 640 | 3300005338 | Ga0068868_100180189 | Ga0068868_1001801892 | 258 |
| 641 | 3300005338 | Ga0068868_100550762 | Ga0068868_1005507621 | 258 |
| 642 | 3300005339 | Ga0070660_100001625 | Ga0070660_1000016253 | 258 |
| 643 | 3300005339 | Ga0070660_100020185 | Ga0070660_1000201852 | 258 |
| 644 | 3300005339 | Ga0070660_100040098 | Ga0070660_1000400982 | 258 |
| 645 | 3300005339 | Ga0070660_100046364 | Ga0070660_1000463643 | 258 |
| 646 | 3300005340 | Ga0070689_100002174 | Ga0070689_1000021748 | 258 |
| 647 | 3300005340 | Ga0070689_100049384 | Ga0070689_1000493843 | 258 |
| 648 | 3300005341 | Ga0070691_10003094 | Ga0070691_100030945 | 258 |
| 649 | 3300005341 | Ga0070691_10047334 | Ga0070691_100473342 | 258 |
| 650 | 3300005343 | Ga0070687_100006156 | Ga0070687_1000061563 | 258 |
| 651 | 3300005343 | Ga0070687_100063831 | Ga0070687_1000638311 | 258 |
| 652 | 3300005344 | Ga0070661_100002772 | Ga0070661_10000277211 | 258 |
| 653 | 3300005344 | Ga0070661_100003649 | Ga0070661_1000036496 | 258 |
| 654 | 3300005344 | Ga0070661_100033514 | Ga0070661_1000335146 | 258 |
| 655 | 3300005344 | Ga0070661_100057987 | Ga0070661_1000579873 | 258 |
| 656 | 3300005344 | Ga0070661_100059977 | Ga0070661_1000599772 | 258 |
| 657 | 3300005345 | Ga0070692_10008674 | Ga0070692_100086743 | 258 |
| 658 | 3300005345 | Ga0070692_10051666 | Ga0070692_100516661 | 258 |
| 659 | 3300005347 | Ga0070668_100002125 | Ga0070668_1000021257 | 258 |
| 660 | 3300005347 | Ga0070668_100047493 | Ga0070668_1000474933 | 258 |
| 661 | 3300005353 | Ga0070669_100012580 | Ga0070669_1000125804 | 258 |
| 662 | 3300005353 | Ga0070669_100151400 | Ga0070669_1001514002 | 258 |
| 663 | 3300005353 | Ga0070669_100267038 | Ga0070669_1002670382 | 258 |
| 664 | 3300005354 | Ga0070675_100007594 | Ga0070675_1000075944 | 258 |
| 665 | 3300005355 | Ga0070671_100021914 | Ga0070671_1000219145 | 258 |
| 666 | 3300005355 | Ga0070671_100153362 | Ga0070671_1001533621 | 258 |
| 667 | 3300005355 | Ga0070671_100413862 | Ga0070671_1004138621 | 258 |
| 668 | 3300005355 | Ga0070671_100647719 | Ga0070671_1006477191 | 258 |
| 669 | 3300005356 | Ga0070674_100021328 | Ga0070674_1000213282 | 258 |
| 670 | 3300005356 | Ga0070674_100209971 | Ga0070674_1002099712 | 258 |
| 671 | 3300005364 | Ga0070673_100005099 | Ga0070673_1000050997 | 258 |
| 672 | 3300005364 | Ga0070673_100231922 | Ga0070673_1002319222 | 258 |
| 673 | 3300005365 | Ga0070688_100002832 | Ga0070688_1000028326 | 258 |
| 674 | 3300005365 | Ga0070688_100037833 | Ga0070688_1000378333 | 258 |
| 675 | 3300005366 | Ga0070659_100003380 | Ga0070659_1000033809 | 258 |
| 676 | 3300005366 | Ga0070659_100007453 | Ga0070659_1000074534 | 258 |
| 677 | 3300005366 | Ga0070659_100016214 | Ga0070659_1000162145 | 258 |
| 678 | 3300005366 | Ga0070659_100215789 | Ga0070659_1002157892 | 258 |
| 679 | 3300005366 | Ga0070659_100312134 | Ga0070659_1003121341 | 258 |
| 680 | 3300005367 | Ga0070667_100014818 | Ga0070667_1000148184 | 258 |
| 681 | 3300005367 | Ga0070667_100026157 | Ga0070667_1000261575 | 258 |
| 682 | 3300005406 | Ga0070703_10054540 | Ga0070703_100545402 | 258 |
| 683 | 3300005434 | Ga0070709_10016563 | Ga0070709_100165631 | 258 |
| 684 | 3300005434 | Ga0070709_10027512 | Ga0070709_100275124 | 258 |
| 685 | 3300005434 | Ga0070709_10073009 | Ga0070709_100730092 | 258 |
| 686 | 3300005434 | Ga0070709_10106075 | Ga0070709_101060752 | 258 |
| 687 | 3300005434 | Ga0070709_10151503 | Ga0070709_101515031 | 258 |
| 688 | 3300005434 | Ga0070709_10215047 | Ga0070709_102150472 | 258 |
| 689 | 3300005435 | Ga0070714_100004937 | Ga0070714_1000049373 | 258 |
| 690 | 3300005435 | Ga0070714_100024261 | Ga0070714_1000242613 | 258 |
| 691 | 3300005435 | Ga0070714_100027101 | Ga0070714_1000271015 | 258 |
| 692 | 3300005435 | Ga0070714_100032871 | Ga0070714_1000328714 | 258 |
| 693 | 3300005435 | Ga0070714_100296655 | Ga0070714_1002966552 | 258 |
| 694 | 3300005436 | Ga0070713_100023687 | Ga0070713_1000236873 | 258 |
| 695 | 3300005436 | Ga0070713_100456962 | Ga0070713_1004569621 | 258 |
| 696 | 3300005437 | Ga0070710_10244384 | Ga0070710_102443842 | 258 |
| 697 | 3300005438 | Ga0070701_10003125 | Ga0070701_100031258 | 258 |
| 698 | 3300005438 | Ga0070701_10032813 | Ga0070701_100328132 | 258 |
| 699 | 3300005439 | Ga0070711_100023693 | Ga0070711_1000236932 | 258 |
| 700 | 3300005440 | Ga0070705_100004755 | Ga0070705_1000047552 | 258 |
| 701 | 3300005441 | Ga0070700_100026410 | Ga0070700_1000264102 | 258 |
| 702 | 3300005441 | Ga0070700_100033480 | Ga0070700_1000334803 | 258 |
| 703 | 3300005444 | Ga0070694_100000595 | Ga0070694_1000005959 | 258 |
| 704 | 3300005444 | Ga0070694_100027641 | Ga0070694_1000276413 | 258 |
| 705 | 3300005444 | Ga0070694_100188789 | Ga0070694_1001887891 | 258 |
| 706 | 3300005445 | Ga0070708_100024240 | Ga0070708_1000242404 | 258 |
| 707 | 3300005445 | Ga0070708_100166060 | Ga0070708_1001660602 | 258 |
| 708 | 3300005445 | Ga0070708_100419318 | Ga0070708_1004193181 | 258 |
| 709 | 3300005455 | Ga0070663_100003107 | Ga0070663_1000031078 | 258 |
| 710 | 3300005455 | Ga0070663_100015857 | Ga0070663_1000158573 | 258 |
| 711 | 3300005455 | Ga0070663_100067574 | Ga0070663_1000675742 | 258 |
| 712 | 3300005455 | Ga0070663_100291358 | Ga0070663_1002913581 | 258 |
| 713 | 3300005456 | Ga0070678_100004266 | Ga0070678_1000042662 | 258 |
| 714 | 3300005456 | Ga0070678_100145602 | Ga0070678_1001456023 | 258 |
| 715 | 3300005457 | Ga0070662_100010721 | Ga0070662_1000107213 | 258 |
| 716 | 3300005457 | Ga0070662_100050667 | Ga0070662_1000506674 | 258 |
| 717 | 3300005458 | Ga0070681_10006372 | Ga0070681_100063723 | 258 |
| 718 | 3300005458 | Ga0070681_10009514 | Ga0070681_100095148 | 258 |
| 719 | 3300005458 | Ga0070681_10161763 | Ga0070681_101617633 | 258 |
| 720 | 3300005459 | Ga0068867_100487316 | Ga0068867_1004873161 | 258 |
