F492292

General Info

Members Datasets Scaffolds Average Seq Length
1260 294 1258 267

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100097470|Ga0070682_1000974701
Length 312
Sequence MRSSVHDIFEHSLQNTRPVACGRAPQPIVGGAVNDQSLNDPSSQWVRFAPGNPVLKGVNWGGLRTLYIKEVRRFFKVQMQTVWAPAITTLLYLAIFTVALGRGGRAVMGVPYATFIAPGLIVMAMMQNAFANASFSLLVGKIQGNIVDYLMPPLSTGELMAGLIGAAVTRAFFVGFAVWVVMLLWPGVSVDMRRPELVLWFGLMGALLLSFLGLLTSLWADKFDHAAAVTNFVVTPLSLLSGTFYSVKQLAPAFRQVSHANPFFYVISGFRAGFLGTSDSPLLVGAIGLLVLNVVLWATCYSLLRSGWKIKN

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
181 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
182 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
210 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
215 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
216 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
217 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
218 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
219 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
220 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
221 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
226 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
238 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
248 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
249 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
261 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
262 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
276 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
277 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
278 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
279 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
280 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
283 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
284 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
288 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
293 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.08
Isolates 0.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 3.49
Rhizosphere 94.68
Stem 0
Stem Tuber 0.08
Unclassified 1.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1004447 3300001904 Bacteria 2394
2 JGI24741J21665_1006848 3300001915 Bacteria 2253
3 JGI24740J21852_10002906 3300001979 Bacteria 7642
4 JGI24740J21852_10008094 3300001979 Bacteria 4220
5 JGI24740J21852_10009823 3300001979 Bacteria 3722
6 JGI24739J22299_10002230 3300001989 Bacteria 7444
7 JGI24739J22299_10007982 3300001989 Bacteria 3961
8 JGI24739J22299_10011188 3300001989 Bacteria 3315
9 JGI24739J22299_10024453 3300001989 Bacteria 2129
10 JGI24737J22298_10000139 3300001990 Bacteria 22332
11 JGI24737J22298_10015978 3300001990 Bacteria 2424
12 JGI24743J22301_10001317 3300001991 Bacteria 3400
13 JGI24735J21928_10009291 3300002067 Bacteria 3161
14 JGI24735J21928_10014992 3300002067 Bacteria 2422
15 JGI24735J21928_10015843 3300002067 Bacteria 2346
16 JGI24735J21928_10017835 3300002067 Bacteria 2193
17 JGI24735J21928_10039117 3300002067 Bacteria 1387
18 JGI24738J21930_10004711 3300002075 Bacteria 3322
19 JGI24738J21930_10006319 3300002075 Bacteria 2788
20 JGI24738J21930_10009356 3300002075 Bacteria 2207
21 JGI24749J21850_1003461 3300002076 Bacteria 2208
22 JGI24034J26672_10012066 3300002239 Bacteria 1300
23 JGI24034J26672_10016656 3300002239 Bacteria 1134
24 Ga0065714_10165085 3300005288 Bacteria 1032
25 Ga0065712_10118971 3300005290 Bacteria 1699
26 Ga0065712_10120246 3300005290 Bacteria 1681
27 Ga0065715_10032864 3300005293 Bacteria 1608
28 Ga0065715_10096139 3300005293 Bacteria 3933
29 Ga0065715_10137338 3300005293 Bacteria 1908
30 Ga0065715_10225146 3300005293 Bacteria 1256
31 Ga0065715_10245126 3300005293 Bacteria 1186
32 Ga0065715_10291120 3300005293 Bacteria 1063
33 Ga0065707_10238438 3300005295 Bacteria 1164
34 Ga0070658_10000165 3300005327 Bacteria 57646
35 Ga0070658_10000804 3300005327 Bacteria 26833
36 Ga0070658_10025945 3300005327 Bacteria 4701
37 Ga0070658_10039745 3300005327 Bacteria 3795
38 Ga0070658_10049990 3300005327 Bacteria 3388
39 Ga0070658_10092713 3300005327 Bacteria 2490
40 Ga0070658_10101099 3300005327 Bacteria 2383
41 Ga0070658_10136282 3300005327 Bacteria 2048
42 Ga0070658_10208406 3300005327 Bacteria 1651
43 Ga0070658_10289437 3300005327 Bacteria 1396
44 Ga0070658_10314113 3300005327 Bacteria 1337
45 Ga0070658_10355880 3300005327 Bacteria 1254
46 Ga0070658_10364852 3300005327 Bacteria 1237
47 Ga0070676_10015522 3300005328 Bacteria 4203
48 Ga0070676_10056365 3300005328 Bacteria 2322
49 Ga0070676_10144642 3300005328 Bacteria 1517
50 Ga0070683_100003336 3300005329 Bacteria 12986
51 Ga0070683_100050095 3300005329 Bacteria 3865
52 Ga0070683_100059774 3300005329 Bacteria 3541
53 Ga0070683_100119834 3300005329 Bacteria 2485
54 Ga0070683_100156381 3300005329 Bacteria 2162
55 Ga0070690_100018415 3300005330 Bacteria 4218
56 Ga0070690_100134171 3300005330 Bacteria 1675
57 Ga0070670_100000565 3300005331 Bacteria 29356
58 Ga0070670_100005098 3300005331 Bacteria 11056
59 Ga0070670_100005115 3300005331 Bacteria 11042
60 Ga0070670_100007045 3300005331 Bacteria 9531
61 Ga0070670_100008555 3300005331 Bacteria 8731
62 Ga0070670_100013608 3300005331 Bacteria 6971
63 Ga0070670_100032318 3300005331 Bacteria 4507
64 Ga0070670_100061675 3300005331 Bacteria 3218
65 Ga0070670_100074052 3300005331 Bacteria 2925
66 Ga0070670_100109018 3300005331 Bacteria 2386
67 Ga0070670_100161526 3300005331 Bacteria 1942
68 Ga0070670_100215110 3300005331 Bacteria 1671
69 Ga0070670_100249124 3300005331 Bacteria 1547
70 Ga0070677_10020221 3300005333 Bacteria 2423
71 Ga0068869_100002989 3300005334 Bacteria 10272
72 Ga0068869_100033661 3300005334 Bacteria 3619
73 Ga0068869_100408801 3300005334 Bacteria 1118
74 Ga0070666_10000423 3300005335 Bacteria 26213
75 Ga0070666_10004162 3300005335 Bacteria 8777
76 Ga0070666_10183635 3300005335 Bacteria 1468
77 Ga0070680_100001732 3300005336 Bacteria 16030
78 Ga0070680_100036751 3300005336 Bacteria 3957
79 Ga0070680_100091083 3300005336 Bacteria 2524
80 Ga0070682_100019049 3300005337 Bacteria 4020
81 Ga0070682_100052340 3300005337 Bacteria 2555
82 Ga0070682_100097470 3300005337 Bacteria 1935
83 Ga0068868_100003061 3300005338 Bacteria 11644
84 Ga0068868_100004040 3300005338 Bacteria 10226
85 Ga0070660_100000009 3300005339 Bacteria 145691
86 Ga0070660_100000429 3300005339 Bacteria 27818
87 Ga0070660_100005146 3300005339 Bacteria 9039
88 Ga0070660_100005432 3300005339 Bacteria 8827
89 Ga0070660_100005487 3300005339 Bacteria 8785
90 Ga0070660_100032084 3300005339 Bacteria 3950
91 Ga0070660_100069919 3300005339 Bacteria 2739
92 Ga0070660_100144902 3300005339 Bacteria 1907
93 Ga0070660_100147808 3300005339 Bacteria 1888
94 Ga0070660_100163503 3300005339 Bacteria 1794
95 Ga0070660_100169390 3300005339 Bacteria 1763
96 Ga0070691_10001631 3300005341 Bacteria 9729
97 Ga0070687_100102108 3300005343 Bacteria 1608
98 Ga0070661_100000001 3300005344 Bacteria 424830
99 Ga0070661_100000214 3300005344 Bacteria 48180
100 Ga0070661_100004946 3300005344 Bacteria 9176
101 Ga0070661_100025047 3300005344 Bacteria 4285
102 Ga0070661_100047264 3300005344 Bacteria 3149
103 Ga0070661_100083614 3300005344 Bacteria 2358
104 Ga0070661_100308926 3300005344 Bacteria 1232
105 Ga0070692_10055067 3300005345 Bacteria 2079
106 Ga0070692_10082197 3300005345 Bacteria 1737
107 Ga0070668_100002562 3300005347 Bacteria 13364
108 Ga0070668_100004445 3300005347 Bacteria 10405
109 Ga0070668_100007507 3300005347 Bacteria 8095
110 Ga0070668_100013121 3300005347 Bacteria 6176
111 Ga0070668_100055350 3300005347 Bacteria 3061
112 Ga0070668_100080246 3300005347 Bacteria 2556
113 Ga0070668_100095873 3300005347 Bacteria 2344
114 Ga0070668_100114623 3300005347 Bacteria 2148
115 Ga0070668_100167285 3300005347 Bacteria 1788
116 Ga0070669_100006697 3300005353 Bacteria 8293
117 Ga0070669_100012028 3300005353 Bacteria 6140
118 Ga0070669_100032977 3300005353 Bacteria 3743
119 Ga0070669_100072572 3300005353 Bacteria 2548
120 Ga0070669_100087671 3300005353 Bacteria 2327
121 Ga0070669_100100399 3300005353 Bacteria 2182
122 Ga0070669_100121568 3300005353 Bacteria 1993
123 Ga0070669_100168716 3300005353 Bacteria 1705
124 Ga0070669_100212520 3300005353 Bacteria 1527
125 Ga0070675_100005812 3300005354 Bacteria 9445
126 Ga0070675_100030416 3300005354 Bacteria 4360
127 Ga0070675_100042513 3300005354 Bacteria 3713
128 Ga0070675_100055591 3300005354 Bacteria 3259
129 Ga0070675_100078772 3300005354 Bacteria 2745
130 Ga0070675_100146227 3300005354 Bacteria 2024
131 Ga0070671_100000302 3300005355 Bacteria 33420
132 Ga0070671_100002117 3300005355 Bacteria 15308
133 Ga0070671_100003170 3300005355 Bacteria 12820
134 Ga0070671_100008472 3300005355 Bacteria 8241
135 Ga0070671_100013424 3300005355 Bacteria 6604
136 Ga0070671_100023002 3300005355 Bacteria 5093
137 Ga0070671_100023014 3300005355 Bacteria 5092
138 Ga0070671_100026823 3300005355 Bacteria 4738
139 Ga0070671_100027854 3300005355 Bacteria 4651
140 Ga0070671_100031855 3300005355 Bacteria 4358
141 Ga0070671_100060803 3300005355 Bacteria 3145
142 Ga0070671_100079136 3300005355 Bacteria 2747
143 Ga0070671_100194681 3300005355 Bacteria 1719
144 Ga0070671_100268416 3300005355 Bacteria 1450
145 Ga0070674_100019850 3300005356 Bacteria 4279
146 Ga0070674_100021874 3300005356 Bacteria 4115
147 Ga0070674_100030349 3300005356 Bacteria 3571
148 Ga0070674_100267219 3300005356 Bacteria 1350
149 Ga0070674_100377919 3300005356 Bacteria 1152
150 Ga0070673_100000446 3300005364 Bacteria 21860
151 Ga0070673_100002366 3300005364 Bacteria 11468
152 Ga0070673_100050226 3300005364 Bacteria 3260
153 Ga0070673_100060636 3300005364 Bacteria 2999
154 Ga0070673_100105755 3300005364 Bacteria 2326
155 Ga0070659_100000048 3300005366 Bacteria 98245
156 Ga0070659_100001857 3300005366 Bacteria 15173
157 Ga0070659_100014336 3300005366 Bacteria 5922
158 Ga0070659_100018069 3300005366 Bacteria 5318
159 Ga0070659_100067314 3300005366 Bacteria 2840
160 Ga0070659_100075744 3300005366 Bacteria 2682
161 Ga0070659_100076411 3300005366 Bacteria 2670
162 Ga0070659_100096278 3300005366 Bacteria 2377
163 Ga0070659_100520096 3300005366 Bacteria 1016
164 Ga0070667_100004203 3300005367 Bacteria 12160
165 Ga0070667_100006180 3300005367 Bacteria 9958
166 Ga0070667_100011252 3300005367 Bacteria 7401
167 Ga0070667_100026229 3300005367 Bacteria 4846
168 Ga0070667_100049786 3300005367 Bacteria 3530
169 Ga0070667_100056942 3300005367 Bacteria 3302
170 Ga0070667_100062711 3300005367 Bacteria 3149
171 Ga0070667_100119731 3300005367 Bacteria 2289
172 Ga0070667_100176732 3300005367 Bacteria 1887
173 Ga0070714_100036648 3300005435 Bacteria 4115
174 Ga0070714_100044040 3300005435 Bacteria 3777
175 Ga0070714_100044444 3300005435 Bacteria 3761
176 Ga0070714_100159767 3300005435 Bacteria 2038
177 Ga0070713_100066402 3300005436 Bacteria 3033
178 Ga0070713_100115266 3300005436 Bacteria 2348
179 Ga0070713_100170080 3300005436 Bacteria 1952
180 Ga0070713_100208345 3300005436 Bacteria 1769
181 Ga0070710_10147582 3300005437 Bacteria 1448
182 Ga0070694_100015348 3300005444 Bacteria 4809
183 Ga0070663_100000206 3300005455 Bacteria 29502
184 Ga0070663_100037040 3300005455 Bacteria 3393
185 Ga0070663_100067226 3300005455 Bacteria 2599
186 Ga0070663_100071893 3300005455 Bacteria 2518
187 Ga0070663_100131878 3300005455 Bacteria 1898
188 Ga0070663_100158962 3300005455 Bacteria 1738
189 Ga0070663_100288300 3300005455 Bacteria 1310
190 Ga0070663_100560893 3300005455 Bacteria 956
191 Ga0070678_100003888 3300005456 Bacteria 8392
192 Ga0070678_100044207 3300005456 Bacteria 3179
193 Ga0070678_100062773 3300005456 Bacteria 2745
194 Ga0070678_100098224 3300005456 Bacteria 2263
195 Ga0070678_100349104 3300005456 Bacteria 1271
196 Ga0070662_100000302 3300005457 Bacteria 29280
197 Ga0070662_100000345 3300005457 Bacteria 27859
198 Ga0070662_100002479 3300005457 Bacteria 11367
199 Ga0070662_100009736 3300005457 Bacteria 6291
200 Ga0070662_100013277 3300005457 Bacteria 5479
201 Ga0070662_100016893 3300005457 Bacteria 4906
202 Ga0070662_100020078 3300005457 Bacteria 4548
203 Ga0070662_100029368 3300005457 Bacteria 3837
204 Ga0070662_100111745 3300005457 Bacteria 2082
205 Ga0070662_100166496 3300005457 Bacteria 1728
206 Ga0070681_10013716 3300005458 Bacteria 8066
207 Ga0070681_10193772 3300005458 Bacteria 1951
208 Ga0070681_10202318 3300005458 Bacteria 1904
209 Ga0070681_10225772 3300005458 Bacteria 1787
210 Ga0070681_10271088 3300005458 Bacteria 1609
211 Ga0068867_100007689 3300005459 Bacteria 7625
212 Ga0068867_100012614 3300005459 Bacteria 5977
213 Ga0068867_100017188 3300005459 Bacteria 5138
214 Ga0068867_100207122 3300005459 Bacteria 1573
215 Ga0068867_100358122 3300005459 Bacteria 1219
216 Ga0070679_100000084 3300005530 Bacteria 70823
217 Ga0070679_100014277 3300005530 Bacteria 7626
218 Ga0070679_100092209 3300005530 Bacteria 3017
219 Ga0070679_100095663 3300005530 Bacteria 2958
220 Ga0070679_100334217 3300005530 Bacteria 1463
221 Ga0070679_100391765 3300005530 Bacteria 1335
222 Ga0070684_100003783 3300005535 Bacteria 11427
223 Ga0070684_100007150 3300005535 Bacteria 8672
224 Ga0068853_100000128 3300005539 Bacteria 51089
225 Ga0068853_100039582 3300005539 Bacteria 4021
226 Ga0068853_100075776 3300005539 Bacteria 2936
227 Ga0068853_100082827 3300005539 Bacteria 2810
228 Ga0068853_100250815 3300005539 Bacteria 1624
229 Ga0068853_100457660 3300005539 Bacteria 1200
230 Ga0070672_100000670 3300005543 Bacteria 20133
231 Ga0070672_100006530 3300005543 Bacteria 7841
232 Ga0070672_100036136 3300005543 Bacteria 3762
233 Ga0070672_100054890 3300005543 Bacteria 3120
234 Ga0070672_100071809 3300005543 Bacteria 2754
235 Ga0070672_100095072 3300005543 Bacteria 2410
236 Ga0070672_100138028 3300005543 Bacteria 2009
237 Ga0070672_100139635 3300005543 Bacteria 1998
238 Ga0070672_100147662 3300005543 Bacteria 1944
239 Ga0070672_100168067 3300005543 Bacteria 1823
240 Ga0070672_100187909 3300005543 Bacteria 1724
241 Ga0070672_100243242 3300005543 Bacteria 1514
242 Ga0070672_100335124 3300005543 Bacteria 1287
243 Ga0070693_100044724 3300005547 Bacteria 2506
244 Ga0070665_100000605 3300005548 Bacteria 49400
245 Ga0070665_100005049 3300005548 Bacteria 13693
246 Ga0070665_100007376 3300005548 Bacteria 11185
247 Ga0070665_100027403 3300005548 Bacteria 5740
248 Ga0070665_100030202 3300005548 Bacteria 5454
249 Ga0070704_100087704 3300005549 Bacteria 2310
250 Ga0070704_100465225 3300005549 Bacteria 1092
251 Ga0068855_100000140 3300005563 Bacteria 92525
252 Ga0068855_100000666 3300005563 Bacteria 41911
253 Ga0068855_100049100 3300005563 Bacteria 4978
254 Ga0068855_100081594 3300005563 Bacteria 3748
255 Ga0068855_100151136 3300005563 Bacteria 2640
256 Ga0068855_100208357 3300005563 Bacteria 2198
257 Ga0068855_100496453 3300005563 Bacteria 1327
258 Ga0068855_100802288 3300005563 Bacteria 1000
259 Ga0070664_100000103 3300005564 Bacteria 54853
260 Ga0070664_100001162 3300005564 Bacteria 20890
261 Ga0070664_100001609 3300005564 Bacteria 18072
262 Ga0070664_100004837 3300005564 Bacteria 10791
263 Ga0070664_100009061 3300005564 Bacteria 8075
264 Ga0070664_100049406 3300005564 Bacteria 3557
265 Ga0070664_100052475 3300005564 Bacteria 3454
266 Ga0070664_100095632 3300005564 Bacteria 2576
267 Ga0070664_100115721 3300005564 Bacteria 2344
268 Ga0070664_100219049 3300005564 Bacteria 1702
269 Ga0070664_100240107 3300005564 Bacteria 1626
270 Ga0070664_100382111 3300005564 Bacteria 1286
271 Ga0068857_100003151 3300005577 Bacteria 13663
272 Ga0068857_100009399 3300005577 Bacteria 8487
273 Ga0068857_100012357 3300005577 Bacteria 7430
274 Ga0068857_100015117 3300005577 Bacteria 6737
275 Ga0068857_100019208 3300005577 Bacteria 5999
276 Ga0068857_100039354 3300005577 Bacteria 4187
277 Ga0068857_100081405 3300005577 Bacteria 2891
278 Ga0068857_100454505 3300005577 Bacteria 1198
279 Ga0068854_100001009 3300005578 Bacteria 16924
280 Ga0068854_100003456 3300005578 Bacteria 9860
281 Ga0068854_100004613 3300005578 Bacteria 8693
282 Ga0068854_100017009 3300005578 Bacteria 4859
283 Ga0068854_100050577 3300005578 Bacteria 2974
284 Ga0068854_100075785 3300005578 Bacteria 2471
285 Ga0068854_100242229 3300005578 Bacteria 1436
286 Ga0068854_100466333 3300005578 Bacteria 1058
287 Ga0068856_100000628 3300005614 Bacteria 38462
288 Ga0068856_100021267 3300005614 Bacteria 6302
289 Ga0068856_100024245 3300005614 Bacteria 5903
290 Ga0068856_100059021 3300005614 Bacteria 3789
291 Ga0068856_100073821 3300005614 Bacteria 3377
292 Ga0068856_100076694 3300005614 Bacteria 3311
293 Ga0068856_100178943 3300005614 Bacteria 2133
294 Ga0068856_100392934 3300005614 Bacteria 1406
295 Ga0068852_100001277 3300005616 Bacteria 16798
296 Ga0068852_100001407 3300005616 Bacteria 16208
297 Ga0068852_100004746 3300005616 Bacteria 9649
298 Ga0068852_100038648 3300005616 Bacteria 4013
299 Ga0068852_100072463 3300005616 Bacteria 3028
300 Ga0068852_100095737 3300005616 Bacteria 2667
301 Ga0068852_100114563 3300005616 Bacteria 2456
302 Ga0068852_100161001 3300005616 Bacteria 2096
303 Ga0068859_100000783 3300005617 Bacteria 32120
304 Ga0068859_100013013 3300005617 Bacteria 8359
305 Ga0068859_100030472 3300005617 Bacteria 5413
306 Ga0068859_100038948 3300005617 Bacteria 4768
307 Ga0068859_100101150 3300005617 Bacteria 2939
308 Ga0068864_100002274 3300005618 Bacteria 15886
309 Ga0068864_100004543 3300005618 Bacteria 11396
310 Ga0068864_100004580 3300005618 Bacteria 11350
311 Ga0068864_100004721 3300005618 Bacteria 11162
312 Ga0068864_100021186 3300005618 Bacteria 5444
313 Ga0068864_100069351 3300005618 Bacteria 3065
314 Ga0068864_100086258 3300005618 Bacteria 2762