| 721 | 3300005466 | Ga0070685_10002126 | Ga0070685_100021262 | 258 |
| 722 | 3300005466 | Ga0070685_10032285 | Ga0070685_100322853 | 258 |
| 723 | 3300005467 | Ga0070706_100015493 | Ga0070706_1000154932 | 258 |
| 724 | 3300005467 | Ga0070706_100023458 | Ga0070706_1000234582 | 258 |
| 725 | 3300005468 | Ga0070707_100196313 | Ga0070707_1001963132 | 258 |
| 726 | 3300005518 | Ga0070699_100026303 | Ga0070699_1000263033 | 258 |
| 727 | 3300005518 | Ga0070699_100233375 | Ga0070699_1002333752 | 258 |
| 728 | 3300005530 | Ga0070679_100004955 | Ga0070679_1000049556 | 258 |
| 729 | 3300005530 | Ga0070679_100030613 | Ga0070679_1000306134 | 258 |
| 730 | 3300005530 | Ga0070679_100054395 | Ga0070679_1000543953 | 258 |
| 731 | 3300005530 | Ga0070679_100076170 | Ga0070679_1000761702 | 258 |
| 732 | 3300005530 | Ga0070679_100084636 | Ga0070679_1000846364 | 258 |
| 733 | 3300005530 | Ga0070679_100113090 | Ga0070679_1001130903 | 258 |
| 734 | 3300005530 | Ga0070679_100179509 | Ga0070679_1001795092 | 258 |
| 735 | 3300005535 | Ga0070684_100008955 | Ga0070684_1000089556 | 258 |
| 736 | 3300005535 | Ga0070684_100009493 | Ga0070684_1000094931 | 258 |
| 737 | 3300005535 | Ga0070684_100052663 | Ga0070684_1000526635 | 258 |
| 738 | 3300005535 | Ga0070684_100078790 | Ga0070684_1000787901 | 258 |
| 739 | 3300005535 | Ga0070684_100102699 | Ga0070684_1001026991 | 258 |
| 740 | 3300005535 | Ga0070684_100111284 | Ga0070684_1001112842 | 258 |
| 741 | 3300005536 | Ga0070697_100033150 | Ga0070697_1000331504 | 258 |
| 742 | 3300005539 | Ga0068853_100027279 | Ga0068853_1000272794 | 258 |
| 743 | 3300005539 | Ga0068853_100036301 | Ga0068853_1000363016 | 258 |
| 744 | 3300005539 | Ga0068853_100044767 | Ga0068853_1000447672 | 258 |
| 745 | 3300005539 | Ga0068853_100199563 | Ga0068853_1001995632 | 258 |
| 746 | 3300005543 | Ga0070672_100028934 | Ga0070672_1000289342 | 258 |
| 747 | 3300005543 | Ga0070672_100068309 | Ga0070672_1000683092 | 258 |
| 748 | 3300005544 | Ga0070686_100015699 | Ga0070686_1000156992 | 258 |
| 749 | 3300005544 | Ga0070686_100018517 | Ga0070686_1000185175 | 258 |
| 750 | 3300005545 | Ga0070695_100004124 | Ga0070695_1000041247 | 258 |
| 751 | 3300005545 | Ga0070695_100187680 | Ga0070695_1001876801 | 258 |
| 752 | 3300005546 | Ga0070696_100001676 | Ga0070696_10000167613 | 258 |
| 753 | 3300005546 | Ga0070696_100029965 | Ga0070696_1000299653 | 258 |
| 754 | 3300005546 | Ga0070696_100183404 | Ga0070696_1001834042 | 258 |
| 755 | 3300005547 | Ga0070693_100006433 | Ga0070693_1000064336 | 258 |
| 756 | 3300005547 | Ga0070693_100025992 | Ga0070693_1000259922 | 258 |
| 757 | 3300005547 | Ga0070693_100265224 | Ga0070693_1002652242 | 258 |
| 758 | 3300005548 | Ga0070665_100042906 | Ga0070665_1000429064 | 258 |
| 759 | 3300005548 | Ga0070665_100261891 | Ga0070665_1002618912 | 258 |
| 760 | 3300005549 | Ga0070704_100005192 | Ga0070704_1000051928 | 258 |
| 761 | 3300005563 | Ga0068855_100008469 | Ga0068855_10000846910 | 258 |
| 762 | 3300005563 | Ga0068855_100018228 | Ga0068855_1000182288 | 258 |
| 763 | 3300005563 | Ga0068855_100043137 | Ga0068855_1000431373 | 258 |
| 764 | 3300005563 | Ga0068855_100079548 | Ga0068855_1000795483 | 258 |
| 765 | 3300005564 | Ga0070664_100001520 | Ga0070664_1000015208 | 258 |
| 766 | 3300005564 | Ga0070664_100002944 | Ga0070664_10000294413 | 258 |
| 767 | 3300005564 | Ga0070664_100004852 | Ga0070664_1000048528 | 258 |
| 768 | 3300005564 | Ga0070664_100009264 | Ga0070664_1000092644 | 258 |
| 769 | 3300005564 | Ga0070664_100020665 | Ga0070664_1000206654 | 258 |
| 770 | 3300005564 | Ga0070664_100079787 | Ga0070664_1000797874 | 258 |
| 771 | 3300005564 | Ga0070664_100336630 | Ga0070664_1003366302 | 258 |
| 772 | 3300005577 | Ga0068857_100002553 | Ga0068857_1000025534 | 258 |
| 773 | 3300005577 | Ga0068857_100047974 | Ga0068857_1000479742 | 258 |
| 774 | 3300005577 | Ga0068857_100057284 | Ga0068857_1000572843 | 258 |
| 775 | 3300005577 | Ga0068857_100180610 | Ga0068857_1001806102 | 258 |
| 776 | 3300005578 | Ga0068854_100031269 | Ga0068854_1000312695 | 258 |
| 777 | 3300005578 | Ga0068854_100067368 | Ga0068854_1000673682 | 258 |
| 778 | 3300005578 | Ga0068854_100098350 | Ga0068854_1000983502 | 258 |
| 779 | 3300005578 | Ga0068854_100209400 | Ga0068854_1002094002 | 258 |
| 780 | 3300005614 | Ga0068856_100003437 | Ga0068856_1000034373 | 258 |
| 781 | 3300005614 | Ga0068856_100015279 | Ga0068856_1000152798 | 258 |
| 782 | 3300005614 | Ga0068856_100022065 | Ga0068856_1000220656 | 258 |
| 783 | 3300005614 | Ga0068856_100023951 | Ga0068856_1000239514 | 258 |
| 784 | 3300005614 | Ga0068856_100024651 | Ga0068856_1000246515 | 258 |
| 785 | 3300005616 | Ga0068852_100011936 | Ga0068852_1000119363 | 258 |
| 786 | 3300005616 | Ga0068852_100014001 | Ga0068852_1000140017 | 258 |
| 787 | 3300005616 | Ga0068852_100658501 | Ga0068852_1006585011 | 258 |
| 788 | 3300005617 | Ga0068859_100112202 | Ga0068859_1001122024 | 258 |
| 789 | 3300005617 | Ga0068859_100219201 | Ga0068859_1002192013 | 258 |
| 790 | 3300005618 | Ga0068864_100010491 | Ga0068864_1000104915 | 258 |
| 791 | 3300005618 | Ga0068864_100149958 | Ga0068864_1001499582 | 258 |
| 792 | 3300005718 | Ga0068866_10006601 | Ga0068866_100066012 | 258 |
| 793 | 3300005719 | Ga0068861_100012217 | Ga0068861_1000122174 | 258 |
| 794 | 3300005719 | Ga0068861_100124174 | Ga0068861_1001241742 | 258 |
| 795 | 3300005834 | Ga0068851_10002997 | Ga0068851_100029974 | 258 |
| 796 | 3300005834 | Ga0068851_10007904 | Ga0068851_100079042 | 258 |
| 797 | 3300005834 | Ga0068851_10074380 | Ga0068851_100743802 | 258 |
| 798 | 3300005840 | Ga0068870_10015301 | Ga0068870_100153012 | 258 |
| 799 | 3300005841 | Ga0068863_100128577 | Ga0068863_1001285772 | 258 |
| 800 | 3300005842 | Ga0068858_100036953 | Ga0068858_1000369536 | 258 |
| 801 | 3300005842 | Ga0068858_100042024 | Ga0068858_1000420246 | 258 |
| 802 | 3300005842 | Ga0068858_100206150 | Ga0068858_1002061502 | 258 |
| 803 | 3300005843 | Ga0068860_100001112 | Ga0068860_1000011122 | 258 |
| 804 | 3300005843 | Ga0068860_100256761 | Ga0068860_1002567612 | 258 |
| 805 | 3300005843 | Ga0068860_100978724 | Ga0068860_1009787241 | 258 |
| 806 | 3300005844 | Ga0068862_100048918 | Ga0068862_1000489185 | 258 |
| 807 | 3300005844 | Ga0068862_100121350 | Ga0068862_1001213502 | 258 |
| 808 | 3300005937 | Ga0081455_10056258 | Ga0081455_100562582 | 258 |
| 809 | 3300006028 | Ga0070717_10597256 | Ga0070717_105972561 | 258 |
| 810 | 3300006058 | Ga0075432_10098210 | Ga0075432_100982101 | 258 |
| 811 | 3300006163 | Ga0070715_10000159 | Ga0070715_1000015912 | 258 |
| 812 | 3300006163 | Ga0070715_10123102 | Ga0070715_101231021 | 258 |
| 813 | 3300006173 | Ga0070716_100010521 | Ga0070716_1000105213 | 258 |
| 814 | 3300006175 | Ga0070712_100004130 | Ga0070712_1000041306 | 258 |
| 815 | 3300006175 | Ga0070712_100284587 | Ga0070712_1002845871 | 258 |
| 816 | 3300006175 | Ga0070712_100606662 | Ga0070712_1006066621 | 258 |
| 817 | 3300006237 | Ga0097621_100172487 | Ga0097621_1001724873 | 258 |
| 818 | 3300006237 | Ga0097621_100418712 | Ga0097621_1004187122 | 258 |
| 819 | 3300006237 | Ga0097621_100545495 | Ga0097621_1005454951 | 258 |
| 820 | 3300006358 | Ga0068871_100123662 | Ga0068871_1001236622 | 258 |
| 821 | 3300006844 | Ga0075428_100221034 | Ga0075428_1002210344 | 258 |
| 822 | 3300006844 | Ga0075428_100221243 | Ga0075428_1002212432 | 258 |
| 823 | 3300006847 | Ga0075431_100061633 | Ga0075431_1000616335 | 258 |
| 824 | 3300006847 | Ga0075431_100076425 | Ga0075431_1000764253 | 258 |
| 825 | 3300006852 | Ga0075433_10000981 | Ga0075433_1000098119 | 258 |
| 826 | 3300006852 | Ga0075433_10242784 | Ga0075433_102427841 | 258 |
| 827 | 3300006852 | Ga0075433_10245154 | Ga0075433_102451542 | 258 |
| 828 | 3300006871 | Ga0075434_100001241 | Ga0075434_1000012413 | 258 |
| 829 | 3300006871 | Ga0075434_100487636 | Ga0075434_1004876362 | 258 |
| 830 | 3300006871 | Ga0075434_101059223 | Ga0075434_1010592231 | 258 |
| 831 | 3300006881 | Ga0068865_100009546 | Ga0068865_1000095466 | 258 |
| 832 | 3300006881 | Ga0068865_100054893 | Ga0068865_1000548932 | 258 |
| 833 | 3300006881 | Ga0068865_100259793 | Ga0068865_1002597933 | 258 |
| 834 | 3300006914 | Ga0075436_100127879 | Ga0075436_1001278792 | 258 |
| 835 | 3300006914 | Ga0075436_100188984 | Ga0075436_1001889842 | 258 |
| 836 | 3300006931 | Ga0097620_100112201 | Ga0097620_1001122011 | 258 |
| 837 | 3300007265 | Ga0099794_10048714 | Ga0099794_100487142 | 258 |
| 838 | 3300007788 | Ga0099795_10000525 | Ga0099795_100005259 | 258 |
| 839 | 3300009036 | Ga0105244_10014193 | Ga0105244_100141932 | 258 |
| 840 | 3300009036 | Ga0105244_10116398 | Ga0105244_101163982 | 258 |
| 841 | 3300009092 | Ga0105250_10039487 | Ga0105250_100394873 | 258 |
| 842 | 3300009093 | Ga0105240_10010466 | Ga0105240_100104663 | 258 |
| 843 | 3300009093 | Ga0105240_10030349 | Ga0105240_100303494 | 258 |
| 844 | 3300009093 | Ga0105240_10121886 | Ga0105240_101218864 | 258 |
| 845 | 3300009094 | Ga0111539_10059595 | Ga0111539_100595953 | 258 |
| 846 | 3300009094 | Ga0111539_10069739 | Ga0111539_100697393 | 258 |
| 847 | 3300009094 | Ga0111539_10091969 | Ga0111539_100919694 | 258 |
| 848 | 3300009094 | Ga0111539_10153741 | Ga0111539_101537413 | 258 |
| 849 | 3300009098 | Ga0105245_10020211 | Ga0105245_100202114 | 258 |
| 850 | 3300009098 | Ga0105245_10064876 | Ga0105245_100648763 | 258 |
| 851 | 3300009098 | Ga0105245_10317840 | Ga0105245_103178402 | 258 |
| 852 | 3300009101 | Ga0105247_10010893 | Ga0105247_100108934 | 258 |
| 853 | 3300009147 | Ga0114129_10298861 | Ga0114129_102988614 | 258 |
| 854 | 3300009147 | Ga0114129_10480363 | Ga0114129_104803631 | 258 |
| 855 | 3300009147 | Ga0114129_11359643 | Ga0114129_113596431 | 258 |
| 856 | 3300009148 | Ga0105243_10007058 | Ga0105243_100070585 | 258 |
| 857 | 3300009148 | Ga0105243_10063327 | Ga0105243_100633272 | 258 |
| 858 | 3300009174 | Ga0105241_10009508 | Ga0105241_100095084 | 258 |
| 859 | 3300009174 | Ga0105241_10386389 | Ga0105241_103863892 | 258 |
| 860 | 3300009176 | Ga0105242_10003922 | Ga0105242_100039227 | 258 |
| 861 | 3300009176 | Ga0105242_10057719 | Ga0105242_100577192 | 258 |
| 862 | 3300009176 | Ga0105242_10099932 | Ga0105242_100999322 | 258 |
| 863 | 3300009177 | Ga0105248_10005206 | Ga0105248_1000520611 | 258 |
| 864 | 3300009177 | Ga0105248_10022900 | Ga0105248_100229005 | 258 |
| 865 | 3300009177 | Ga0105248_10045266 | Ga0105248_100452661 | 258 |
| 866 | 3300009177 | Ga0105248_10161153 | Ga0105248_101611531 | 258 |
| 867 | 3300009545 | Ga0105237_10022783 | Ga0105237_100227836 | 258 |
| 868 | 3300009545 | Ga0105237_10082572 | Ga0105237_100825725 | 258 |
| 869 | 3300009545 | Ga0105237_10317152 | Ga0105237_103171522 | 258 |
| 870 | 3300009551 | Ga0105238_10003490 | Ga0105238_100034908 | 258 |
| 871 | 3300009551 | Ga0105238_10010511 | Ga0105238_100105112 | 258 |
| 872 | 3300009551 | Ga0105238_10031634 | Ga0105238_100316345 | 258 |
| 873 | 3300009551 | Ga0105238_10038745 | Ga0105238_100387455 | 258 |
| 874 | 3300009551 | Ga0105238_10046908 | Ga0105238_100469082 | 258 |
| 875 | 3300009551 | Ga0105238_10416888 | Ga0105238_104168882 | 258 |
| 876 | 3300009553 | Ga0105249_10239556 | Ga0105249_102395562 | 258 |
| 877 | 3300010375 | Ga0105239_10115907 | Ga0105239_101159074 | 258 |
| 878 | 3300010375 | Ga0105239_10119880 | Ga0105239_101198804 | 258 |
| 879 | 3300010375 | Ga0105239_11202922 | Ga0105239_112029221 | 258 |
| 880 | 3300011119 | Ga0105246_10018900 | Ga0105246_100189003 | 258 |
| 881 | 3300011119 | Ga0105246_10089601 | Ga0105246_100896013 | 258 |
| 882 | 3300013100 | Ga0157373_10010428 | Ga0157373_100104283 | 258 |
| 883 | 3300013100 | Ga0157373_10010753 | Ga0157373_100107533 | 258 |
| 884 | 3300013100 | Ga0157373_10167222 | Ga0157373_101672222 | 258 |