315 Ga0068864_100138710 3300005618 Bacteria 2192
316 Ga0068864_100384687 3300005618 Bacteria 1330
317 Ga0068866_10151943 3300005718 Bacteria 1342
318 Ga0068861_100040413 3300005719 Bacteria 3489
319 Ga0068861_100100439 3300005719 Bacteria 2300
320 Ga0068851_10003456 3300005834 Bacteria 7031
321 Ga0068851_10063439 3300005834 Bacteria 1897
322 Ga0068851_10070343 3300005834 Bacteria 1809
323 Ga0068851_10187718 3300005834 Bacteria 1148
324 Ga0068851_10191567 3300005834 Bacteria 1137
325 Ga0068851_10205219 3300005834 Bacteria 1102
326 Ga0068851_10217249 3300005834 Bacteria 1073
327 Ga0068863_100003427 3300005841 Bacteria 15621
328 Ga0068863_100009975 3300005841 Bacteria 9246
329 Ga0068863_100017729 3300005841 Bacteria 6815
330 Ga0068863_100021803 3300005841 Bacteria 6113
331 Ga0068863_100064619 3300005841 Bacteria 3461
332 Ga0068863_100216234 3300005841 Bacteria 1846
333 Ga0068863_100294703 3300005841 Bacteria 1573
334 Ga0068858_100005027 3300005842 Bacteria 12960
335 Ga0068858_100005309 3300005842 Bacteria 12632
336 Ga0068858_100036151 3300005842 Bacteria 4580
337 Ga0068858_100045941 3300005842 Bacteria 4049
338 Ga0068858_100064677 3300005842 Bacteria 3385
339 Ga0068860_100002617 3300005843 Bacteria 18717
340 Ga0068860_100007249 3300005843 Bacteria 11088
341 Ga0068860_100109447 3300005843 Bacteria 2641
342 Ga0068860_100153319 3300005843 Bacteria 2220
343 Ga0068860_100173922 3300005843 Bacteria 2081
344 Ga0068860_100549689 3300005843 Bacteria 1157
345 Ga0068862_100016580 3300005844 Bacteria 6135
346 Ga0068862_100024556 3300005844 Bacteria 5058
347 Ga0068862_100027358 3300005844 Bacteria 4800
348 Ga0068862_100096812 3300005844 Bacteria 2576
349 Ga0068862_100179958 3300005844 Bacteria 1897
350 Ga0068862_100443867 3300005844 Bacteria 1222
351 Ga0068862_100518708 3300005844 Bacteria 1134
352 Ga0081455_10003938 3300005937 Bacteria 16882
353 Ga0081539_10033794 3300005985 Bacteria 3106
354 Ga0070717_10002536 3300006028 Bacteria 12862
355 Ga0070717_10015027 3300006028 Bacteria 5966
356 Ga0070716_100038236 3300006173 Bacteria 2656
357 Ga0070712_100141631 3300006175 Bacteria 1836
358 Ga0097621_100084268 3300006237 Bacteria 2650
359 Ga0097621_100213125 3300006237 Bacteria 1681
360 Ga0097621_100219928 3300006237 Bacteria 1655
361 Ga0068871_100015704 3300006358 Bacteria 5679
362 Ga0068871_100169888 3300006358 Bacteria 1868
363 Ga0068871_100473257 3300006358 Bacteria 1126
364 Ga0075428_100038713 3300006844 Bacteria 5247
365 Ga0075431_100452277 3300006847 Bacteria 1280
366 Ga0068865_100045625 3300006881 Bacteria 3005
367 Ga0068865_100109619 3300006881 Bacteria 2034
368 Ga0097620_100000783 3300006931 Bacteria 32120
369 Ga0097620_100013013 3300006931 Bacteria 8359
370 Ga0097620_100030475 3300006931 Bacteria 5413
371 Ga0097620_100038948 3300006931 Bacteria 4768
372 Ga0097620_100101160 3300006931 Bacteria 2939
373 Ga0105250_10019818 3300009092 Bacteria 2721
374 Ga0105240_10016469 3300009093 Bacteria 10006
375 Ga0105240_10039898 3300009093 Bacteria 6009
376 Ga0105240_10201997 3300009093 Bacteria 2328
377 Ga0105240_10226233 3300009093 Bacteria 2177
378 Ga0105240_10230587 3300009093 Bacteria 2152
379 Ga0111539_10123895 3300009094 Bacteria 3029
380 Ga0111539_10149841 3300009094 Bacteria 2731
381 Ga0105245_10001091 3300009098 Bacteria 24614
382 Ga0105245_10013322 3300009098 Bacteria 7165
383 Ga0105245_10069474 3300009098 Bacteria 3194
384 Ga0105243_10038205 3300009148 Bacteria 3738
385 Ga0105243_10071926 3300009148 Bacteria 2798
386 Ga0105241_10062098 3300009174 Bacteria 2879
387 Ga0105248_10000414 3300009177 Bacteria 49092
388 Ga0105248_10003086 3300009177 Bacteria 18472
389 Ga0105248_10004063 3300009177 Bacteria 16164
390 Ga0105248_10004387 3300009177 Bacteria 15613
391 Ga0105248_10004884 3300009177 Bacteria 14818
392 Ga0105248_10010962 3300009177 Bacteria 10002
393 Ga0105248_10023881 3300009177 Bacteria 6795
394 Ga0105248_10060357 3300009177 Bacteria 4257
395 Ga0105248_10097014 3300009177 Bacteria 3321
396 Ga0105248_10121245 3300009177 Bacteria 2950
397 Ga0105248_10122183 3300009177 Bacteria 2937
398 Ga0105248_10124780 3300009177 Bacteria 2904
399 Ga0105248_10144527 3300009177 Bacteria 2684
400 Ga0105248_10176069 3300009177 Bacteria 2411
401 Ga0105248_10327487 3300009177 Bacteria 1725
402 Ga0105248_10364518 3300009177 Bacteria 1627
403 Ga0105237_10007184 3300009545 Bacteria 12232
404 Ga0105237_10049017 3300009545 Bacteria 4246
405 Ga0105237_10205419 3300009545 Bacteria 1970
406 Ga0105238_10355514 3300009551 Bacteria 1454
407 Ga0105238_10762075 3300009551 Bacteria 982
408 Ga0105238_10794773 3300009551 Bacteria 961
409 Ga0105249_10013113 3300009553 Bacteria 7314
410 Ga0105239_10003490 3300010375 Bacteria 19248
411 Ga0105239_10055073 3300010375 Bacteria 4362
412 Ga0105246_10006307 3300011119 Bacteria 7237
413 Ga0157373_10010454 3300013100 Bacteria 6828
414 Ga0157373_10028028 3300013100 Bacteria 4063
415 Ga0157373_10032968 3300013100 Bacteria 3728
416 Ga0157373_10036176 3300013100 Bacteria 3545
417 Ga0157373_10073939 3300013100 Bacteria 2405
418 Ga0157373_10105319 3300013100 Bacteria 1984
419 Ga0157373_10138519 3300013100 Bacteria 1711
420 Ga0157373_10164863 3300013100 Bacteria 1559
421 Ga0157371_10011274 3300013102 Bacteria 6901
422 Ga0157371_10014122 3300013102 Bacteria 6040
423 Ga0157371_10033872 3300013102 Bacteria 3668
424 Ga0157371_10122715 3300013102 Bacteria 1847
425 Ga0157370_10023880 3300013104 Bacteria 6063
426 Ga0157370_10040745 3300013104 Bacteria 4484
427 Ga0157370_10065713 3300013104 Bacteria 3431
428 Ga0157370_10081270 3300013104 Bacteria 3050
429 Ga0157370_10132127 3300013104 Bacteria 2328
430 Ga0157370_10321581 3300013104 Bacteria 1427
431 Ga0157370_10418325 3300013104 Bacteria 1233
432 Ga0157369_10002210 3300013105 Bacteria 23437
433 Ga0157369_10007335 3300013105 Bacteria 12692
434 Ga0157369_10008463 3300013105 Bacteria 11801
435 Ga0157369_10055103 3300013105 Bacteria 4292
436 Ga0157369_10108916 3300013105 Bacteria 2946
437 Ga0157369_10122754 3300013105 Bacteria 2755
438 Ga0157369_10185040 3300013105 Bacteria 2191
439 Ga0157369_10368681 3300013105 Bacteria 1491
440 Ga0157374_10001807 3300013296 Bacteria 18013
441 Ga0157374_10038628 3300013296 Bacteria 4389
442 Ga0157374_10053157 3300013296 Bacteria 3775
443 Ga0157374_10108247 3300013296 Bacteria 2671
444 Ga0157378_10003531 3300013297 Bacteria 13864
445 Ga0157378_10677358 3300013297 Bacteria 1049
446 Ga0163162_10004797 3300013306 Bacteria 13047
447 Ga0163162_10022448 3300013306 Bacteria 6217
448 Ga0163162_10030691 3300013306 Bacteria 5326
449 Ga0163162_10251582 3300013306 Bacteria 1899
450 Ga0157372_10034736 3300013307 Bacteria 5546
451 Ga0157372_10198212 3300013307 Bacteria 2325
452 Ga0157372_10249372 3300013307 Bacteria 2061
453 Ga0157372_10369058 3300013307 Bacteria 1672
454 Ga0157375_10006148 3300013308 Bacteria 10462
455 Ga0157375_10008420 3300013308 Bacteria 9033
456 Ga0157375_10076847 3300013308 Bacteria 3367
457 Ga0157375_10131300 3300013308 Bacteria 2624
458 Ga0163163_10000192 3300014325 Bacteria 62963
459 Ga0163163_10000323 3300014325 Bacteria 46423
460 Ga0163163_10002333 3300014325 Bacteria 16040
461 Ga0157380_10003914 3300014326 Bacteria 10270
462 Ga0157380_10256975 3300014326 Bacteria 1585
463 Ga0157380_10265542 3300014326 Bacteria 1561
464 Ga0182008_10031700 3300014497 Bacteria 2658
465 Ga0157379_10003540 3300014968 Bacteria 13228
466 Ga0157379_10084203 3300014968 Bacteria 2850
467 Ga0157376_10513776 3300014969 Bacteria 1179
468 Ga0163161_10001527 3300017792 Bacteria 17114
469 Ga0163161_10069912 3300017792 Bacteria 2567
470 Ga0206353_12003655 3300020082 Bacteria 1179
471 Ga0213873_10000013 3300021358 Bacteria 206227
472 Ga0213876_10000072 3300021384 Bacteria 123469
473 Ga0213876_10000460 3300021384 Bacteria 32585
474 Ga0213876_10011874 3300021384 Bacteria 4644
475 Ga0213875_10002749 3300021388 Bacteria 10388
476 Ga0207673_1003596 3300025290 Bacteria 1821
477 Ga0207697_10000395 3300025315 Bacteria 24502
478 Ga0207697_10009638 3300025315 Bacteria 4160
479 Ga0207697_10013188 3300025315 Bacteria 3450
480 Ga0207697_10054347 3300025315 Bacteria 1659
481 Ga0207656_10011443 3300025321 Bacteria 3352
482 Ga0207656_10030771 3300025321 Bacteria 2219
483 Ga0207656_10043174 3300025321 Bacteria 1922
484 Ga0207656_10068210 3300025321 Bacteria 1575
485 Ga0207656_10112871 3300025321 Bacteria 1258
486 Ga0207656_10135006 3300025321 Bacteria 1159
487 Ga0207682_10000424 3300025893 Bacteria 19481
488 Ga0207692_10307918 3300025898 Bacteria 966
489 Ga0207642_10040231 3300025899 Bacteria 2038
490 Ga0207688_10003889 3300025901 Bacteria 8146
491 Ga0207680_10000597 3300025903 Bacteria 17032
492 Ga0207680_10003521 3300025903 Bacteria 7368
493 Ga0207680_10050640 3300025903 Bacteria 2479
494 Ga0207680_10078507 3300025903 Bacteria 2068
495 Ga0207680_10091063 3300025903 Bacteria 1940
496 Ga0207680_10103867 3300025903 Bacteria 1831
497 Ga0207647_10003357 3300025904 Bacteria 12007
498 Ga0207647_10006843 3300025904 Bacteria 8268
499 Ga0207647_10008719 3300025904 Bacteria 7243
500 Ga0207647_10042677 3300025904 Bacteria 2844
501 Ga0207647_10071363 3300025904 Bacteria 2095
502 Ga0207647_10073743 3300025904 Bacteria 2056
503 Ga0207647_10078337 3300025904 Bacteria 1985
504 Ga0207647_10126805 3300025904 Bacteria 1502
505 Ga0207647_10126821 3300025904 Bacteria 1502
506 Ga0207699_10184256 3300025906 Bacteria 1405
507 Ga0207645_10011052 3300025907 Bacteria 6177
508 Ga0207645_10027677 3300025907 Bacteria 3659
509 Ga0207645_10037388 3300025907 Bacteria 3115
510 Ga0207645_10061384 3300025907 Bacteria 2401
511 Ga0207645_10066518 3300025907 Bacteria 2304
512 Ga0207643_10021392 3300025908 Bacteria 3553
513 Ga0207643_10108335 3300025908 Bacteria 1634
514 Ga0207705_10000060 3300025909 Bacteria 152576
515 Ga0207705_10000429 3300025909 Bacteria 36649
516 Ga0207705_10000687 3300025909 Bacteria 28005
517 Ga0207705_10000762 3300025909 Bacteria 26613
518 Ga0207705_10008810 3300025909 Bacteria 7355
519 Ga0207705_10014722 3300025909 Bacteria 5624
520 Ga0207705_10021048 3300025909 Bacteria 4653
521 Ga0207705_10022831 3300025909 Bacteria 4461
522 Ga0207705_10031353 3300025909 Bacteria 3794
523 Ga0207705_10033183 3300025909 Bacteria 3688
524 Ga0207705_10036011 3300025909 Bacteria 3542
525 Ga0207705_10038909 3300025909 Bacteria 3407
526 Ga0207705_10045991 3300025909 Bacteria 3136
527 Ga0207705_10057449 3300025909 Bacteria 2806
528 Ga0207705_10057780 3300025909 Bacteria 2798
529 Ga0207705_10061791 3300025909 Bacteria 2706
530 Ga0207705_10092660 3300025909 Bacteria 2214
531 Ga0207705_10116834 3300025909 Bacteria 1975
532 Ga0207705_10233174 3300025909 Bacteria 1401
533 Ga0207705_10250320 3300025909 Bacteria 1351
534 Ga0207654_10108601 3300025911 Bacteria 1722
535 Ga0207707_10034868 3300025912 Bacteria 4402
536 Ga0207707_10092462 3300025912 Bacteria 2643
537 Ga0207707_10184944 3300025912 Bacteria 1818
538 Ga0207707_10196048 3300025912 Bacteria 1762
539 Ga0207695_10011772 3300025913 Bacteria 10569
540 Ga0207695_10030691 3300025913 Bacteria 5913
541 Ga0207695_10097999 3300025913 Bacteria 2932
542 Ga0207695_10099265 3300025913 Bacteria 2909
543 Ga0207695_10105662 3300025913 Bacteria 2803
544 Ga0207695_10141665 3300025913 Bacteria 2352
545 Ga0207671_10026576 3300025914 Bacteria 4335
546 Ga0207671_10065154 3300025914 Bacteria 2709
547 Ga0207693_10212377 3300025915 Bacteria 1521
548 Ga0207663_10090823 3300025916 Bacteria 2026
549 Ga0207660_10001596 3300025917 Bacteria 15213
550 Ga0207660_10014305 3300025917 Bacteria 5215
551 Ga0207660_10031891 3300025917 Bacteria 3634
552 Ga0207660_10047111 3300025917 Bacteria 3046
553 Ga0207660_10082343 3300025917 Bacteria 2367
554 Ga0207662_10004989 3300025918 Bacteria 7024
555 Ga0207657_10000328 3300025919 Bacteria 50486
556 Ga0207657_10004752 3300025919 Bacteria 14343
557 Ga0207657_10004948 3300025919 Bacteria 14020
558 Ga0207657_10008884 3300025919 Bacteria 10164
559 Ga0207657_10010107 3300025919 Bacteria 9433
560 Ga0207657_10013808 3300025919 Bacteria 7906
561 Ga0207657_10014902 3300025919 Bacteria 7560
562 Ga0207657_10019231 3300025919 Bacteria 6490
563 Ga0207657_10020685 3300025919 Bacteria 6212
564 Ga0207657_10036351 3300025919 Bacteria 4408
565 Ga0207657_10056273 3300025919 Bacteria 3394
566 Ga0207657_10057252 3300025919 Bacteria 3360
567 Ga0207657_10070120 3300025919 Bacteria 2971
568 Ga0207657_10090319 3300025919 Bacteria 2557
569 Ga0207657_10103324 3300025919 Bacteria 2362
570 Ga0207657_10115779 3300025919 Bacteria 2209
571 Ga0207657_10288831 3300025919 Bacteria 1301
572 Ga0207649_10000011 3300025920 Bacteria 266219
573 Ga0207649_10000266 3300025920 Bacteria 41245
574 Ga0207649_10013035 3300025920 Bacteria 4634
575 Ga0207649_10019707 3300025920 Bacteria 3860
576 Ga0207649_10021471 3300025920 Bacteria 3717
577 Ga0207649_10026333 3300025920 Bacteria 3401
578 Ga0207649_10029694 3300025920 Bacteria 3230
579 Ga0207649_10155062 3300025920 Bacteria 1581
580 Ga0207652_10000001 3300025921 Bacteria 1006643
581 Ga0207652_10000002 3300025921 Bacteria 878035
582 Ga0207652_10085533 3300025921 Bacteria 2764
583 Ga0207652_10212386 3300025921 Bacteria 1743
584 Ga0207652_10242988 3300025921 Bacteria 1623
585 Ga0207652_10272254 3300025921 Bacteria 1527
586 Ga0207652_10351317 3300025921 Bacteria 1331
587 Ga0207652_10457859 3300025921 Bacteria 1150
588 Ga0207681_10002274 3300025923 Bacteria 12206
589 Ga0207681_10005400 3300025923 Bacteria 7849
590 Ga0207681_10021946 3300025923 Bacteria 4066
591 Ga0207681_10116196 3300025923 Bacteria 1954
592 Ga0207681_10166783 3300025923 Bacteria 1665
593 Ga0207694_10114923 3300025924 Bacteria 2144
594 Ga0207694_10294401 3300025924 Bacteria 1335
595 Ga0207650_10000200 3300025925 Bacteria 69213
596 Ga0207650_10001521 3300025925 Bacteria 16585
597 Ga0207650_10012232 3300025925 Bacteria 5922
598 Ga0207650_10057707 3300025925 Bacteria 2888
599 Ga0207650_10074888 3300025925 Bacteria 2553
600 Ga0207650_10106894 3300025925 Bacteria 2161
601 Ga0207650_10128544 3300025925 Bacteria 1980
602 Ga0207650_10132473 3300025925 Bacteria 1952
603 Ga0207650_10151890 3300025925 Bacteria 1828
604 Ga0207650_10195166 3300025925 Bacteria 1619
605 Ga0207650_10211201 3300025925 Bacteria 1558
606 Ga0207650_10211400 3300025925 Bacteria 1558
607 Ga0207650_10218692 3300025925 Bacteria 1532
608 Ga0207650_10416111 3300025925 Bacteria 1114
609 Ga0207650_10440766 3300025925 Bacteria 1083
610 Ga0207659_10018207 3300025926 Bacteria 4601
611 Ga0207659_10060626 3300025926 Bacteria 2724
612 Ga0207659_10070408 3300025926 Bacteria 2551
613 Ga0207687_10168965 3300025927 Bacteria 1685
614 Ga0207687_10169946 3300025927 Bacteria 1681
615 Ga0207700_10119211 3300025928 Bacteria 2137
616 Ga0207700_10133337 3300025928 Bacteria 2031
617 Ga0207700_10172635 3300025928 Bacteria 1805
618 Ga0207664_10021829 3300025929 Bacteria 4770
619 Ga0207664_10073421 3300025929 Bacteria 2760
620 Ga0207664_10134865 3300025929 Bacteria 2082
621 Ga0207664_10242233 3300025929 Bacteria 1571
622 Ga0207644_10000181 3300025931 Bacteria 45051
623 Ga0207644_10013016 3300025931 Bacteria 5536
624 Ga0207644_10014716 3300025931 Bacteria 5242
625 Ga0207644_10041158 3300025931 Bacteria 3267
626 Ga0207644_10066731 3300025931 Bacteria 2620
627 Ga0207644_10073348 3300025931 Bacteria 2509
628 Ga0207644_10077258 3300025931 Bacteria 2451
629 Ga0207644_10099665 3300025931 Bacteria 2180
630 Ga0207644_10132253 3300025931 Bacteria 1911
631 Ga0207644_10147543 3300025931 Bacteria 1817
632 Ga0207644_10270913 3300025931 Bacteria 1360
633 Ga0207644_10293855 3300025931 Bacteria 1307
634 Ga0207644_10295328 3300025931 Bacteria 1304
635 Ga0207644_10389536 3300025931 Bacteria 1137
636 Ga0207690_10000036 3300025932 Bacteria 143853
637 Ga0207690_10023994 3300025932 Bacteria 3815
638 Ga0207690_10027150 3300025932 Bacteria 3615
639 Ga0207690_10043770 3300025932 Bacteria 2948
640 Ga0207690_10075659 3300025932 Bacteria 2335
641 Ga0207690_10095774 3300025932 Bacteria 2109
642 Ga0207690_10102191 3300025932 Bacteria 2049
643 Ga0207690_10244820 3300025932 Bacteria 1383
644 Ga0207690_10252149 3300025932 Bacteria 1364
645 Ga0207706_10000343 3300025933 Bacteria 50497
646 Ga0207706_10001570 3300025933 Bacteria 22655
647 Ga0207706_10003563 3300025933 Bacteria 14869
648 Ga0207706_10003918 3300025933 Bacteria 14116
649 Ga0207706_10004739 3300025933 Bacteria 12735
650 Ga0207706_10006042 3300025933 Bacteria 11264
651 Ga0207706_10007601 3300025933 Bacteria 10028
652 Ga0207706_10009525 3300025933 Bacteria 8919
653 Ga0207706_10011379 3300025933 Bacteria 8107
654 Ga0207706_10041829 3300025933 Bacteria 4062
655 Ga0207706_10064959 3300025933 Bacteria 3213
656 Ga0207706_10091257 3300025933 Bacteria 2678
657 Ga0207706_10293716 3300025933 Bacteria 1417
658 Ga0207669_10002778 3300025937 Bacteria 7508
659 Ga0207669_10003284 3300025937 Bacteria 6994
660 Ga0207669_10056622 3300025937 Bacteria 2382
661 Ga0207669_10074780 3300025937 Bacteria 2144
662 Ga0207669_10155785 3300025937 Bacteria 1606
663 Ga0207669_10192622 3300025937 Bacteria 1472
664 Ga0207669_10248356 3300025937 Bacteria 1323
665 Ga0207704_10040010 3300025938 Bacteria 2736
666 Ga0207704_10120005 3300025938 Bacteria 1797
667 Ga0207704_10282196 3300025938 Bacteria 1263
668 Ga0207665_10044030 3300025939 Bacteria 2986
669 Ga0207691_10002747 3300025940 Bacteria 17161
670 Ga0207691_10003655 3300025940 Bacteria 14921
671 Ga0207691_10034379 3300025940 Bacteria 4714
672 Ga0207691_10057118 3300025940 Bacteria 3553
673 Ga0207691_10070756 3300025940 Bacteria 3150
674 Ga0207691_10072694 3300025940 Bacteria 3102
675 Ga0207691_10141639 3300025940 Bacteria 2119
676 Ga0207691_10177614 3300025940 Bacteria 1862
677 Ga0207691_10212352 3300025940 Bacteria 1680