| 885 | 3300013102 | Ga0157371_10023743 | Ga0157371_100237435 | 258 |
| 886 | 3300013102 | Ga0157371_10033215 | Ga0157371_100332154 | 258 |
| 887 | 3300013102 | Ga0157371_10072031 | Ga0157371_100720312 | 258 |
| 888 | 3300013102 | Ga0157371_10150202 | Ga0157371_101502021 | 258 |
| 889 | 3300013104 | Ga0157370_10002532 | Ga0157370_1000253220 | 258 |
| 890 | 3300013104 | Ga0157370_10015571 | Ga0157370_100155713 | 258 |
| 891 | 3300013104 | Ga0157370_10018623 | Ga0157370_100186233 | 258 |
| 892 | 3300013104 | Ga0157370_10026491 | Ga0157370_100264914 | 258 |
| 893 | 3300013104 | Ga0157370_10058461 | Ga0157370_100584612 | 258 |
| 894 | 3300013104 | Ga0157370_10168643 | Ga0157370_101686432 | 258 |
| 895 | 3300013105 | Ga0157369_10007438 | Ga0157369_100074384 | 258 |
| 896 | 3300013105 | Ga0157369_10032889 | Ga0157369_100328894 | 258 |
| 897 | 3300013105 | Ga0157369_10143782 | Ga0157369_101437821 | 258 |
| 898 | 3300013105 | Ga0157369_10219729 | Ga0157369_102197293 | 258 |
| 899 | 3300013296 | Ga0157374_10008130 | Ga0157374_100081308 | 258 |
| 900 | 3300013296 | Ga0157374_10008516 | Ga0157374_100085163 | 258 |
| 901 | 3300013296 | Ga0157374_10062647 | Ga0157374_100626473 | 258 |
| 902 | 3300013296 | Ga0157374_10227085 | Ga0157374_102270852 | 258 |
| 903 | 3300013296 | Ga0157374_10363912 | Ga0157374_103639121 | 258 |
| 904 | 3300013297 | Ga0157378_10018792 | Ga0157378_100187923 | 258 |
| 905 | 3300013297 | Ga0157378_10033486 | Ga0157378_100334867 | 258 |
| 906 | 3300013297 | Ga0157378_10070373 | Ga0157378_100703734 | 258 |
| 907 | 3300013306 | Ga0163162_10007822 | Ga0163162_100078229 | 258 |
| 908 | 3300013306 | Ga0163162_10034723 | Ga0163162_100347232 | 258 |
| 909 | 3300013307 | Ga0157372_10003130 | Ga0157372_1000313012 | 258 |
| 910 | 3300013307 | Ga0157372_10011420 | Ga0157372_100114206 | 258 |
| 911 | 3300013307 | Ga0157372_10012456 | Ga0157372_100124563 | 258 |
| 912 | 3300013307 | Ga0157372_10034622 | Ga0157372_100346223 | 258 |
| 913 | 3300013307 | Ga0157372_10051086 | Ga0157372_100510862 | 258 |
| 914 | 3300013307 | Ga0157372_10103907 | Ga0157372_101039072 | 258 |
| 915 | 3300013307 | Ga0157372_10128120 | Ga0157372_101281202 | 258 |
| 916 | 3300013307 | Ga0157372_10240052 | Ga0157372_102400522 | 258 |
| 917 | 3300013307 | Ga0157372_10312514 | Ga0157372_103125141 | 258 |
| 918 | 3300013307 | Ga0157372_10333214 | Ga0157372_103332142 | 258 |
| 919 | 3300013307 | Ga0157372_10404621 | Ga0157372_104046212 | 258 |
| 920 | 3300013307 | Ga0157372_10545212 | Ga0157372_105452122 | 258 |
| 921 | 3300013308 | Ga0157375_10020474 | Ga0157375_100204746 | 258 |
| 922 | 3300014325 | Ga0163163_10007632 | Ga0163163_100076323 | 258 |
| 923 | 3300014325 | Ga0163163_10054993 | Ga0163163_100549932 | 258 |
| 924 | 3300014325 | Ga0163163_10155272 | Ga0163163_101552721 | 258 |
| 925 | 3300014325 | Ga0163163_10490960 | Ga0163163_104909602 | 258 |
| 926 | 3300014326 | Ga0157380_10037017 | Ga0157380_100370171 | 258 |
| 927 | 3300014745 | Ga0157377_10007033 | Ga0157377_100070335 | 258 |
| 928 | 3300014968 | Ga0157379_10030891 | Ga0157379_100308912 | 258 |
| 929 | 3300014968 | Ga0157379_10061468 | Ga0157379_100614682 | 258 |
| 930 | 3300014969 | Ga0157376_10025325 | Ga0157376_100253253 | 258 |
| 931 | 3300014969 | Ga0157376_10089349 | Ga0157376_100893493 | 258 |
| 932 | 3300017792 | Ga0163161_10031958 | Ga0163161_100319585 | 258 |
| 933 | 3300017792 | Ga0163161_10117266 | Ga0163161_101172663 | 258 |
| 934 | 3300017792 | Ga0163161_10201015 | Ga0163161_102010151 | 258 |
| 935 | 3300021361 | Ga0213872_10000712 | Ga0213872_1000071222 | 258 |
| 936 | 3300025254 | Ga0209148_1000386 | Ga0209148_100038613 | 258 |
| 937 | 3300025271 | Ga0207666_1005781 | Ga0207666_10057812 | 258 |
| 938 | 3300025295 | Ga0209564_1000007 | Ga0209564_1000007464 | 258 |
| 939 | 3300025315 | Ga0207697_10001389 | Ga0207697_1000138911 | 258 |
| 940 | 3300025321 | Ga0207656_10005345 | Ga0207656_100053452 | 258 |
| 941 | 3300025321 | Ga0207656_10008756 | Ga0207656_100087563 | 258 |
| 942 | 3300025321 | Ga0207656_10015099 | Ga0207656_100150992 | 258 |
| 943 | 3300025321 | Ga0207656_10238124 | Ga0207656_102381241 | 258 |
| 944 | 3300025728 | Ga0207655_1016139 | Ga0207655_10161394 | 258 |
| 945 | 3300025893 | Ga0207682_10000199 | Ga0207682_100001992 | 258 |
| 946 | 3300025898 | Ga0207692_10004390 | Ga0207692_100043905 | 258 |
| 947 | 3300025898 | Ga0207692_10333781 | Ga0207692_103337811 | 258 |
| 948 | 3300025900 | Ga0207710_10021773 | Ga0207710_100217733 | 258 |
| 949 | 3300025901 | Ga0207688_10002110 | Ga0207688_100021103 | 258 |
| 950 | 3300025901 | Ga0207688_10012316 | Ga0207688_100123166 | 258 |
| 951 | 3300025903 | Ga0207680_10002416 | Ga0207680_100024167 | 258 |
| 952 | 3300025903 | Ga0207680_10133850 | Ga0207680_101338502 | 258 |
| 953 | 3300025903 | Ga0207680_10150519 | Ga0207680_101505192 | 258 |
| 954 | 3300025904 | Ga0207647_10018037 | Ga0207647_100180375 | 258 |
| 955 | 3300025906 | Ga0207699_10022753 | Ga0207699_100227532 | 258 |
| 956 | 3300025906 | Ga0207699_10053258 | Ga0207699_100532581 | 258 |
| 957 | 3300025906 | Ga0207699_10253341 | Ga0207699_102533412 | 258 |
| 958 | 3300025907 | Ga0207645_10015977 | Ga0207645_100159773 | 258 |
| 959 | 3300025907 | Ga0207645_10039569 | Ga0207645_100395692 | 258 |
| 960 | 3300025907 | Ga0207645_10055884 | Ga0207645_100558842 | 258 |
| 961 | 3300025907 | Ga0207645_10085880 | Ga0207645_100858802 | 258 |
| 962 | 3300025907 | Ga0207645_10243356 | Ga0207645_102433561 | 258 |
| 963 | 3300025908 | Ga0207643_10000285 | Ga0207643_100002857 | 258 |
| 964 | 3300025908 | Ga0207643_10083901 | Ga0207643_100839013 | 258 |
| 965 | 3300025909 | Ga0207705_10030823 | Ga0207705_100308235 | 258 |
| 966 | 3300025909 | Ga0207705_10037392 | Ga0207705_100373921 | 258 |
| 967 | 3300025910 | Ga0207684_10006392 | Ga0207684_1000639210 | 258 |
| 968 | 3300025910 | Ga0207684_10073880 | Ga0207684_100738804 | 258 |
| 969 | 3300025910 | Ga0207684_10176364 | Ga0207684_101763642 | 258 |
| 970 | 3300025911 | Ga0207654_10097298 | Ga0207654_100972983 | 258 |
| 971 | 3300025912 | Ga0207707_10011673 | Ga0207707_100116735 | 258 |
| 972 | 3300025912 | Ga0207707_10012952 | Ga0207707_100129523 | 258 |
| 973 | 3300025912 | Ga0207707_10025294 | Ga0207707_100252942 | 258 |
| 974 | 3300025912 | Ga0207707_10026682 | Ga0207707_100266824 | 258 |
| 975 | 3300025913 | Ga0207695_10006493 | Ga0207695_1000649314 | 258 |
| 976 | 3300025913 | Ga0207695_10040712 | Ga0207695_100407122 | 258 |
| 977 | 3300025913 | Ga0207695_10087600 | Ga0207695_100876001 | 258 |
| 978 | 3300025914 | Ga0207671_10195738 | Ga0207671_101957382 | 258 |
| 979 | 3300025914 | Ga0207671_10349954 | Ga0207671_103499541 | 258 |
| 980 | 3300025915 | Ga0207693_10014239 | Ga0207693_100142396 | 258 |
| 981 | 3300025916 | Ga0207663_10015515 | Ga0207663_100155153 | 258 |
| 982 | 3300025917 | Ga0207660_10012309 | Ga0207660_100123093 | 258 |
| 983 | 3300025917 | Ga0207660_10045893 | Ga0207660_100458932 | 258 |
| 984 | 3300025917 | Ga0207660_10074565 | Ga0207660_100745654 | 258 |
| 985 | 3300025917 | Ga0207660_10102775 | Ga0207660_101027752 | 258 |
| 986 | 3300025917 | Ga0207660_10236524 | Ga0207660_102365242 | 258 |
| 987 | 3300025918 | Ga0207662_10000929 | Ga0207662_100009299 | 258 |
| 988 | 3300025918 | Ga0207662_10003667 | Ga0207662_100036678 | 258 |
| 989 | 3300025919 | Ga0207657_10000882 | Ga0207657_100008824 | 258 |
| 990 | 3300025919 | Ga0207657_10002238 | Ga0207657_100022385 | 258 |
| 991 | 3300025919 | Ga0207657_10006109 | Ga0207657_100061094 | 258 |
| 992 | 3300025919 | Ga0207657_10014997 | Ga0207657_100149972 | 258 |
| 993 | 3300025919 | Ga0207657_10051541 | Ga0207657_100515413 | 258 |
| 994 | 3300025920 | Ga0207649_10002511 | Ga0207649_100025118 | 258 |
| 995 | 3300025920 | Ga0207649_10037866 | Ga0207649_100378662 | 258 |
| 996 | 3300025920 | Ga0207649_10063142 | Ga0207649_100631422 | 258 |
| 997 | 3300025920 | Ga0207649_10064299 | Ga0207649_100642992 | 258 |
| 998 | 3300025920 | Ga0207649_10089484 | Ga0207649_100894842 | 258 |
| 999 | 3300025921 | Ga0207652_10006566 | Ga0207652_100065666 | 258 |
| 1000 | 3300025921 | Ga0207652_10019084 | Ga0207652_100190843 | 258 |
| 1001 | 3300025921 | Ga0207652_10090872 | Ga0207652_100908722 | 258 |
| 1002 | 3300025921 | Ga0207652_10111889 | Ga0207652_101118893 | 258 |
| 1003 | 3300025922 | Ga0207646_10084014 | Ga0207646_100840142 | 258 |
| 1004 | 3300025923 | Ga0207681_10060289 | Ga0207681_100602892 | 258 |
| 1005 | 3300025923 | Ga0207681_10256457 | Ga0207681_102564572 | 258 |
| 1006 | 3300025924 | Ga0207694_10004100 | Ga0207694_100041004 | 258 |
| 1007 | 3300025924 | Ga0207694_10007945 | Ga0207694_100079455 | 258 |
| 1008 | 3300025924 | Ga0207694_10044084 | Ga0207694_100440842 | 258 |
| 1009 | 3300025926 | Ga0207659_10026579 | Ga0207659_100265794 | 258 |
| 1010 | 3300025926 | Ga0207659_10146489 | Ga0207659_101464891 | 258 |
| 1011 | 3300025927 | Ga0207687_10015863 | Ga0207687_100158636 | 258 |
| 1012 | 3300025927 | Ga0207687_10162814 | Ga0207687_101628142 | 258 |
| 1013 | 3300025928 | Ga0207700_10020365 | Ga0207700_100203654 | 258 |
| 1014 | 3300025929 | Ga0207664_10001046 | Ga0207664_1000104617 | 258 |
| 1015 | 3300025929 | Ga0207664_10012686 | Ga0207664_100126862 | 258 |
| 1016 | 3300025929 | Ga0207664_10050774 | Ga0207664_100507741 | 258 |
| 1017 | 3300025929 | Ga0207664_10051133 | Ga0207664_100511332 | 258 |
| 1018 | 3300025929 | Ga0207664_10059671 | Ga0207664_100596714 | 258 |
| 1019 | 3300025929 | Ga0207664_10297437 | Ga0207664_102974372 | 258 |
| 1020 | 3300025931 | Ga0207644_10012046 | Ga0207644_100120463 | 258 |
| 1021 | 3300025931 | Ga0207644_10018949 | Ga0207644_100189495 | 258 |
| 1022 | 3300025931 | Ga0207644_10094661 | Ga0207644_100946612 | 258 |
| 1023 | 3300025931 | Ga0207644_10145787 | Ga0207644_101457872 | 258 |
| 1024 | 3300025932 | Ga0207690_10005099 | Ga0207690_100050993 | 258 |
| 1025 | 3300025932 | Ga0207690_10007295 | Ga0207690_100072955 | 258 |
| 1026 | 3300025932 | Ga0207690_10013597 | Ga0207690_100135972 | 258 |
| 1027 | 3300025932 | Ga0207690_10027060 | Ga0207690_100270602 | 258 |
| 1028 | 3300025932 | Ga0207690_10046682 | Ga0207690_100466824 | 258 |
| 1029 | 3300025933 | Ga0207706_10000820 | Ga0207706_100008205 | 258 |
| 1030 | 3300025933 | Ga0207706_10006730 | Ga0207706_100067308 | 258 |
| 1031 | 3300025933 | Ga0207706_10073712 | Ga0207706_100737122 | 258 |
| 1032 | 3300025933 | Ga0207706_10152699 | Ga0207706_101526992 | 258 |
| 1033 | 3300025933 | Ga0207706_10343471 | Ga0207706_103434712 | 258 |
| 1034 | 3300025934 | Ga0207686_10016093 | Ga0207686_100160933 | 258 |
| 1035 | 3300025935 | Ga0207709_10024538 | Ga0207709_100245382 | 258 |
| 1036 | 3300025935 | Ga0207709_10223798 | Ga0207709_102237983 | 258 |
| 1037 | 3300025936 | Ga0207670_10002275 | Ga0207670_100022754 | 258 |
| 1038 | 3300025937 | Ga0207669_10034055 | Ga0207669_100340555 | 258 |
| 1039 | 3300025937 | Ga0207669_10362329 | Ga0207669_103623292 | 258 |
| 1040 | 3300025939 | Ga0207665_10001863 | Ga0207665_100018638 | 258 |
| 1041 | 3300025940 | Ga0207691_10017740 | Ga0207691_100177405 | 258 |
| 1042 | 3300025940 | Ga0207691_10035330 | Ga0207691_100353302 | 258 |
| 1043 | 3300025941 | Ga0207711_10029383 | Ga0207711_100293834 | 258 |
| 1044 | 3300025941 | Ga0207711_10032690 | Ga0207711_100326904 | 258 |
| 1045 | 3300025941 | Ga0207711_10075247 | Ga0207711_100752472 | 258 |
| 1046 | 3300025942 | Ga0207689_10000559 | Ga0207689_1000055931 | 258 |
| 1047 | 3300025942 | Ga0207689_10014667 | Ga0207689_100146676 | 258 |
| 1048 | 3300025942 | Ga0207689_10052332 | Ga0207689_100523323 | 258 |
| 1049 | 3300025944 | Ga0207661_10028106 | Ga0207661_100281064 | 258 |
| 1050 | 3300025944 | Ga0207661_10274424 | Ga0207661_102744241 | 258 |