678 Ga0207691_10342504 3300025940 Bacteria 1279
679 Ga0207711_10000244 3300025941 Bacteria 58260
680 Ga0207711_10000529 3300025941 Bacteria 39087
681 Ga0207711_10001357 3300025941 Bacteria 23100
682 Ga0207711_10002916 3300025941 Bacteria 14997
683 Ga0207711_10003788 3300025941 Bacteria 13012
684 Ga0207711_10009311 3300025941 Bacteria 8198
685 Ga0207711_10012365 3300025941 Bacteria 7093
686 Ga0207711_10053199 3300025941 Bacteria 3472
687 Ga0207711_10079180 3300025941 Bacteria 2868
688 Ga0207711_10101797 3300025941 Bacteria 2542
689 Ga0207711_10138867 3300025941 Bacteria 2185
690 Ga0207711_10145478 3300025941 Bacteria 2135
691 Ga0207711_10153522 3300025941 Bacteria 2079
692 Ga0207689_10000064 3300025942 Bacteria 84222
693 Ga0207689_10009546 3300025942 Bacteria 8370
694 Ga0207689_10015354 3300025942 Bacteria 6484
695 Ga0207689_10102065 3300025942 Bacteria 2356
696 Ga0207661_10040356 3300025944 Bacteria 3668
697 Ga0207661_10076300 3300025944 Bacteria 2752
698 Ga0207661_10580099 3300025944 Bacteria 1028
699 Ga0207679_10000093 3300025945 Bacteria 78331
700 Ga0207679_10007839 3300025945 Bacteria 6784
701 Ga0207679_10008066 3300025945 Bacteria 6696
702 Ga0207679_10012480 3300025945 Bacteria 5542
703 Ga0207679_10016932 3300025945 Bacteria 4847
704 Ga0207679_10035489 3300025945 Bacteria 3528
705 Ga0207679_10044699 3300025945 Bacteria 3198
706 Ga0207679_10065781 3300025945 Bacteria 2715
707 Ga0207679_10094533 3300025945 Bacteria 2321
708 Ga0207679_10173993 3300025945 Bacteria 1775
709 Ga0207679_10174207 3300025945 Bacteria 1774
710 Ga0207679_10264084 3300025945 Bacteria 1469
711 Ga0207679_10265846 3300025945 Bacteria 1465
712 Ga0207679_10570951 3300025945 Bacteria 1017
713 Ga0207667_10002660 3300025949 Bacteria 22079
714 Ga0207667_10022610 3300025949 Bacteria 6939
715 Ga0207667_10026276 3300025949 Bacteria 6362
716 Ga0207667_10034568 3300025949 Bacteria 5426
717 Ga0207667_10071459 3300025949 Bacteria 3608
718 Ga0207667_10212586 3300025949 Bacteria 1982
719 Ga0207651_10015695 3300025960 Bacteria 4411
720 Ga0207651_10029877 3300025960 Bacteria 3461
721 Ga0207651_10038746 3300025960 Bacteria 3135
722 Ga0207651_10046750 3300025960 Bacteria 2913
723 Ga0207651_10078930 3300025960 Bacteria 2363
724 Ga0207651_10199481 3300025960 Bacteria 1602
725 Ga0207651_10247835 3300025960 Bacteria 1455
726 Ga0207651_10315686 3300025960 Bacteria 1305
727 Ga0207712_10004805 3300025961 Bacteria 8535
728 Ga0207712_10009866 3300025961 Bacteria 6053
729 Ga0207668_10000964 3300025972 Bacteria 17306
730 Ga0207668_10010696 3300025972 Bacteria 5553
731 Ga0207668_10031466 3300025972 Bacteria 3495
732 Ga0207668_10065635 3300025972 Bacteria 2570
733 Ga0207668_10179117 3300025972 Bacteria 1670
734 Ga0207640_10001500 3300025981 Bacteria 12580
735 Ga0207640_10001792 3300025981 Bacteria 11533
736 Ga0207640_10003946 3300025981 Bacteria 8003
737 Ga0207640_10025099 3300025981 Bacteria 3604
738 Ga0207640_10040881 3300025981 Bacteria 2945
739 Ga0207640_10060648 3300025981 Bacteria 2501
740 Ga0207640_10069173 3300025981 Bacteria 2369
741 Ga0207640_10127550 3300025981 Bacteria 1834
742 Ga0207640_10128523 3300025981 Bacteria 1828
743 Ga0207640_10146733 3300025981 Bacteria 1727
744 Ga0207658_10003068 3300025986 Bacteria 11944
745 Ga0207658_10004514 3300025986 Bacteria 9669
746 Ga0207658_10004731 3300025986 Bacteria 9427
747 Ga0207658_10011871 3300025986 Bacteria 5938
748 Ga0207658_10017072 3300025986 Bacteria 4998
749 Ga0207658_10087743 3300025986 Bacteria 2403
750 Ga0207658_10169683 3300025986 Bacteria 1796
751 Ga0207658_10438027 3300025986 Bacteria 1155
752 Ga0207677_10068915 3300026023 Bacteria 2485
753 Ga0207677_10094798 3300026023 Bacteria 2179
754 Ga0207677_10109709 3300026023 Bacteria 2052
755 Ga0207703_10005314 3300026035 Bacteria 10377
756 Ga0207703_10011050 3300026035 Bacteria 7036
757 Ga0207703_10056727 3300026035 Bacteria 3191
758 Ga0207703_10284006 3300026035 Bacteria 1504
759 Ga0207639_10000181 3300026041 Bacteria 49444
760 Ga0207639_10001001 3300026041 Bacteria 19216
761 Ga0207639_10053385 3300026041 Bacteria 3084
762 Ga0207639_10097905 3300026041 Bacteria 2363
763 Ga0207639_10196098 3300026041 Bacteria 1728
764 Ga0207639_10286854 3300026041 Bacteria 1450
765 Ga0207678_10013995 3300026067 Bacteria 7051
766 Ga0207678_10016076 3300026067 Bacteria 6571
767 Ga0207678_10019512 3300026067 Bacteria 5957
768 Ga0207678_10020835 3300026067 Bacteria 5746
769 Ga0207678_10040788 3300026067 Bacteria 4024
770 Ga0207678_10082202 3300026067 Bacteria 2756
771 Ga0207678_10134915 3300026067 Bacteria 2106
772 Ga0207678_10155890 3300026067 Bacteria 1950
773 Ga0207678_10164153 3300026067 Bacteria 1897
774 Ga0207678_10167987 3300026067 Bacteria 1873
775 Ga0207678_10197699 3300026067 Bacteria 1718
776 Ga0207678_10245047 3300026067 Bacteria 1535
777 Ga0207678_10274048 3300026067 Bacteria 1447
778 Ga0207678_10422434 3300026067 Bacteria 1156
779 Ga0207678_10434706 3300026067 Bacteria 1139
780 Ga0207702_10000619 3300026078 Bacteria 39068
781 Ga0207702_10006261 3300026078 Bacteria 10284
782 Ga0207702_10029367 3300026078 Bacteria 4575
783 Ga0207641_10000248 3300026088 Bacteria 68877
784 Ga0207641_10004537 3300026088 Bacteria 12006
785 Ga0207641_10010896 3300026088 Bacteria 7450
786 Ga0207641_10103915 3300026088 Bacteria 2507
787 Ga0207641_10134823 3300026088 Bacteria 2221
788 Ga0207648_10003289 3300026089 Bacteria 16995
789 Ga0207648_10012796 3300026089 Bacteria 7839
790 Ga0207648_10012992 3300026089 Bacteria 7770
791 Ga0207648_10044080 3300026089 Bacteria 3914
792 Ga0207648_10054562 3300026089 Bacteria 3490
793 Ga0207676_10002603 3300026095 Bacteria 12862
794 Ga0207676_10003606 3300026095 Bacteria 10947
795 Ga0207676_10012996 3300026095 Bacteria 5977
796 Ga0207676_10013621 3300026095 Bacteria 5837
797 Ga0207676_10531228 3300026095 Bacteria 1121
798 Ga0207676_10646239 3300026095 Bacteria 1020
799 Ga0207674_10000362 3300026116 Bacteria 58887
800 Ga0207674_10002525 3300026116 Bacteria 23064
801 Ga0207674_10010800 3300026116 Bacteria 10296
802 Ga0207674_10019082 3300026116 Bacteria 7433
803 Ga0207674_10020127 3300026116 Bacteria 7217
804 Ga0207674_10046921 3300026116 Bacteria 4432
805 Ga0207674_10046988 3300026116 Bacteria 4429
806 Ga0207674_10099219 3300026116 Bacteria 2895
807 Ga0207674_10124627 3300026116 Bacteria 2542
808 Ga0207674_10210765 3300026116 Bacteria 1892
809 Ga0207675_100088265 3300026118 Bacteria 2913
810 Ga0207675_100208243 3300026118 Bacteria 1880
811 Ga0207675_100212382 3300026118 Bacteria 1862
812 Ga0207683_10000430 3300026121 Bacteria 38851
813 Ga0207683_10045340 3300026121 Bacteria 3845
814 Ga0207683_10132373 3300026121 Bacteria 2243
815 Ga0207683_10137979 3300026121 Bacteria 2196
816 Ga0207683_10178668 3300026121 Bacteria 1924
817 Ga0207683_10222248 3300026121 Bacteria 1721
818 Ga0207698_10001315 3300026142 Bacteria 14474
819 Ga0207698_10004532 3300026142 Bacteria 8478
820 Ga0207698_10006091 3300026142 Bacteria 7504
821 Ga0207698_10039026 3300026142 Bacteria 3515
822 Ga0207698_10062881 3300026142 Bacteria 2901
823 Ga0209984_1015827 3300027424 Bacteria 1004
824 Ga0209974_10002536 3300027876 Bacteria 6625
825 Ga0209974_10033280 3300027876 Bacteria 1710
826 Ga0207428_10241385 3300027907 Bacteria 1350
827 Ga0268266_10000337 3300028379 Bacteria 73510
828 Ga0268266_10006241 3300028379 Bacteria 10944
829 Ga0268266_10011158 3300028379 Bacteria 7821
830 Ga0268266_10012833 3300028379 Bacteria 7234
831 Ga0268266_10044238 3300028379 Bacteria 3806
832 Ga0268266_10100669 3300028379 Bacteria 2546
833 Ga0268266_10337717 3300028379 Bacteria 1413
834 Ga0268265_10001705 3300028380 Bacteria 17883
835 Ga0268265_10009853 3300028380 Bacteria 6451
836 Ga0268265_10031559 3300028380 Bacteria 3827
837 Ga0268265_10046076 3300028380 Bacteria 3257
838 Ga0268265_10227669 3300028380 Bacteria 1636
839 Ga0268265_10484325 3300028380 Bacteria 1162
840 Ga0268264_10002278 3300028381 Bacteria 17002
841 Ga0268264_10002314 3300028381 Bacteria 16854
842 Ga0268264_10003356 3300028381 Bacteria 13841
843 Ga0268264_10110389 3300028381 Bacteria 2408
844 Ga0268264_10137411 3300028381 Bacteria 2175
845 Ga0268264_10293479 3300028381 Bacteria 1528
846 Ga0316177_1111970 3300030731 Bacteria 1916
847 Ga0316183_1010987 3300030742 Bacteria 1664
848 Ga0316182_1085750 3300030745 Bacteria 2592
849 Ga0307408_100010309 3300031548 Bacteria 6163
850 Ga0307408_100015486 3300031548 Bacteria 5077
851 Ga0307408_100032169 3300031548 Bacteria 3657
852 Ga0307408_100106702 3300031548 Bacteria 2143
853 Ga0307408_100144941 3300031548 Bacteria 1868
854 Ga0307408_100148430 3300031548 Bacteria 1848
855 Ga0307408_100195746 3300031548 Bacteria 1632
856 Ga0307408_100261986 3300031548 Bacteria 1431
857 Ga0307408_100269919 3300031548 Bacteria 1412
858 Ga0307408_100302223 3300031548 Bacteria 1341
859 Ga0307508_10169671 3300031616 Bacteria 1785
860 Ga0307405_10016436 3300031731 Bacteria 4035
861 Ga0307405_10016740 3300031731 Bacteria 4005
862 Ga0307405_10017929 3300031731 Bacteria 3896
863 Ga0307405_10020192 3300031731 Bacteria 3718
864 Ga0307405_10039182 3300031731 Bacteria 2862
865 Ga0307405_10040445 3300031731 Bacteria 2824
866 Ga0307405_10131035 3300031731 Bacteria 1732
867 Ga0307405_10292610 3300031731 Bacteria 1231
868 Ga0307405_10461136 3300031731 Bacteria 1010
869 Ga0307413_10002912 3300031824 Bacteria 7072
870 Ga0307413_10007487 3300031824 Bacteria 5074
871 Ga0307413_10009619 3300031824 Bacteria 4638
872 Ga0307413_10021302 3300031824 Bacteria 3467
873 Ga0307413_10025726 3300031824 Bacteria 3231
874 Ga0307413_10032790 3300031824 Bacteria 2949
875 Ga0307413_10062771 3300031824 Bacteria 2300
876 Ga0307413_10090114 3300031824 Bacteria 1994
877 Ga0307413_10112876 3300031824 Bacteria 1823
878 Ga0307413_10252159 3300031824 Bacteria 1310
879 Ga0307410_10003662 3300031852 Bacteria 7761
880 Ga0307410_10004619 3300031852 Bacteria 7150
881 Ga0307410_10005908 3300031852 Bacteria 6542
882 Ga0307410_10012262 3300031852 Bacteria 4947
883 Ga0307410_10012343 3300031852 Bacteria 4937
884 Ga0307410_10014744 3300031852 Bacteria 4611
885 Ga0307410_10016523 3300031852 Bacteria 4404
886 Ga0307410_10029309 3300031852 Bacteria 3504
887 Ga0307410_10034673 3300031852 Bacteria 3271
888 Ga0307410_10037134 3300031852 Bacteria 3179
889 Ga0307410_10047354 3300031852 Bacteria 2873
890 Ga0307410_10054329 3300031852 Bacteria 2715
891 Ga0307410_10060622 3300031852 Bacteria 2586
892 Ga0307410_10068029 3300031852 Bacteria 2458
893 Ga0307410_10100999 3300031852 Bacteria 2067
894 Ga0307410_10104385 3300031852 Bacteria 2037
895 Ga0307410_10120804 3300031852 Bacteria 1910
896 Ga0307410_10151467 3300031852 Bacteria 1727
897 Ga0307410_10221590 3300031852 Bacteria 1455
898 Ga0307406_10019692 3300031901 Bacteria 3964
899 Ga0307406_10023046 3300031901 Bacteria 3700
900 Ga0307406_10026016 3300031901 Bacteria 3508
901 Ga0307406_10039118 3300031901 Bacteria 2940
902 Ga0307406_10039125 3300031901 Bacteria 2940
903 Ga0307406_10053972 3300031901 Bacteria 2562
904 Ga0307406_10054856 3300031901 Bacteria 2545
905 Ga0307406_10206451 3300031901 Bacteria 1450
906 Ga0307406_10346833 3300031901 Bacteria 1158
907 Ga0307407_10004135 3300031903 Bacteria 6111
908 Ga0307407_10004989 3300031903 Bacteria 5710
909 Ga0307407_10020538 3300031903 Bacteria 3387
910 Ga0307407_10023918 3300031903 Bacteria 3194
911 Ga0307407_10029048 3300031903 Bacteria 2964
912 Ga0307407_10034387 3300031903 Bacteria 2774
913 Ga0307407_10042165 3300031903 Bacteria 2557
914 Ga0307407_10053773 3300031903 Bacteria 2318
915 Ga0307407_10058452 3300031903 Bacteria 2241
916 Ga0307407_10059162 3300031903 Bacteria 2230
917 Ga0307407_10080894 3300031903 Bacteria 1964
918 Ga0307407_10347779 3300031903 Bacteria 1049
919 Ga0307412_10011925 3300031911 Bacteria 5047
920 Ga0307412_10018402 3300031911 Bacteria 4203
921 Ga0307412_10039561 3300031911 Bacteria 3045
922 Ga0307412_10049607 3300031911 Bacteria 2766
923 Ga0307412_10058410 3300031911 Bacteria 2580
924 Ga0307412_10064610 3300031911 Bacteria 2473
925 Ga0307412_10067145 3300031911 Bacteria 2434
926 Ga0307412_10094385 3300031911 Bacteria 2101
927 Ga0307412_10128789 3300031911 Bacteria 1835
928 Ga0307412_10140116 3300031911 Bacteria 1770
929 Ga0307412_10510382 3300031911 Bacteria 1002
930 Ga0307409_100023233 3300031995 Bacteria 4291
931 Ga0307409_100023866 3300031995 Bacteria 4249
932 Ga0307409_100026262 3300031995 Bacteria 4103
933 Ga0307409_100038652 3300031995 Bacteria 3532
934 Ga0307409_100040555 3300031995 Bacteria 3468
935 Ga0307409_100067050 3300031995 Bacteria 2832
936 Ga0307409_100077361 3300031995 Bacteria 2672
937 Ga0307409_100079381 3300031995 Bacteria 2644
938 Ga0307409_100126522 3300031995 Bacteria 2174
939 Ga0307409_100128097 3300031995 Bacteria 2163
940 Ga0307409_100136479 3300031995 Bacteria 2106
941 Ga0307409_100137929 3300031995 Bacteria 2097
942 Ga0307409_100183907 3300031995 Bacteria 1853
943 Ga0307409_100289991 3300031995 Bacteria 1517
944 Ga0307416_100022796 3300032002 Bacteria 4529
945 Ga0307416_100023314 3300032002 Bacteria 4489
946 Ga0307416_100062269 3300032002 Bacteria 3050
947 Ga0307416_100063814 3300032002 Bacteria 3018
948 Ga0307416_100084812 3300032002 Bacteria 2693
949 Ga0307416_100091687 3300032002 Bacteria 2610
950 Ga0307416_100105106 3300032002 Bacteria 2470
951 Ga0307416_100107888 3300032002 Bacteria 2445
952 Ga0307416_100117754 3300032002 Bacteria 2359
953 Ga0307416_100130606 3300032002 Bacteria 2260
954 Ga0307416_100137610 3300032002 Bacteria 2213
955 Ga0307416_100140926 3300032002 Bacteria 2191
956 Ga0307416_100320428 3300032002 Bacteria 1552
957 Ga0307416_100361800 3300032002 Bacteria 1473
958 Ga0307416_100392965 3300032002 Bacteria 1421
959 Ga0307416_100408149 3300032002 Bacteria 1398
960 Ga0307416_100882184 3300032002 Bacteria 994
961 Ga0307414_10002679 3300032004 Bacteria 9361
962 Ga0307414_10005253 3300032004 Bacteria 7119
963 Ga0307414_10010879 3300032004 Bacteria 5308
964 Ga0307414_10016257 3300032004 Bacteria 4519
965 Ga0307414_10021719 3300032004 Bacteria 4035
966 Ga0307414_10025742 3300032004 Bacteria 3774
967 Ga0307414_10031696 3300032004 Bacteria 3471
968 Ga0307414_10037200 3300032004 Bacteria 3257
969 Ga0307414_10042640 3300032004 Bacteria 3084
970 Ga0307414_10064914 3300032004 Bacteria 2602
971 Ga0307414_10105553 3300032004 Bacteria 2130
972 Ga0307414_10108756 3300032004 Bacteria 2104
973 Ga0307414_10310971 3300032004 Bacteria 1337
974 Ga0307411_10006942 3300032005 Bacteria 5713
975 Ga0307411_10007999 3300032005 Bacteria 5443
976 Ga0307411_10009661 3300032005 Bacteria 5090
977 Ga0307411_10011678 3300032005 Bacteria 4754
978 Ga0307411_10015157 3300032005 Bacteria 4319
979 Ga0307411_10016681 3300032005 Bacteria 4161
980 Ga0307411_10023070 3300032005 Bacteria 3677
981 Ga0307411_10025253 3300032005 Bacteria 3557
982 Ga0307411_10036994 3300032005 Bacteria 3064
983 Ga0307411_10042830 3300032005 Bacteria 2892
984 Ga0307411_10049430 3300032005 Bacteria 2732
985 Ga0307411_10052037 3300032005 Bacteria 2675
986 Ga0307411_10054580 3300032005 Bacteria 2624
987 Ga0307411_10078512 3300032005 Bacteria 2263
988 Ga0307411_10083778 3300032005 Bacteria 2203
989 Ga0307411_10111837 3300032005 Bacteria 1956
990 Ga0307411_10116173 3300032005 Bacteria 1926
991 Ga0307411_10138770 3300032005 Bacteria 1789
992 Ga0307411_10190780 3300032005 Bacteria 1564
993 Ga0307411_10211998 3300032005 Bacteria 1496
994 Ga0307411_10261166 3300032005 Bacteria 1367
995 Ga0307411_10397332 3300032005 Bacteria 1138
996 Ga0307415_100009109 3300032126 Bacteria 5544
997 Ga0307415_100009728 3300032126 Bacteria 5408
998 Ga0307415_100009841 3300032126 Bacteria 5386
999 Ga0307415_100013999 3300032126 Bacteria 4700
1000 Ga0307415_100025028 3300032126 Bacteria 3739
1001 Ga0307415_100033642 3300032126 Bacteria 3328
1002 Ga0307415_100056165 3300032126 Bacteria 2697
1003 Ga0307415_100058241 3300032126 Bacteria 2659
1004 Ga0307415_100060888 3300032126 Bacteria 2611
1005 Ga0307415_100072544 3300032126 Bacteria 2425
1006 Ga0307415_100078756 3300032126 Bacteria 2345
1007 Ga0307415_100085414 3300032126 Bacteria 2267
1008 Ga0307415_100229718 3300032126 Bacteria 1493
1009 Ga0373941_0047938 3300035115 Bacteria 1347
1010 Ga0373955_0018662 3300035172 Bacteria 3454
1011 Ga0373961_0062184 3300035241 Bacteria 1136
1012 Ga0373931_0007622 3300035691 Bacteria 5103
1013 Ga0373935_0051406 3300035692 Bacteria 2617
1014 Ga0373933_0123139 3300035724 Bacteria 1625
1015 Ga0373937_0153667 3300036401 Bacteria 2156
1016 Ga0373925_0028143 3300037068 Bacteria 4117
1017 Ga0373925_0323769 3300037068 Bacteria 1248
1018 Ga0395899_0000334 3300037312 Bacteria 59344
1019 Ga0395899_0003848 3300037312 Bacteria 11837
1020 Ga0395899_0014063 3300037312 Bacteria 6110
1021 Ga0395899_0031655 3300037312 Bacteria 3975
1022 Ga0395899_0042578 3300037312 Bacteria 3389
1023 Ga0395899_0046637 3300037312 Bacteria 3227
1024 Ga0395899_0057007 3300037312 Bacteria 2885
1025 Ga0395899_0062948 3300037312 Bacteria 2731
1026 Ga0395899_0138059 3300037312 Bacteria 1736
1027 Ga0395899_0265076 3300037312 Bacteria 1173
1028 Ga0395899_0287472 3300037312 Bacteria 1116
1029 Ga0395900_0000084 3300037418 Bacteria 172593
1030 Ga0395900_0000530 3300037418 Bacteria 53919
1031 Ga0395900_0002289 3300037418 Bacteria 21271
1032 Ga0395900_0011450 3300037418 Bacteria 9078
1033 Ga0395900_0021175 3300037418 Bacteria 6646
1034 Ga0395900_0022859 3300037418 Bacteria 6397
1035 Ga0395900_0022912 3300037418 Bacteria 6391
1036 Ga0395900_0040463 3300037418 Bacteria 4803
1037 Ga0395900_0049491 3300037418 Bacteria 4330
1038 Ga0395900_0207064 3300037418 Bacteria 1982
1039 Ga0395900_0208002 3300037418 Bacteria 1977
1040 Ga0395900_0236073 3300037418 Bacteria 1836