| 1051 | 3300025945 | Ga0207679_10003380 | Ga0207679_100033803 | 258 |
| 1052 | 3300025945 | Ga0207679_10003681 | Ga0207679_100036814 | 258 |
| 1053 | 3300025945 | Ga0207679_10010584 | Ga0207679_100105844 | 258 |
| 1054 | 3300025945 | Ga0207679_10064697 | Ga0207679_100646972 | 258 |
| 1055 | 3300025949 | Ga0207667_10001841 | Ga0207667_1000184121 | 258 |
| 1056 | 3300025949 | Ga0207667_10091854 | Ga0207667_100918542 | 258 |
| 1057 | 3300025949 | Ga0207667_10277015 | Ga0207667_102770151 | 258 |
| 1058 | 3300025949 | Ga0207667_10500891 | Ga0207667_105008912 | 258 |
| 1059 | 3300025949 | Ga0207667_10763780 | Ga0207667_107637802 | 258 |
| 1060 | 3300025960 | Ga0207651_10002984 | Ga0207651_100029845 | 258 |
| 1061 | 3300025960 | Ga0207651_10117362 | Ga0207651_101173621 | 258 |
| 1062 | 3300025960 | Ga0207651_10157406 | Ga0207651_101574062 | 258 |
| 1063 | 3300025960 | Ga0207651_10237925 | Ga0207651_102379251 | 258 |
| 1064 | 3300025961 | Ga0207712_10045875 | Ga0207712_100458752 | 258 |
| 1065 | 3300025972 | Ga0207668_10018888 | Ga0207668_100188884 | 258 |
| 1066 | 3300025972 | Ga0207668_10079489 | Ga0207668_100794892 | 258 |
| 1067 | 3300025972 | Ga0207668_10141487 | Ga0207668_101414872 | 258 |
| 1068 | 3300025981 | Ga0207640_10038374 | Ga0207640_100383741 | 258 |
| 1069 | 3300025981 | Ga0207640_10045477 | Ga0207640_100454772 | 258 |
| 1070 | 3300025986 | Ga0207658_10020076 | Ga0207658_100200765 | 258 |
| 1071 | 3300025986 | Ga0207658_10025067 | Ga0207658_100250674 | 258 |
| 1072 | 3300025986 | Ga0207658_10198488 | Ga0207658_101984882 | 258 |
| 1073 | 3300025986 | Ga0207658_10553520 | Ga0207658_105535202 | 258 |
| 1074 | 3300026023 | Ga0207677_10090482 | Ga0207677_100904822 | 258 |
| 1075 | 3300026023 | Ga0207677_10094049 | Ga0207677_100940492 | 258 |
| 1076 | 3300026023 | Ga0207677_10198376 | Ga0207677_101983761 | 258 |
| 1077 | 3300026035 | Ga0207703_10097426 | Ga0207703_100974262 | 258 |
| 1078 | 3300026035 | Ga0207703_10902203 | Ga0207703_109022031 | 258 |
| 1079 | 3300026035 | Ga0207703_10906624 | Ga0207703_109066241 | 258 |
| 1080 | 3300026041 | Ga0207639_10012698 | Ga0207639_100126986 | 258 |
| 1081 | 3300026041 | Ga0207639_10030893 | Ga0207639_100308933 | 258 |
| 1082 | 3300026041 | Ga0207639_10036924 | Ga0207639_100369241 | 258 |
| 1083 | 3300026041 | Ga0207639_10048995 | Ga0207639_100489952 | 258 |
| 1084 | 3300026041 | Ga0207639_10099833 | Ga0207639_100998331 | 258 |
| 1085 | 3300026041 | Ga0207639_10132235 | Ga0207639_101322352 | 258 |
| 1086 | 3300026041 | Ga0207639_10351348 | Ga0207639_103513481 | 258 |
| 1087 | 3300026041 | Ga0207639_10796769 | Ga0207639_107967691 | 258 |
| 1088 | 3300026067 | Ga0207678_10001637 | Ga0207678_1000163715 | 258 |
| 1089 | 3300026067 | Ga0207678_10020833 | Ga0207678_100208335 | 258 |
| 1090 | 3300026067 | Ga0207678_10038735 | Ga0207678_100387353 | 258 |
| 1091 | 3300026067 | Ga0207678_10367688 | Ga0207678_103676882 | 258 |
| 1092 | 3300026067 | Ga0207678_10421032 | Ga0207678_104210322 | 258 |
| 1093 | 3300026075 | Ga0207708_10003553 | Ga0207708_1000355312 | 258 |
| 1094 | 3300026075 | Ga0207708_10009000 | Ga0207708_100090005 | 258 |
| 1095 | 3300026078 | Ga0207702_10042978 | Ga0207702_100429783 | 258 |
| 1096 | 3300026078 | Ga0207702_10050842 | Ga0207702_100508422 | 258 |
| 1097 | 3300026078 | Ga0207702_10066459 | Ga0207702_100664594 | 258 |
| 1098 | 3300026078 | Ga0207702_10340732 | Ga0207702_103407322 | 258 |
| 1099 | 3300026078 | Ga0207702_10532124 | Ga0207702_105321241 | 258 |
| 1100 | 3300026088 | Ga0207641_10266332 | Ga0207641_102663322 | 258 |
| 1101 | 3300026088 | Ga0207641_10415295 | Ga0207641_104152953 | 258 |
| 1102 | 3300026088 | Ga0207641_10838603 | Ga0207641_108386031 | 258 |
| 1103 | 3300026089 | Ga0207648_10001104 | Ga0207648_100011043 | 258 |
| 1104 | 3300026089 | Ga0207648_10426945 | Ga0207648_104269451 | 258 |
| 1105 | 3300026095 | Ga0207676_10007903 | Ga0207676_100079035 | 258 |
| 1106 | 3300026095 | Ga0207676_10096057 | Ga0207676_100960571 | 258 |
| 1107 | 3300026095 | Ga0207676_10718003 | Ga0207676_107180031 | 258 |
| 1108 | 3300026116 | Ga0207674_10000089 | Ga0207674_1000008978 | 258 |
| 1109 | 3300026116 | Ga0207674_10002196 | Ga0207674_1000219615 | 258 |
| 1110 | 3300026116 | Ga0207674_10004693 | Ga0207674_1000469311 | 258 |
| 1111 | 3300026116 | Ga0207674_10004995 | Ga0207674_100049952 | 258 |
| 1112 | 3300026116 | Ga0207674_10010018 | Ga0207674_100100183 | 258 |
| 1113 | 3300026116 | Ga0207674_10132705 | Ga0207674_101327052 | 258 |
| 1114 | 3300026116 | Ga0207674_10190171 | Ga0207674_101901712 | 258 |
| 1115 | 3300026118 | Ga0207675_100000047 | Ga0207675_10000004731 | 258 |
| 1116 | 3300026118 | Ga0207675_100000376 | Ga0207675_10000037633 | 258 |
| 1117 | 3300026118 | Ga0207675_100547266 | Ga0207675_1005472662 | 258 |
| 1118 | 3300026121 | Ga0207683_10000127 | Ga0207683_1000012728 | 258 |
| 1119 | 3300026121 | Ga0207683_10016793 | Ga0207683_100167934 | 258 |
| 1120 | 3300026142 | Ga0207698_10008357 | Ga0207698_100083573 | 258 |
| 1121 | 3300026142 | Ga0207698_10031784 | Ga0207698_100317845 | 258 |
| 1122 | 3300026142 | Ga0207698_10042815 | Ga0207698_100428152 | 258 |
| 1123 | 3300026142 | Ga0207698_10045785 | Ga0207698_100457855 | 258 |
| 1124 | 3300026142 | Ga0207698_10099036 | Ga0207698_100990361 | 258 |
| 1125 | 3300027471 | Ga0209995_1012932 | Ga0209995_10129322 | 258 |
| 1126 | 3300027665 | Ga0209983_1005434 | Ga0209983_10054342 | 258 |
| 1127 | 3300027682 | Ga0209971_1001127 | Ga0209971_10011273 | 258 |
| 1128 | 3300027907 | Ga0207428_10070875 | Ga0207428_100708753 | 258 |
| 1129 | 3300027907 | Ga0207428_10113181 | Ga0207428_101131811 | 258 |
| 1130 | 3300027907 | Ga0207428_10518449 | Ga0207428_105184491 | 258 |
| 1131 | 3300028379 | Ga0268266_10038608 | Ga0268266_100386084 | 258 |
| 1132 | 3300028380 | Ga0268265_10045406 | Ga0268265_100454061 | 258 |
| 1133 | 3300028380 | Ga0268265_10730613 | Ga0268265_107306131 | 258 |
| 1134 | 3300028381 | Ga0268264_10042905 | Ga0268264_100429056 | 258 |
| 1135 | 3300028381 | Ga0268264_10165288 | Ga0268264_101652882 | 258 |
| 1136 | 3300031239 | Ga0265328_10009096 | Ga0265328_100090962 | 258 |
| 1137 | 3300031249 | Ga0265339_10016519 | Ga0265339_100165194 | 258 |
| 1138 | 3300031344 | Ga0265316_10021653 | Ga0265316_100216532 | 258 |
| 1139 | 3300031824 | Ga0307413_10237381 | Ga0307413_102373811 | 258 |
| 1140 | 3300031911 | Ga0307412_10026142 | Ga0307412_100261424 | 258 |
| 1141 | 3300035085 | Ga0373929_0007593 | Ga0373929_0007593_727_1503 | 258 |
| 1142 | 3300035085 | Ga0373929_0040769 | Ga0373929_0040769_64_840 | 258 |
| 1143 | 3300035086 | Ga0373934_0000639 | Ga0373934_0000639_5686_6468 | 258 |
| 1144 | 3300035088 | Ga0373940_0009937 | Ga0373940_0009937_1263_2039 | 258 |
| 1145 | 3300035092 | Ga0373952_0041093 | Ga0373952_0041093_176_952 | 258 |
| 1146 | 3300035111 | Ga0373923_0050607 | Ga0373923_0050607_119_901 | 258 |
| 1147 | 3300035112 | Ga0373932_0011564 | Ga0373932_0011564_567_1343 | 258 |
| 1148 | 3300035114 | Ga0373939_0045629 | Ga0373939_0045629_219_995 | 258 |
| 1149 | 3300035115 | Ga0373941_0063328 | Ga0373941_0063328_156_932 | 258 |
| 1150 | 3300035117 | Ga0373953_0073359 | Ga0373953_0073359_561_1385 | 258 |
| 1151 | 3300035118 | Ga0373954_0025888 | Ga0373954_0025888_1748_2530 | 258 |
| 1152 | 3300035119 | Ga0373956_0000135 | Ga0373956_0000135_5767_6549 | 258 |
| 1153 | 3300035120 | Ga0373957_0000933 | Ga0373957_0000933_5678_6460 | 258 |
| 1154 | 3300035121 | Ga0373960_0014938 | Ga0373960_0014938_740_1516 | 258 |
| 1155 | 3300035121 | Ga0373960_0021024 | Ga0373960_0021024_853_1629 | 258 |
| 1156 | 3300035172 | Ga0373955_0023281 | Ga0373955_0023281_1559_2341 | 258 |
| 1157 | 3300035242 | Ga0373962_0005595 | Ga0373962_0005595_163_939 | 258 |
| 1158 | 3300035691 | Ga0373931_0004770 | Ga0373931_0004770_672_1448 | 258 |
| 1159 | 3300035691 | Ga0373931_0007171 | Ga0373931_0007171_2781_3557 | 258 |
| 1160 | 3300035691 | Ga0373931_0016109 | Ga0373931_0016109_1938_2714 | 258 |
| 1161 | 3300035695 | Ga0373927_0218147 | Ga0373927_0218147_443_1222 | 258 |
| 1162 | 3300035695 | Ga0373927_0336775 | Ga0373927_0336775_61_861 | 258 |
| 1163 | 3300035724 | Ga0373933_0000813 | Ga0373933_0000813_3462_4244 | 258 |
| 1164 | 3300035725 | Ga0373947_0112483 | Ga0373947_0112483_485_1270 | 258 |
| 1165 | 3300036401 | Ga0373937_0004329 | Ga0373937_0004329_5224_6006 | 258 |
| 1166 | 3300036401 | Ga0373937_0023186 | Ga0373937_0023186_3460_4236 | 258 |
| 1167 | 3300036401 | Ga0373937_0087549 | Ga0373937_0087549_134_1015 | 258 |
| 1168 | 3300037068 | Ga0373925_0087309 | Ga0373925_0087309_1429_2205 | 258 |
| 1169 | 3300037418 | Ga0395900_0010652 | Ga0395900_0010652_7111_7887 | 258 |
| 1170 | 3300037471 | Ga0395905_0000086 | Ga0395905_0000086_6512_7294 | 258 |
| 1171 | 3300037471 | Ga0395905_0004236 | Ga0395905_0004236_7950_8726 | 258 |
| 1172 | 3300038443 | Ga0395901_0079508 | Ga0395901_0079508_704_1480 | 258 |
| 1173 | 3300038443 | Ga0395901_0415128 | Ga0395901_0415128_263_1045 | 258 |
| 1174 | 3300038996 | Ga0242420_009807 | Ga0242420_009807_26_805 | 258 |
| 1175 | 3300039447 | Ga0436361_0530365 | Ga0436361_0530365_41680_42462 | 258 |
| 1176 | 3300042876 | Ga0451577_0097984 | Ga0451577_0097984_1425_2204 | 258 |
| 1177 | 3300044735 | Ga0466968_0074670 | Ga0466968_0074670_535_1332 | 258 |
| 1178 | 3300045051 | Ga0451576_0104326 | Ga0451576_0104326_875_1675 | 258 |
| 1179 | 3300046462 | Ga0495651_0000274 | Ga0495651_0000274_34084_34866 | 258 |
| 1180 | 3300046472 | Ga0495580_0072639 | Ga0495580_0072639_1431_2213 | 258 |
| 1181 | 3300046491 | Ga0495584_0073030 | Ga0495584_0073030_677_1453 | 258 |
| 1182 | 3300046491 | Ga0495584_0095625 | Ga0495584_0095625_263_1045 | 258 |
| 1183 | 3300046507 | Ga0495606_0269849 | Ga0495606_0269849_51_833 | 258 |
| 1184 | 3300046539 | Ga0495621_0105795 | Ga0495621_0105795_122_898 | 258 |
| 1185 | 3300046616 | Ga0495668_0002784 | Ga0495668_0002784_820_1602 | 258 |
| 1186 | 3300046675 | Ga0495657_0022641 | Ga0495657_0022641_2814_3596 | 258 |
| 1187 | 3300047317 | Ga0495604_0050123 | Ga0495604_0050123_313_1095 | 258 |
| 1188 | 3300048903 | Ga0496100_0022383 | Ga0496100_0022383_2463_3239 | 258 |
| 1189 | 3300048904 | Ga0496101_0138658 | Ga0496101_0138658_246_1022 | 258 |
| 1190 | 3300048904 | Ga0496101_0449248 | Ga0496101_0449248_203_982 | 258 |
| 1191 | 3300048905 | Ga0496102_0012224 | Ga0496102_0012224_457_1233 | 258 |
| 1192 | 3300048905 | Ga0496102_0034379 | Ga0496102_0034379_1768_2550 | 258 |
| 1193 | 3300048905 | Ga0496102_0411198 | Ga0496102_0411198_278_1054 | 258 |
| 1194 | 3300048906 | Ga0496103_0004445 | Ga0496103_0004445_2965_3747 | 258 |
| 1195 | 3300048906 | Ga0496103_0024209 | Ga0496103_0024209_1527_2303 | 258 |
| 1196 | 3300048906 | Ga0496103_0064765 | Ga0496103_0064765_407_1183 | 258 |
| 1197 | 3300048906 | Ga0496103_0072089 | Ga0496103_0072089_310_1092 | 258 |
| 1198 | 3300048907 | Ga0496104_0414017 | Ga0496104_0414017_77_853 | 258 |
| 1199 | 3300048908 | Ga0496105_0023569 | Ga0496105_0023569_2312_3088 | 258 |
| 1200 | 3300048908 | Ga0496105_0220084 | Ga0496105_0220084_263_1039 | 258 |
| 1201 | 3300048908 | Ga0496105_0324557 | Ga0496105_0324557_393_1169 | 258 |
| 1202 | 3300048909 | Ga0496106_0021775 | Ga0496106_0021775_3529_4305 | 258 |
| 1203 | 3300048909 | Ga0496106_0178145 | Ga0496106_0178145_749_1525 | 258 |
| 1204 | 3300048910 | Ga0496107_0029338 | Ga0496107_0029338_2370_3146 | 258 |
| 1205 | 3300048910 | Ga0496107_0054627 | Ga0496107_0054627_2034_2810 | 258 |
| 1206 | 3300048910 | Ga0496107_0376757 | Ga0496107_0376757_29_805 | 258 |
| 1207 | 3300048911 | Ga0496108_0069736 | Ga0496108_0069736_1765_2541 | 258 |
| 1208 | 3300048912 | Ga0496109_0006173 | Ga0496109_0006173_8796_9572 | 258 |