1041 Ga0395900_0247442 3300037418 Bacteria 1785
1042 Ga0395900_0473707 3300037418 Bacteria 1205
1043 Ga0395900_0536196 3300037418 Bacteria 1116
1044 Ga0395900_0851061 3300037418 Bacteria 837
1045 Ga0395900_0851115 3300037418 Bacteria 837
1046 Ga0395898_0000021 3300037466 Bacteria 393971
1047 Ga0395898_0002115 3300037466 Bacteria 24534
1048 Ga0395898_0016514 3300037466 Bacteria 7551
1049 Ga0395898_0024673 3300037466 Bacteria 6064
1050 Ga0395898_0029222 3300037466 Bacteria 5523
1051 Ga0395898_0038421 3300037466 Bacteria 4744
1052 Ga0395898_0091995 3300037466 Bacteria 2917
1053 Ga0395898_0115548 3300037466 Bacteria 2571
1054 Ga0395898_0282613 3300037466 Bacteria 1583
1055 Ga0395898_0365201 3300037466 Bacteria 1376
1056 Ga0395898_0570866 3300037466 Bacteria 1074
1057 Ga0395905_0000006 3300037471 Bacteria 549428
1058 Ga0395905_0000191 3300037471 Bacteria 97191
1059 Ga0395905_0001616 3300037471 Bacteria 26793
1060 Ga0395905_0003041 3300037471 Bacteria 18170
1061 Ga0395905_0009005 3300037471 Bacteria 9796
1062 Ga0395905_0009128 3300037471 Bacteria 9716
1063 Ga0395905_0023621 3300037471 Bacteria 5806
1064 Ga0395905_0031138 3300037471 Bacteria 5023
1065 Ga0395905_0040237 3300037471 Bacteria 4384
1066 Ga0395905_0052000 3300037471 Bacteria 3837
1067 Ga0395905_0054620 3300037471 Bacteria 3738
1068 Ga0395905_0058702 3300037471 Bacteria 3597
1069 Ga0395905_0067965 3300037471 Bacteria 3338
1070 Ga0395905_0082622 3300037471 Bacteria 3010
1071 Ga0395905_0099408 3300037471 Bacteria 2732
1072 Ga0395905_0138869 3300037471 Bacteria 2286
1073 Ga0395905_0155546 3300037471 Bacteria 2150
1074 Ga0395905_0176934 3300037471 Bacteria 2003
1075 Ga0395905_0179203 3300037471 Bacteria 1989
1076 Ga0395905_0180014 3300037471 Bacteria 1984
1077 Ga0395905_0533237 3300037471 Bacteria 1074
1078 Ga0436364_0677582 3300037853 Bacteria 26261
1079 Ga0395901_0000372 3300038443 Bacteria 53814
1080 Ga0395901_0003214 3300038443 Bacteria 16452
1081 Ga0395901_0011073 3300038443 Bacteria 9140
1082 Ga0395901_0026727 3300038443 Bacteria 5925
1083 Ga0395901_0027033 3300038443 Bacteria 5894
1084 Ga0395901_0043213 3300038443 Bacteria 4675
1085 Ga0395901_0043979 3300038443 Bacteria 4632
1086 Ga0395901_0047725 3300038443 Bacteria 4446
1087 Ga0395901_0051080 3300038443 Bacteria 4297
1088 Ga0395901_0058383 3300038443 Bacteria 4013
1089 Ga0395901_0066465 3300038443 Bacteria 3755
1090 Ga0395901_0072259 3300038443 Bacteria 3596
1091 Ga0395901_0073632 3300038443 Bacteria 3562
1092 Ga0395901_0075572 3300038443 Bacteria 3514
1093 Ga0395901_0195788 3300038443 Bacteria 2119
1094 Ga0395901_0242074 3300038443 Bacteria 1881
1095 Ga0395901_0359926 3300038443 Bacteria 1500
1096 Ga0395901_0564188 3300038443 Bacteria 1152
1097 Ga0395901_0577356 3300038443 Bacteria 1136
1098 Ga0395901_0687124 3300038443 Bacteria 1022
1099 Ga0395901_0851124 3300038443 Bacteria 897
1100 Ga0400483_207500 3300039062 Bacteria 1669
1101 Ga0436365_0044388 3300039437 Bacteria 123489
1102 Ga0436365_1353505 3300039437 Bacteria 22625
1103 Ga0436365_1720437 3300039437 Bacteria 4592
1104 Ga0436363_0701969 3300039450 Bacteria 3613
1105 Ga0436362_1051662 3300039453 Bacteria 138391
1106 Ga0439461_0034251 3300041410 Bacteria 1072
1107 Ga0439445_0000067 3300042004 Bacteria 15722
1108 Ga0439432_026291 3300042006 Bacteria 1906
1109 Ga0450921_002924 3300042123 Bacteria 1172
1110 Ga0450889_000890 3300042144 Bacteria 3209
1111 Ga0439458_0000128 3300042157 Bacteria 15800
1112 Ga0439458_0000937 3300042157 Bacteria 7506
1113 Ga0439435_0043597 3300042436 Bacteria 1263
1114 Ga0439464_0004810 3300042439 Bacteria 3460
1115 Ga0451577_0488819 3300042876 Bacteria 1118
1116 Ga0466969_0004326 3300044656 Bacteria 7557
1117 Ga0466966_0000001 3300044684 Bacteria 410376
1118 Ga0466966_0002089 3300044684 Bacteria 12970
1119 Ga0466966_0008399 3300044684 Bacteria 6835
1120 Ga0466961_0054818 3300044693 Bacteria 2543
1121 Ga0466961_0120787 3300044693 Bacteria 1645
1122 Ga0466961_0249503 3300044693 Bacteria 1090
1123 Ga0466963_0015926 3300044694 Bacteria 4668
1124 Ga0466963_0035358 3300044694 Bacteria 3254
1125 Ga0466963_0052428 3300044694 Bacteria 2707
1126 Ga0466963_0052679 3300044694 Bacteria 2701
1127 Ga0466963_0067976 3300044694 Bacteria 2392
1128 Ga0466963_0284757 3300044694 Bacteria 1162
1129 Ga0466963_0320194 3300044694 Bacteria 1091
1130 Ga0466971_0003632 3300044719 Bacteria 6594
1131 Ga0466971_0057437 3300044719 Bacteria 1755
1132 Ga0466968_0002445 3300044735 Bacteria 6811
1133 Ga0466968_0196175 3300044735 Bacteria 944
1134 Ga0466957_0004040 3300044842 Bacteria 8121
1135 Ga0466957_0010017 3300044842 Bacteria 5425
1136 Ga0466957_0013504 3300044842 Bacteria 4738
1137 Ga0466957_0038695 3300044842 Bacteria 2874
1138 Ga0466959_0056025 3300045049 Bacteria 2877
1139 Ga0451576_0000165 3300045051 Bacteria 168085
1140 Ga0466958_0012547 3300045836 Bacteria 4803
1141 Ga0466958_0029516 3300045836 Bacteria 3254
1142 Ga0466958_0263618 3300045836 Bacteria 1103
1143 Ga0466967_0024560 3300045976 Bacteria 4958
1144 Ga0466967_0036895 3300045976 Bacteria 4177
1145 Ga0466967_0068397 3300045976 Bacteria 3171
1146 Ga0466967_0105874 3300045976 Bacteria 2577
1147 Ga0466967_0137478 3300045976 Bacteria 2273
1148 Ga0466967_0186260 3300045976 Bacteria 1960
1149 Ga0466967_0246452 3300045976 Bacteria 1705
1150 Ga0466967_0257591 3300045976 Bacteria 1668
1151 Ga0466967_0488284 3300045976 Bacteria 1207
1152 Ga0466967_0608769 3300045976 Bacteria 1079
1153 Ga0495585_0098837 3300046492 Bacteria 1563
1154 Ga0495663_0000862 3300046525 Bacteria 10252
1155 Ga0495663_0001559 3300046525 Bacteria 7174
1156 Ga0495663_0018856 3300046525 Bacteria 1968
1157 Ga0495663_0114606 3300046525 Bacteria 898
1158 Ga0495598_0000301 3300046537 Bacteria 8857
1159 Ga0495621_0000024 3300046539 Bacteria 28376
1160 Ga0495621_0002526 3300046539 Bacteria 4934
1161 Ga0495621_0003645 3300046539 Bacteria 4253
1162 Ga0495622_0078320 3300046557 Bacteria 1522
1163 Ga0495633_0003354 3300046558 Bacteria 10742
1164 Ga0495633_0144155 3300046558 Bacteria 1101
1165 Ga0495656_0040806 3300046615 Bacteria 1936
1166 Ga0495668_0007644 3300046616 Bacteria 6877
1167 Ga0495659_0012382 3300046664 Bacteria 2761
1168 Ga0495659_0015028 3300046664 Bacteria 2542
1169 Ga0495669_0003515 3300046684 Bacteria 6462
1170 Ga0495669_0004197 3300046684 Bacteria 5928
1171 Ga0495669_0025815 3300046684 Bacteria 2565
1172 Ga0495670_0001033 3300046691 Bacteria 13506
1173 Ga0495677_0003479 3300047445 Bacteria 6115
1174 Ga0495602_0046107 3300048088 Bacteria 3940
1175 Ga0496100_0047912 3300048903 Bacteria 2756
1176 Ga0496100_0192553 3300048903 Bacteria 1481
1177 Ga0496101_0020671 3300048904 Bacteria 4513
1178 Ga0496102_0136455 3300048905 Bacteria 2299
1179 Ga0496102_0186162 3300048905 Bacteria 1957
1180 Ga0496102_0189603 3300048905 Bacteria 1937
1181 Ga0496104_0206919 3300048907 Bacteria 1874
1182 Ga0496106_0002679 3300048909 Bacteria 13229
1183 Ga0496107_0002672 3300048910 Bacteria 11678
1184 Ga0496107_0009264 3300048910 Bacteria 6826
1185 Ga0496107_0096688 3300048910 Bacteria 2161
1186 Ga0496107_0163673 3300048910 Bacteria 1649
1187 Ga0496107_0169433 3300048910 Bacteria 1620
1188 Ga0496107_0379318 3300048910 Bacteria 1052
1189 Ga0496108_0001735 3300048911 Bacteria 17316
1190 Ga0496108_0006426 3300048911 Bacteria 9531
1191 Ga0496108_0015393 3300048911 Bacteria 6239
1192 Ga0496108_0046589 3300048911 Bacteria 3622
1193 Ga0496109_0118067 3300048912 Bacteria 2469
1194 Ga0496109_0123095 3300048912 Bacteria 2417
1195 Ga0496109_0220279 3300048912 Bacteria 1784
1196 Ga0496110_0025783 3300048913 Bacteria 5026
1197 Ga0496110_0274146 3300048913 Bacteria 1536
1198 Ga0496110_0309332 3300048913 Bacteria 1439
1199 Ga0496110_0495518 3300048913 Bacteria 1113
1200 Ga0496110_0549190 3300048913 Bacteria 1050
1201 Ga0496111_0010650 3300048914 Bacteria 6180
1202 Ga0496111_0014909 3300048914 Bacteria 5321
1203 Ga0496111_0024681 3300048914 Bacteria 4237
1204 Ga0496111_0133860 3300048914 Bacteria 1835
1205 Ga0496111_0491521 3300048914 Bacteria 904
1206 Ga0496112_0000841 3300048915 Bacteria 21896
1207 Ga0496112_0003098 3300048915 Bacteria 13633
1208 Ga0496112_0030167 3300048915 Bacteria 5246
1209 Ga0496112_0052107 3300048915 Bacteria 4015
1210 Ga0496112_0224076 3300048915 Bacteria 1836
1211 Ga0496112_0345318 3300048915 Bacteria 1431
1212 Ga0496113_0001922 3300048916 Bacteria 11879
1213 Ga0496113_0003879 3300048916 Bacteria 9053
1214 Ga0496113_0081291 3300048916 Bacteria 2483
1215 Ga0496114_0000023 3300048917 Bacteria 219092
1216 Ga0496114_0039924 3300048917 Bacteria 3884
1217 Ga0496114_0105985 3300048917 Bacteria 2405
1218 Ga0496115_0013070 3300048918 Bacteria 6269
1219 Ga0496117_0016745 3300048920 Bacteria 6162
1220 Ga0496117_0017057 3300048920 Bacteria 6082
1221 Ga0496118_0020688 3300048921 Bacteria 5827
1222 Ga0496118_0162211 3300048921 Bacteria 1380
1223 Ga0496121_0001910 3300048924 Bacteria 33357
1224 Ga0496121_0007299 3300048924 Bacteria 13369
1225 Ga0496124_0024411 3300048927 Bacteria 5497
1226 Ga0496125_0125213 3300048928 Bacteria 1823
1227 Ga0496126_0042348 3300048929 Bacteria 4206
1228 Ga0501031_0070523 3300049568 Bacteria 2276
1229 Ga0501033_0024174 3300049570 Bacteria 4584
1230 Ga0501033_0134988 3300049570 Bacteria 1785
1231 Ga0501036_0134892 3300049572 Bacteria 2083
1232 Ga0501037_0149253 3300049573 Bacteria 1671
1233 Ga0501039_0008592 3300049575 Bacteria 7787
1234 Ga0501046_0051299 3300049580 Bacteria 3256
1235 Ga0501047_0019705 3300049581 Bacteria 6473
1236 Ga0501074_0015841 3300049590 Bacteria 5483
1237 Ga0501202_007398 3300049652 Bacteria 1984
1238 Ga0501202_023262 3300049652 Bacteria 1249
1239 Ga0501217_005730 3300049661 Bacteria 2610
1240 Ga0501224_011229 3300049664 Bacteria 1317
1241 Ga0501249_001739 3300049679 Bacteria 4439
1242 Ga0501257_022988 3300049686 Bacteria 1477
1243 Ga0501225_0005790 3300049705 Bacteria 3619
1244 Ga0501080_0015862 3300049742 Bacteria 6951
1245 Ga0501241_019077 3300049758 Bacteria 1258
1246 Ga0501267_000632 3300049764 Bacteria 2803
1247 Ga0501273_014534 3300049770 Bacteria 1014
1248 Ga0501035_0039951 3300049822 Bacteria 4242
1249 Ga0501044_0183294 3300049823 Bacteria 2059
1250 Ga0501212_016142 3300049851 Bacteria 1119
1251 nmdc:mga09592_118383_c1 3300050508 Bacteria 2273
1252 nmdc:mga06r32_100336_c1 3300050510 Bacteria 2840
1253 nmdc:mga08y16_91605_c1 3300050511 Bacteria 3168
1254 nmdc:mga0a205_10468_c1 3300050515 Bacteria 8520
1255 Ga0500658_0000044 3300053134 Bacteria 72423
1256 Ga0500619_003946 3300053154 Bacteria 3120
1257 Ga0466962_0006536 3300061719 Bacteria 5597
1258 Ga0466962_0077500 3300061719 Bacteria 1589

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046525 Ga0495663_0114606 Ga0495663_0114606_18_737 214
2 3300039437 Ga0436365_0044388 Ga0436365_0044388_6038_6775 222
3 3300039453 Ga0436362_1051662 Ga0436362_1051662_131644_132381 222
4 3300005618 Ga0068864_100138710 Ga0068864_1001387104 228
5 3300005457 Ga0070662_100009736 Ga0070662_1000097362 233
6 3300005616 Ga0068852_100114563 Ga0068852_1001145633 233
7 3300025933 Ga0207706_10007601 Ga0207706_100076015 233
8 3300001989 JGI24739J22299_10002230 JGI24739J22299_100022303 234
9 3300001991 JGI24743J22301_10001317 JGI24743J22301_100013172 234
10 3300002075 JGI24738J21930_10004711 JGI24738J21930_100047114 234
11 3300005331 Ga0070670_100013608 Ga0070670_1000136083 234
12 3300005548 Ga0070665_100005049 Ga0070665_1000050498 234
13 3300005577 Ga0068857_100015117 Ga0068857_1000151173 234
14 3300025903 Ga0207680_10003521 Ga0207680_100035213 234
15 3300025919 Ga0207657_10070120 Ga0207657_100701201 234
16 3300028379 Ga0268266_10012833 Ga0268266_100128333 234
17 3300005339 Ga0070660_100147808 Ga0070660_1001478082 235
18 3300005458 Ga0070681_10271088 Ga0070681_102710882 235
19 3300005530 Ga0070679_100092209 Ga0070679_1000922092 235
20 3300005563 Ga0068855_100151136 Ga0068855_1001511363 235
21 3300005578 Ga0068854_100466333 Ga0068854_1004663331 235
22 3300013104 Ga0157370_10081270 Ga0157370_100812703 235
23 3300025909 Ga0207705_10033183 Ga0207705_100331834 235
24 3300025912 Ga0207707_10184944 Ga0207707_101849442 235
25 3300025917 Ga0207660_10047111 Ga0207660_100471113 235
26 3300025921 Ga0207652_10242988 Ga0207652_102429882 235
27 3300037312 Ga0395899_0014063 Ga0395899_0014063_1864_2757 235
28 3300037418 Ga0395900_0002289 Ga0395900_0002289_6104_6997 235
29 3300037466 Ga0395898_0024673 Ga0395898_0024673_3308_4201 235
30 3300038443 Ga0395901_0073632 Ga0395901_0073632_1861_2754 235
31 3300031901 Ga0307406_10206451 Ga0307406_102064512 236
32 3300031911 Ga0307412_10140116 Ga0307412_101401161 236
33 3300032002 Ga0307416_100408149 Ga0307416_1004081492 236
34 3300032126 Ga0307415_100072544 Ga0307415_1000725441 236
35 3300042876 Ga0451577_0488819 Ga0451577_0488819_226_1002 236
36 3300048914 Ga0496111_0491521 Ga0496111_0491521_32_808 236
37 3300037471 Ga0395905_0180014 Ga0395905_0180014_1176_1955 237
38 3300045976 Ga0466967_0024560 Ga0466967_0024560_467_1348 237
39 3300005339 Ga0070660_100005146 Ga0070660_1000051464 238
40 3300025919 Ga0207657_10010107 Ga0207657_100101074 238
41 3300026067 Ga0207678_10274048 Ga0207678_102740482 239
42 3300005543 Ga0070672_100095072 Ga0070672_1000950723 241
43 3300005564 Ga0070664_100382111 Ga0070664_1003821112 241
44 3300005834 Ga0068851_10070343 Ga0068851_100703433 241
45 3300025909 Ga0207705_10045991 Ga0207705_100459914 241
46 3300025919 Ga0207657_10057252 Ga0207657_100572522 241
47 3300025925 Ga0207650_10128544 Ga0207650_101285442 241
48 3300025940 Ga0207691_10212352 Ga0207691_102123522 241
49 3300025945 Ga0207679_10265846 Ga0207679_102658462 241
50 3300027424 Ga0209984_1015827 Ga0209984_10158271 241
51 3300031731 Ga0307405_10040445 Ga0307405_100404451 241
52 3300031852 Ga0307410_10120804 Ga0307410_101208043 241
53 3300032004 Ga0307414_10031696 Ga0307414_100316962 241
54 3300032126 Ga0307415_100085414 Ga0307415_1000854143 241
55 3300048905 Ga0496102_0136455 Ga0496102_0136455_452_1228 241
56 3300048913 Ga0496110_0549190 Ga0496110_0549190_30_806 241
57 3300001979 JGI24740J21852_10002906 JGI24740J21852_100029065 242
58 3300001989 JGI24739J22299_10007982 JGI24739J22299_100079825 242
59 3300001990 JGI24737J22298_10000139 JGI24737J22298_1000013921 242
60 3300002075 JGI24738J21930_10009356 JGI24738J21930_100093562 242
61 3300005328 Ga0070676_10015522 Ga0070676_100155226 242
62 3300005330 Ga0070690_100134171 Ga0070690_1001341712 242
63 3300005331 Ga0070670_100161526 Ga0070670_1001615262 242
64 3300005334 Ga0068869_100002989 Ga0068869_1000029894 242
65 3300005338 Ga0068868_100003061 Ga0068868_1000030614 242
66 3300005339 Ga0070660_100005432 Ga0070660_1000054325 242
67 3300005347 Ga0070668_100080246 Ga0070668_1000802464 242
68 3300005347 Ga0070668_100095873 Ga0070668_1000958731 242
69 3300005353 Ga0070669_100012028 Ga0070669_1000120282 242
70 3300005354 Ga0070675_100078772 Ga0070675_1000787724 242
71 3300005355 Ga0070671_100002117 Ga0070671_1000021179 242
72 3300005355 Ga0070671_100027854 Ga0070671_1000278544 242
73 3300005364 Ga0070673_100000446 Ga0070673_10000044618 242
74 3300005366 Ga0070659_100001857 Ga0070659_10000185712 242
75 3300005367 Ga0070667_100011252 Ga0070667_1000112525 242
76 3300005457 Ga0070662_100016893 Ga0070662_1000168933 242
77 3300005459 Ga0068867_100017188 Ga0068867_1000171882 242
78 3300005543 Ga0070672_100006530 Ga0070672_1000065301 242
79 3300005564 Ga0070664_100219049 Ga0070664_1002190492 242
80 3300005577 Ga0068857_100009399 Ga0068857_1000093992 242
81 3300005578 Ga0068854_100004613 Ga0068854_1000046132 242
82 3300005616 Ga0068852_100161001 Ga0068852_1001610013 242
83 3300005618 Ga0068864_100004543 Ga0068864_1000045434 242
84 3300005618 Ga0068864_100004721 Ga0068864_1000047219 242
85 3300005719 Ga0068861_100040413 Ga0068861_1000404133 242
86 3300005841 Ga0068863_100009975 Ga0068863_1000099754 242
87 3300005842 Ga0068858_100064677 Ga0068858_1000646773 242
88 3300005843 Ga0068860_100109447 Ga0068860_1001094471 242
89 3300005843 Ga0068860_100549689 Ga0068860_1005496892 242
90 3300005844 Ga0068862_100443867 Ga0068862_1004438672 242
91 3300006881 Ga0068865_100045625 Ga0068865_1000456254 242
92 3300013102 Ga0157371_10011274 Ga0157371_100112746 242
93 3300013105 Ga0157369_10007335 Ga0157369_1000733511 242
94 3300025290 Ga0207673_1003596 Ga0207673_10035962 242
95 3300025315 Ga0207697_10000395 Ga0207697_1000039523 242
96 3300025315 Ga0207697_10009638 Ga0207697_100096383 242
97 3300025901 Ga0207688_10003889 Ga0207688_1000388911 242
98 3300025903 Ga0207680_10050640 Ga0207680_100506402 242
99 3300025903 Ga0207680_10091063 Ga0207680_100910632 242
100 3300025904 Ga0207647_10006843 Ga0207647_1000684312 242
101 3300025907 Ga0207645_10011052 Ga0207645_100110528 242
102 3300025909 Ga0207705_10036011 Ga0207705_100360113 242
103 3300025919 Ga0207657_10013808 Ga0207657_100138086 242
104 3300025920 Ga0207649_10021471 Ga0207649_100214713 242
105 3300025923 Ga0207681_10021946 Ga0207681_100219466 242
106 3300025924 Ga0207694_10114923 Ga0207694_101149231 242
107 3300025925 Ga0207650_10132473 Ga0207650_101324732 242
108 3300025926 Ga0207659_10018207 Ga0207659_100182072 242
109 3300025926 Ga0207659_10060626 Ga0207659_100606261 242
110 3300025931 Ga0207644_10000181 Ga0207644_1000018139 242
111 3300025931 Ga0207644_10013016 Ga0207644_100130163 242
112 3300025932 Ga0207690_10043770 Ga0207690_100437702 242
113 3300025933 Ga0207706_10003563 Ga0207706_100035639 242
114 3300025937 Ga0207669_10248356 Ga0207669_102483562 242
115 3300025940 Ga0207691_10003655 Ga0207691_100036559 242
116 3300025941 Ga0207711_10009311 Ga0207711_100093114 242
117 3300025941 Ga0207711_10053199 Ga0207711_100531993 242
118 3300025942 Ga0207689_10000064 Ga0207689_1000006487 242
119 3300025945 Ga0207679_10044699 Ga0207679_100446994 242
120 3300025945 Ga0207679_10173993 Ga0207679_101739932 242
121 3300025960 Ga0207651_10247835 Ga0207651_102478352 242
122 3300025972 Ga0207668_10031466 Ga0207668_100314662 242
123 3300025981 Ga0207640_10003946 Ga0207640_100039465 242
124 3300025986 Ga0207658_10004731 Ga0207658_100047319 242
125 3300026023 Ga0207677_10068915 Ga0207677_100689152 242
126 3300026035 Ga0207703_10056727 Ga0207703_100567273 242
127 3300026089 Ga0207648_10012796 Ga0207648_1001279612 242
128 3300026095 Ga0207676_10003606 Ga0207676_100036061 242
129 3300026095 Ga0207676_10012996 Ga0207676_100129963 242
130 3300026095 Ga0207676_10013621 Ga0207676_100136211 242
131 3300026116 Ga0207674_10000362 Ga0207674_1000036212 242
132 3300026118 Ga0207675_100088265 Ga0207675_1000882653 242
133 3300026121 Ga0207683_10222248 Ga0207683_102222482 242
134 3300028379 Ga0268266_10006241 Ga0268266_1000624114 242
135 3300028380 Ga0268265_10031559 Ga0268265_100315593 242
136 3300028380 Ga0268265_10484325 Ga0268265_104843252 242
137 3300028381 Ga0268264_10293479 Ga0268264_102934791 242
138 3300031548 Ga0307408_100144941 Ga0307408_1001449412 242
139 3300031731 Ga0307405_10017929 Ga0307405_100179294 242
140 3300031824 Ga0307413_10009619 Ga0307413_100096193 242
141 3300031852 Ga0307410_10100999 Ga0307410_101009992 242
142 3300031901 Ga0307406_10039118 Ga0307406_100391183 242
143 3300031903 Ga0307407_10020538 Ga0307407_100205381 242
144 3300031911 Ga0307412_10039561 Ga0307412_100395613 242
145 3300032002 Ga0307416_100063814 Ga0307416_1000638142 242
146 3300032002 Ga0307416_100117754 Ga0307416_1001177542 242
147 3300032004 Ga0307414_10108756 Ga0307414_101087562 242
148 3300032005 Ga0307411_10138770 Ga0307411_101387702 242
149 3300044693 Ga0466961_0120787 Ga0466961_0120787_14_793 242
150 3300005367 Ga0070667_100176732 Ga0070667_1001767321 243
151 3300025986 Ga0207658_10087743 Ga0207658_100877433 243
152 3300045051 Ga0451576_0000165 Ga0451576_0000165_153822_154724 243
153 3300048907 Ga0496104_0206919 Ga0496104_0206919_1028_1834 243
154 3300005336 Ga0070680_100001732 Ga0070680_10000173215 244
155 3300005530 Ga0070679_100000084 Ga0070679_10000008455 244
156 3300025912 Ga0207707_10196048 Ga0207707_101960483 244
157 3300025917 Ga0207660_10001596 Ga0207660_1000159615 244
158 3300025921 Ga0207652_10000001 Ga0207652_10000001561 244
159 3300025921 Ga0207652_10000002 Ga0207652_10000002167 244
160 3300005327 Ga0070658_10000804 Ga0070658_1000080429 245
161 3300005339 Ga0070660_100000429 Ga0070660_1000004294 245
162 3300005344 Ga0070661_100000001 Ga0070661_100000001428 245
163 3300005366 Ga0070659_100075744 Ga0070659_1000757442 245
164 3300005530 Ga0070679_100334217 Ga0070679_1003342172 245
165 3300005563 Ga0068855_100000140 Ga0068855_10000014046 245
166 3300005563 Ga0068855_100208357 Ga0068855_1002083572 245
167 3300025909 Ga0207705_10057449 Ga0207705_100574493 245
168 3300025919 Ga0207657_10115779 Ga0207657_101157792 245
169 3300025920 Ga0207649_10000011 Ga0207649_1000001171 245
170 3300025921 Ga0207652_10457859 Ga0207652_104578591 245
171 3300026142 Ga0207698_10006091 Ga0207698_100060915 245
172 3300009177 Ga0105248_10122183 Ga0105248_101221835 246
173 3300025921 Ga0207652_10085533 Ga0207652_100855333 246
174 3300038443 Ga0395901_0000372 Ga0395901_0000372_19983_20885 246
175 3300049568 Ga0501031_0070523 Ga0501031_0070523_813_1685 246
176 3300049570 Ga0501033_0134988 Ga0501033_0134988_560_1432 246
177 3300049572 Ga0501036_0134892 Ga0501036_0134892_560_1432 246
178 3300049573 Ga0501037_0149253 Ga0501037_0149253_21_893 246
179 3300049575 Ga0501039_0008592 Ga0501039_0008592_3834_4706 246
180 3300049580 Ga0501046_0051299 Ga0501046_0051299_224_1096 246
181 3300049581 Ga0501047_0019705 Ga0501047_0019705_3380_4252 246
182 3300049822 Ga0501035_0039951 Ga0501035_0039951_2304_3176 246
183 3300049823 Ga0501044_0183294 Ga0501044_0183294_1167_2039 246
184 3300002067 JGI24735J21928_10009291 JGI24735J21928_100092912 247
185 3300005293 Ga0065715_10032864 Ga0065715_100328641 247
186 3300005347 Ga0070668_100004445 Ga0070668_1000044455 247
187 3300032002 Ga0307416_100882184 Ga0307416_1008821842 247
188 3300044694 Ga0466963_0035358 Ga0466963_0035358_1930_2757 247
189 3300048920 Ga0496117_0016745 Ga0496117_0016745_2179_3006 247
190 3300048921 Ga0496118_0020688 Ga0496118_0020688_4558_5385 247
191 3300048927 Ga0496124_0024411 Ga0496124_0024411_1637_2464 247
192 3300001915 JGI24741J21665_1006848 JGI24741J21665_10068483 248
193 3300001979 JGI24740J21852_10009823 JGI24740J21852_100098233 248
194 3300001989 JGI24739J22299_10024453 JGI24739J22299_100244532 248
195 3300005329 Ga0070683_100050095 Ga0070683_1000500952 248
196 3300005336 Ga0070680_100091083 Ga0070680_1000910832 248
197 3300005337 Ga0070682_100019049 Ga0070682_1000190493 248
198 3300005344 Ga0070661_100047264 Ga0070661_1000472643 248
199 3300005455 Ga0070663_100288300 Ga0070663_1002883002 248
200 3300005547 Ga0070693_100044724 Ga0070693_1000447242 248
201 3300005564 Ga0070664_100052475 Ga0070664_1000524753 248
202 3300005578 Ga0068854_100242229 Ga0068854_1002422291 248
203 3300005937 Ga0081455_10003938 Ga0081455_1000393811 248
204 3300009177 Ga0105248_10023881 Ga0105248_100238813 248
205 3300025917 Ga0207660_10031891 Ga0207660_100318913 248
206 3300025917 Ga0207660_10082343 Ga0207660_100823433 248
207 3300025919 Ga0207657_10004948 Ga0207657_1000494810 248
208 3300025919 Ga0207657_10056273 Ga0207657_100562733 248
209 3300025920 Ga0207649_10013035 Ga0207649_100130353 248
210 3300025932 Ga0207690_10075659 Ga0207690_100756593 248
211 3300025933 Ga0207706_10064959 Ga0207706_100649592 248
212 3300025941 Ga0207711_10002916 Ga0207711_100029163 248
213 3300025944 Ga0207661_10580099 Ga0207661_105800991 248
214 3300025945 Ga0207679_10016932 Ga0207679_100169323 248
215 3300026067 Ga0207678_10082202 Ga0207678_100822022 248
216 3300026116 Ga0207674_10124627 Ga0207674_101246273 248
217 3300046557 Ga0495622_0078320 Ga0495622_0078320_275_1099 248
218 3300048905 Ga0496102_0189603 Ga0496102_0189603_725_1567 248
219 3300048920 Ga0496117_0017057 Ga0496117_0017057_1739_2584 248
220 3300048921 Ga0496118_0162211 Ga0496118_0162211_178_1023 248
221 3300005327 Ga0070658_10025945 Ga0070658_100259453 249
222 3300005344 Ga0070661_100025047 Ga0070661_1000250471 249
223 3300005366 Ga0070659_100018069 Ga0070659_1000180692 249
224 3300005543 Ga0070672_100139635 Ga0070672_1001396351 249
225 3300005616 Ga0068852_100004746 Ga0068852_1000047465 249
226 3300009093 Ga0105240_10016469 Ga0105240_1001646910 249
227 3300009545 Ga0105237_10007184 Ga0105237_100071847 249
228 3300010375 Ga0105239_10003490 Ga0105239_100034909 249
229 3300013100 Ga0157373_10028028 Ga0157373_100280282 249
230 3300013104 Ga0157370_10321581 Ga0157370_103215812 249
231 3300025913 Ga0207695_10141665 Ga0207695_101416651 249
232 3300025914 Ga0207671_10026576 Ga0207671_100265764 249
233 3300025981 Ga0207640_10025099 Ga0207640_100250994 249
234 3300031852 Ga0307410_10003662 Ga0307410_100036625 249
235 3300031903 Ga0307407_10004989 Ga0307407_100049894 249
236 3300032005 Ga0307411_10006942 Ga0307411_100069425 249
237 3300032126 Ga0307415_100058241 Ga0307415_1000582411 249
238 3300038443 Ga0395901_0047725 Ga0395901_0047725_2255_3058 249
239 3300038443 Ga0395901_0851124 Ga0395901_0851124_12_839 249
240 3300046525 Ga0495663_0001559 Ga0495663_0001559_3804_4640 249
241 3300046558 Ga0495633_0003354 Ga0495633_0003354_7899_8735 249
242 3300046684 Ga0495669_0003515 Ga0495669_0003515_1252_2088 249
243 3300048924 Ga0496121_0001910 Ga0496121_0001910_10119_10964 249
244 3300048924 Ga0496121_0007299 Ga0496121_0007299_5529_6374 249
245 3300048929 Ga0496126_0042348 Ga0496126_0042348_1286_2131 249
246 3300049570 Ga0501033_0024174 Ga0501033_0024174_1588_2436 249
247 3300005327 Ga0070658_10355880 Ga0070658_103558802 250
248 3300005330 Ga0070690_100018415 Ga0070690_1000184151 250
249 3300005334 Ga0068869_100408801 Ga0068869_1004088012 250
250 3300005335 Ga0070666_10000423 Ga0070666_1000042331 250
251 3300005338 Ga0068868_100004040 Ga0068868_1000040409 250
252 3300005354 Ga0070675_100042513 Ga0070675_1000425133 250
253 3300005355 Ga0070671_100008472 Ga0070671_1000084727 250
254 3300005435 Ga0070714_100159767 Ga0070714_1001597672 250
255 3300005436 Ga0070713_100066402 Ga0070713_1000664023 250
256 3300005458 Ga0070681_10193772 Ga0070681_101937722 250
257 3300005458 Ga0070681_10225772 Ga0070681_102257721 250
258 3300005539 Ga0068853_100075776 Ga0068853_1000757765 250
259 3300005564 Ga0070664_100115721 Ga0070664_1001157211 250
260 3300005614 Ga0068856_100178943 Ga0068856_1001789433 250
261 3300005842 Ga0068858_100005027 Ga0068858_1000050272 250
262 3300006028 Ga0070717_10002536 Ga0070717_1000253612 250
263 3300009093 Ga0105240_10226233 Ga0105240_102262332 250
264 3300009174 Ga0105241_10062098 Ga0105241_100620982 250
265 3300009177 Ga0105248_10004884 Ga0105248_100048843 250
266 3300009177 Ga0105248_10121245 Ga0105248_101212453 250
267 3300009177 Ga0105248_10144527 Ga0105248_101445275 250
268 3300009177 Ga0105248_10176069 Ga0105248_101760694 250
269 3300013100 Ga0157373_10010454 Ga0157373_100104543 250
270 3300013100 Ga0157373_10105319 Ga0157373_101053192 250
271 3300013102 Ga0157371_10122715 Ga0157371_101227151 250
272 3300013104 Ga0157370_10023880 Ga0157370_100238807 250
273 3300013296 Ga0157374_10108247 Ga0157374_101082472 250
274 3300013307 Ga0157372_10249372 Ga0157372_102493723 250
275 3300014968 Ga0157379_10084203 Ga0157379_100842032 250
276 3300014969 Ga0157376_10513776 Ga0157376_105137762 250
277 3300025903 Ga0207680_10000597 Ga0207680_1000059721 250
278 3300025909 Ga0207705_10031353 Ga0207705_100313532 250
279 3300025909 Ga0207705_10061791 Ga0207705_100617911 250
280 3300025928 Ga0207700_10133337 Ga0207700_101333373 250
281 3300025933 Ga0207706_10001570 Ga0207706_1000157010 250
282 3300025938 Ga0207704_10040010 Ga0207704_100400102 250
283 3300025941 Ga0207711_10003788 Ga0207711_1000378812 250
284 3300025945 Ga0207679_10094533 Ga0207679_100945333 250
285 3300025960 Ga0207651_10015695 Ga0207651_100156954 250
286 3300026023 Ga0207677_10094798 Ga0207677_100947982 250
287 3300031995 Ga0307409_100128097 Ga0307409_1001280973 250
288 3300032005 Ga0307411_10116173 Ga0307411_101161732 250
289 3300037312 Ga0395899_0062948 Ga0395899_0062948_17_835 250
290 3300037312 Ga0395899_0138059 Ga0395899_0138059_283_1086 250
291 3300037312 Ga0395899_0287472 Ga0395899_0287472_140_943 250
292 3300037418 Ga0395900_0040463 Ga0395900_0040463_2510_3313 250
293 3300037418 Ga0395900_0049491 Ga0395900_0049491_1343_2146 250
294 3300037418 Ga0395900_0851061 Ga0395900_0851061_11_820 250
295 3300037418 Ga0395900_0851115 Ga0395900_0851115_11_820 250
296 3300037466 Ga0395898_0029222 Ga0395898_0029222_2085_2888 250
297 3300037466 Ga0395898_0282613 Ga0395898_0282613_221_1030 250
298 3300037466 Ga0395898_0365201 Ga0395898_0365201_525_1328 250
299 3300037471 Ga0395905_0000191 Ga0395905_0000191_10904_11707 250
300 3300037471 Ga0395905_0031138 Ga0395905_0031138_3246_4064 250
301 3300037471 Ga0395905_0058702 Ga0395905_0058702_1784_2587 250
302 3300037471 Ga0395905_0155546 Ga0395905_0155546_140_943 250
303 3300037471 Ga0395905_0176934 Ga0395905_0176934_996_1805 250
304 3300038443 Ga0395901_0043213 Ga0395901_0043213_1512_2330 250
305 3300038443 Ga0395901_0058383 Ga0395901_0058383_433_1242 250
306 3300038443 Ga0395901_0687124 Ga0395901_0687124_80_883 250
307 3300042157 Ga0439458_0000128 Ga0439458_0000128_7084_7902 250
308 3300044693 Ga0466961_0249503 Ga0466961_0249503_18_821 250
309 3300044735 Ga0466968_0196175 Ga0466968_0196175_39_848 250
310 3300045836 Ga0466958_0029516 Ga0466958_0029516_2361_3164 250
311 3300048910 Ga0496107_0163673 Ga0496107_0163673_521_1339 250
312 3300048911 Ga0496108_0046589 Ga0496108_0046589_647_1465 250
313 3300048913 Ga0496110_0025783 Ga0496110_0025783_1247_2065 250
314 3300048914 Ga0496111_0024681 Ga0496111_0024681_1939_2757 250
315 3300048915 Ga0496112_0003098 Ga0496112_0003098_11810_12619 250
316 3300048915 Ga0496112_0030167 Ga0496112_0030167_1240_2058 250
317 3300048916 Ga0496113_0003879 Ga0496113_0003879_4006_4824 250
318 3300002067 JGI24735J21928_10039117 JGI24735J21928_100391172 251
319 3300005339 Ga0070660_100069919 Ga0070660_1000699192 251
320 3300005339 Ga0070660_100169390 Ga0070660_1001693902 251
321 3300005455 Ga0070663_100037040 Ga0070663_1000370402 251
322 3300005563 Ga0068855_100802288 Ga0068855_1008022881 251
323 3300005614 Ga0068856_100073821 Ga0068856_1000738213 251
324 3300005834 Ga0068851_10063439 Ga0068851_100634392 251
325 3300005841 Ga0068863_100021803 Ga0068863_1000218032 251
326 3300009093 Ga0105240_10201997 Ga0105240_102019972 251
327 3300009551 Ga0105238_10794773 Ga0105238_107947731 251
328 3300013104 Ga0157370_10040745 Ga0157370_100407451 251
329 3300013296 Ga0157374_10053157 Ga0157374_100531571 251
330 3300025321 Ga0207656_10043174 Ga0207656_100431742 251
331 3300025904 Ga0207647_10042677 Ga0207647_100426771 251
332 3300025909 Ga0207705_10000060 Ga0207705_1000006051 251
333 3300025909 Ga0207705_10000429 Ga0207705_100004299 251
334 3300025909 Ga0207705_10116834 Ga0207705_101168342 251
335 3300025913 Ga0207695_10099265 Ga0207695_100992652 251
336 3300025919 Ga0207657_10036351 Ga0207657_100363515 251
337 3300025920 Ga0207649_10026333 Ga0207649_100263334 251
338 3300025932 Ga0207690_10027150 Ga0207690_100271503 251
339 3300025932 Ga0207690_10102191 Ga0207690_101021912 251
340 3300025949 Ga0207667_10212586 Ga0207667_102125863 251
341 3300026041 Ga0207639_10000181 Ga0207639_1000018139 251
342 3300026067 Ga0207678_10019512 Ga0207678_100195125 251
343 3300026067 Ga0207678_10167987 Ga0207678_101679873 251
344 3300026088 Ga0207641_10000248 Ga0207641_100002489 251
345 3300026116 Ga0207674_10046988 Ga0207674_100469882 251
346 3300031824 Ga0307413_10032790 Ga0307413_100327903 251
347 3300031852 Ga0307410_10047354 Ga0307410_100473543 251
348 3300031903 Ga0307407_10347779 Ga0307407_103477791 251
349 3300031995 Ga0307409_100079381 Ga0307409_1000793813 251
350 3300032004 Ga0307414_10002679 Ga0307414_100026793 251
351 3300032005 Ga0307411_10111837 Ga0307411_101118372 251
352 3300032126 Ga0307415_100229718 Ga0307415_1002297182 251
353 3300038443 Ga0395901_0577356 Ga0395901_0577356_77_916 251
354 3300045976 Ga0466967_0068397 Ga0466967_0068397_2132_2995 251
355 3300046616 Ga0495668_0007644 Ga0495668_0007644_1133_1990 251
356 3300053134 Ga0500658_0000044 Ga0500658_0000044_55454_56311 251
357 iso_pu_bacteria 2896429255 2896430695 251
358 3300005327 Ga0070658_10364852 Ga0070658_103648521 252
359 3300005355 Ga0070671_100079136 Ga0070671_1000791364 252
360 3300005366 Ga0070659_100520096 Ga0070659_1005200961 252
361 3300005455 Ga0070663_100067226 Ga0070663_1000672264 252
362 3300005458 Ga0070681_10013716 Ga0070681_100137162 252
363 3300005459 Ga0068867_100207122 Ga0068867_1002071222 252
364 3300005577 Ga0068857_100012357 Ga0068857_10001235710 252
365 3300005614 Ga0068856_100059021 Ga0068856_1000590215 252
366 3300005617 Ga0068859_100038948 Ga0068859_1000389482 252
367 3300005618 Ga0068864_100384687 Ga0068864_1003846872 252
368 3300005718 Ga0068866_10151943 Ga0068866_101519432 252
369 3300005842 Ga0068858_100045941 Ga0068858_1000459415 252
370 3300005843 Ga0068860_100153319 Ga0068860_1001533192 252
371 3300006237 Ga0097621_100084268 Ga0097621_1000842684 252
372 3300006358 Ga0068871_100015704 Ga0068871_1000157045 252
373 3300006931 Ga0097620_100038948 Ga0097620_1000389482 252
374 3300013105 Ga0157369_10108916 Ga0157369_101089163 252
375 3300020082 Ga0206353_12003655 Ga0206353_120036551 252
376 3300021358 Ga0213873_10000013 Ga0213873_100000135 252
377 3300021384 Ga0213876_10000072 Ga0213876_10000072102 252
378 3300025912 Ga0207707_10034868 Ga0207707_100348685 252
379 3300025920 Ga0207649_10029694 Ga0207649_100296946 252
380 3300025921 Ga0207652_10351317 Ga0207652_103513172 252
381 3300025938 Ga0207704_10120005 Ga0207704_101200052 252
382 3300025941 Ga0207711_10079180 Ga0207711_100791805 252
383 3300025945 Ga0207679_10035489 Ga0207679_100354895 252
384 3300025972 Ga0207668_10179117 Ga0207668_101791172 252
385 3300026035 Ga0207703_10284006 Ga0207703_102840061 252
386 3300026116 Ga0207674_10002525 Ga0207674_100025258 252
387 3300028381 Ga0268264_10110389 Ga0268264_101103892 252
388 3300035172 Ga0373955_0018662 Ga0373955_0018662_2024_2902 252
389 3300035724 Ga0373933_0123139 Ga0373933_0123139_688_1566 252
390 3300036401 Ga0373937_0153667 Ga0373937_0153667_31_909 252
391 3300037853 Ga0436364_0677582 Ga0436364_0677582_23965_24822 252
392 3300044694 Ga0466963_0067976 Ga0466963_0067976_704_1534 252
393 3300044694 Ga0466963_0284757 Ga0466963_0284757_204_1031 252
394 3300046492 Ga0495585_0098837 Ga0495585_0098837_316_1152 252
395 3300046615 Ga0495656_0040806 Ga0495656_0040806_587_1423 252
396 3300047445 Ga0495677_0003479 Ga0495677_0003479_643_1470 252
397 3300048088 Ga0495602_0046107 Ga0495602_0046107_2144_3022 252
398 3300048910 Ga0496107_0002672 Ga0496107_0002672_7677_8504 252
399 3300048911 Ga0496108_0001735 Ga0496108_0001735_12670_13497 252
400 3300048917 Ga0496114_0000023 Ga0496114_0000023_94592_95425 252
401 3300048928 Ga0496125_0125213 Ga0496125_0125213_10_846 252
402 3300049590 Ga0501074_0015841 Ga0501074_0015841_2575_3402 252
403 3300049742 Ga0501080_0015862 Ga0501080_0015862_5735_6562 252
404 3300049770 Ga0501273_014534 Ga0501273_014534_106_933 252
405 3300005331 Ga0070670_100215110 Ga0070670_1002151102 253
406 3300005564 Ga0070664_100001162 Ga0070664_10000116223 253
407 3300005578 Ga0068854_100001009 Ga0068854_1000010099 253
408 3300009551 Ga0105238_10355514 Ga0105238_103555141 253
409 3300013105 Ga0157369_10185040 Ga0157369_101850403 253
410 3300025904 Ga0207647_10071363 Ga0207647_100713632 253
411 3300025913 Ga0207695_10011772 Ga0207695_100117721 253
412 3300025925 Ga0207650_10440766 Ga0207650_104407662 253
413 3300025945 Ga0207679_10012480 Ga0207679_100124804 253
414 3300025981 Ga0207640_10001792 Ga0207640_100017925 253
415 3300026041 Ga0207639_10196098 Ga0207639_101960982 253
416 3300026078 Ga0207702_10006261 Ga0207702_1000626110 253
417 3300031852 Ga0307410_10005908 Ga0307410_100059084 253
418 3300032005 Ga0307411_10011678 Ga0307411_100116782 253
419 3300032126 Ga0307415_100060888 Ga0307415_1000608882 253
420 3300037466 Ga0395898_0091995 Ga0395898_0091995_1085_1924 253
421 3300044694 Ga0466963_0052679 Ga0466963_0052679_329_1156 253
422 3300044719 Ga0466971_0057437 Ga0466971_0057437_722_1549 253
423 3300044842 Ga0466957_0038695 Ga0466957_0038695_1906_2733 253
424 3300002076 JGI24749J21850_1003461 JGI24749J21850_10034613 254
425 3300002239 JGI24034J26672_10012066 JGI24034J26672_100120662 254
426 3300005288 Ga0065714_10165085 Ga0065714_101650851 254
427 3300005290 Ga0065712_10118971 Ga0065712_101189712 254
428 3300005293 Ga0065715_10096139 Ga0065715_100961394 254
429 3300005327 Ga0070658_10136282 Ga0070658_101362822 254
430 3300005328 Ga0070676_10056365 Ga0070676_100563653 254
431 3300005331 Ga0070670_100007045 Ga0070670_1000070452 254
432 3300005347 Ga0070668_100007507 Ga0070668_1000075072 254
433 3300005347 Ga0070668_100114623 Ga0070668_1001146232 254
434 3300005353 Ga0070669_100006697 Ga0070669_1000066972 254
435 3300005354 Ga0070675_100005812 Ga0070675_1000058127 254
436 3300005354 Ga0070675_100146227 Ga0070675_1001462272 254
437 3300005355 Ga0070671_100060803 Ga0070671_1000608033 254
438 3300005356 Ga0070674_100021874 Ga0070674_1000218744 254
439 3300005367 Ga0070667_100049786 Ga0070667_1000497864 254
440 3300005457 Ga0070662_100002479 Ga0070662_1000024793 254
441 3300005459 Ga0068867_100012614 Ga0068867_1000126142 254
442 3300005539 Ga0068853_100250815 Ga0068853_1002508152 254
443 3300005543 Ga0070672_100036136 Ga0070672_1000361363 254
444 3300005548 Ga0070665_100030202 Ga0070665_1000302024 254
445 3300005549 Ga0070704_100465225 Ga0070704_1004652251 254
446 3300005617 Ga0068859_100013013 Ga0068859_1000130135 254
447 3300005618 Ga0068864_100086258 Ga0068864_1000862581 254
448 3300005719 Ga0068861_100100439 Ga0068861_1001004392 254
449 3300005843 Ga0068860_100173922 Ga0068860_1001739222 254
450 3300005844 Ga0068862_100016580 Ga0068862_1000165803 254
451 3300006358 Ga0068871_100473257 Ga0068871_1004732571 254
452 3300006931 Ga0097620_100013013 Ga0097620_1000130135 254
453 3300009094 Ga0111539_10149841 Ga0111539_101498412 254
454 3300009177 Ga0105248_10060357 Ga0105248_100603572 254
455 3300009177 Ga0105248_10097014 Ga0105248_100970143 254
456 3300013104 Ga0157370_10132127 Ga0157370_101321273 254
457 3300013306 Ga0163162_10251582 Ga0163162_102515822 254
458 3300013308 Ga0157375_10006148 Ga0157375_100061483 254
459 3300014326 Ga0157380_10003914 Ga0157380_100039147 254
460 3300017792 Ga0163161_10001527 Ga0163161_100015274 254
461 3300017792 Ga0163161_10069912 Ga0163161_100699122 254
462 3300025315 Ga0207697_10013188 Ga0207697_100131882 254
463 3300025893 Ga0207682_10000424 Ga0207682_1000042421 254
464 3300025907 Ga0207645_10061384 Ga0207645_100613842 254
465 3300025908 Ga0207643_10108335 Ga0207643_101083352 254
466 3300025923 Ga0207681_10005400 Ga0207681_100054004 254
467 3300025925 Ga0207650_10106894 Ga0207650_101068942 254
468 3300025931 Ga0207644_10041158 Ga0207644_100411582 254
469 3300025932 Ga0207690_10252149 Ga0207690_102521492 254
470 3300025933 Ga0207706_10003918 Ga0207706_100039185 254
471 3300025937 Ga0207669_10002778 Ga0207669_100027786 254
472 3300025938 Ga0207704_10282196 Ga0207704_102821962 254
473 3300025940 Ga0207691_10034379 Ga0207691_100343793 254
474 3300025941 Ga0207711_10101797 Ga0207711_101017973 254
475 3300025941 Ga0207711_10138867 Ga0207711_101388672 254
476 3300025960 Ga0207651_10046750 Ga0207651_100467503 254
477 3300026067 Ga0207678_10164153 Ga0207678_101641533 254
478 3300026067 Ga0207678_10434706 Ga0207678_104347062 254
479 3300026089 Ga0207648_10012992 Ga0207648_100129923 254
480 3300026095 Ga0207676_10531228 Ga0207676_105312281 254
481 3300026116 Ga0207674_10210765 Ga0207674_102107652 254
482 3300026121 Ga0207683_10045340 Ga0207683_100453403 254
483 3300028380 Ga0268265_10046076 Ga0268265_100460762 254
484 3300028381 Ga0268264_10137411 Ga0268264_101374112 254
485 3300031548 Ga0307408_100010309 Ga0307408_1000103093 254
486 3300031548 Ga0307408_100015486 Ga0307408_1000154863 254
487 3300031731 Ga0307405_10292610 Ga0307405_102926101 254
488 3300031824 Ga0307413_10021302 Ga0307413_100213023 254
489 3300031852 Ga0307410_10004619 Ga0307410_100046198 254
490 3300031852 Ga0307410_10012343 Ga0307410_100123431 254
491 3300031852 Ga0307410_10029309 Ga0307410_100293093 254
492 3300031852 Ga0307410_10060622 Ga0307410_100606223 254
493 3300031901 Ga0307406_10019692 Ga0307406_100196923 254
494 3300031901 Ga0307406_10346833 Ga0307406_103468332 254
495 3300031903 Ga0307407_10034387 Ga0307407_100343873 254
496 3300031911 Ga0307412_10049607 Ga0307412_100496073 254
497 3300031911 Ga0307412_10128789 Ga0307412_101287892 254
498 3300031995 Ga0307409_100023866 Ga0307409_1000238662 254
499 3300031995 Ga0307409_100038652 Ga0307409_1000386525 254
500 3300031995 Ga0307409_100040555 Ga0307409_1000405553 254
501 3300032002 Ga0307416_100392965 Ga0307416_1003929651 254
502 3300032004 Ga0307414_10010879 Ga0307414_100108794 254
503 3300032004 Ga0307414_10037200 Ga0307414_100372003 254
504 3300032004 Ga0307414_10105553 Ga0307414_101055532 254
505 3300032004 Ga0307414_10310971 Ga0307414_103109711 254
506 3300032005 Ga0307411_10025253 Ga0307411_100252532 254
507 3300032005 Ga0307411_10054580 Ga0307411_100545802 254
508 3300032126 Ga0307415_100025028 Ga0307415_1000250286 254
509 3300037418 Ga0395900_0022912 Ga0395900_0022912_2967_3809 254
510 3300042436 Ga0439435_0043597 Ga0439435_0043597_155_982 254
511 3300046525 Ga0495663_0018856 Ga0495663_0018856_1081_1908 254
512 3300046539 Ga0495621_0003645 Ga0495621_0003645_2747_3574 254
513 3300046558 Ga0495633_0144155 Ga0495633_0144155_58_885 254
514 3300046664 Ga0495659_0015028 Ga0495659_0015028_1338_2165 254
515 3300048913 Ga0496110_0309332 Ga0496110_0309332_365_1207 254
516 3300048917 Ga0496114_0039924 Ga0496114_0039924_1314_2156 254
517 3300049664 Ga0501224_011229 Ga0501224_011229_433_1260 254
518 3300049686 Ga0501257_022988 Ga0501257_022988_557_1384 254
519 iso_pu_bacteria 2885427238 2885427925 254
520 3300005293 Ga0065715_10291120 Ga0065715_102911201 255
521 3300005295 Ga0065707_10238438 Ga0065707_102384381 255
522 3300005327 Ga0070658_10208406 Ga0070658_102084062 255
523 3300005347 Ga0070668_100167285 Ga0070668_1001672852 255
524 3300005353 Ga0070669_100100399 Ga0070669_1001003992 255
525 3300005356 Ga0070674_100377919 Ga0070674_1003779191 255
526 3300005435 Ga0070714_100044040 Ga0070714_1000440403 255
527 3300005436 Ga0070713_100208345 Ga0070713_1002083451 255
528 3300005457 Ga0070662_100166496 Ga0070662_1001664962 255
529 3300005543 Ga0070672_100243242 Ga0070672_1002432422 255
530 3300005578 Ga0068854_100050577 Ga0068854_1000505772 255
531 3300005614 Ga0068856_100021267 Ga0068856_1000212674 255
532 3300005844 Ga0068862_100179958 Ga0068862_1001799582 255
533 3300005844 Ga0068862_100518708 Ga0068862_1005187081 255
534 3300009093 Ga0105240_10039898 Ga0105240_100398982 255
535 3300009093 Ga0105240_10230587 Ga0105240_102305872 255
536 3300009177 Ga0105248_10124780 Ga0105248_101247803 255
537 3300009545 Ga0105237_10205419 Ga0105237_102054192 255
538 3300009551 Ga0105238_10762075 Ga0105238_107620751 255
539 3300013104 Ga0157370_10065713 Ga0157370_100657136 255
540 3300013105 Ga0157369_10368681 Ga0157369_103686812 255
541 3300021388 Ga0213875_10002749 Ga0213875_1000274910 255
542 3300025903 Ga0207680_10078507 Ga0207680_100785072 255
543 3300025904 Ga0207647_10073743 Ga0207647_100737433 255
544 3300025913 Ga0207695_10030691 Ga0207695_100306912 255
545 3300025913 Ga0207695_10105662 Ga0207695_101056622 255
546 3300025919 Ga0207657_10103324 Ga0207657_101033242 255
547 3300025919 Ga0207657_10288831 Ga0207657_102888311 255
548 3300025923 Ga0207681_10116196 Ga0207681_101161961 255
549 3300025928 Ga0207700_10119211 Ga0207700_101192111 255
550 3300025929 Ga0207664_10021829 Ga0207664_100218293 255
551 3300025933 Ga0207706_10293716 Ga0207706_102937162 255
552 3300025941 Ga0207711_10145478 Ga0207711_101454782 255
553 3300025945 Ga0207679_10570951 Ga0207679_105709511 255
554 3300025949 Ga0207667_10071459 Ga0207667_100714593 255
555 3300025972 Ga0207668_10065635 Ga0207668_100656355 255
556 3300025981 Ga0207640_10146733 Ga0207640_101467332 255
557 3300026067 Ga0207678_10155890 Ga0207678_101558902 255
558 3300026142 Ga0207698_10062881 Ga0207698_100628813 255
559 3300027907 Ga0207428_10241385 Ga0207428_102413852 255
560 3300028379 Ga0268266_10337717 Ga0268266_103377172 255
561 3300028380 Ga0268265_10227669 Ga0268265_102276692 255
562 3300031548 Ga0307408_100148430 Ga0307408_1001484303 255
563 3300031548 Ga0307408_100261986 Ga0307408_1002619862 255
564 3300031616 Ga0307508_10169671 Ga0307508_101696712 255
565 3300031731 Ga0307405_10461136 Ga0307405_104611361 255
566 3300031824 Ga0307413_10062771 Ga0307413_100627712 255
567 3300031824 Ga0307413_10252159 Ga0307413_102521592 255
568 3300031852 Ga0307410_10014744 Ga0307410_100147443 255
569 3300031852 Ga0307410_10151467 Ga0307410_101514672 255
570 3300031903 Ga0307407_10023918 Ga0307407_100239183 255
571 3300031911 Ga0307412_10064610 Ga0307412_100646104 255
572 3300031995 Ga0307409_100026262 Ga0307409_1000262623 255
573 3300031995 Ga0307409_100137929 Ga0307409_1001379293 255
574 3300031995 Ga0307409_100289991 Ga0307409_1002899912 255
575 3300032002 Ga0307416_100062269 Ga0307416_1000622692 255
576 3300032002 Ga0307416_100107888 Ga0307416_1001078882 255
577 3300032002 Ga0307416_100137610 Ga0307416_1001376103 255
578 3300032004 Ga0307414_10005253 Ga0307414_100052535 255
579 3300032005 Ga0307411_10009661 Ga0307411_100096612 255
580 3300032005 Ga0307411_10015157 Ga0307411_100151576 255
581 3300032005 Ga0307411_10190780 Ga0307411_101907802 255
582 3300032126 Ga0307415_100013999 Ga0307415_1000139995 255
583 3300037312 Ga0395899_0265076 Ga0395899_0265076_49_897 255
584 3300037418 Ga0395900_0247442 Ga0395900_0247442_225_1082 255
585 3300037471 Ga0395905_0082622 Ga0395905_0082622_406_1233 255
586 3300037471 Ga0395905_0533237 Ga0395905_0533237_178_1026 255
587 3300038443 Ga0395901_0195788 Ga0395901_0195788_1055_1912 255
588 3300038443 Ga0395901_0359926 Ga0395901_0359926_604_1452 255
589 3300039062 Ga0400483_207500 Ga0400483_207500_144_977 255
590 3300041410 Ga0439461_0034251 Ga0439461_0034251_225_1052 255
591 3300042439 Ga0439464_0004810 Ga0439464_0004810_57_884 255
592 3300044694 Ga0466963_0320194 Ga0466963_0320194_139_981 255
593 3300045976 Ga0466967_0137478 Ga0466967_0137478_891_1733 255
594 3300045976 Ga0466967_0186260 Ga0466967_0186260_347_1189 255
595 3300045976 Ga0466967_0257591 Ga0466967_0257591_516_1358 255
596 3300046525 Ga0495663_0000862 Ga0495663_0000862_7718_8578 255
597 3300046539 Ga0495621_0002526 Ga0495621_0002526_1626_2486 255
598 3300046664 Ga0495659_0012382 Ga0495659_0012382_112_939 255
599 3300048903 Ga0496100_0192553 Ga0496100_0192553_214_1041 255
600 3300048904 Ga0496101_0020671 Ga0496101_0020671_3198_4025 255
601 3300048910 Ga0496107_0096688 Ga0496107_0096688_664_1491 255
602 3300048912 Ga0496109_0123095 Ga0496109_0123095_1118_1945 255
603 3300048914 Ga0496111_0133860 Ga0496111_0133860_54_881 255
604 3300001989 JGI24739J22299_10011188 JGI24739J22299_100111883 256
605 3300001990 JGI24737J22298_10015978 JGI24737J22298_100159782 256
606 3300002075 JGI24738J21930_10006319 JGI24738J21930_100063193 256
607 3300005293 Ga0065715_10245126 Ga0065715_102451261 256
608 3300005327 Ga0070658_10000165 Ga0070658_1000016547 256
609 3300005327 Ga0070658_10092713 Ga0070658_100927132 256
610 3300005329 Ga0070683_100003336 Ga0070683_1000033362 256
611 3300005331 Ga0070670_100000565 Ga0070670_10000056524 256
612 3300005331 Ga0070670_100005098 Ga0070670_1000050987 256
613 3300005331 Ga0070670_100008555 Ga0070670_1000085558 256
614 3300005331 Ga0070670_100074052 Ga0070670_1000740523 256
615 3300005335 Ga0070666_10183635 Ga0070666_101836351 256
616 3300005339 Ga0070660_100000009 Ga0070660_100000009123 256
617 3300005339 Ga0070660_100032084 Ga0070660_1000320842 256
618 3300005344 Ga0070661_100000214 Ga0070661_10000021447 256
619 3300005344 Ga0070661_100004946 Ga0070661_10000494613 256
620 3300005347 Ga0070668_100013121 Ga0070668_1000131214 256
621 3300005353 Ga0070669_100087671 Ga0070669_1000876712 256
622 3300005355 Ga0070671_100194681 Ga0070671_1001946812 256
623 3300005366 Ga0070659_100000048 Ga0070659_10000004893 256
624 3300005367 Ga0070667_100062711 Ga0070667_1000627113 256
625 3300005455 Ga0070663_100000206 Ga0070663_10000020623 256
626 3300005455 Ga0070663_100131878 Ga0070663_1001318782 256
627 3300005456 Ga0070678_100349104 Ga0070678_1003491042 256
628 3300005457 Ga0070662_100000302 Ga0070662_1000003023 256
629 3300005457 Ga0070662_100029368 Ga0070662_1000293683 256
630 3300005539 Ga0068853_100000128 Ga0068853_10000012847 256
631 3300005543 Ga0070672_100138028 Ga0070672_1001380282 256
632 3300005543 Ga0070672_100147662 Ga0070672_1001476623 256
633 3300005548 Ga0070665_100000605 Ga0070665_10000060520 256
634 3300005548 Ga0070665_100007376 Ga0070665_10000737610 256
635 3300005563 Ga0068855_100000666 Ga0068855_10000066644 256
636 3300005564 Ga0070664_100000103 Ga0070664_10000010338 256
637 3300005564 Ga0070664_100009061 Ga0070664_10000906113 256
638 3300005578 Ga0068854_100075785 Ga0068854_1000757852 256
639 3300005614 Ga0068856_100000628 Ga0068856_10000062834 256
640 3300005616 Ga0068852_100001277 Ga0068852_1000012777 256
641 3300005618 Ga0068864_100069351 Ga0068864_1000693512 256
642 3300005834 Ga0068851_10205219 Ga0068851_102052192 256
643 3300005842 Ga0068858_100036151 Ga0068858_1000361515 256
644 3300005844 Ga0068862_100096812 Ga0068862_1000968123 256
645 3300006847 Ga0075431_100452277 Ga0075431_1004522771 256
646 3300009094 Ga0111539_10123895 Ga0111539_101238953 256
647 3300009177 Ga0105248_10000414 Ga0105248_1000041417 256
648 3300013102 Ga0157371_10014122 Ga0157371_100141224 256
649 3300013296 Ga0157374_10038628 Ga0157374_100386285 256
650 3300014325 Ga0163163_10000323 Ga0163163_100003236 256
651 3300014326 Ga0157380_10256975 Ga0157380_102569752 256
652 3300014326 Ga0157380_10265542 Ga0157380_102655422 256
653 3300014497 Ga0182008_10031700 Ga0182008_100317002 256
654 3300014968 Ga0157379_10003540 Ga0157379_100035402 256
655 3300025904 Ga0207647_10078337 Ga0207647_100783373 256
656 3300025909 Ga0207705_10000687 Ga0207705_1000068714 256
657 3300025909 Ga0207705_10022831 Ga0207705_100228315 256
658 3300025912 Ga0207707_10092462 Ga0207707_100924622 256
659 3300025919 Ga0207657_10000328 Ga0207657_1000032834 256
660 3300025919 Ga0207657_10014902 Ga0207657_100149022 256
661 3300025920 Ga0207649_10000266 Ga0207649_1000026638 256
662 3300025920 Ga0207649_10019707 Ga0207649_100197072 256
663 3300025925 Ga0207650_10001521 Ga0207650_100015219 256
664 3300025925 Ga0207650_10074888 Ga0207650_100748884 256
665 3300025925 Ga0207650_10211201 Ga0207650_102112011 256
666 3300025925 Ga0207650_10211400 Ga0207650_102114001 256
667 3300025931 Ga0207644_10066731 Ga0207644_100667313 256
668 3300025931 Ga0207644_10147543 Ga0207644_101475432 256
669 3300025932 Ga0207690_10000036 Ga0207690_1000003688 256
670 3300025933 Ga0207706_10000343 Ga0207706_1000034334 256
671 3300025933 Ga0207706_10004739 Ga0207706_1000473912 256
672 3300025940 Ga0207691_10070756 Ga0207691_100707563 256
673 3300025940 Ga0207691_10141639 Ga0207691_101416392 256
674 3300025941 Ga0207711_10000529 Ga0207711_1000052941 256
675 3300025945 Ga0207679_10000093 Ga0207679_1000009389 256
676 3300025945 Ga0207679_10007839 Ga0207679_100078397 256
677 3300025949 Ga0207667_10002660 Ga0207667_1000266016 256
678 3300025972 Ga0207668_10010696 Ga0207668_100106965 256
679 3300025981 Ga0207640_10060648 Ga0207640_100606483 256
680 3300025986 Ga0207658_10003068 Ga0207658_1000306814 256
681 3300026035 Ga0207703_10011050 Ga0207703_100110505 256
682 3300026041 Ga0207639_10001001 Ga0207639_1000100117 256
683 3300026067 Ga0207678_10016076 Ga0207678_100160762 256
684 3300026067 Ga0207678_10020835 Ga0207678_100208353 256
685 3300026067 Ga0207678_10422434 Ga0207678_104224341 256
686 3300026078 Ga0207702_10000619 Ga0207702_1000061912 256
687 3300026095 Ga0207676_10646239 Ga0207676_106462391 256
688 3300026142 Ga0207698_10001315 Ga0207698_1000131515 256
689 3300027876 Ga0209974_10033280 Ga0209974_100332801 256
690 3300028379 Ga0268266_10000337 Ga0268266_1000033776 256
691 3300028379 Ga0268266_10011158 Ga0268266_100111585 256
692 3300031548 Ga0307408_100106702 Ga0307408_1001067022 256
693 3300031548 Ga0307408_100195746 Ga0307408_1001957462 256
694 3300031731 Ga0307405_10016436 Ga0307405_100164361 256
695 3300031731 Ga0307405_10016740 Ga0307405_100167404 256
696 3300031731 Ga0307405_10131035 Ga0307405_101310353 256
697 3300031824 Ga0307413_10002912 Ga0307413_100029125 256
698 3300031824 Ga0307413_10007487 Ga0307413_100074872 256
699 3300031824 Ga0307413_10025726 Ga0307413_100257264 256
700 3300031852 Ga0307410_10012262 Ga0307410_100122623 256
701 3300031852 Ga0307410_10016523 Ga0307410_100165233 256
702 3300031852 Ga0307410_10034673 Ga0307410_100346733 256
703 3300031852 Ga0307410_10037134 Ga0307410_100371343 256
704 3300031852 Ga0307410_10054329 Ga0307410_100543294 256
705 3300031852 Ga0307410_10104385 Ga0307410_101043853 256
706 3300031901 Ga0307406_10023046 Ga0307406_100230462 256
707 3300031901 Ga0307406_10026016 Ga0307406_100260164 256
708 3300031901 Ga0307406_10039125 Ga0307406_100391252 256
709 3300031901 Ga0307406_10053972 Ga0307406_100539722 256
710 3300031901 Ga0307406_10054856 Ga0307406_100548563 256
711 3300031903 Ga0307407_10004135 Ga0307407_100041351 256
712 3300031903 Ga0307407_10029048 Ga0307407_100290483 256
713 3300031903 Ga0307407_10053773 Ga0307407_100537733 256
714 3300031903 Ga0307407_10058452 Ga0307407_100584523 256
715 3300031903 Ga0307407_10059162 Ga0307407_100591622 256
716 3300031903 Ga0307407_10080894 Ga0307407_100808942 256
717 3300031911 Ga0307412_10011925 Ga0307412_100119253 256
718 3300031911 Ga0307412_10018402 Ga0307412_100184024 256
719 3300031911 Ga0307412_10058410 Ga0307412_100584103 256
720 3300031911 Ga0307412_10510382 Ga0307412_105103821 256
721 3300031995 Ga0307409_100067050 Ga0307409_1000670503 256
722 3300031995 Ga0307409_100126522 Ga0307409_1001265223 256
723 3300031995 Ga0307409_100183907 Ga0307409_1001839073 256
724 3300032002 Ga0307416_100023314 Ga0307416_1000233143 256
725 3300032002 Ga0307416_100084812 Ga0307416_1000848123 256
726 3300032002 Ga0307416_100091687 Ga0307416_1000916872 256
727 3300032002 Ga0307416_100105106 Ga0307416_1001051062 256
728 3300032002 Ga0307416_100130606 Ga0307416_1001306063 256
729 3300032004 Ga0307414_10021719 Ga0307414_100217193 256
730 3300032004 Ga0307414_10042640 Ga0307414_100426404 256
731 3300032004 Ga0307414_10064914 Ga0307414_100649144 256
732 3300032005 Ga0307411_10023070 Ga0307411_100230703 256
733 3300032005 Ga0307411_10036994 Ga0307411_100369944 256
734 3300032005 Ga0307411_10042830 Ga0307411_100428303 256
735 3300032005 Ga0307411_10049430 Ga0307411_100494302 256
736 3300032005 Ga0307411_10052037 Ga0307411_100520373 256
737 3300032005 Ga0307411_10083778 Ga0307411_100837781 256
738 3300032005 Ga0307411_10397332 Ga0307411_103973322 256
739 3300032126 Ga0307415_100009728 Ga0307415_1000097285 256
740 3300032126 Ga0307415_100033642 Ga0307415_1000336423 256
741 3300032126 Ga0307415_100056165 Ga0307415_1000561653 256
742 3300032126 Ga0307415_100078756 Ga0307415_1000787562 256
743 3300035115 Ga0373941_0047938 Ga0373941_0047938_325_1152 256
744 3300035241 Ga0373961_0062184 Ga0373961_0062184_279_1106 256
745 3300035691 Ga0373931_0007622 Ga0373931_0007622_3560_4387 256
746 3300042004 Ga0439445_0000067 Ga0439445_0000067_9720_10580 256
747 3300042144 Ga0450889_000890 Ga0450889_000890_208_1035 256
748 3300045976 Ga0466967_0488284 Ga0466967_0488284_230_1072 256
749 3300048915 Ga0496112_0052107 Ga0496112_0052107_1751_2578 256
750 3300048916 Ga0496113_0001922 Ga0496113_0001922_6036_6863 256
751 3300049652 Ga0501202_007398 Ga0501202_007398_201_1028 256
752 3300049661 Ga0501217_005730 Ga0501217_005730_1572_2399 256
753 3300049679 Ga0501249_001739 Ga0501249_001739_477_1304 256
754 3300049705 Ga0501225_0005790 Ga0501225_0005790_1792_2619 256
755 3300049758 Ga0501241_019077 Ga0501241_019077_250_1077 256
756 3300049764 Ga0501267_000632 Ga0501267_000632_1219_2046 256
757 3300049851 Ga0501212_016142 Ga0501212_016142_54_881 256
758 3300050510 nmdc:mga06r32_100336_c1 nmdc:mga06r32_100336_c1_1777_2604 256
759 3300050511 nmdc:mga08y16_91605_c1 nmdc:mga08y16_91605_c1_1410_2237 256
760 3300053154 Ga0500619_003946 Ga0500619_003946_1884_3098 256
761 3300005290 Ga0065712_10120246 Ga0065712_101202462 257
762 3300005293 Ga0065715_10225146 Ga0065715_102251462 257
763 3300005327 Ga0070658_10039745 Ga0070658_100397456 257
764 3300005327 Ga0070658_10289437 Ga0070658_102894372 257
765 3300005331 Ga0070670_100005115 Ga0070670_1000051156 257
766 3300005331 Ga0070670_100109018 Ga0070670_1001090182 257
767 3300005344 Ga0070661_100083614 Ga0070661_1000836143 257
768 3300005353 Ga0070669_100121568 Ga0070669_1001215682 257
769 3300005354 Ga0070675_100030416 Ga0070675_1000304162 257
770 3300005355 Ga0070671_100000302 Ga0070671_10000030230 257
771 3300005356 Ga0070674_100030349 Ga0070674_1000303492 257
772 3300005356 Ga0070674_100267219 Ga0070674_1002672192 257
773 3300005367 Ga0070667_100026229 Ga0070667_1000262295 257
774 3300005455 Ga0070663_100158962 Ga0070663_1001589623 257
775 3300005457 Ga0070662_100013277 Ga0070662_1000132774 257
776 3300005530 Ga0070679_100391765 Ga0070679_1003917652 257
777 3300005543 Ga0070672_100000670 Ga0070672_10000067026 257
778 3300005564 Ga0070664_100001609 Ga0070664_1000016099 257
779 3300009177 Ga0105248_10004387 Ga0105248_100043878 257
780 3300013100 Ga0157373_10164863 Ga0157373_101648632 257
781 3300013308 Ga0157375_10076847 Ga0157375_100768472 257
782 3300025898 Ga0207692_10307918 Ga0207692_103079181 257
783 3300025909 Ga0207705_10000762 Ga0207705_1000076224 257
784 3300025909 Ga0207705_10092660 Ga0207705_100926602 257
785 3300025909 Ga0207705_10233174 Ga0207705_102331741 257
786 3300025917 Ga0207660_10014305 Ga0207660_100143055 257
787 3300025919 Ga0207657_10020685 Ga0207657_100206856 257
788 3300025921 Ga0207652_10272254 Ga0207652_102722542 257
789 3300025925 Ga0207650_10000200 Ga0207650_1000020057 257
790 3300025925 Ga0207650_10218692 Ga0207650_102186921 257
791 3300025931 Ga0207644_10077258 Ga0207644_100772583 257
792 3300025931 Ga0207644_10099665 Ga0207644_100996652 257
793 3300025933 Ga0207706_10041829 Ga0207706_100418294 257
794 3300025937 Ga0207669_10003284 Ga0207669_100032843 257
795 3300025940 Ga0207691_10002747 Ga0207691_1000274717 257
796 3300025941 Ga0207711_10012365 Ga0207711_100123658 257
797 3300025945 Ga0207679_10065781 Ga0207679_100657813 257
798 3300026067 Ga0207678_10197699 Ga0207678_101976992 257
799 3300026118 Ga0207675_100212382 Ga0207675_1002123822 257
800 3300031731 Ga0307405_10039182 Ga0307405_100391822 257
801 3300031824 Ga0307413_10090114 Ga0307413_100901142 257
802 3300031824 Ga0307413_10112876 Ga0307413_101128762 257
803 3300031852 Ga0307410_10068029 Ga0307410_100680293 257
804 3300031903 Ga0307407_10042165 Ga0307407_100421652 257
805 3300031911 Ga0307412_10094385 Ga0307412_100943852 257
806 3300031995 Ga0307409_100077361 Ga0307409_1000773612 257
807 3300031995 Ga0307409_100136479 Ga0307409_1001364793 257
808 3300032002 Ga0307416_100140926 Ga0307416_1001409262 257
809 3300032002 Ga0307416_100320428 Ga0307416_1003204282 257
810 3300032002 Ga0307416_100361800 Ga0307416_1003618001 257
811 3300032004 Ga0307414_10025742 Ga0307414_100257421 257
812 3300032005 Ga0307411_10007999 Ga0307411_100079993 257
813 3300032005 Ga0307411_10016681 Ga0307411_100166813 257
814 3300032005 Ga0307411_10261166 Ga0307411_102611662 257
815 3300037312 Ga0395899_0042578 Ga0395899_0042578_1724_2563 257
816 3300037418 Ga0395900_0536196 Ga0395900_0536196_81_920 257
817 3300038443 Ga0395901_0072259 Ga0395901_0072259_165_1004 257
818 3300042006 Ga0439432_026291 Ga0439432_026291_767_1603 257
819 3300042123 Ga0450921_002924 Ga0450921_002924_75_911 257
820 3300044656 Ga0466969_0004326 Ga0466969_0004326_5857_6696 257
821 3300044694 Ga0466963_0052428 Ga0466963_0052428_82_921 257
822 3300044719 Ga0466971_0003632 Ga0466971_0003632_1769_2608 257
823 3300044842 Ga0466957_0004040 Ga0466957_0004040_5764_6603 257
824 3300046684 Ga0495669_0004197 Ga0495669_0004197_275_1111 257
825 3300048909 Ga0496106_0002679 Ga0496106_0002679_6105_6932 257
826 3300048912 Ga0496109_0118067 Ga0496109_0118067_1234_2070 257
827 3300048914 Ga0496111_0010650 Ga0496111_0010650_4103_4939 257
828 3300049652 Ga0501202_023262 Ga0501202_023262_337_1179 257
829 3300061719 Ga0466962_0006536 Ga0466962_0006536_1982_2821 257
830 3300001904 JGI24736J21556_1004447 JGI24736J21556_10044472 258
831 3300001979 JGI24740J21852_10008094 JGI24740J21852_100080944 258
832 3300002067 JGI24735J21928_10014992 JGI24735J21928_100149922 258
833 3300002067 JGI24735J21928_10015843 JGI24735J21928_100158433 258
834 3300002067 JGI24735J21928_10017835 JGI24735J21928_100178352 258
835 3300002239 JGI24034J26672_10016656 JGI24034J26672_100166561 258
836 3300005293 Ga0065715_10137338 Ga0065715_101373382 258
837 3300005327 Ga0070658_10049990 Ga0070658_100499904 258
838 3300005327 Ga0070658_10101099 Ga0070658_101010993 258
839 3300005327 Ga0070658_10314113 Ga0070658_103141131 258
840 3300005328 Ga0070676_10144642 Ga0070676_101446421 258
841 3300005329 Ga0070683_100059774 Ga0070683_1000597742 258
842 3300005329 Ga0070683_100119834 Ga0070683_1001198344 258
843 3300005329 Ga0070683_100156381 Ga0070683_1001563813 258
844 3300005331 Ga0070670_100032318 Ga0070670_1000323182 258
845 3300005331 Ga0070670_100061675 Ga0070670_1000616753 258
846 3300005331 Ga0070670_100249124 Ga0070670_1002491242 258
847 3300005333 Ga0070677_10020221 Ga0070677_100202211 258
848 3300005334 Ga0068869_100033661 Ga0068869_1000336613 258
849 3300005335 Ga0070666_10004162 Ga0070666_1000416210 258
850 3300005336 Ga0070680_100036751 Ga0070680_1000367514 258
851 3300005337 Ga0070682_100052340 Ga0070682_1000523402 258
852 3300005337 Ga0070682_100097470 Ga0070682_1000974701 258
853 3300005339 Ga0070660_100005487 Ga0070660_1000054873 258
854 3300005339 Ga0070660_100144902 Ga0070660_1001449022 258
855 3300005339 Ga0070660_100163503 Ga0070660_1001635032 258
856 3300005341 Ga0070691_10001631 Ga0070691_100016313 258
857 3300005343 Ga0070687_100102108 Ga0070687_1001021082 258
858 3300005344 Ga0070661_100308926 Ga0070661_1003089262 258
859 3300005345 Ga0070692_10055067 Ga0070692_100550671 258
860 3300005345 Ga0070692_10082197 Ga0070692_100821972 258
861 3300005347 Ga0070668_100002562 Ga0070668_1000025629 258
862 3300005347 Ga0070668_100055350 Ga0070668_1000553501 258
863 3300005353 Ga0070669_100032977 Ga0070669_1000329773 258
864 3300005353 Ga0070669_100072572 Ga0070669_1000725722 258
865 3300005353 Ga0070669_100168716 Ga0070669_1001687162 258
866 3300005353 Ga0070669_100212520 Ga0070669_1002125202 258
867 3300005354 Ga0070675_100055591 Ga0070675_1000555912 258
868 3300005355 Ga0070671_100003170 Ga0070671_1000031703 258
869 3300005355 Ga0070671_100013424 Ga0070671_1000134245 258
870 3300005355 Ga0070671_100023002 Ga0070671_1000230022 258
871 3300005355 Ga0070671_100023014 Ga0070671_1000230143 258
872 3300005355 Ga0070671_100026823 Ga0070671_1000268231 258
873 3300005355 Ga0070671_100031855 Ga0070671_1000318553 258
874 3300005355 Ga0070671_100268416 Ga0070671_1002684161 258
875 3300005356 Ga0070674_100019850 Ga0070674_1000198505 258
876 3300005364 Ga0070673_100002366 Ga0070673_1000023662 258
877 3300005364 Ga0070673_100050226 Ga0070673_1000502263 258
878 3300005364 Ga0070673_100060636 Ga0070673_1000606363 258
879 3300005364 Ga0070673_100105755 Ga0070673_1001057553 258
880 3300005366 Ga0070659_100014336 Ga0070659_1000143363 258
881 3300005366 Ga0070659_100067314 Ga0070659_1000673142 258
882 3300005366 Ga0070659_100076411 Ga0070659_1000764112 258
883 3300005366 Ga0070659_100096278 Ga0070659_1000962781 258
884 3300005367 Ga0070667_100004203 Ga0070667_1000042037 258
885 3300005367 Ga0070667_100006180 Ga0070667_10000618012 258
886 3300005367 Ga0070667_100056942 Ga0070667_1000569423 258
887 3300005367 Ga0070667_100119731 Ga0070667_1001197313 258
888 3300005435 Ga0070714_100036648 Ga0070714_1000366483 258
889 3300005435 Ga0070714_100044444 Ga0070714_1000444443 258
890 3300005436 Ga0070713_100115266 Ga0070713_1001152662 258
891 3300005436 Ga0070713_100170080 Ga0070713_1001700802 258
892 3300005437 Ga0070710_10147582 Ga0070710_101475821 258
893 3300005444 Ga0070694_100015348 Ga0070694_1000153483 258
894 3300005455 Ga0070663_100071893 Ga0070663_1000718932 258
895 3300005455 Ga0070663_100560893 Ga0070663_1005608931 258
896 3300005456 Ga0070678_100003888 Ga0070678_1000038886 258
897 3300005456 Ga0070678_100044207 Ga0070678_1000442072 258
898 3300005456 Ga0070678_100062773 Ga0070678_1000627731 258
899 3300005456 Ga0070678_100098224 Ga0070678_1000982242 258
900 3300005457 Ga0070662_100000345 Ga0070662_10000034529 258
901 3300005457 Ga0070662_100020078 Ga0070662_1000200784 258
902 3300005457 Ga0070662_100111745 Ga0070662_1001117452 258
903 3300005458 Ga0070681_10202318 Ga0070681_102023181 258
904 3300005459 Ga0068867_100007689 Ga0068867_1000076899 258
905 3300005459 Ga0068867_100358122 Ga0068867_1003581221 258
906 3300005530 Ga0070679_100014277 Ga0070679_1000142773 258
907 3300005530 Ga0070679_100095663 Ga0070679_1000956635 258
908 3300005535 Ga0070684_100003783 Ga0070684_1000037836 258
909 3300005535 Ga0070684_100007150 Ga0070684_1000071504 258
910 3300005539 Ga0068853_100039582 Ga0068853_1000395823 258
911 3300005539 Ga0068853_100082827 Ga0068853_1000828272 258
912 3300005539 Ga0068853_100457660 Ga0068853_1004576602 258
913 3300005543 Ga0070672_100054890 Ga0070672_1000548903 258
914 3300005543 Ga0070672_100071809 Ga0070672_1000718093 258
915 3300005543 Ga0070672_100168067 Ga0070672_1001680672 258
916 3300005543 Ga0070672_100187909 Ga0070672_1001879092 258
917 3300005543 Ga0070672_100335124 Ga0070672_1003351242 258
918 3300005548 Ga0070665_100027403 Ga0070665_1000274035 258
919 3300005549 Ga0070704_100087704 Ga0070704_1000877043 258
920 3300005563 Ga0068855_100049100 Ga0068855_1000491004 258
921 3300005563 Ga0068855_100081594 Ga0068855_1000815943 258
922 3300005563 Ga0068855_100496453 Ga0068855_1004964532 258
923 3300005564 Ga0070664_100004837 Ga0070664_1000048372 258
924 3300005564 Ga0070664_100049406 Ga0070664_1000494063 258
925 3300005564 Ga0070664_100095632 Ga0070664_1000956323 258
926 3300005564 Ga0070664_100240107 Ga0070664_1002401072 258
927 3300005577 Ga0068857_100003151 Ga0068857_10000315116 258
928 3300005577 Ga0068857_100019208 Ga0068857_1000192083 258
929 3300005577 Ga0068857_100039354 Ga0068857_1000393542 258
930 3300005577 Ga0068857_100081405 Ga0068857_1000814052 258
931 3300005577 Ga0068857_100454505 Ga0068857_1004545051 258
932 3300005578 Ga0068854_100003456 Ga0068854_10000345612 258
933 3300005578 Ga0068854_100017009 Ga0068854_1000170093 258
934 3300005614 Ga0068856_100024245 Ga0068856_1000242452 258
935 3300005614 Ga0068856_100076694 Ga0068856_1000766945 258
936 3300005614 Ga0068856_100392934 Ga0068856_1003929342 258
937 3300005616 Ga0068852_100001407 Ga0068852_10000140712 258
938 3300005616 Ga0068852_100038648 Ga0068852_1000386481 258
939 3300005616 Ga0068852_100072463 Ga0068852_1000724632 258
940 3300005616 Ga0068852_100095737 Ga0068852_1000957373 258
941 3300005617 Ga0068859_100000783 Ga0068859_10000078322 258
942 3300005617 Ga0068859_100030472 Ga0068859_1000304725 258
943 3300005617 Ga0068859_100101150 Ga0068859_1001011502 258
944 3300005618 Ga0068864_100002274 Ga0068864_1000022746 258
945 3300005618 Ga0068864_100004580 Ga0068864_1000045804 258
946 3300005618 Ga0068864_100021186 Ga0068864_1000211864 258
947 3300005834 Ga0068851_10003456 Ga0068851_100034567 258
948 3300005834 Ga0068851_10187718 Ga0068851_101877182 258
949 3300005834 Ga0068851_10191567 Ga0068851_101915672 258
950 3300005834 Ga0068851_10217249 Ga0068851_102172491 258
951 3300005841 Ga0068863_100003427 Ga0068863_1000034275 258
952 3300005841 Ga0068863_100017729 Ga0068863_1000177297 258
953 3300005841 Ga0068863_100064619 Ga0068863_1000646192 258
954 3300005841 Ga0068863_100216234 Ga0068863_1002162341 258
955 3300005841 Ga0068863_100294703 Ga0068863_1002947032 258
956 3300005842 Ga0068858_100005309 Ga0068858_10000530912 258
957 3300005843 Ga0068860_100002617 Ga0068860_10000261711 258
958 3300005843 Ga0068860_100007249 Ga0068860_1000072493 258
959 3300005844 Ga0068862_100024556 Ga0068862_1000245563 258
960 3300005844 Ga0068862_100027358 Ga0068862_1000273581 258
961 3300005985 Ga0081539_10033794 Ga0081539_100337942 258
962 3300006028 Ga0070717_10015027 Ga0070717_100150272 258
963 3300006173 Ga0070716_100038236 Ga0070716_1000382363 258
964 3300006175 Ga0070712_100141631 Ga0070712_1001416312 258
965 3300006237 Ga0097621_100213125 Ga0097621_1002131252 258
966 3300006237 Ga0097621_100219928 Ga0097621_1002199282 258
967 3300006358 Ga0068871_100169888 Ga0068871_1001698883 258
968 3300006844 Ga0075428_100038713 Ga0075428_1000387133 258
969 3300006881 Ga0068865_100109619 Ga0068865_1001096192 258
970 3300006931 Ga0097620_100000783 Ga0097620_10000078317 258
971 3300006931 Ga0097620_100030475 Ga0097620_1000304752 258
972 3300006931 Ga0097620_100101160 Ga0097620_1001011603 258
973 3300009092 Ga0105250_10019818 Ga0105250_100198182 258
974 3300009098 Ga0105245_10001091 Ga0105245_1000109113 258
975 3300009098 Ga0105245_10013322 Ga0105245_100133223 258
976 3300009098 Ga0105245_10069474 Ga0105245_100694745 258
977 3300009148 Ga0105243_10038205 Ga0105243_100382053 258
978 3300009148 Ga0105243_10071926 Ga0105243_100719263 258
979 3300009177 Ga0105248_10003086 Ga0105248_1000308611 258
980 3300009177 Ga0105248_10004063 Ga0105248_1000406310 258
981 3300009177 Ga0105248_10010962 Ga0105248_100109629 258
982 3300009177 Ga0105248_10327487 Ga0105248_103274872 258
983 3300009177 Ga0105248_10364518 Ga0105248_103645182 258
984 3300009545 Ga0105237_10049017 Ga0105237_100490173 258
985 3300009553 Ga0105249_10013113 Ga0105249_100131137 258
986 3300010375 Ga0105239_10055073 Ga0105239_100550733 258
987 3300011119 Ga0105246_10006307 Ga0105246_100063077 258
988 3300013100 Ga0157373_10032968 Ga0157373_100329682 258
989 3300013100 Ga0157373_10036176 Ga0157373_100361762 258
990 3300013100 Ga0157373_10073939 Ga0157373_100739393 258
991 3300013100 Ga0157373_10138519 Ga0157373_101385192 258
992 3300013102 Ga0157371_10033872 Ga0157371_100338722 258
993 3300013104 Ga0157370_10418325 Ga0157370_104183252 258
994 3300013105 Ga0157369_10002210 Ga0157369_1000221021 258
995 3300013105 Ga0157369_10008463 Ga0157369_100084637 258
996 3300013105 Ga0157369_10055103 Ga0157369_100551034 258
997 3300013105 Ga0157369_10122754 Ga0157369_101227543 258
998 3300013296 Ga0157374_10001807 Ga0157374_100018074 258
999 3300013297 Ga0157378_10003531 Ga0157378_100035315 258
1000 3300013297 Ga0157378_10677358 Ga0157378_106773582 258
1001 3300013306 Ga0163162_10004797 Ga0163162_1000479712 258
1002 3300013306 Ga0163162_10022448 Ga0163162_100224489 258
1003 3300013306 Ga0163162_10030691 Ga0163162_100306913 258
1004 3300013307 Ga0157372_10034736 Ga0157372_100347364 258
1005 3300013307 Ga0157372_10198212 Ga0157372_101982123 258
1006 3300013307 Ga0157372_10369058 Ga0157372_103690582 258
1007 3300013308 Ga0157375_10008420 Ga0157375_100084207 258
1008 3300013308 Ga0157375_10131300 Ga0157375_101313003 258
1009 3300014325 Ga0163163_10000192 Ga0163163_1000019216 258
1010 3300014325 Ga0163163_10002333 Ga0163163_1000233318 258
1011 3300021384 Ga0213876_10000460 Ga0213876_1000046017 258
1012 3300021384 Ga0213876_10011874 Ga0213876_100118744 258
1013 3300025315 Ga0207697_10054347 Ga0207697_100543472 258
1014 3300025321 Ga0207656_10011443 Ga0207656_100114433 258
1015 3300025321 Ga0207656_10030771 Ga0207656_100307713 258
1016 3300025321 Ga0207656_10068210 Ga0207656_100682102 258
1017 3300025321 Ga0207656_10112871 Ga0207656_101128712 258
1018 3300025321 Ga0207656_10135006 Ga0207656_101350062 258
1019 3300025899 Ga0207642_10040231 Ga0207642_100402313 258
1020 3300025903 Ga0207680_10103867 Ga0207680_101038672 258
1021 3300025904 Ga0207647_10003357 Ga0207647_100033573 258
1022 3300025904 Ga0207647_10008719 Ga0207647_100087192 258
1023 3300025904 Ga0207647_10126805 Ga0207647_101268052 258
1024 3300025904 Ga0207647_10126821 Ga0207647_101268212 258
1025 3300025906 Ga0207699_10184256 Ga0207699_101842562 258
1026 3300025907 Ga0207645_10027677 Ga0207645_100276774 258
1027 3300025907 Ga0207645_10037388 Ga0207645_100373882 258
1028 3300025907 Ga0207645_10066518 Ga0207645_100665182 258
1029 3300025908 Ga0207643_10021392 Ga0207643_100213923 258
1030 3300025909 Ga0207705_10008810 Ga0207705_100088108 258
1031 3300025909 Ga0207705_10014722 Ga0207705_100147223 258
1032 3300025909 Ga0207705_10021048 Ga0207705_100210485 258
1033 3300025909 Ga0207705_10038909 Ga0207705_100389094 258
1034 3300025909 Ga0207705_10057780 Ga0207705_100577803 258
1035 3300025909 Ga0207705_10250320 Ga0207705_102503202 258
1036 3300025911 Ga0207654_10108601 Ga0207654_101086012 258
1037 3300025913 Ga0207695_10097999 Ga0207695_100979993 258
1038 3300025914 Ga0207671_10065154 Ga0207671_100651543 258
1039 3300025915 Ga0207693_10212377 Ga0207693_102123772 258
1040 3300025916 Ga0207663_10090823 Ga0207663_100908232 258
1041 3300025918 Ga0207662_10004989 Ga0207662_100049898 258
1042 3300025919 Ga0207657_10004752 Ga0207657_100047525 258
1043 3300025919 Ga0207657_10008884 Ga0207657_1000888411 258
1044 3300025919 Ga0207657_10019231 Ga0207657_100192316 258
1045 3300025919 Ga0207657_10090319 Ga0207657_100903193 258
1046 3300025920 Ga0207649_10155062 Ga0207649_101550622 258
1047 3300025921 Ga0207652_10212386 Ga0207652_102123861 258
1048 3300025923 Ga0207681_10002274 Ga0207681_100022743 258
1049 3300025923 Ga0207681_10166783 Ga0207681_101667832 258
1050 3300025924 Ga0207694_10294401 Ga0207694_102944012 258
1051 3300025925 Ga0207650_10012232 Ga0207650_100122324 258
1052 3300025925 Ga0207650_10057707 Ga0207650_100577073 258
1053 3300025925 Ga0207650_10151890 Ga0207650_101518903 258
1054 3300025925 Ga0207650_10195166 Ga0207650_101951662 258
1055 3300025925 Ga0207650_10416111 Ga0207650_104161112 258
1056 3300025926 Ga0207659_10070408 Ga0207659_100704082 258
1057 3300025927 Ga0207687_10168965 Ga0207687_101689652 258
1058 3300025927 Ga0207687_10169946 Ga0207687_101699462 258
1059 3300025928 Ga0207700_10172635 Ga0207700_101726353 258
1060 3300025929 Ga0207664_10073421 Ga0207664_100734213 258
1061 3300025929 Ga0207664_10134865 Ga0207664_101348653 258
1062 3300025929 Ga0207664_10242233 Ga0207664_102422332 258
1063 3300025931 Ga0207644_10014716 Ga0207644_100147163 258
1064 3300025931 Ga0207644_10073348 Ga0207644_100733482 258
1065 3300025931 Ga0207644_10132253 Ga0207644_101322532 258
1066 3300025931 Ga0207644_10270913 Ga0207644_102709132 258
1067 3300025931 Ga0207644_10293855 Ga0207644_102938551 258
1068 3300025931 Ga0207644_10295328 Ga0207644_102953282 258
1069 3300025931 Ga0207644_10389536 Ga0207644_103895361 258
1070 3300025932 Ga0207690_10023994 Ga0207690_100239942 258
1071 3300025932 Ga0207690_10095774 Ga0207690_100957742 258
1072 3300025932 Ga0207690_10244820 Ga0207690_102448202 258
1073 3300025933 Ga0207706_10006042 Ga0207706_1000604211 258
1074 3300025933 Ga0207706_10009525 Ga0207706_100095257 258
1075 3300025933 Ga0207706_10011379 Ga0207706_100113799 258
1076 3300025933 Ga0207706_10091257 Ga0207706_100912574 258
1077 3300025937 Ga0207669_10056622 Ga0207669_100566222 258
1078 3300025937 Ga0207669_10074780 Ga0207669_100747803 258
1079 3300025937 Ga0207669_10155785 Ga0207669_101557852 258
1080 3300025937 Ga0207669_10192622 Ga0207669_101926222 258
1081 3300025939 Ga0207665_10044030 Ga0207665_100440303 258
1082 3300025940 Ga0207691_10057118 Ga0207691_100571182 258
1083 3300025940 Ga0207691_10072694 Ga0207691_100726943 258
1084 3300025940 Ga0207691_10177614 Ga0207691_101776142 258
1085 3300025940 Ga0207691_10342504 Ga0207691_103425042 258
1086 3300025941 Ga0207711_10000244 Ga0207711_1000024412 258
1087 3300025941 Ga0207711_10001357 Ga0207711_100013578 258
1088 3300025941 Ga0207711_10153522 Ga0207711_101535222 258
1089 3300025942 Ga0207689_10009546 Ga0207689_100095463 258
1090 3300025942 Ga0207689_10015354 Ga0207689_100153544 258
1091 3300025942 Ga0207689_10102065 Ga0207689_101020652 258
1092 3300025944 Ga0207661_10040356 Ga0207661_100403563 258
1093 3300025944 Ga0207661_10076300 Ga0207661_100763003 258
1094 3300025945 Ga0207679_10008066 Ga0207679_100080663 258
1095 3300025945 Ga0207679_10174207 Ga0207679_101742072 258
1096 3300025945 Ga0207679_10264084 Ga0207679_102640842 258
1097 3300025949 Ga0207667_10022610 Ga0207667_100226108 258
1098 3300025949 Ga0207667_10026276 Ga0207667_100262763 258
1099 3300025949 Ga0207667_10034568 Ga0207667_100345685 258
1100 3300025960 Ga0207651_10029877 Ga0207651_100298773 258
1101 3300025960 Ga0207651_10038746 Ga0207651_100387462 258
1102 3300025960 Ga0207651_10078930 Ga0207651_100789303 258
1103 3300025960 Ga0207651_10199481 Ga0207651_101994812 258
1104 3300025960 Ga0207651_10315686 Ga0207651_103156862 258
1105 3300025961 Ga0207712_10004805 Ga0207712_100048055 258
1106 3300025961 Ga0207712_10009866 Ga0207712_100098666 258
1107 3300025972 Ga0207668_10000964 Ga0207668_100009643 258
1108 3300025981 Ga0207640_10001500 Ga0207640_1000150017 258
1109 3300025981 Ga0207640_10040881 Ga0207640_100408812 258
1110 3300025981 Ga0207640_10069173 Ga0207640_100691732 258
1111 3300025981 Ga0207640_10127550 Ga0207640_101275501 258
1112 3300025981 Ga0207640_10128523 Ga0207640_101285232 258
1113 3300025986 Ga0207658_10004514 Ga0207658_100045148 258
1114 3300025986 Ga0207658_10011871 Ga0207658_100118712 258
1115 3300025986 Ga0207658_10017072 Ga0207658_100170722 258
1116 3300025986 Ga0207658_10169683 Ga0207658_101696832 258
1117 3300025986 Ga0207658_10438027 Ga0207658_104380272 258
1118 3300026023 Ga0207677_10109709 Ga0207677_101097091 258
1119 3300026035 Ga0207703_10005314 Ga0207703_100053145 258
1120 3300026041 Ga0207639_10053385 Ga0207639_100533853 258
1121 3300026041 Ga0207639_10097905 Ga0207639_100979051 258
1122 3300026041 Ga0207639_10286854 Ga0207639_102868541 258
1123 3300026067 Ga0207678_10013995 Ga0207678_100139953 258
1124 3300026067 Ga0207678_10040788 Ga0207678_100407885 258
1125 3300026067 Ga0207678_10134915 Ga0207678_101349153 258
1126 3300026067 Ga0207678_10245047 Ga0207678_102450472 258
1127 3300026078 Ga0207702_10029367 Ga0207702_100293674 258
1128 3300026088 Ga0207641_10004537 Ga0207641_1000453713 258
1129 3300026088 Ga0207641_10010896 Ga0207641_100108963 258
1130 3300026088 Ga0207641_10103915 Ga0207641_101039152 258
1131 3300026088 Ga0207641_10134823 Ga0207641_101348232 258
1132 3300026089 Ga0207648_10003289 Ga0207648_100032893 258
1133 3300026089 Ga0207648_10044080 Ga0207648_100440802 258
1134 3300026089 Ga0207648_10054562 Ga0207648_100545623 258
1135 3300026095 Ga0207676_10002603 Ga0207676_1000260312 258
1136 3300026116 Ga0207674_10010800 Ga0207674_1001080011 258
1137 3300026116 Ga0207674_10019082 Ga0207674_100190828 258
1138 3300026116 Ga0207674_10020127 Ga0207674_100201274 258
1139 3300026116 Ga0207674_10046921 Ga0207674_100469211 258
1140 3300026116 Ga0207674_10099219 Ga0207674_100992193 258
1141 3300026118 Ga0207675_100208243 Ga0207675_1002082432 258
1142 3300026121 Ga0207683_10000430 Ga0207683_1000043040 258
1143 3300026121 Ga0207683_10132373 Ga0207683_101323732 258
1144 3300026121 Ga0207683_10137979 Ga0207683_101379792 258
1145 3300026121 Ga0207683_10178668 Ga0207683_101786681 258
1146 3300026142 Ga0207698_10004532 Ga0207698_100045322 258
1147 3300026142 Ga0207698_10039026 Ga0207698_100390264 258
1148 3300027876 Ga0209974_10002536 Ga0209974_100025362 258
1149 3300028379 Ga0268266_10044238 Ga0268266_100442382 258
1150 3300028379 Ga0268266_10100669 Ga0268266_101006692 258
1151 3300028380 Ga0268265_10001705 Ga0268265_1000170520 258
1152 3300028380 Ga0268265_10009853 Ga0268265_100098536 258
1153 3300028381 Ga0268264_10002278 Ga0268264_100022783 258
1154 3300028381 Ga0268264_10002314 Ga0268264_1000231419 258
1155 3300028381 Ga0268264_10003356 Ga0268264_1000335619 258
1156 3300030731 Ga0316177_1111970 Ga0316177_11119702 258
1157 3300030742 Ga0316183_1010987 Ga0316183_10109872 258
1158 3300030745 Ga0316182_1085750 Ga0316182_10857503 258
1159 3300031548 Ga0307408_100032169 Ga0307408_1000321693 258
1160 3300031548 Ga0307408_100269919 Ga0307408_1002699192 258
1161 3300031548 Ga0307408_100302223 Ga0307408_1003022232 258
1162 3300031731 Ga0307405_10020192 Ga0307405_100201924 258
1163 3300031852 Ga0307410_10221590 Ga0307410_102215901 258
1164 3300031911 Ga0307412_10067145 Ga0307412_100671452 258
1165 3300031995 Ga0307409_100023233 Ga0307409_1000232335 258
1166 3300032002 Ga0307416_100022796 Ga0307416_1000227962 258
1167 3300032004 Ga0307414_10016257 Ga0307414_100162575 258
1168 3300032005 Ga0307411_10078512 Ga0307411_100785122 258
1169 3300032005 Ga0307411_10211998 Ga0307411_102119982 258
1170 3300032126 Ga0307415_100009109 Ga0307415_1000091095 258
1171 3300032126 Ga0307415_100009841 Ga0307415_1000098413 258
1172 3300035692 Ga0373935_0051406 Ga0373935_0051406_1365_2213 258
1173 3300037068 Ga0373925_0028143 Ga0373925_0028143_2157_2984 258
1174 3300037068 Ga0373925_0323769 Ga0373925_0323769_28_876 258
1175 3300037312 Ga0395899_0000334 Ga0395899_0000334_38668_39495 258
1176 3300037312 Ga0395899_0003848 Ga0395899_0003848_9956_10783 258
1177 3300037312 Ga0395899_0031655 Ga0395899_0031655_551_1384 258
1178 3300037312 Ga0395899_0046637 Ga0395899_0046637_1531_2409 258
1179 3300037312 Ga0395899_0057007 Ga0395899_0057007_1666_2508 258
1180 3300037418 Ga0395900_0000084 Ga0395900_0000084_23567_24394 258
1181 3300037418 Ga0395900_0000530 Ga0395900_0000530_8468_9325 258
1182 3300037418 Ga0395900_0011450 Ga0395900_0011450_3397_4224 258
1183 3300037418 Ga0395900_0021175 Ga0395900_0021175_4686_5528 258
1184 3300037418 Ga0395900_0022859 Ga0395900_0022859_2502_3344 258
1185 3300037418 Ga0395900_0207064 Ga0395900_0207064_588_1415 258
1186 3300037418 Ga0395900_0208002 Ga0395900_0208002_738_1565 258
1187 3300037418 Ga0395900_0236073 Ga0395900_0236073_574_1452 258
1188 3300037418 Ga0395900_0473707 Ga0395900_0473707_80_907 258
1189 3300037466 Ga0395898_0000021 Ga0395898_0000021_308911_309738 258
1190 3300037466 Ga0395898_0002115 Ga0395898_0002115_4632_5459 258
1191 3300037466 Ga0395898_0016514 Ga0395898_0016514_2055_2897 258
1192 3300037466 Ga0395898_0038421 Ga0395898_0038421_1091_1933 258
1193 3300037466 Ga0395898_0115548 Ga0395898_0115548_1234_2112 258
1194 3300037466 Ga0395898_0570866 Ga0395898_0570866_184_1011 258
1195 3300037471 Ga0395905_0000006 Ga0395905_0000006_525163_525990 258
1196 3300037471 Ga0395905_0001616 Ga0395905_0001616_565_1407 258
1197 3300037471 Ga0395905_0003041 Ga0395905_0003041_3782_4639 258
1198 3300037471 Ga0395905_0009005 Ga0395905_0009005_7790_8617 258
1199 3300037471 Ga0395905_0009128 Ga0395905_0009128_2862_3704 258
1200 3300037471 Ga0395905_0023621 Ga0395905_0023621_3473_4315 258
1201 3300037471 Ga0395905_0040237 Ga0395905_0040237_3283_4110 258
1202 3300037471 Ga0395905_0052000 Ga0395905_0052000_1649_2488 258
1203 3300037471 Ga0395905_0054620 Ga0395905_0054620_2170_3012 258
1204 3300037471 Ga0395905_0067965 Ga0395905_0067965_1916_2758 258
1205 3300037471 Ga0395905_0099408 Ga0395905_0099408_84_917 258
1206 3300037471 Ga0395905_0138869 Ga0395905_0138869_344_1171 258
1207 3300037471 Ga0395905_0179203 Ga0395905_0179203_818_1645 258
1208 3300038443 Ga0395901_0003214 Ga0395901_0003214_5844_6671 258
1209 3300038443 Ga0395901_0011073 Ga0395901_0011073_737_1579 258
1210 3300038443 Ga0395901_0026727 Ga0395901_0026727_4395_5252 258
1211 3300038443 Ga0395901_0027033 Ga0395901_0027033_513_1352 258
1212 3300038443 Ga0395901_0043979 Ga0395901_0043979_1588_2430 258
1213 3300038443 Ga0395901_0051080 Ga0395901_0051080_3124_3951 258
1214 3300038443 Ga0395901_0066465 Ga0395901_0066465_2631_3458 258
1215 3300038443 Ga0395901_0075572 Ga0395901_0075572_234_1076 258
1216 3300038443 Ga0395901_0242074 Ga0395901_0242074_93_920 258
1217 3300038443 Ga0395901_0564188 Ga0395901_0564188_226_1053 258
1218 3300039437 Ga0436365_1353505 Ga0436365_1353505_7642_8481 258
1219 3300039437 Ga0436365_1720437 Ga0436365_1720437_2098_2925 258
1220 3300039450 Ga0436363_0701969 Ga0436363_0701969_1410_2267 258
1221 3300042157 Ga0439458_0000937 Ga0439458_0000937_6215_7057 258
1222 3300044684 Ga0466966_0000001 Ga0466966_0000001_229182_230024 258
1223 3300044684 Ga0466966_0002089 Ga0466966_0002089_7032_7865 258
1224 3300044684 Ga0466966_0008399 Ga0466966_0008399_4505_5347 258
1225 3300044693 Ga0466961_0054818 Ga0466961_0054818_279_1121 258
1226 3300044694 Ga0466963_0015926 Ga0466963_0015926_2549_3388 258
1227 3300044735 Ga0466968_0002445 Ga0466968_0002445_820_1647 258
1228 3300044842 Ga0466957_0010017 Ga0466957_0010017_3805_4683 258
1229 3300044842 Ga0466957_0013504 Ga0466957_0013504_3416_4258 258
1230 3300045049 Ga0466959_0056025 Ga0466959_0056025_93_926 258
1231 3300045836 Ga0466958_0012547 Ga0466958_0012547_2402_3280 258
1232 3300045836 Ga0466958_0263618 Ga0466958_0263618_143_970 258
1233 3300045976 Ga0466967_0036895 Ga0466967_0036895_1513_2391 258
1234 3300045976 Ga0466967_0105874 Ga0466967_0105874_1255_2082 258
1235 3300045976 Ga0466967_0246452 Ga0466967_0246452_65_904 258
1236 3300045976 Ga0466967_0608769 Ga0466967_0608769_66_893 258
1237 3300046537 Ga0495598_0000301 Ga0495598_0000301_1217_2062 258
1238 3300046539 Ga0495621_0000024 Ga0495621_0000024_7561_8406 258
1239 3300046684 Ga0495669_0025815 Ga0495669_0025815_821_1678 258
1240 3300046691 Ga0495670_0001033 Ga0495670_0001033_8936_9781 258
1241 3300048903 Ga0496100_0047912 Ga0496100_0047912_573_1430 258
1242 3300048905 Ga0496102_0186162 Ga0496102_0186162_18_875 258
1243 3300048910 Ga0496107_0009264 Ga0496107_0009264_1121_1978 258
1244 3300048910 Ga0496107_0169433 Ga0496107_0169433_168_1025 258
1245 3300048910 Ga0496107_0379318 Ga0496107_0379318_28_870 258
1246 3300048911 Ga0496108_0006426 Ga0496108_0006426_6841_7683 258
1247 3300048911 Ga0496108_0015393 Ga0496108_0015393_95_952 258
1248 3300048912 Ga0496109_0220279 Ga0496109_0220279_22_864 258
1249 3300048913 Ga0496110_0274146 Ga0496110_0274146_278_1105 258
1250 3300048913 Ga0496110_0495518 Ga0496110_0495518_12_854 258
1251 3300048914 Ga0496111_0014909 Ga0496111_0014909_38_895 258
1252 3300048915 Ga0496112_0000841 Ga0496112_0000841_16571_17398 258
1253 3300048915 Ga0496112_0224076 Ga0496112_0224076_129_956 258
1254 3300048915 Ga0496112_0345318 Ga0496112_0345318_72_929 258
1255 3300048916 Ga0496113_0081291 Ga0496113_0081291_1635_2462 258
1256 3300048917 Ga0496114_0105985 Ga0496114_0105985_864_1721 258
1257 3300048918 Ga0496115_0013070 Ga0496115_0013070_3949_4806 258
1258 3300050508 nmdc:mga09592_118383_c1 nmdc:mga09592_118383_c1_424_1251 258
1259 3300050515 nmdc:mga0a205_10468_c1 nmdc:mga0a205_10468_c1_1983_2810 258
1260 3300061719 Ga0466962_0077500 Ga0466962_0077500_101_928 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

62

275

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.5973 28 253
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.5945 28 253
7qba-assembly1.cif.gz_E cryoem structure of the abc transporter nosdfy complexed with nitrous oxide reductase nosz 0.5877 35 248
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.5796 28 253
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.5733 28 253
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7515 73 243 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7274 55 246 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6926 51 246 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5556 55 246 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.541 51 246 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A2N3ATC0-F1-model_v4 Multidrug ABC transporter permease 0.9493 78 258 GO:0005886
GO:0140359
AF-A0A168RUQ3-F1-model_v4 deleted 0.9274 36 258
AF-A0A059DVU1-F1-model_v4 Transport permease protein 0.9247 39 258 GO:0043190
GO:0140359
AF-A0A2A5CRV9-F1-model_v4 Transport permease protein 0.9186 42 258 GO:0005524
GO:0016887
GO:0043190
GO:0140359
AF-A0A6L5C7L1-F1-model_v4 deleted 0.9151 28 258

Feature Viewer

pLDDT pTM Quality
81.03 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map