| 1209 | 3300048912 | Ga0496109_0015267 | Ga0496109_0015267_3659_4435 | 258 |
| 1210 | 3300048912 | Ga0496109_0136861 | Ga0496109_0136861_1296_2072 | 258 |
| 1211 | 3300048912 | Ga0496109_0298500 | Ga0496109_0298500_306_1088 | 258 |
| 1212 | 3300048912 | Ga0496109_0453695 | Ga0496109_0453695_96_878 | 258 |
| 1213 | 3300048913 | Ga0496110_0024038 | Ga0496110_0024038_2034_2810 | 258 |
| 1214 | 3300048913 | Ga0496110_0030989 | Ga0496110_0030989_258_1034 | 258 |
| 1215 | 3300048913 | Ga0496110_0037915 | Ga0496110_0037915_1015_1797 | 258 |
| 1216 | 3300048913 | Ga0496110_0292335 | Ga0496110_0292335_421_1200 | 258 |
| 1217 | 3300048914 | Ga0496111_0017001 | Ga0496111_0017001_1373_2149 | 258 |
| 1218 | 3300048914 | Ga0496111_0036092 | Ga0496111_0036092_1360_2136 | 258 |
| 1219 | 3300048915 | Ga0496112_0047020 | Ga0496112_0047020_551_1333 | 258 |
| 1220 | 3300048915 | Ga0496112_0128607 | Ga0496112_0128607_1399_2175 | 258 |
| 1221 | 3300048915 | Ga0496112_0145141 | Ga0496112_0145141_1528_2304 | 258 |
| 1222 | 3300048917 | Ga0496114_0018456 | Ga0496114_0018456_2359_3135 | 258 |
| 1223 | 3300048920 | Ga0496117_0002582 | Ga0496117_0002582_21194_21976 | 258 |
| 1224 | 3300048921 | Ga0496118_0002912 | Ga0496118_0002912_10083_10865 | 258 |
| 1225 | 3300048921 | Ga0496118_0138530 | Ga0496118_0138530_437_1219 | 258 |
| 1226 | 3300048924 | Ga0496121_0001731 | Ga0496121_0001731_34121_34900 | 258 |
| 1227 | 3300048927 | Ga0496124_0051010 | Ga0496124_0051010_2039_2818 | 258 |
| 1228 | 3300048928 | Ga0496125_0007726 | Ga0496125_0007726_6499_7278 | 258 |
| 1229 | 3300048928 | Ga0496125_0100672 | Ga0496125_0100672_317_1096 | 258 |
| 1230 | 3300049572 | Ga0501036_0141693 | Ga0501036_0141693_92_874 | 258 |
| 1231 | 3300049580 | Ga0501046_0001880 | Ga0501046_0001880_16747_17523 | 258 |
| 1232 | 3300049581 | Ga0501047_0047668 | Ga0501047_0047668_481_1257 | 258 |
| 1233 | 3300049581 | Ga0501047_0169371 | Ga0501047_0169371_620_1396 | 258 |
| 1234 | 3300049583 | Ga0501067_0010788 | Ga0501067_0010788_1924_2700 | 258 |
| 1235 | 3300049583 | Ga0501067_0167473 | Ga0501067_0167473_259_1077 | 258 |
| 1236 | 3300049586 | Ga0501070_0274753 | Ga0501070_0274753_237_1019 | 258 |
| 1237 | 3300049742 | Ga0501080_0201871 | Ga0501080_0201871_505_1284 | 258 |
| 1238 | 3300049744 | Ga0501083_0050819 | Ga0501083_0050819_1650_2429 | 258 |
| 1239 | 3300049823 | Ga0501044_0199410 | Ga0501044_0199410_712_1488 | 258 |
| 1240 | 3300049823 | Ga0501044_0599599 | Ga0501044_0599599_52_828 | 258 |
| 1241 | 3300050496 | nmdc:mga07m45_291084_c1 | nmdc:mga07m45_291084_c1_53_835 | 258 |
| 1242 | 3300050507 | nmdc:mga05p37_565804_c1 | nmdc:mga05p37_565804_c1_165_941 | 258 |
| 1243 | 3300050510 | nmdc:mga06r32_139724_c1 | nmdc:mga06r32_139724_c1_817_1593 | 258 |
| 1244 | 3300050510 | nmdc:mga06r32_73504_c1 | nmdc:mga06r32_73504_c1_1447_2223 | 258 |
| 1245 | 3300050511 | nmdc:mga08y16_147138_c1 | nmdc:mga08y16_147138_c1_1236_2012 | 258 |
| 1246 | 3300050511 | nmdc:mga08y16_239051_c1 | nmdc:mga08y16_239051_c1_378_1154 | 258 |
| 1247 | 3300050511 | nmdc:mga08y16_276208_c1 | nmdc:mga08y16_276208_c1_205_981 | 258 |
| 1248 | 3300050511 | nmdc:mga08y16_672347_c1 | nmdc:mga08y16_672347_c1_113_889 | 258 |
| 1249 | 3300050512 | nmdc:mga0n895_116657_c1 | nmdc:mga0n895_116657_c1_271_1047 | 258 |
| 1250 | 3300050512 | nmdc:mga0n895_39655_c1 | nmdc:mga0n895_39655_c1_1042_1818 | 258 |
| 1251 | 3300050513 | nmdc:mga0rr50_307731_c1 | nmdc:mga0rr50_307731_c1_515_1291 | 258 |
| 1252 | 3300050514 | nmdc:mga08x19_109026_c1 | nmdc:mga08x19_109026_c1_399_1178 | 258 |
| 1253 | 3300050514 | nmdc:mga08x19_60991_c1 | nmdc:mga08x19_60991_c1_32_808 | 258 |
| 1254 | 3300050515 | nmdc:mga0a205_2472_c1 | nmdc:mga0a205_2472_c1_13765_14541 | 258 |
| 1255 | 3300050515 | nmdc:mga0a205_61465_c1 | nmdc:mga0a205_61465_c1_631_1407 | 258 |
| 1256 | 3300053083 | Ga0495655_0000902 | Ga0495655_0000902_2104_2880 | 258 |
| 1257 | 3300053085 | Ga0495619_0294433 | Ga0495619_0294433_182_964 | 258 |
| 1258 | 3300053125 | Ga0500618_015233 | Ga0500618_015233_650_1432 | 258 |
| 1259 | 3300053148 | Ga0500590_011367 | Ga0500590_011367_2221_3003 | 258 |
| 1260 | 3300054114 | Ga0501084_0091452 | Ga0501084_0091452_139_918 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8dt1-assembly1.cif.gz_C | crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad | 0.9739 | 2 | 257 |
| 4trr-assembly2.cif.gz_G | crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 | 0.9716 | 5 | 257 |
| 8dt1-assembly1.cif.gz_C | crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad | 0.9664 | 2 | 257 |
| 6zzq-assembly1.cif.gz_A | crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and acetoacetate | 0.9653 | 3 | 254 |
| 5cej-assembly1.cif.gz_A | the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.50a resolution | 0.9638 | 2 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4trrG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9716 | 5 | 257 | 3.40.50.720 |
| 4trrG00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9631 | 5 | 257 | 3.40.50.720 |
| af_Q6PKH6_18_219_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9619 | 6 | 179 | 3.40.50.720 |
| 4trrC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9617 | 2 | 257 | 3.40.50.720 |
| 5itvD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9537 | 6 | 249 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-T0YFG4-F1-model_v4 | D-beta-hydroxybutyrate dehydrogenase | 0.9839 | 5 | 235 |
GO:0016491
|
| AF-A0A2H0I9M2-F1-model_v4 | 3-hydroxybutyrate dehydrogenase (EC 1.1.1.30) | 0.9806 | 5 | 257 |
GO:0003858
|
| AF-A0A504F657-F1-model_v4 | deleted | 0.9794 | 1 | 257 |
|
| AF-T1AIA8-F1-model_v4 | 3-hydroxybutyrate dehydrogenase | 0.9789 | 2 | 244 |
GO:0003858
|
| AF-A0A504F657-F1-model_v4 | deleted | 0.9756 | 1 | 257 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar