F492276

General Info

Members Datasets Scaffolds Average Seq Length
1258 357 1258 265

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0155679|Ga0466963_0155679_118_975
Length 285
Sequence MAALQDGGRSRPAVPQFAPAAMLSNLSKLSRYRGLIQSLVARELKARYRGSVLGFVWSFINPLLLLLIYSFVFTTVMPNTTTGIQPYALFMFCGILPWTWFSSSLSEAAGSLIAGGNLIKKVLFPAEVLPIVSVLTNMVHFFLGLPILIAFLLIYKHPPDAWDLIWFPIAVAVQLVFTLXXXXVLSAIAVHFRDIRDILANVLTLWFFATPIIYPIFQDSVARYKWLFNLNPFTHLAVSYQEILFFNGPIGHWRWLVALGVASVGLFLGGYWVFDRLRDSFAEAV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
126 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
190 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
191 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
194 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
195 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
206 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
207 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
208 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
211 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
212 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
215 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
221 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
235 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
236 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
237 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
240 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
241 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
242 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
243 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
244 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
248 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
249 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
250 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
286 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
287 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
288 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
304 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
305 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
306 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
307 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
310 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
311 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
314 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
315 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
316 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
317 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
318 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
319 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
323 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
324 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
325 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
326 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
330 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
350 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
351 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
352 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
353 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
354 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
355 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
356 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0
Rhizoplane 3.82
Rhizosphere 91.41
Stem 0
Stem Tuber 0
Unclassified 0.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_235890 2162886007 Bacteria 4908
2 JGI24034J26672_10012924 3300002239 Bacteria 1263
3 rootH1_10386755 3300003323 Bacteria 1518
4 Ga0065714_10112503 3300005288 Bacteria 1455
5 Ga0065704_10002200 3300005289 Bacteria 6832
6 Ga0065704_10113837 3300005289 Bacteria 1904
7 Ga0065712_10000281 3300005290 Bacteria 15480
8 Ga0065712_10000338 3300005290 Bacteria 20563
9 Ga0065712_10002509 3300005290 Bacteria 4635
10 Ga0065712_10007252 3300005290 Bacteria 4558
11 Ga0065712_10007813 3300005290 Bacteria 2594
12 Ga0065712_10027610 3300005290 Bacteria 1687
13 Ga0065712_10074095 3300005290 Bacteria 4185
14 Ga0065712_10079334 3300005290 Bacteria 3228
15 Ga0065712_10146177 3300005290 Bacteria 1407
16 Ga0065712_10190043 3300005290 Bacteria 1146
17 Ga0065715_10000713 3300005293 Bacteria 9106
18 Ga0065715_10003913 3300005293 Bacteria 6572
19 Ga0065715_10011643 3300005293 Bacteria 3468
20 Ga0065715_10017317 3300005293 Bacteria 2411
21 Ga0065715_10114755 3300005293 Bacteria 2413
22 Ga0065715_10115391 3300005293 Bacteria 2407
23 Ga0065715_10119676 3300005293 Bacteria 2279
24 Ga0065715_10122051 3300005293 Bacteria 2215
25 Ga0065715_10130677 3300005293 Bacteria 2022
26 Ga0065715_10133885 3300005293 Bacteria 1964
27 Ga0065715_10146179 3300005293 Bacteria 1786
28 Ga0065715_10166266 3300005293 Bacteria 1573
29 Ga0065715_10194178 3300005293 Bacteria 1397
30 Ga0065715_10203018 3300005293 Unclassified 1351
31 Ga0065715_10243328 3300005293 Bacteria 1192
32 Ga0065715_10277364 3300005293 Bacteria 1095
33 Ga0065715_10369813 3300005293 Bacteria 908
34 Ga0065707_10000865 3300005295 Bacteria 12187
35 Ga0065707_10001316 3300005295 Bacteria 12030
36 Ga0065707_10004595 3300005295 Bacteria 6379
37 Ga0065707_10084894 3300005295 Bacteria 6667
38 Ga0065707_10208912 3300005295 Bacteria 1253
39 Ga0065707_10224647 3300005295 Bacteria 1210
40 Ga0065707_10329934 3300005295 Bacteria 951
41 Ga0070676_10009864 3300005328 Bacteria 5167
42 Ga0070683_100000638 3300005329 Bacteria 25248
43 Ga0070683_100027744 3300005329 Bacteria 5109
44 Ga0070690_100012018 3300005330 Bacteria 5081
45 Ga0070690_100036906 3300005330 Bacteria 3076
46 Ga0070670_100003219 3300005331 Bacteria 13476
47 Ga0070670_100031992 3300005331 Bacteria 4529
48 Ga0070670_100130336 3300005331 Bacteria 2171
49 Ga0070670_100264128 3300005331 Bacteria 1501
50 Ga0070670_100311194 3300005331 Bacteria 1379
51 Ga0070670_100422345 3300005331 Bacteria 1179
52 Ga0068869_100142194 3300005334 Bacteria 1853
53 Ga0068869_100198993 3300005334 Bacteria 1579
54 Ga0068869_100409386 3300005334 Bacteria 1117
55 Ga0070666_10012736 3300005335 Bacteria 5316
56 Ga0070666_10068736 3300005335 Bacteria 2407
57 Ga0070666_10149520 3300005335 Bacteria 1629
58 Ga0070666_10326109 3300005335 Bacteria 1096
59 Ga0070680_100049717 3300005336 Bacteria 3418
60 Ga0070680_100207133 3300005336 Bacteria 1654
61 Ga0070680_100256474 3300005336 Bacteria 1479
62 Ga0068868_100073308 3300005338 Bacteria 2734
63 Ga0068868_100082975 3300005338 Bacteria 2572
64 Ga0068868_100098127 3300005338 Bacteria 2368
65 Ga0068868_100205000 3300005338 Bacteria 1646
66 Ga0070660_100061024 3300005339 Bacteria 2927
67 Ga0070660_100220060 3300005339 Unclassified 1543
68 Ga0070689_100061998 3300005340 Bacteria 2909
69 Ga0070691_10000425 3300005341 Bacteria 15505
70 Ga0070687_100020732 3300005343 Bacteria 3079
71 Ga0070687_100038243 3300005343 Bacteria 2404
72 Ga0070687_100265220 3300005343 Bacteria 1074
73 Ga0070661_100204898 3300005344 Bacteria 1508
74 Ga0070692_10140060 3300005345 Bacteria 1368
75 Ga0070668_100020029 3300005347 Bacteria 5045
76 Ga0070668_100087313 3300005347 Bacteria 2454
77 Ga0070668_100092920 3300005347 Bacteria 2380
78 Ga0070669_100012308 3300005353 Bacteria 6070
79 Ga0070669_100031389 3300005353 Bacteria 3838
80 Ga0070669_100035365 3300005353 Bacteria 3618
81 Ga0070669_100054145 3300005353 Bacteria 2938
82 Ga0070669_100066391 3300005353 Bacteria 2659
83 Ga0070669_100111672 3300005353 Bacteria 2075
84 Ga0070669_100213605 3300005353 Bacteria 1523
85 Ga0070669_100282274 3300005353 Bacteria 1331
86 Ga0070669_100324982 3300005353 Bacteria 1243
87 Ga0070675_100000433 3300005354 Bacteria 28442
88 Ga0070675_100013560 3300005354 Bacteria 6409
89 Ga0070675_100076205 3300005354 Bacteria 2789
90 Ga0070675_100153302 3300005354 Bacteria 1977
91 Ga0070675_100185718 3300005354 Bacteria 1799
92 Ga0070675_100213132 3300005354 Bacteria 1680
93 Ga0070675_100221171 3300005354 Bacteria 1649
94 Ga0070675_100237759 3300005354 Bacteria 1591
95 Ga0070675_100424300 3300005354 Bacteria 1189
96 Ga0070675_100490361 3300005354 Bacteria 1106
97 Ga0070671_100023862 3300005355 Bacteria 5006
98 Ga0070671_100132674 3300005355 Bacteria 2098
99 Ga0070671_100153385 3300005355 Bacteria 1946
100 Ga0070674_100006653 3300005356 Bacteria 6759
101 Ga0070674_100015693 3300005356 Bacteria 4736
102 Ga0070674_100046578 3300005356 Bacteria 2967
103 Ga0070674_100050368 3300005356 Bacteria 2867
104 Ga0070674_100081488 3300005356 Bacteria 2313
105 Ga0070674_100136656 3300005356 Bacteria 1834
106 Ga0070674_100149028 3300005356 Bacteria 1764
107 Ga0070674_100299694 3300005356 Bacteria 1281
108 Ga0070673_100043665 3300005364 Bacteria 3465
109 Ga0070673_100103698 3300005364 Bacteria 2347
110 Ga0070673_100132094 3300005364 Bacteria 2096
111 Ga0070673_100199696 3300005364 Bacteria 1722
112 Ga0070673_100269804 3300005364 Bacteria 1489
113 Ga0070673_100333156 3300005364 Bacteria 1343
114 Ga0070688_100028461 3300005365 Bacteria 3336
115 Ga0070688_100139381 3300005365 Bacteria 1645
116 Ga0070688_100197684 3300005365 Bacteria 1405
117 Ga0070667_100148419 3300005367 Bacteria 2058
118 Ga0070667_100313348 3300005367 Bacteria 1415
119 Ga0070667_100444870 3300005367 Bacteria 1184
120 Ga0070667_100447016 3300005367 Bacteria 1181
121 Ga0070714_100003070 3300005435 Bacteria 12391
122 Ga0070713_100036514 3300005436 Bacteria 3966
123 Ga0070713_100107478 3300005436 Bacteria 2427
124 Ga0070701_10036525 3300005438 Bacteria 2476
125 Ga0070701_10059804 3300005438 Bacteria 2004
126 Ga0070701_10435536 3300005438 Bacteria 838
127 Ga0070711_100315544 3300005439 Unclassified 1247
128 Ga0070705_100001404 3300005440 Bacteria 12773
129 Ga0070705_100054979 3300005440 Bacteria 2338
130 Ga0070705_100178065 3300005440 Unclassified 1438
131 Ga0070705_100230195 3300005440 Bacteria 1289
132 Ga0070705_100382639 3300005440 Bacteria 1036
133 Ga0070700_100000788 3300005441 Bacteria 15603
134 Ga0070700_100005290 3300005441 Bacteria 6824
135 Ga0070700_100038754 3300005441 Bacteria 2907
136 Ga0070694_100010045 3300005444 Bacteria 5820
137 Ga0070694_100067544 3300005444 Bacteria 2455
138 Ga0070694_100073290 3300005444 Bacteria 2365
139 Ga0070694_100113025 3300005444 Bacteria 1937
140 Ga0070694_100680906 3300005444 Bacteria 835
141 Ga0070708_100029801 3300005445 Bacteria 4710
142 Ga0070708_100485294 3300005445 Bacteria 1166
143 Ga0070663_100067506 3300005455 Bacteria 2594
144 Ga0070663_100084342 3300005455 Bacteria 2342
145 Ga0070678_100049265 3300005456 Bacteria 3039
146 Ga0070678_100161468 3300005456 Bacteria 1816
147 Ga0070678_100232500 3300005456 Bacteria 1538
148 Ga0070662_100035211 3300005457 Bacteria 3535
149 Ga0070662_100151492 3300005457 Bacteria 1806
150 Ga0070662_100207947 3300005457 Bacteria 1556
151 Ga0070662_100238789 3300005457 Bacteria 1457
152 Ga0070662_100356310 3300005457 Bacteria 1200
153 Ga0070662_100415692 3300005457 Bacteria 1112
154 Ga0068867_100052763 3300005459 Bacteria 3001
155 Ga0068867_100193137 3300005459 Bacteria 1626
156 Ga0068867_100484532 3300005459 Bacteria 1060
157 Ga0068867_100648856 3300005459 Bacteria 926
158 Ga0070685_10006374 3300005466 Bacteria 6012
159 Ga0070706_100009582 3300005467 Bacteria 9006
160 Ga0070706_100243253 3300005467 Bacteria 1680
161 Ga0070706_100409113 3300005467 Bacteria 1263
162 Ga0070707_100434000 3300005468 Bacteria 1274
163 Ga0070698_100035909 3300005471 Bacteria 5123
164 Ga0070698_100174756 3300005471 Bacteria 2088
165 Ga0070698_100261779 3300005471 Bacteria 1662
166 Ga0070699_100013629 3300005518 Bacteria 6998
167 Ga0070699_100232564 3300005518 Bacteria 1644
168 Ga0070699_100271224 3300005518 Bacteria 1519
169 Ga0070679_100068341 3300005530 Bacteria 3544
170 Ga0070684_100000247 3300005535 Bacteria 37390
171 Ga0070684_100041153 3300005535 Bacteria 3983
172 Ga0070684_100072483 3300005535 Bacteria 3032
173 Ga0070684_100412520 3300005535 Bacteria 1246
174 Ga0070697_100123535 3300005536 Bacteria 2167
175 Ga0070697_100187344 3300005536 Bacteria 1755
176 Ga0068853_100635620 3300005539 Bacteria 1015
177 Ga0070672_100106879 3300005543 Bacteria 2277
178 Ga0070672_100150694 3300005543 Bacteria 1924
179 Ga0070672_100203789 3300005543 Bacteria 1655
180 Ga0070672_100235891 3300005543 Bacteria 1538
181 Ga0070686_100000153 3300005544 Bacteria 47434
182 Ga0070686_100232929 3300005544 Bacteria 1337
183 Ga0070686_100261895 3300005544 Bacteria 1268
184 Ga0070686_100448011 3300005544 Bacteria 992
185 Ga0070686_100480085 3300005544 Unclassified 961
186 Ga0070695_100008345 3300005545 Bacteria 6144
187 Ga0070695_100032985 3300005545 Bacteria 3238
188 Ga0070695_100072744 3300005545 Bacteria 2255
189 Ga0070695_100074093 3300005545 Bacteria 2236
190 Ga0070695_100143162 3300005545 Bacteria 1660
191 Ga0070695_100174239 3300005545 Bacteria 1520
192 Ga0070695_100188205 3300005545 Bacteria 1467
193 Ga0070696_100008086 3300005546 Bacteria 7029
194 Ga0070696_100067331 3300005546 Bacteria 2513
195 Ga0070696_100148659 3300005546 Bacteria 1718
196 Ga0070696_100393324 3300005546 Bacteria 1083
197 Ga0070693_100068268 3300005547 Unclassified 2086
198 Ga0070693_100200729 3300005547 Bacteria 1295
199 Ga0070693_100371405 3300005547 Bacteria 984
200 Ga0070665_100008640 3300005548 Bacteria 10308
201 Ga0070665_100021963 3300005548 Bacteria 6419
202 Ga0070665_100045540 3300005548 Bacteria 4405
203 Ga0070665_100086416 3300005548 Bacteria 3141
204 Ga0070665_100486755 3300005548 Bacteria 1245
205 Ga0070665_100888329 3300005548 Unclassified 904
206 Ga0070704_100006982 3300005549 Bacteria 6697
207 Ga0070704_100035377 3300005549 Bacteria 3394
208 Ga0070704_100079376 3300005549 Bacteria 2411
209 Ga0070704_100092322 3300005549 Bacteria 2260
210 Ga0070704_100172805 3300005549 Unclassified 1720
211 Ga0070704_100293927 3300005549 Bacteria 1351
212 Ga0070704_100396194 3300005549 Bacteria 1177
213 Ga0070704_100633108 3300005549 Bacteria 943
214 Ga0068855_100092401 3300005563 Bacteria 3490
215 Ga0070664_100007347 3300005564 Bacteria 8882
216 Ga0070664_100029409 3300005564 Bacteria 4580
217 Ga0070664_100608073 3300005564 Bacteria 1014
218 Ga0068857_100000620 3300005577 Bacteria 26143
219 Ga0068857_100279658 3300005577 Bacteria 1535
220 Ga0068854_100008015 3300005578 Bacteria 6767
221 Ga0068854_100182992 3300005578 Bacteria 1638
222 Ga0068856_100063822 3300005614 Bacteria 3639
223 Ga0070702_100004567 3300005615 Bacteria 6336
224 Ga0070702_100021674 3300005615 Bacteria 3386
225 Ga0070702_100145749 3300005615 Bacteria 1514
226 Ga0068852_100205884 3300005616 Bacteria 1864
227 Ga0068859_100118080 3300005617 Unclassified 2718
228 Ga0068859_100271189 3300005617 Bacteria 1789
229 Ga0068859_100277741 3300005617 Bacteria 1768
230 Ga0068859_100306382 3300005617 Bacteria 1682
231 Ga0068859_100362391 3300005617 Bacteria 1545
232 Ga0068859_100453888 3300005617 Unclassified 1378
233 Ga0068859_101184016 3300005617 Bacteria 841
234 Ga0068864_100007960 3300005618 Bacteria 8734
235 Ga0068864_100013387 3300005618 Bacteria 6798
236 Ga0068864_100164354 3300005618 Bacteria 2020
237 Ga0068864_100182739 3300005618 Bacteria 1918
238 Ga0068864_100354497 3300005618 Bacteria 1385
239 Ga0068866_10025986 3300005718 Bacteria 2759
240 Ga0068861_100056244 3300005719 Bacteria 3002
241 Ga0068861_100089592 3300005719 Bacteria 2425
242 Ga0068861_100243873 3300005719 Bacteria 1530
243 Ga0068861_100264318 3300005719 Bacteria 1474
244 Ga0068870_10178904 3300005840 Bacteria 1271
245 Ga0068870_10321456 3300005840 Unclassified 983
246 Ga0068863_100003004 3300005841 Bacteria 16664
247 Ga0068863_100008453 3300005841 Bacteria 10052
248 Ga0068863_100036782 3300005841 Bacteria 4662
249 Ga0068863_100061146 3300005841 Bacteria 3561
250 Ga0068863_100139481 3300005841 Bacteria 2317
251 Ga0068858_100020774 3300005842 Bacteria 6136
252 Ga0068858_100047760 3300005842 Bacteria 3968
253 Ga0068858_100078637 3300005842 Bacteria 3065
254 Ga0068858_100114217 3300005842 Bacteria 2522
255 Ga0068858_100115350 3300005842 Bacteria 2510
256 Ga0068858_100155306 3300005842 Bacteria 2153
257 Ga0068858_100184834 3300005842 Bacteria 1969
258 Ga0068858_100589902 3300005842 Unclassified 1077
259 Ga0068860_100126978 3300005843 Bacteria 2445
260 Ga0068860_100167760 3300005843 Bacteria 2120
261 Ga0068860_100283082 3300005843 Unclassified 1621
262 Ga0068860_100332788 3300005843 Bacteria 1492
263 Ga0068860_100352177 3300005843 Unclassified 1449
264 Ga0068860_100390499 3300005843 Bacteria 1375
265 Ga0068860_100451690 3300005843 Bacteria 1278
266 Ga0068860_100522704 3300005843 Bacteria 1187
267 Ga0068860_100661073 3300005843 Unclassified 1053
268 Ga0068862_100003536 3300005844 Bacteria 13406
269 Ga0068862_100010510 3300005844 Bacteria 7646
270 Ga0068862_100023616 3300005844 Bacteria 5154
271 Ga0068862_100030779 3300005844 Bacteria 4524
272 Ga0068862_100043918 3300005844 Bacteria 3811
273 Ga0068862_100043959 3300005844 Bacteria 3810
274 Ga0068862_100055505 3300005844 Bacteria 3393
275 Ga0068862_100148446 3300005844 Bacteria 2085
276 Ga0068862_100429636 3300005844 Bacteria 1241
277 Ga0068862_100489248 3300005844 Bacteria 1166
278 Ga0068862_100815864 3300005844 Unclassified 912
279 Ga0081455_10150963 3300005937 Bacteria 1791
280 Ga0081455_10228568 3300005937 Bacteria 1374
281 Ga0081455_10246321 3300005937 Unclassified 1310
282 Ga0081539_10002012 3300005985 Bacteria 30795
283 Ga0075365_10155941 3300006038 Bacteria 1589
284 Ga0075365_10182173 3300006038 Bacteria 1469
285 Ga0075368_10010324 3300006042 Bacteria 3374
286 Ga0075368_10010466 3300006042 Bacteria 3352
287 Ga0075363_100048986 3300006048 Bacteria 2248
288 Ga0075363_100111344 3300006048 Bacteria 1522
289 Ga0075364_10004634 3300006051 Bacteria 7926
290 Ga0075364_10038175 3300006051 Bacteria 3111
291 Ga0075364_10039634 3300006051 Bacteria 3055
292 Ga0075364_10207617 3300006051 Bacteria 1328
293 Ga0075364_10258665 3300006051 Bacteria 1183
294 Ga0070715_10019060 3300006163 Bacteria 2625
295 Ga0075362_10075871 3300006177 Bacteria 1542
296 Ga0075362_10173432 3300006177 Bacteria 1043
297 Ga0075367_10011763 3300006178 Bacteria 4645
298 Ga0075367_10030782 3300006178 Bacteria 3079
299 Ga0075367_10178504 3300006178 Bacteria 1324
300 Ga0075367_10321863 3300006178 Unclassified 974
301 Ga0075366_10002821 3300006195 Bacteria 8995
302 Ga0075366_10013017 3300006195 Bacteria 4730
303 Ga0075366_10022649 3300006195 Bacteria 3656
304 Ga0075366_10095486 3300006195 Bacteria 1782
305 Ga0075366_10107433 3300006195 Bacteria 1678
306 Ga0075366_10156105 3300006195 Bacteria 1382
307 Ga0097621_100000125 3300006237 Bacteria 44370
308 Ga0097621_100026539 3300006237 Bacteria 4545
309 Ga0097621_100029672 3300006237 Bacteria 4322
310 Ga0097621_100062060 3300006237 Bacteria 3067
311 Ga0097621_100072124 3300006237 Bacteria 2856
312 Ga0097621_100119238 3300006237 Bacteria 2236
313 Ga0097621_100225496 3300006237 Bacteria 1634
314 Ga0097621_100485043 3300006237 Bacteria 1118
315 Ga0075370_10011509 3300006353 Bacteria 4652
316 Ga0075370_10221881 3300006353 Bacteria 1117
317 Ga0068871_100000134 3300006358 Bacteria 47412
318 Ga0068871_100004547 3300006358 Bacteria 9672
319 Ga0068871_100026101 3300006358 Bacteria 4554
320 Ga0068871_100058115 3300006358 Bacteria 3148
321 Ga0068871_100082538 3300006358 Bacteria 2665
322 Ga0068871_100210412 3300006358 Bacteria 1682
323 Ga0068871_100227154 3300006358 Bacteria 1619
324 Ga0068871_100246275 3300006358 Bacteria 1556
325 Ga0068871_100388015 3300006358 Bacteria 1242
326 Ga0075428_100000497 3300006844 Bacteria 39844
327 Ga0075428_100002189 3300006844 Bacteria 21139
328 Ga0075428_100003117 3300006844 Bacteria 18098
329 Ga0075428_100006263 3300006844 Bacteria 13228
330 Ga0075428_100011781 3300006844 Bacteria 9733
331 Ga0075428_100017486 3300006844 Bacteria 7922
332 Ga0075428_100137393 3300006844 Bacteria 2657
333 Ga0075428_100217307 3300006844 Bacteria 2064
334 Ga0075428_100235960 3300006844 Bacteria 1973
335 Ga0075428_100283003 3300006844 Bacteria 1784
336 Ga0075428_100551365 3300006844 Bacteria 1232
337 Ga0075428_100594711 3300006844 Bacteria 1182
338 Ga0075430_100000389 3300006846 Bacteria 32344
339 Ga0075430_100000722 3300006846 Bacteria 25248
340 Ga0075430_100007706 3300006846 Bacteria 9095
341 Ga0075430_100137176 3300006846 Unclassified 2038
342 Ga0075430_100514160 3300006846 Unclassified 988
343 Ga0075431_100001219 3300006847 Bacteria 23281
344 Ga0075431_100013197 3300006847 Bacteria 8345
345 Ga0075431_100019089 3300006847 Bacteria 6984
346 Ga0075431_100019172 3300006847 Bacteria 6972
347 Ga0075431_100037347 3300006847 Bacteria 5005
348 Ga0075431_100063779 3300006847 Bacteria 3803
349 Ga0075431_100086340 3300006847 Bacteria 3238
350 Ga0075431_100150164 3300006847 Bacteria 2399
351 Ga0075431_100169999 3300006847 Bacteria 2240
352 Ga0075431_100309364 3300006847 Bacteria 1595
353 Ga0075431_100405486 3300006847 Unclassified 1364
354 Ga0075431_100640812 3300006847 Bacteria 1044
355 Ga0075433_10005767 3300006852 Bacteria 9744
356 Ga0075433_10009466 3300006852 Bacteria 7787
357 Ga0075433_10017226 3300006852 Bacteria 5979
358 Ga0075433_10028350 3300006852 Bacteria 4759
359 Ga0075433_10048453 3300006852 Bacteria 3694
360 Ga0075433_10076283 3300006852 Bacteria 2951
361 Ga0075433_10085553 3300006852 Bacteria 2784
362 Ga0075433_10230196 3300006852 Bacteria 1646
363 Ga0075433_10441294 3300006852 Bacteria 1147
364 Ga0075433_10443053 3300006852 Bacteria 1145
365 Ga0075434_100001202 3300006871 Bacteria 21518
366 Ga0075434_100001546 3300006871 Bacteria 19486
367 Ga0075434_100005743 3300006871 Bacteria 11328
368 Ga0075434_100007256 3300006871 Bacteria 10253
369 Ga0075434_100011171 3300006871 Bacteria 8450
370 Ga0075434_100022294 3300006871 Bacteria 6168
371 Ga0075434_100149199 3300006871 Bacteria 2358
372 Ga0075434_100154420 3300006871 Bacteria 2315
373 Ga0075434_100253564 3300006871 Bacteria 1778
374 Ga0075434_100281293 3300006871 Bacteria 1683
375 Ga0075434_100298717 3300006871 Bacteria 1631
376 Ga0075434_100334989 3300006871 Bacteria 1534
377 Ga0075434_100338747 3300006871 Bacteria 1525
378 Ga0075434_100948707 3300006871 Bacteria 875
379 Ga0075429_100002690 3300006880 Bacteria 14968
380 Ga0075429_100006315 3300006880 Bacteria 10261
381 Ga0075429_100051671 3300006880 Bacteria 3575
382 Ga0075429_100125991 3300006880 Bacteria 2240
383 Ga0075429_100147434 3300006880 Bacteria 2060
384 Ga0075429_100230084 3300006880 Bacteria 1624
385 Ga0075429_100238132 3300006880 Bacteria 1594
386 Ga0075429_100302614 3300006880 Bacteria 1400
387 Ga0075429_100320962 3300006880 Bacteria 1356
388 Ga0075429_100477268 3300006880 Bacteria 1093
389 Ga0075429_100597973 3300006880 Bacteria 966
390 Ga0075429_100678081 3300006880 Unclassified 903
391 Ga0068865_100020188 3300006881 Bacteria 4320
392 Ga0068865_100102993 3300006881 Bacteria 2093
393 Ga0068865_100175809 3300006881 Bacteria 1645
394 Ga0068865_100203298 3300006881 Bacteria 1539
395 Ga0068865_100280136 3300006881 Bacteria 1327
396 Ga0068865_100430411 3300006881 Bacteria 1087
397 Ga0075436_100008391 3300006914 Bacteria 7065
398 Ga0075436_100012571 3300006914 Bacteria 5802
399 Ga0075436_100035274 3300006914 Bacteria 3451
400 Ga0075436_100259270 3300006914 Bacteria 1239
401 Ga0097620_100004515 3300006931 Bacteria 14197
402 Ga0097620_100118068 3300006931 Unclassified 2718
403 Ga0097620_100271200 3300006931 Bacteria 1789
404 Ga0097620_100277750 3300006931 Bacteria 1768
405 Ga0097620_100306358 3300006931 Bacteria 1682
406 Ga0097620_100362378 3300006931 Bacteria 1545
407 Ga0097620_100453863 3300006931 Unclassified 1378
408 Ga0097620_101184035 3300006931 Bacteria 841
409 Ga0075435_100000204 3300007076 Bacteria 35933
410 Ga0075435_100001088 3300007076 Bacteria 17281
411 Ga0075435_100006762 3300007076 Bacteria 8135
412 Ga0075435_100017729 3300007076 Bacteria 5396
413 Ga0075435_100091589 3300007076 Bacteria 2509
414 Ga0075435_100186497 3300007076 Bacteria 1754
415 Ga0105251_10098546 3300009011 Bacteria 1337
416 Ga0105240_10175286 3300009093 Bacteria 2535
417 Ga0105240_10192050 3300009093 Bacteria 2400
418 Ga0105240_10415973 3300009093 Bacteria 1511
419 Ga0105240_10438407 3300009093 Bacteria 1464
420 Ga0111539_10000014 3300009094 Bacteria 307501
421 Ga0111539_10000230 3300009094 Bacteria 67127
422 Ga0111539_10000466 3300009094 Bacteria 50937
423 Ga0111539_10002605 3300009094 Bacteria 23899
424 Ga0111539_10003342 3300009094 Bacteria 21190
425 Ga0111539_10015022 3300009094 Bacteria 9650
426 Ga0111539_10028028 3300009094 Bacteria 6877
427 Ga0111539_10040677 3300009094 Bacteria 5594
428 Ga0111539_10098867 3300009094 Bacteria 3427
429 Ga0111539_10102668 3300009094 Bacteria 3356
430 Ga0111539_10115714 3300009094 Bacteria 3144
431 Ga0111539_10127730 3300009094 Bacteria 2978
432 Ga0111539_10135036 3300009094 Bacteria 2889
433 Ga0111539_10159169 3300009094 Bacteria 2641
434 Ga0111539_10185541 3300009094 Bacteria 2429
435 Ga0111539_10904485 3300009094 Bacteria 1026
436 Ga0105245_10013815 3300009098 Bacteria 7033
437 Ga0105245_10044522 3300009098 Bacteria 3962
438 Ga0105245_10079527 3300009098 Bacteria 2993
439 Ga0105245_10114957 3300009098 Bacteria 2507
440 Ga0105245_10286834 3300009098 Bacteria 1611
441 Ga0105245_10522377 3300009098 Bacteria 1206
442 Ga0105247_10006319 3300009101 Bacteria 7345
443 Ga0105247_10028671 3300009101 Bacteria 3369
444 Ga0105247_10171594 3300009101 Bacteria 1442
445 Ga0105247_10212071 3300009101 Bacteria 1307
446 Ga0105247_10213035 3300009101 Bacteria 1304
447 Ga0114129_10000426 3300009147 Bacteria 50026
448 Ga0114129_10002490 3300009147 Bacteria 25564
449 Ga0114129_10004086 3300009147 Bacteria 20621
450 Ga0114129_10011201 3300009147 Bacteria 12784
451 Ga0114129_10013149 3300009147 Bacteria 11792
452 Ga0114129_10015649 3300009147 Bacteria 10787
453 Ga0114129_10016744 3300009147 Bacteria 10441
454 Ga0114129_10017204 3300009147 Bacteria 10298
455 Ga0114129_10019409 3300009147 Bacteria 9680
456 Ga0114129_10019817 3300009147 Bacteria 9571
457 Ga0114129_10031829 3300009147 Bacteria 7457
458 Ga0114129_10058163 3300009147 Bacteria 5408
459 Ga0114129_10062276 3300009147 Bacteria 5212
460 Ga0114129_10070085 3300009147 Bacteria 4888
461 Ga0114129_10076822 3300009147 Bacteria 4648
462 Ga0114129_10109545 3300009147 Bacteria 3812
463 Ga0114129_10147890 3300009147 Bacteria 3217
464 Ga0114129_10261589 3300009147 Bacteria 2319
465 Ga0114129_10286990 3300009147 Bacteria 2197
466 Ga0114129_10474098 3300009147 Bacteria 1638
467 Ga0105243_10016270 3300009148 Bacteria 5628
468 Ga0105243_10039489 3300009148 Bacteria 3680
469 Ga0105243_10425097 3300009148 Bacteria 1240
470 Ga0105243_10670225 3300009148 Bacteria 1007
471 Ga0105241_10183968 3300009174 Bacteria 1735
472 Ga0105242_10006391 3300009176 Bacteria 9073
473 Ga0105242_10042783 3300009176 Bacteria 3660
474 Ga0105242_10116182 3300009176 Bacteria 2289
475 Ga0105242_10143596 3300009176 Bacteria 2074
476 Ga0105242_10333526 3300009176 Bacteria 1395
477 Ga0105242_10374269 3300009176 Bacteria 1322
478 Ga0105242_10480302 3300009176 Bacteria 1178
479 Ga0105242_10652596 3300009176 Bacteria 1023
480 Ga0105248_10001823 3300009177 Bacteria 23686
481 Ga0105248_10002172 3300009177 Bacteria 21714
482 Ga0105248_10023946 3300009177 Bacteria 6787
483 Ga0105248_10026358 3300009177 Bacteria 6465
484 Ga0105248_10033883 3300009177 Bacteria 5706
485 Ga0105248_10039647 3300009177 Bacteria 5278
486 Ga0105248_10042359 3300009177 Bacteria 5106
487 Ga0105248_10063280 3300009177 Bacteria 4153
488 Ga0105248_10082243 3300009177 Bacteria 3621
489 Ga0105248_10162796 3300009177 Bacteria 2516
490 Ga0105248_10207165 3300009177 Bacteria 2209
491 Ga0105248_10285506 3300009177 Bacteria 1858
492 Ga0105248_10341898 3300009177 Bacteria 1685
493 Ga0105248_10396596 3300009177 Bacteria 1554
494 Ga0105248_10712052 3300009177 Bacteria 1133
495 Ga0105237_10085659 3300009545 Bacteria 3141
496 Ga0105238_10346104 3300009551 Bacteria 1475
497 Ga0105249_10009745 3300009553 Bacteria 8416
498 Ga0105249_10029901 3300009553 Bacteria 4922
499 Ga0105249_10136382 3300009553 Bacteria 2348
500 Ga0105249_10163395 3300009553 Bacteria 2154
501 Ga0105249_10171846 3300009553 Bacteria 2102
502 Ga0105249_10224863 3300009553 Bacteria 1848
503 Ga0105249_10760151 3300009553 Bacteria 1031
504 Ga0105249_10805182 3300009553 Bacteria 1004
505 Ga0105239_10442152 3300010375 Bacteria 1474
506 Ga0105246_10215283 3300011119 Unclassified 1502
507 Ga0157370_10209227 3300013104 Bacteria 1808
508 Ga0157370_10383865 3300013104 Unclassified 1294
509 Ga0157374_10017943 3300013296 Bacteria 6237
510 Ga0157374_10086749 3300013296 Bacteria 2978
511 Ga0157374_10125215 3300013296 Bacteria 2484
512 Ga0157374_10171463 3300013296 Bacteria 2117
513 Ga0157374_10223564 3300013296 Bacteria 1848
514 Ga0157378_10009109 3300013297 Bacteria 8639
515 Ga0157378_10106605 3300013297 Bacteria 2563
516 Ga0157378_10256121 3300013297 Bacteria 1677
517 Ga0157378_10322007 3300013297 Bacteria 1502
518 Ga0163162_10027287 3300013306 Bacteria 5646
519 Ga0163162_10076478 3300013306 Bacteria 3409
520 Ga0163162_10174086 3300013306 Bacteria 2277
521 Ga0163162_10193677 3300013306 Bacteria 2161
522 Ga0163162_10360614 3300013306 Bacteria 1586
523 Ga0163162_10828631 3300013306 Bacteria 1041
524 Ga0157372_10346601 3300013307 Bacteria 1730
525 Ga0157375_10011898 3300013308 Bacteria 7698
526 Ga0157375_10220474 3300013308 Bacteria 2055
527 Ga0157375_10327702 3300013308 Bacteria 1696
528 Ga0157375_10523597 3300013308 Bacteria 1349
529 Ga0163163_10000001 3300014325 Bacteria 622185
530 Ga0163163_10085069 3300014325 Bacteria 3170
531 Ga0163163_10089531 3300014325 Bacteria 3090
532 Ga0163163_10240755 3300014325 Bacteria 1859
533 Ga0163163_10362623 3300014325 Bacteria 1506
534 Ga0163163_10634742 3300014325 Bacteria 1131
535 Ga0163163_10840245 3300014325 Bacteria 982
536 Ga0157380_10002775 3300014326 Bacteria 11897
537 Ga0157380_10003534 3300014326 Bacteria 10743
538 Ga0157380_10021379 3300014326 Bacteria 4853
539 Ga0157380_10042674 3300014326 Bacteria 3546
540 Ga0157380_10057183 3300014326 Bacteria 3105
541 Ga0157380_10236872 3300014326 Bacteria 1643
542 Ga0157380_10239969 3300014326 Bacteria 1633
543 Ga0157380_10457115 3300014326 Bacteria 1228
544 Ga0157380_10476386 3300014326 Bacteria 1206
545 Ga0157380_10505618 3300014326 Bacteria 1175
546 Ga0157380_10575995 3300014326 Bacteria 1109
547 Ga0157377_10045403 3300014745 Bacteria 2454
548 Ga0157377_10054221 3300014745 Bacteria 2269
549 Ga0157379_10002568 3300014968 Bacteria 15239
550 Ga0157379_10008620 3300014968 Bacteria 8875
551 Ga0157379_10010535 3300014968 Bacteria 8060
552 Ga0157379_10104470 3300014968 Bacteria 2542
553 Ga0157379_10121832 3300014968 Bacteria 2346
554 Ga0157376_10086235 3300014969 Bacteria 2707
555 Ga0157376_10115833 3300014969 Bacteria 2367
556 Ga0157376_10244175 3300014969 Bacteria 1674
557 Ga0163161_10597223 3300017792 Bacteria 910
558 Ga0213876_10047185 3300021384 Bacteria 2277
559 Ga0213876_10104207 3300021384 Bacteria 1504
560 Ga0207666_1002799 3300025271 Bacteria 2120
561 Ga0207697_10002984 3300025315 Bacteria 8536
562 Ga0207697_10169146 3300025315 Bacteria 955
563 Ga0207653_10088597 3300025885 Bacteria 1081
564 Ga0207682_10016962 3300025893 Bacteria 2843
565 Ga0207642_10021638 3300025899 Bacteria 2535
566 Ga0207642_10043309 3300025899 Bacteria 1984
567 Ga0207642_10102248 3300025899 Bacteria 1441
568 Ga0207710_10016662 3300025900 Bacteria 3110
569 Ga0207710_10192084 3300025900 Bacteria 1006
570 Ga0207688_10018825 3300025901 Bacteria 3756
571 Ga0207688_10035785 3300025901 Bacteria 2751
572 Ga0207688_10045030 3300025901 Bacteria 2460
573 Ga0207688_10174167 3300025901 Bacteria 1281
574 Ga0207680_10043788 3300025903 Bacteria 2628
575 Ga0207680_10055163 3300025903 Bacteria 2394
576 Ga0207680_10179057 3300025903 Bacteria 1432
577 Ga0207680_10204680 3300025903 Bacteria 1347
578 Ga0207680_10266201 3300025903 Bacteria 1188
579 Ga0207699_10076147 3300025906 Bacteria 2066
580 Ga0207645_10001406 3300025907 Bacteria 19717
581 Ga0207645_10082041 3300025907 Bacteria 2067
582 Ga0207643_10026892 3300025908 Bacteria 3188
583 Ga0207643_10309537 3300025908 Unclassified 984
584 Ga0207643_10424821 3300025908 Unclassified 843
585 Ga0207705_10047753 3300025909 Bacteria 3078
586 Ga0207684_10030634 3300025910 Bacteria 4579
587 Ga0207684_10262237 3300025910 Bacteria 1491
588 Ga0207684_10354555 3300025910 Bacteria 1263
589 Ga0207707_10072644 3300025912 Bacteria 2999
590 Ga0207707_10310721 3300025912 Bacteria 1362
591 Ga0207695_10145674 3300025913 Bacteria 2313
592 Ga0207695_10271060 3300025913 Bacteria 1593
593 Ga0207695_10372230 3300025913 Bacteria 1315
594 Ga0207671_10335159 3300025914 Bacteria 1198
595 Ga0207663_10472861 3300025916 Bacteria 970
596 Ga0207660_10052773 3300025917 Bacteria 2896
597 Ga0207660_10180894 3300025917 Bacteria 1637
598 Ga0207660_10417344 3300025917 Bacteria 1082
599 Ga0207662_10093116 3300025918 Bacteria 1856
600 Ga0207662_10103102 3300025918 Bacteria 1770
601 Ga0207662_10177484 3300025918 Bacteria 1369
602 Ga0207662_10194372 3300025918 Bacteria 1310
603 Ga0207657_10006096 3300025919 Bacteria 12536
604 Ga0207649_10026590 3300025920 Bacteria 3387
605 Ga0207646_10118951 3300025922 Bacteria 2373
606 Ga0207646_10226959 3300025922 Bacteria 1687
607 Ga0207681_10004564 3300025923 Bacteria 8517
608 Ga0207681_10007710 3300025923 Bacteria 6592
609 Ga0207681_10010304 3300025923 Bacteria 5718
610 Ga0207681_10022128 3300025923 Bacteria 4050
611 Ga0207681_10049070 3300025923 Bacteria 2852
612 Ga0207694_10512040 3300025924 Bacteria 1005
613 Ga0207650_10012873 3300025925 Bacteria 5780
614 Ga0207650_10045925 3300025925 Bacteria 3215
615 Ga0207650_10051134 3300025925 Bacteria 3057
616 Ga0207650_10089217 3300025925 Bacteria 2353
617 Ga0207650_10094452 3300025925 Bacteria 2291
618 Ga0207650_10219084 3300025925 Bacteria 1531
619 Ga0207659_10000079 3300025926 Bacteria 60790
620 Ga0207659_10056267 3300025926 Bacteria 2817
621 Ga0207659_10107113 3300025926 Bacteria 2118
622 Ga0207659_10110120 3300025926 Bacteria 2092
623 Ga0207659_10131900 3300025926 Bacteria 1930
624 Ga0207659_10345297 3300025926 Bacteria 1234
625 Ga0207687_10032490 3300025927 Bacteria 3535
626 Ga0207687_10042449 3300025927 Bacteria 3129
627 Ga0207700_10027277 3300025928 Bacteria 3997
628 Ga0207700_10284527 3300025928 Bacteria 1423
629 Ga0207644_10231817 3300025931 Bacteria 1467
630 Ga0207706_10045569 3300025933 Bacteria 3885
631 Ga0207706_10048053 3300025933 Bacteria 3774
632 Ga0207706_10127583 3300025933 Bacteria 2237
633 Ga0207706_10260904 3300025933 Bacteria 1513
634 Ga0207706_10293356 3300025933 Bacteria 1418
635 Ga0207686_10004099 3300025934 Bacteria 7817
636 Ga0207670_10054263 3300025936 Bacteria 2704
637 Ga0207670_10293954 3300025936 Unclassified 1270
638 Ga0207670_10614512 3300025936 Bacteria 893
639 Ga0207669_10005378 3300025937 Bacteria 5741
640 Ga0207669_10007871 3300025937 Bacteria 4966
641 Ga0207669_10065074 3300025937 Bacteria 2260
642 Ga0207669_10122108 3300025937 Bacteria 1771
643 Ga0207669_10140110 3300025937 Bacteria 1677
644 Ga0207669_10167628 3300025937 Bacteria 1559
645 Ga0207665_10136872 3300025939 Bacteria 1743
646 Ga0207691_10033053 3300025940 Bacteria 4818
647 Ga0207691_10061749 3300025940 Bacteria 3403
648 Ga0207691_10174138 3300025940 Unclassified 1883
649 Ga0207691_10225366 3300025940 Bacteria 1624
650 Ga0207691_10301962 3300025940 Bacteria 1375
651 Ga0207691_10400216 3300025940 Bacteria 1171
652 Ga0207711_10006268 3300025941 Bacteria 10036
653 Ga0207711_10006976 3300025941 Bacteria 9479
654 Ga0207711_10011151 3300025941 Bacteria 7469
655 Ga0207711_10026659 3300025941 Bacteria 4850
656 Ga0207711_10034866 3300025941 Bacteria 4262
657 Ga0207711_10084364 3300025941 Bacteria 2780
658 Ga0207711_10101916 3300025941 Bacteria 2540
659 Ga0207711_10160725 3300025941 Bacteria 2033
660 Ga0207711_10595480 3300025941 Bacteria 1031
661 Ga0207661_10000962 3300025944 Bacteria 18951
662 Ga0207661_10104972 3300025944 Bacteria 2380
663 Ga0207661_10255896 3300025944 Bacteria 1558
664 Ga0207679_10007075 3300025945 Bacteria 7113
665 Ga0207679_10040639 3300025945 Bacteria 3331
666 Ga0207679_10052501 3300025945 Bacteria 2990
667 Ga0207679_10109615 3300025945 Bacteria 2176
668 Ga0207679_10144034 3300025945 Bacteria 1930
669 Ga0207667_10118454 3300025949 Bacteria 2729
670 Ga0207651_10010494 3300025960 Bacteria 5138
671 Ga0207651_10018039 3300025960 Bacteria 4188
672 Ga0207651_10060323 3300025960 Bacteria 2633
673 Ga0207651_10162608 3300025960 Bacteria 1752
674 Ga0207651_10224658 3300025960 Bacteria 1520
675 Ga0207651_10236597 3300025960 Bacteria 1486
676 Ga0207651_10491363 3300025960 Unclassified 1059
677 Ga0207712_10055161 3300025961 Bacteria 2794
678 Ga0207712_10062928 3300025961 Bacteria 2639
679 Ga0207712_10135348 3300025961 Bacteria 1883
680 Ga0207712_10142701 3300025961 Bacteria 1840
681 Ga0207712_10287650 3300025961 Bacteria 1344
682 Ga0207712_10476076 3300025961 Bacteria 1063
683 Ga0207668_10298445 3300025972 Bacteria 1329
684 Ga0207640_10037408 3300025981 Bacteria 3053
685 Ga0207640_10042397 3300025981 Bacteria 2901
686 Ga0207640_10194519 3300025981 Bacteria 1531
687 Ga0207658_10106488 3300025986 Bacteria 2208
688 Ga0207658_10185036 3300025986 Bacteria 1727
689 Ga0207658_10417522 3300025986 Bacteria 1182
690 Ga0207658_10462845 3300025986 Bacteria 1124
691 Ga0207677_10006085 3300026023 Bacteria 6585
692 Ga0207677_10065561 3300026023 Bacteria 2534
693 Ga0207677_10312829 3300026023 Unclassified 1302
694 Ga0207677_10577700 3300026023 Bacteria 983
695 Ga0207703_10011918 3300026035 Bacteria 6770
696 Ga0207703_10024349 3300026035 Bacteria 4763
697 Ga0207703_10028554 3300026035 Bacteria 4398
698 Ga0207703_10032058 3300026035 Bacteria 4157
699 Ga0207703_10091644 3300026035 Bacteria 2557
700 Ga0207703_10255558 3300026035 Bacteria 1582
701 Ga0207703_10321376 3300026035 Bacteria 1417
702 Ga0207703_10334288 3300026035 Bacteria 1390
703 Ga0207703_10407661 3300026035 Bacteria 1262
704 Ga0207678_10016500 3300026067 Bacteria 6484
705 Ga0207678_10026289 3300026067 Bacteria 5078
706 Ga0207678_10075340 3300026067 Bacteria 2890
707 Ga0207678_10083819 3300026067 Bacteria 2726
708 Ga0207708_10004337 3300026075 Bacteria 10446
709 Ga0207708_10011869 3300026075 Bacteria 6489
710 Ga0207708_10027833 3300026075 Bacteria 4281
711 Ga0207708_10073587 3300026075 Bacteria 2619
712 Ga0207708_10143398 3300026075 Bacteria 1875
713 Ga0207702_10008196 3300026078 Bacteria 8832
714 Ga0207641_10000955 3300026088 Bacteria 29716
715 Ga0207641_10029587 3300026088 Bacteria 4531
716 Ga0207641_10098340 3300026088 Bacteria 2573
717 Ga0207641_10155543 3300026088 Bacteria 2074
718 Ga0207648_10002536 3300026089 Bacteria 19594
719 Ga0207648_10100441 3300026089 Bacteria 2535
720 Ga0207648_10147181 3300026089 Bacteria 2078
721 Ga0207648_10202798 3300026089 Bacteria 1759
722 Ga0207648_10259085 3300026089 Unclassified 1552
723 Ga0207648_10413548 3300026089 Bacteria 1224
724 Ga0207676_10058841 3300026095 Bacteria 3033
725 Ga0207676_10223923 3300026095 Bacteria 1677
726 Ga0207676_10363959 3300026095 Bacteria 1341
727 Ga0207674_10001555 3300026116 Bacteria 29583
728 Ga0207674_10329280 3300026116 Bacteria 1477
729 Ga0207675_100020327 3300026118 Bacteria 6190
730 Ga0207675_100028863 3300026118 Bacteria 5168
731 Ga0207675_100029006 3300026118 Bacteria 5156
732 Ga0207675_100077824 3300026118 Bacteria 3107
733 Ga0207675_100083523 3300026118 Bacteria 2996
734 Ga0207675_100101869 3300026118 Bacteria 2705
735 Ga0207675_100218517 3300026118 Bacteria 1835
736 Ga0207675_100512448 3300026118 Bacteria 1195
737 Ga0207675_100789129 3300026118 Bacteria 963
738 Ga0207683_10012041 3300026121 Bacteria 7383
739 Ga0207683_10084754 3300026121 Bacteria 2817
740 Ga0207683_10091968 3300026121 Bacteria 2703
741 Ga0207683_10158638 3300026121 Bacteria 2044
742 Ga0207683_10230017 3300026121 Bacteria 1691
743 Ga0209983_1012400 3300027665 Bacteria 1749
744 Ga0209971_1005060 3300027682 Bacteria 3131
745 Ga0209971_1061955 3300027682 Bacteria 906
746 Ga0209813_10017732 3300027866 Bacteria 1957
747 Ga0209813_10029849 3300027866 Unclassified 1599
748 Ga0207428_10000005 3300027907 Bacteria 520045
749 Ga0207428_10000531 3300027907 Bacteria 45546
750 Ga0207428_10003214 3300027907 Bacteria 15966
751 Ga0207428_10008933 3300027907 Bacteria 9025
752 Ga0207428_10030121 3300027907 Bacteria 4489
753 Ga0207428_10032836 3300027907 Bacteria 4268
754 Ga0207428_10046855 3300027907 Bacteria 3474
755 Ga0207428_10052174 3300027907 Bacteria 3267
756 Ga0207428_10067695 3300027907 Bacteria 2811
757 Ga0207428_10079831 3300027907 Bacteria 2557
758 Ga0207428_10088301 3300027907 Bacteria 2411
759 Ga0207428_10089480 3300027907 Bacteria 2392
760 Ga0207428_10155376 3300027907 Bacteria 1740
761 Ga0207428_10195328 3300027907 Bacteria 1524
762 Ga0207428_10199150 3300027907 Bacteria 1507
763 Ga0268266_10015925 3300028379 Bacteria 6434
764 Ga0268266_10019822 3300028379 Bacteria 5731
765 Ga0268266_10070132 3300028379 Bacteria 3037
766 Ga0268266_10156520 3300028379 Bacteria 2059
767 Ga0268266_10353625 3300028379 Bacteria 1381
768 Ga0268265_10002223 3300028380 Bacteria 14919
769 Ga0268265_10007125 3300028380 Bacteria 7548
770 Ga0268265_10088356 3300028380 Bacteria 2469
771 Ga0268265_10106633 3300028380 Bacteria 2276
772 Ga0268265_10125407 3300028380 Bacteria 2124
773 Ga0268265_10206043 3300028380 Bacteria 1710
774 Ga0268265_10231485 3300028380 Bacteria 1624
775 Ga0268265_10378570 3300028380 Unclassified 1301
776 Ga0268264_10077566 3300028381 Bacteria 2830
777 Ga0268264_10235681 3300028381 Unclassified 1692
778 Ga0268264_10239234 3300028381 Unclassified 1681
779 Ga0268264_10240731 3300028381 Bacteria 1676
780 Ga0268264_10453774 3300028381 Bacteria 1242
781 Ga0268264_10678721 3300028381 Bacteria 1022
782 Ga0268264_10804815 3300028381 Bacteria 939
783 Ga0265318_10046670 3300028577 Bacteria 1634
784 Ga0265332_10033437 3300031238 Bacteria 2238
785 Ga0265320_10045892 3300031240 Unclassified 2144
786 Ga0265340_10177401 3300031247 Bacteria 964
787 Ga0307408_100013807 3300031548 Bacteria 5362
788 Ga0307408_100045626 3300031548 Bacteria 3131
789 Ga0307408_100082347 3300031548 Bacteria 2408
790 Ga0265314_10011701 3300031711 Bacteria 7219
791 Ga0265314_10145586 3300031711 Bacteria 1459
792 Ga0316576_10032559 3300031727 Bacteria 3705
793 Ga0316576_10165464 3300031727 Bacteria 1669
794 Ga0316578_10258961 3300031728 Bacteria 1043
795 Ga0307405_10077332 3300031731 Bacteria 2162
796 Ga0307405_10388539 3300031731 Bacteria 1089
797 Ga0307413_10180278 3300031824 Bacteria 1505
798 Ga0307410_10027381 3300031852 Bacteria 3603
799 Ga0307410_10205258 3300031852 Bacteria 1507
800 Ga0307407_10296114 3300031903 Bacteria 1126
801 Ga0307412_10134435 3300031911 Unclassified 1802
802 Ga0307412_10407952 3300031911 Unclassified 1108
803 Ga0307409_100136343 3300031995 Bacteria 2107
804 Ga0307409_100715394 3300031995 Bacteria 1002
805 Ga0307409_100728351 3300031995 Bacteria 994
806 Ga0307416_100016217 3300032002 Bacteria 5170
807 Ga0307416_100031387 3300032002 Bacteria 3999
808 Ga0307416_100051654 3300032002 Bacteria 3285
809 Ga0307416_100059474 3300032002 Bacteria 3105
810 Ga0307416_100420988 3300032002 Bacteria 1380
811 Ga0307416_100874177 3300032002 Bacteria 998
812 Ga0307414_10016170 3300032004 Bacteria 4528
813 Ga0307411_10029640 3300032005 Bacteria 3345
814 Ga0307411_10110149 3300032005 Bacteria 1968
815 Ga0307411_10343281 3300032005 Unclassified 1214
816 Ga0307415_100025699 3300032126 Bacteria 3701
817 Ga0373948_0025652 3300034817 Bacteria 1157
818 Ga0373938_0000489 3300034957 Bacteria 6397
819 Ga0373929_0000898 3300035085 Bacteria 5806
820 Ga0373934_0003832 3300035086 Bacteria 5536
821 Ga0373949_0001032 3300035090 Bacteria 8540
822 Ga0373951_0007844 3300035091 Bacteria 2421
823 Ga0373952_0005074 3300035092 Bacteria 2399
824 Ga0373923_0032199 3300035111 Bacteria 2117
825 Ga0373932_0009900 3300035112 Bacteria 2298
826 Ga0373939_0002375 3300035114 Bacteria 4445
827 Ga0373954_0113162 3300035118 Bacteria 1314
828 Ga0373956_0002659 3300035119 Bacteria 7234
829 Ga0373957_0003805 3300035120 Bacteria 4523
830 Ga0373943_0006653 3300035170 Bacteria 5186
831 Ga0373943_0056915 3300035170 Bacteria 1942
832 Ga0373943_0090563 3300035170 Bacteria 1584
833 Ga0373946_0121619 3300035171 Bacteria 1192
834 Ga0373955_0004470 3300035172 Bacteria 6191
835 Ga0373955_0069986 3300035172 Bacteria 1959
836 Ga0373961_0004391 3300035241 Bacteria 3413
837 Ga0373962_0005233 3300035242 Bacteria 3136
838 Ga0373931_0083899 3300035691 Bacteria 1764
839 Ga0373933_0002143 3300035724 Bacteria 11323
840 Ga0373947_0013719 3300035725 Bacteria 4643
841 Ga0373947_0043610 3300035725 Bacteria 2680
842 Ga0373947_0139066 3300035725 Bacteria 1556
843 Ga0373937_0000088 3300036401 Bacteria 84659
844 Ga0373937_0202511 3300036401 Bacteria 1866
845 Ga0316584_0199055 3300036712 Bacteria 1479
846 Ga0373925_0003153 3300037068 Bacteria 12918
847 Ga0373925_0019339 3300037068 Bacteria 4953
848 Ga0395905_0436434 3300037471 Bacteria 1207
849 Ga0436365_0603834 3300039437 Bacteria 1482
850 Ga0436365_1823118 3300039437 Bacteria 2420
851 Ga0451802_1074021 3300041460 Bacteria 1680
852 Ga0451807_0932481 3300041486 Bacteria 1113
853 Ga0439437_004082 3300042000 Bacteria 1588
854 Ga0439449_0133081 3300042007 Bacteria 925
855 Ga0439450_001044 3300042008 Bacteria 3903
856 Ga0450896_013328 3300042133 Bacteria 1169
857 Ga0439446_0003549 3300042156 Bacteria 3886
858 Ga0450908_000601 3300042184 Bacteria 6903
859 Ga0439434_0163745 3300042435 Bacteria 740
860 Ga0439435_0001680 3300042436 Bacteria 4168
861 Ga0439435_0004236 3300042436 Bacteria 3070
862 Ga0439435_0020268 3300042436 Bacteria 1713
863 Ga0439464_0002262 3300042439 Bacteria 4709
864 Ga0451577_0036902 3300042876 Bacteria 4400
865 Ga0466963_0155679 3300044694 Bacteria 1588
866 Ga0453684_0015096 3300044712 Bacteria 12256
867 Ga0453684_0238100 3300044712 Bacteria 2097
868 Ga0451576_0014174 3300045051 Bacteria 8884
869 Ga0451576_0118553 3300045051 Bacteria 2755
870 Ga0451576_0129865 3300045051 Bacteria 2626
871 Ga0451576_0191819 3300045051 Bacteria 2134
872 Ga0451576_0689132 3300045051 Bacteria 1073
873 Ga0451576_0692611 3300045051 Bacteria 1071
874 Ga0466967_0134331 3300045976 Bacteria 2300
875 Ga0495592_0065872 3300046454 Bacteria 2651
876 Ga0495592_0109176 3300046454 Bacteria 1960
877 Ga0495603_0162083 3300046455 Bacteria 1297
878 Ga0495638_0002169 3300046460 Bacteria 16465
879 Ga0495653_0037508 3300046463 Bacteria 3807
880 Ga0495582_0100665 3300046473 Bacteria 1618
881 Ga0495582_0133801 3300046473 Bacteria 1402
882 Ga0495639_0227769 3300046475 Unclassified 918
883 Ga0495628_0024037 3300046516 Bacteria 4993
884 Ga0495630_0024902 3300046517 Bacteria 4424
885 Ga0495643_0002984 3300046522 Bacteria 12782
886 Ga0495642_0094024 3300046528 Unclassified 1271
887 Ga0495621_0020651 3300046539 Bacteria 2164
888 Ga0495621_0023373 3300046539 Bacteria 2055
889 Ga0495645_0002325 3300046543 Bacteria 12895
890 Ga0495645_0119351 3300046543 Bacteria 1858
891 Ga0495667_0280297 3300046559 Unclassified 1058
892 Ga0495656_0095821 3300046615 Bacteria 1365
893 Ga0495634_0140850 3300046642 Bacteria 1531
894 Ga0495634_0189134 3300046642 Bacteria 1285
895 Ga0495588_0138723 3300046674 Bacteria 1284
896 Ga0495658_0095474 3300046683 Bacteria 1767
897 Ga0495669_0003820 3300046684 Bacteria 6187
898 Ga0495613_0001676 3300046689 Bacteria 16870
899 Ga0495600_0015351 3300046809 Bacteria 4842
900 Ga0495674_0233145 3300047319 Bacteria 1519
901 Ga0495674_0233461 3300047319 Bacteria 1518
902 Ga0495684_0004473 3300047471 Bacteria 10925
903 Ga0496100_0001496 3300048903 Bacteria 11450
904 Ga0496101_0000830 3300048904 Bacteria 18197
905 Ga0496101_0178336 3300048904 Bacteria 1635
906 Ga0496101_0217405 3300048904 Bacteria 1482
907 Ga0496101_0647389 3300048904 Bacteria 835
908 Ga0496102_0010247 3300048905 Bacteria 8059
909 Ga0496102_0055442 3300048905 Bacteria 3614
910 Ga0496102_0252039 3300048905 Bacteria 1665
911 Ga0496104_0010482 3300048907 Bacteria 8280
912 Ga0496104_0011819 3300048907 Bacteria 7834
913 Ga0496104_0016154 3300048907 Bacteria 6774
914 Ga0496104_0018381 3300048907 Bacteria 6379
915 Ga0496104_0138434 3300048907 Bacteria 2339
916 Ga0496104_0138762 3300048907 Bacteria 2336
917 Ga0496104_0439341 3300048907 Bacteria 1217
918 Ga0496105_0030341 3300048908 Bacteria 4430
919 Ga0496106_0079657 3300048909 Bacteria 2515
920 Ga0496106_0234342 3300048909 Bacteria 1466
921 Ga0496106_0234768 3300048909 Unclassified 1465
922 Ga0496107_0073966 3300048910 Bacteria 2479
923 Ga0496107_0391259 3300048910 Bacteria 1034
924 Ga0496108_0000976 3300048911 Bacteria 22271
925 Ga0496108_0001834 3300048911 Bacteria 16977
926 Ga0496108_0021565 3300048911 Bacteria 5292
927 Ga0496108_0250105 3300048911 Bacteria 1542
928 Ga0496109_0001292 3300048912 Bacteria 20740
929 Ga0496109_0007547 3300048912 Bacteria 9219
930 Ga0496109_0349301 3300048912 Bacteria 1397
931 Ga0496109_0428121 3300048912 Bacteria 1250
932 Ga0496110_0001114 3300048913 Bacteria 18968
933 Ga0496110_0025373 3300048913 Bacteria 5064
934 Ga0496110_0222729 3300048913 Bacteria 1716
935 Ga0496110_0657348 3300048913 Bacteria 948
936 Ga0496111_0001821 3300048914 Bacteria 12537
937 Ga0496112_0000279 3300048915 Bacteria 33168
938 Ga0496112_0003880 3300048915 Bacteria 12501
939 Ga0496112_0007942 3300048915 Bacteria 9460
940 Ga0496112_0028083 3300048915 Bacteria 5428
941 Ga0496112_0373262 3300048915 Bacteria 1368
942 Ga0496113_0032239 3300048916 Bacteria 3808
943 Ga0496114_0001212 3300048917 Bacteria 19503
944 Ga0496114_0065893 3300048917 Bacteria 3035
945 Ga0496114_0083151 3300048917 Bacteria 2708
946 Ga0496114_0210557 3300048917 Bacteria 1705
947 Ga0496114_0226940 3300048917 Bacteria 1640
948 Ga0496115_0040595 3300048918 Bacteria 3700
949 Ga0501292_003919 3300049515 Bacteria 2012
950 Ga0501295_030850 3300049518 Bacteria 1056
951 Ga0501299_001454 3300049522 Bacteria 3056
952 Ga0501031_0006245 3300049568 Bacteria 7768
953 Ga0501031_0035339 3300049568 Bacteria 3260
954 Ga0501031_0044128 3300049568 Bacteria 2909
955 Ga0501032_0003850 3300049569 Bacteria 11396
956 Ga0501032_0011090 3300049569 Bacteria 6475
957 Ga0501032_0032071 3300049569 Bacteria 3601
958 Ga0501032_0165201 3300049569 Bacteria 1452
959 Ga0501033_0003710 3300049570 Bacteria 12424
960 Ga0501033_0010678 3300049570 Bacteria 7037
961 Ga0501033_0020306 3300049570 Bacteria 5018
962 Ga0501034_0001559 3300049571 Bacteria 29974
963 Ga0501034_0023972 3300049571 Bacteria 6210
964 Ga0501034_0036744 3300049571 Bacteria 4960
965 Ga0501034_0061179 3300049571 Bacteria 3782
966 Ga0501034_0077462 3300049571 Bacteria 3330
967 Ga0501034_0099937 3300049571 Bacteria 2895
968 Ga0501034_0117012 3300049571 Bacteria 2653
969 Ga0501034_0141126 3300049571 Bacteria 2388
970 Ga0501034_0234814 3300049571 Bacteria 1781
971 Ga0501036_0001288 3300049572 Bacteria 19206
972 Ga0501036_0003430 3300049572 Bacteria 12663
973 Ga0501036_0027045 3300049572 Bacteria 4847
974 Ga0501036_0036647 3300049572 Bacteria 4151
975 Ga0501036_0047881 3300049572 Bacteria 3620
976 Ga0501036_0139212 3300049572 Bacteria 2048
977 Ga0501036_0167093 3300049572 Bacteria 1854
978 Ga0501036_0229712 3300049572 Bacteria 1557
979 Ga0501037_0005114 3300049573 Bacteria 9538
980 Ga0501037_0027399 3300049573 Bacteria 4209
981 Ga0501038_0013284 3300049574 Bacteria 7509
982 Ga0501038_0025440 3300049574 Bacteria 5276
983 Ga0501038_0044353 3300049574 Bacteria 3864
984 Ga0501038_0422877 3300049574 Bacteria 1028
985 Ga0501039_0039864 3300049575 Bacteria 3626
986 Ga0501039_0044494 3300049575 Bacteria 3429
987 Ga0501039_0104120 3300049575 Bacteria 2215
988 Ga0501039_0275998 3300049575 Bacteria 1321
989 Ga0501040_0158582 3300049576 Bacteria 1599
990 Ga0501041_0171645 3300049577 Bacteria 1357
991 Ga0501041_0200061 3300049577 Bacteria 1252
992 Ga0501042_0011496 3300049578 Bacteria 5976
993 Ga0501042_0046566 3300049578 Bacteria 3092
994 Ga0501042_0138095 3300049578 Bacteria 1757
995 Ga0501042_0145774 3300049578 Bacteria 1707
996 Ga0501043_0001015 3300049579 Bacteria 24651
997 Ga0501043_0019720 3300049579 Bacteria 5295
998 Ga0501046_0003506 3300049580 Bacteria 14374
999 Ga0501046_0010413 3300049580 Bacteria 7988
1000 Ga0501046_0022162 3300049580 Bacteria 5235
1001 Ga0501046_0048701 3300049580 Bacteria 3354
1002 Ga0501046_0127601 3300049580 Bacteria 1931
1003 Ga0501047_0000134 3300049581 Bacteria 89882
1004 Ga0501047_0007600 3300049581 Bacteria 10199
1005 Ga0501047_0025544 3300049581 Bacteria 5678
1006 Ga0501047_0046619 3300049581 Bacteria 4188
1007 Ga0501047_0049039 3300049581 Bacteria 4077
1008 Ga0501047_0116186 3300049581 Bacteria 2557
1009 Ga0501048_0012101 3300049582 Bacteria 6431
1010 Ga0501048_0018801 3300049582 Bacteria 5079
1011 Ga0501048_0085239 3300049582 Bacteria 2228
1012 Ga0501048_0141400 3300049582 Bacteria 1702
1013 Ga0501048_0215063 3300049582 Bacteria 1363
1014 Ga0501067_0009296 3300049583 Bacteria 5445
1015 Ga0501067_0040369 3300049583 Bacteria 2592
1016 Ga0501068_0007676 3300049584 Bacteria 5969
1017 Ga0501068_0096422 3300049584 Bacteria 1829
1018 Ga0501069_0000277 3300049585 Bacteria 23273
1019 Ga0501069_0019992 3300049585 Bacteria 3624
1020 Ga0501070_0004794 3300049586 Bacteria 11569
1021 Ga0501070_0018320 3300049586 Bacteria 5873
1022 Ga0501070_0050600 3300049586 Bacteria 3448
1023 Ga0501070_0092740 3300049586 Bacteria 2499
1024 Ga0501071_0000369 3300049587 Bacteria 22026
1025 Ga0501071_0003389 3300049587 Bacteria 9955
1026 Ga0501071_0030947 3300049587 Bacteria 3789
1027 Ga0501071_0124780 3300049587 Bacteria 1910
1028 Ga0501071_0355309 3300049587 Bacteria 1115
1029 Ga0501072_0021203 3300049588 Bacteria 5040
1030 Ga0501072_0082222 3300049588 Bacteria 2553
1031 Ga0501072_0088680 3300049588 Bacteria 2454
1032 Ga0501072_0097786 3300049588 Bacteria 2333
1033 Ga0501072_0230675 3300049588 Bacteria 1475
1034 Ga0501073_0003611 3300049589 Bacteria 11631
1035 Ga0501073_0007039 3300049589 Bacteria 8379
1036 Ga0501073_0022571 3300049589 Bacteria 4529
1037 Ga0501073_0037072 3300049589 Bacteria 3463
1038 Ga0501073_0045589 3300049589 Bacteria 3087
1039 Ga0501073_0108890 3300049589 Bacteria 1922
1040 Ga0501073_0252384 3300049589 Bacteria 1217
1041 Ga0501074_0000449 3300049590 Bacteria 24661
1042 Ga0501074_0241206 3300049590 Bacteria 1285
1043 Ga0501074_0349795 3300049590 Bacteria 1049
1044 Ga0501075_0018528 3300049591 Bacteria 5039
1045 Ga0501075_0074374 3300049591 Bacteria 2570
1046 Ga0501075_0152726 3300049591 Bacteria 1760
1047 Ga0501075_0221368 3300049591 Bacteria 1444
1048 Ga0501076_0027186 3300049592 Bacteria 4438
1049 Ga0501076_0061179 3300049592 Bacteria 2997
1050 Ga0501076_0066885 3300049592 Bacteria 2869
1051 Ga0501076_0116504 3300049592 Bacteria 2162
1052 Ga0501076_0175950 3300049592 Bacteria 1744
1053 Ga0501076_0234633 3300049592 Unclassified 1500
1054 Ga0501076_0269868 3300049592 Bacteria 1393
1055 Ga0501202_019612 3300049652 Bacteria 1337
1056 Ga0501223_023820 3300049663 Bacteria 1193
1057 Ga0501227_035557 3300049665 Bacteria 1213
1058 Ga0501257_043102 3300049686 Bacteria 1111
1059 Ga0501260_007122 3300049689 Bacteria 1087
1060 Ga0501221_007064 3300049704 Bacteria 1915
1061 Ga0501225_0038322 3300049705 Bacteria 1321
1062 Ga0501079_0005948 3300049741 Bacteria 9128
1063 Ga0501079_0034747 3300049741 Bacteria 3879
1064 Ga0501079_0044720 3300049741 Bacteria 3417
1065 Ga0501079_0055947 3300049741 Bacteria 3044
1066 Ga0501079_0065500 3300049741 Bacteria 2803
1067 Ga0501079_0198369 3300049741 Bacteria 1567
1068 Ga0501079_0262579 3300049741 Bacteria 1349
1069 Ga0501079_0524765 3300049741 Bacteria 931
1070 Ga0501080_0005720 3300049742 Bacteria 11120
1071 Ga0501080_0074665 3300049742 Bacteria 3154
1072 Ga0501080_0079581 3300049742 Bacteria 3047
1073 Ga0501080_0332121 3300049742 Bacteria 1375
1074 Ga0501080_0460588 3300049742 Bacteria 1139
1075 Ga0501080_0536090 3300049742 Bacteria 1043
1076 Ga0501080_0657930 3300049742 Bacteria 926
1077 Ga0501081_0031923 3300049743 Bacteria 3571
1078 Ga0501081_0075016 3300049743 Bacteria 2360
1079 Ga0501081_0118790 3300049743 Bacteria 1881
1080 Ga0501081_0235273 3300049743 Bacteria 1335
1081 Ga0501083_0007272 3300049744 Bacteria 7856
1082 Ga0501083_0023357 3300049744 Bacteria 4288
1083 Ga0501083_0037056 3300049744 Bacteria 3323
1084 Ga0501083_0213119 3300049744 Bacteria 1259
1085 Ga0501083_0409890 3300049744 Bacteria 882
1086 Ga0501273_007020 3300049770 Bacteria 1318
1087 Ga0501283_003346 3300049779 Bacteria 2117
1088 Ga0501035_0003099 3300049822 Bacteria 15972
1089 Ga0501035_0003483 3300049822 Bacteria 15055
1090 Ga0501035_0007716 3300049822 Bacteria 10049
1091 Ga0501035_0008187 3300049822 Bacteria 9743
1092 Ga0501035_0014236 3300049822 Bacteria 7341
1093 Ga0501035_0183138 3300049822 Bacteria 1804
1094 Ga0501044_0001440 3300049823 Bacteria 27955
1095 Ga0501044_0010848 3300049823 Bacteria 9884
1096 Ga0501044_0013275 3300049823 Bacteria 8917
1097 Ga0501044_0249962 3300049823 Bacteria 1714
1098 Ga0501044_0586603 3300049823 Bacteria 1009
1099 Ga0501045_0002867 3300049824 Bacteria 11780
1100 Ga0501045_0029810 3300049824 Bacteria 3945
1101 Ga0501045_0072142 3300049824 Bacteria 2542
1102 Ga0501045_0081056 3300049824 Bacteria 2393
1103 Ga0501045_0102406 3300049824 Bacteria 2120
1104 Ga0501045_0175736 3300049824 Bacteria 1595
1105 nmdc:mga03683_165606_c1 3300050489 Bacteria 1003
1106 nmdc:mga03n38_171283_c1 3300050490 Bacteria 1106
1107 nmdc:mga03n38_186690_c1 3300050490 Bacteria 1065
1108 nmdc:mga00v17_100512_c1 3300050491 Bacteria 1825
1109 nmdc:mga00v17_141508_c1 3300050491 Bacteria 1543
1110 nmdc:mga00v17_154947_c1 3300050491 Bacteria 1473
1111 nmdc:mga00v17_360854_c1 3300050491 Bacteria 945
1112 nmdc:mga00v17_62372_c1 3300050491 Bacteria 2293
1113 nmdc:mga00v17_9452_c1 3300050491 Bacteria 5278
1114 nmdc:mga0yw44_377032_c1 3300050492 Bacteria 957
1115 nmdc:mga0k408_115359_c1 3300050493 Bacteria 1589
1116 nmdc:mga0k408_144587_c1 3300050493 Bacteria 1415
1117 nmdc:mga0k408_23075_c1 3300050493 Bacteria 3506
1118 nmdc:mga0k408_35990_c1 3300050493 Bacteria 2840
1119 nmdc:mga0k408_36941_c1 3300050493 Bacteria 2804
1120 nmdc:mga0k408_54275_c1 3300050493 Bacteria 2323
1121 nmdc:mga0k408_8436_c1 3300050493 Bacteria 5532
1122 nmdc:mga06z11_12223_c1 3300050494 Bacteria 3729
1123 nmdc:mga06z11_3006_c1 3300050494 Bacteria 6485
1124 nmdc:mga06z11_4077_c1 3300050494 Bacteria 5713
1125 nmdc:mga06z11_65126_c1 3300050494 Bacteria 1912
1126 nmdc:mga04h51_21091_c1 3300050495 Bacteria 1956
1127 nmdc:mga04h51_7352_c1 3300050495 Bacteria 2902
1128 nmdc:mga07m45_39437_c1 3300050496 Bacteria 2639
1129 nmdc:mga07m45_66706_c2 3300050496 Bacteria 1756
1130 nmdc:mga05p37_11473_c2 3300050507 Bacteria 9057
1131 nmdc:mga05p37_1986_c1 3300050507 Bacteria 23862
1132 nmdc:mga05p37_199303_c1 3300050507 Bacteria 2426
1133 nmdc:mga05p37_1997_c1 3300050507 Bacteria 23815
1134 nmdc:mga05p37_207268_c1 3300050507 Bacteria 2371
1135 nmdc:mga05p37_21_c1 3300050507 Bacteria 122678
1136 nmdc:mga05p37_24358_c1 3300050507 Bacteria 7355
1137 nmdc:mga05p37_2445_c1 3300050507 Bacteria 21611
1138 nmdc:mga05p37_248566_c1 3300050507 Bacteria 2134
1139 nmdc:mga05p37_2516_c1 3300050507 Bacteria 21303
1140 nmdc:mga05p37_3977_c1 3300050507 Bacteria 17303
1141 nmdc:mga05p37_47044_c1 3300050507 Bacteria 5305
1142 nmdc:mga05p37_492589_c1 3300050507 Bacteria 1409
1143 nmdc:mga05p37_56962_c1 3300050507 Bacteria 4813
1144 nmdc:mga05p37_678423_c1 3300050507 Bacteria 1149
1145 nmdc:mga05p37_76174_c1 3300050507 Bacteria 4130
1146 nmdc:mga05p37_7856_c1 3300050507 Bacteria 12591
1147 nmdc:mga05p37_78875_c1 3300050507 Bacteria 4055
1148 nmdc:mga09592_139323_c1 3300050508 Bacteria 2090
1149 nmdc:mga09592_255414_c1 3300050508 Bacteria 1519
1150 nmdc:mga09592_32171_c1 3300050508 Bacteria 4373
1151 nmdc:mga09592_344226_c1 3300050508 Bacteria 1291
1152 nmdc:mga09592_349478_c1 3300050508 Bacteria 1280
1153 nmdc:mga0qj67_160782_c1 3300050509 Bacteria 1823
1154 nmdc:mga0qj67_403551_c1 3300050509 Bacteria 1103
1155 nmdc:mga0qj67_44257_c1 3300050509 Bacteria 3507
1156 nmdc:mga0qj67_4908_c1 3300050509 Bacteria 9728
1157 nmdc:mga06r32_126168_c1 3300050510 Bacteria 2528
1158 nmdc:mga06r32_21546_c1 3300050510 Bacteria 5950
1159 nmdc:mga06r32_254654_c1 3300050510 Bacteria 1743
1160 nmdc:mga06r32_360691_c1 3300050510 Bacteria 1437
1161 nmdc:mga06r32_562787_c1 3300050510 Bacteria 1113
1162 nmdc:mga06r32_56326_c1 3300050510 Bacteria 3774
1163 nmdc:mga06r32_686776_c1 3300050510 Bacteria 990
1164 nmdc:mga06r32_7703_c1 3300050510 Bacteria 9686
1165 nmdc:mga06r32_79532_c1 3300050510 Bacteria 3189
1166 nmdc:mga06r32_82852_c1 3300050510 Bacteria 3125
1167 nmdc:mga08y16_11940_c1 3300050511 Bacteria 9123
1168 nmdc:mga08y16_119763_c1 3300050511 Bacteria 2740
1169 nmdc:mga08y16_169922_c1 3300050511 Bacteria 2265
1170 nmdc:mga08y16_17155_c1 3300050511 Bacteria 7623
1171 nmdc:mga08y16_20322_c1 3300050511 Bacteria 7010
1172 nmdc:mga08y16_256119_c1 3300050511 Bacteria 1808
1173 nmdc:mga08y16_2569_c1 3300050511 Bacteria 18667
1174 nmdc:mga08y16_26996_c1 3300050511 Bacteria 6051
1175 nmdc:mga08y16_28335_c1 3300050511 Bacteria 5904
1176 nmdc:mga08y16_3154_c1 3300050511 Bacteria 17076
1177 nmdc:mga08y16_316062_c1 3300050511 Bacteria 1608
1178 nmdc:mga08y16_335389_c1 3300050511 Bacteria 1555
1179 nmdc:mga08y16_41792_c1 3300050511 Bacteria 4802
1180 nmdc:mga08y16_444223_c1 3300050511 Bacteria 1323
1181 nmdc:mga08y16_4998_c1 3300050511 Bacteria 13866
1182 nmdc:mga08y16_59749_c1 3300050511 Bacteria 3982
1183 nmdc:mga08y16_614_c1 3300050511 Bacteria 33280
1184 nmdc:mga08y16_83503_c1 3300050511 Bacteria 3329
1185 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
1186 nmdc:mga0n895_141_c1 3300050512 Bacteria 43611
1187 nmdc:mga0n895_153557_c1 3300050512 Bacteria 2333
1188 nmdc:mga0n895_197724_c1 3300050512 Bacteria 2042
1189 nmdc:mga0n895_25107_c1 3300050512 Bacteria 5627
1190 nmdc:mga0n895_285681_c1 3300050512 Bacteria 1673
1191 nmdc:mga0n895_287861_c1 3300050512 Bacteria 1666
1192 nmdc:mga0n895_2881_c1 3300050512 Bacteria 13648
1193 nmdc:mga0n895_296283_c1 3300050512 Bacteria 1640
1194 nmdc:mga0n895_305048_c1 3300050512 Bacteria 1614
1195 nmdc:mga0n895_841578_c1 3300050512 Bacteria 906
1196 nmdc:mga0n895_96237_c1 3300050512 Bacteria 2965
1197 nmdc:mga0rr50_10070_c1 3300050513 Bacteria 5982
1198 nmdc:mga0rr50_12958_c1 3300050513 Bacteria 5408
1199 nmdc:mga0rr50_1401_c1 3300050513 Bacteria 13214
1200 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
1201 nmdc:mga0rr50_360533_c1 3300050513 Bacteria 1223
1202 nmdc:mga0rr50_392322_c1 3300050513 Bacteria 1172
1203 nmdc:mga0rr50_84673_c1 3300050513 Bacteria 2455
1204 nmdc:mga08x19_140516_c1 3300050514 Unclassified 1631
1205 nmdc:mga08x19_153025_c1 3300050514 Bacteria 1563
1206 nmdc:mga08x19_289185_c1 3300050514 Bacteria 1137
1207 nmdc:mga08x19_40819_c1 3300050514 Bacteria 2955
1208 nmdc:mga08x19_92_c1 3300050514 Bacteria 80986
1209 nmdc:mga08x19_96803_c1 3300050514 Bacteria 1954
1210 nmdc:mga0a205_12745_c1 3300050515 Bacteria 7794
1211 nmdc:mga0a205_153035_c2 3300050515 Bacteria 1435
1212 nmdc:mga0a205_19169_c1 3300050515 Bacteria 6447
1213 nmdc:mga0a205_31626_c1 3300050515 Bacteria 5072
1214 nmdc:mga0a205_487952_c1 3300050515 Bacteria 1090
1215 nmdc:mga0a205_53491_c1 3300050515 Bacteria 3897
1216 nmdc:mga0a205_620484_c1 3300050515 Bacteria 934
1217 nmdc:mga0a205_679409_c1 3300050515 Bacteria 880
1218 nmdc:mga0a205_69222_c1 3300050515 Bacteria 1100
1219 nmdc:mga0a205_78897_c1 3300050515 Bacteria 3181
1220 nmdc:mga0a205_84453_c1 3300050515 Bacteria 3067
1221 nmdc:mga0a205_8884_c1 3300050515 Bacteria 9155
1222 Ga0495601_0002903 3300053077 Bacteria 9751
1223 Ga0495601_0029644 3300053077 Bacteria 3395
1224 Ga0495601_0119219 3300053077 Bacteria 1713
1225 Ga0495595_0029864 3300053084 Bacteria 2442
1226 Ga0495619_0003133 3300053085 Bacteria 10726
1227 Ga0495619_0061168 3300053085 Bacteria 2505
1228 Ga0495619_0067328 3300053085 Bacteria 2391
1229 Ga0495619_0144047 3300053085 Bacteria 1642
1230 Ga0495619_0212332 3300053085 Bacteria 1340
1231 Ga0495619_0320373 3300053085 Bacteria 1073
1232 Ga0500556_0036350 3300053104 Bacteria 1708
1233 Ga0500616_0000286 3300053153 Bacteria 74130
1234 Ga0500599_002802 3300053736 Bacteria 2109
1235 Ga0501084_0008020 3300054114 Bacteria 8695
1236 Ga0501084_0013745 3300054114 Bacteria 6700
1237 Ga0501084_0039063 3300054114 Bacteria 3970
1238 Ga0501084_0052098 3300054114 Bacteria 3425
1239 Ga0501084_0144787 3300054114 Bacteria 2001
1240 Ga0501084_0151446 3300054114 Bacteria 1955
1241 Ga0590071_000390 3300059421 Bacteria 12930
1242 Ga0590071_014269 3300059421 Bacteria 1863
1243 Ga0590071_022752 3300059421 Bacteria 1480
1244 Ga0590071_031688 3300059421 Unclassified 1261
1245 Ga0590074_000745 3300059423 Bacteria 4978
1246 Ga0590075_000031 3300059424 Bacteria 37130
1247 Ga0590075_001820 3300059424 Bacteria 5206
1248 Ga0590075_008945 3300059424 Bacteria 2397
1249 Ga0590077_001677 3300059426 Bacteria 5068
1250 Ga0590077_008805 3300059426 Bacteria 2067
1251 Ga0501082_0002846 3300060353 Bacteria 15076
1252 Ga0501082_0026771 3300060353 Bacteria 4970
1253 Ga0501082_0114839 3300060353 Bacteria 2332
1254 Ga0501082_0127913 3300060353 Bacteria 2203
1255 Ga0501082_0163449 3300060353 Bacteria 1934
1256 Ga0501082_0201892 3300060353 Bacteria 1730
1257 Ga0501082_0223038 3300060353 Bacteria 1640
1258 Ga0501082_0275754 3300060353 Bacteria 1464

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025918 Ga0207662_10177484 Ga0207662_101774842 183
2 3300006844 Ga0075428_100594711 Ga0075428_1005947112 193
3 3300053104 Ga0500556_0036350 Ga0500556_0036350_407_1201 194
4 3300005339 Ga0070660_100220060 Ga0070660_1002200601 199
5 3300005547 Ga0070693_100068268 Ga0070693_1000682681 199
6 3300005293 Ga0065715_10369813 Ga0065715_103698131 200
7 3300006177 Ga0075362_10173432 Ga0075362_101734322 204
8 3300049592 Ga0501076_0116504 Ga0501076_0116504_1096_1884 204
9 3300050507 nmdc:mga05p37_76174_c1 nmdc:mga05p37_76174_c1_1989_2777 204
10 3300060353 Ga0501082_0201892 Ga0501082_0201892_824_1612 204
11 3300006847 Ga0075431_100405486 Ga0075431_1004054862 205
12 3300005334 Ga0068869_100409386 Ga0068869_1004093861 207
13 3300005436 Ga0070713_100036514 Ga0070713_1000365144 207
14 3300035170 Ga0373943_0056915 Ga0373943_0056915_574_1365 207
15 3300037068 Ga0373925_0003153 Ga0373925_0003153_7110_7901 207
16 3300005290 Ga0065712_10000281 Ga0065712_100002817 208
17 3300005293 Ga0065715_10122051 Ga0065715_101220512 208
18 3300005329 Ga0070683_100000638 Ga0070683_10000063811 208
19 3300005331 Ga0070670_100031992 Ga0070670_1000319924 208
20 3300005335 Ga0070666_10012736 Ga0070666_100127364 208
21 3300005354 Ga0070675_100153302 Ga0070675_1001533022 208
22 3300005355 Ga0070671_100023862 Ga0070671_1000238622 208
23 3300005364 Ga0070673_100103698 Ga0070673_1001036982 208
24 3300005455 Ga0070663_100084342 Ga0070663_1000843423 208
25 3300005456 Ga0070678_100161468 Ga0070678_1001614682 208
26 3300005457 Ga0070662_100356310 Ga0070662_1003563102 208
27 3300005535 Ga0070684_100000247 Ga0070684_10000024713 208
28 3300005548 Ga0070665_100486755 Ga0070665_1004867551 208
29 3300005564 Ga0070664_100007347 Ga0070664_1000073472 208
30 3300013296 Ga0157374_10223564 Ga0157374_102235643 208
31 3300025315 Ga0207697_10169146 Ga0207697_101691462 208
32 3300025903 Ga0207680_10204680 Ga0207680_102046802 208
33 3300025920 Ga0207649_10026590 Ga0207649_100265904 208
34 3300025925 Ga0207650_10051134 Ga0207650_100511343 208
35 3300025926 Ga0207659_10056267 Ga0207659_100562672 208
36 3300025933 Ga0207706_10127583 Ga0207706_101275832 208
37 3300025944 Ga0207661_10000962 Ga0207661_1000096210 208
38 3300025945 Ga0207679_10007075 Ga0207679_100070757 208
39 3300026067 Ga0207678_10083819 Ga0207678_100838192 208
40 3300026121 Ga0207683_10230017 Ga0207683_102300172 208
41 3300028379 Ga0268266_10353625 Ga0268266_103536252 208
42 3300048907 Ga0496104_0011819 Ga0496104_0011819_1007_1801 208
43 3300048911 Ga0496108_0000976 Ga0496108_0000976_10753_11547 208
44 3300048912 Ga0496109_0001292 Ga0496109_0001292_14294_15088 208
45 3300048913 Ga0496110_0001114 Ga0496110_0001114_8012_8806 208
46 3300048914 Ga0496111_0001821 Ga0496111_0001821_11362_12156 208
47 3300048915 Ga0496112_0000279 Ga0496112_0000279_24960_25754 208
48 3300005518 Ga0070699_100232564 Ga0070699_1002325642 210
49 3300005544 Ga0070686_100000153 Ga0070686_10000015311 210
50 3300005547 Ga0070693_100371405 Ga0070693_1003714051 210
51 3300025981 Ga0207640_10194519 Ga0207640_101945192 210
52 3300025972 Ga0207668_10298445 Ga0207668_102984452 211
53 3300005335 Ga0070666_10068736 Ga0070666_100687363 213
54 3300005457 Ga0070662_100207947 Ga0070662_1002079472 213
55 3300006844 Ga0075428_100283003 Ga0075428_1002830032 213
56 3300006846 Ga0075430_100514160 Ga0075430_1005141602 213
57 3300006880 Ga0075429_100006315 Ga0075429_1000063156 213
58 3300007076 Ga0075435_100001088 Ga0075435_10000108814 213
59 3300009147 Ga0114129_10002490 Ga0114129_1000249017 213
60 3300009177 Ga0105248_10162796 Ga0105248_101627962 213
61 3300013104 Ga0157370_10383865 Ga0157370_103838652 213
62 3300025903 Ga0207680_10179057 Ga0207680_101790572 213
63 3300034817 Ga0373948_0025652 Ga0373948_0025652_173_964 213
64 3300034957 Ga0373938_0000489 Ga0373938_0000489_3005_3796 213
65 3300035085 Ga0373929_0000898 Ga0373929_0000898_3170_3961 213
66 3300035090 Ga0373949_0001032 Ga0373949_0001032_2733_3524 213
67 3300035091 Ga0373951_0007844 Ga0373951_0007844_1346_2137 213
68 3300035092 Ga0373952_0005074 Ga0373952_0005074_1207_1998 213
69 3300035112 Ga0373932_0009900 Ga0373932_0009900_1377_2168 213
70 3300035114 Ga0373939_0002375 Ga0373939_0002375_3164_3955 213
71 3300035241 Ga0373961_0004391 Ga0373961_0004391_758_1549 213
72 3300035242 Ga0373962_0005233 Ga0373962_0005233_506_1297 213
73 3300045051 Ga0451576_0118553 Ga0451576_0118553_421_1212 213
74 3300049589 Ga0501073_0108890 Ga0501073_0108890_943_1710 213
75 3300050507 nmdc:mga05p37_1986_c1 nmdc:mga05p37_1986_c1_15013_15792 213
76 3300050510 nmdc:mga06r32_254654_c1 nmdc:mga06r32_254654_c1_176_970 213
77 3300050513 nmdc:mga0rr50_1401_c1 nmdc:mga0rr50_1401_c1_11693_12484 213
78 3300035725 Ga0373947_0043610 Ga0373947_0043610_806_1594 214
79 3300059421 Ga0590071_014269 Ga0590071_014269_1058_1849 214
80 3300059424 Ga0590075_008945 Ga0590075_008945_15_806 214
81 3300005330 Ga0070690_100012018 Ga0070690_1000120184 216
82 3300005343 Ga0070687_100020732 Ga0070687_1000207323 216
83 3300005843 Ga0068860_100451690 Ga0068860_1004516902 216
84 3300048910 Ga0496107_0391259 Ga0496107_0391259_48_839 216
85 3300053085 Ga0495619_0320373 Ga0495619_0320373_108_896 216
86 3300049571 Ga0501034_0061179 Ga0501034_0061179_1933_2721 217
87 3300005356 Ga0070674_100299694 Ga0070674_1002996942 218
88 3300025893 Ga0207682_10016962 Ga0207682_100169622 219
89 3300031240 Ga0265320_10045892 Ga0265320_100458922 219
90 3300005937 Ga0081455_10150963 Ga0081455_101509632 220
91 3300006048 Ga0075363_100111344 Ga0075363_1001113442 220
92 3300006051 Ga0075364_10039634 Ga0075364_100396344 220
93 3300006051 Ga0075364_10207617 Ga0075364_102076172 220
94 3300006163 Ga0070715_10019060 Ga0070715_100190602 220
95 3300006237 Ga0097621_100029672 Ga0097621_1000296723 220
96 3300006358 Ga0068871_100004547 Ga0068871_1000045476 220
97 3300006847 Ga0075431_100150164 Ga0075431_1001501642 220
98 3300009176 Ga0105242_10143596 Ga0105242_101435962 220
99 3300025926 Ga0207659_10345297 Ga0207659_103452972 220
100 3300035118 Ga0373954_0113162 Ga0373954_0113162_273_1067 220
101 3300035691 Ga0373931_0083899 Ga0373931_0083899_298_1098 220
102 3300046642 Ga0495634_0189134 Ga0495634_0189134_81_875 220
103 3300046683 Ga0495658_0095474 Ga0495658_0095474_266_1060 220
104 3300048903 Ga0496100_0001496 Ga0496100_0001496_4597_5391 220
105 3300048904 Ga0496101_0000830 Ga0496101_0000830_5369_6163 220
106 3300048905 Ga0496102_0055442 Ga0496102_0055442_1613_2407 220
107 3300048907 Ga0496104_0016154 Ga0496104_0016154_5780_6574 220
108 3300048908 Ga0496105_0030341 Ga0496105_0030341_1534_2328 220
109 3300048909 Ga0496106_0079657 Ga0496106_0079657_1182_1976 220
110 3300048917 Ga0496114_0001212 Ga0496114_0001212_8135_8929 220
111 3300050490 nmdc:mga03n38_186690_c1 nmdc:mga03n38_186690_c1_95_925 220
112 3300050491 nmdc:mga00v17_62372_c1 nmdc:mga00v17_62372_c1_1156_1956 220
113 3300053085 Ga0495619_0144047 Ga0495619_0144047_302_1096 220
114 3300005365 Ga0070688_100028461 Ga0070688_1000284612 221
115 3300005549 Ga0070704_100079376 Ga0070704_1000793763 221
116 3300005840 Ga0068870_10321456 Ga0068870_103214562 221
117 3300005842 Ga0068858_100155306 Ga0068858_1001553062 221
118 3300005844 Ga0068862_100815864 Ga0068862_1008158641 221
119 3300006844 Ga0075428_100003117 Ga0075428_10000311714 221
120 3300006844 Ga0075428_100006263 Ga0075428_10000626312 221
121 3300006844 Ga0075428_100217307 Ga0075428_1002173073 221
122 3300006847 Ga0075431_100019172 Ga0075431_1000191723 221
123 3300006852 Ga0075433_10009466 Ga0075433_100094666 221
124 3300006871 Ga0075434_100007256 Ga0075434_1000072565 221
125 3300009094 Ga0111539_10185541 Ga0111539_101855411 221
126 3300009147 Ga0114129_10058163 Ga0114129_100581633 221
127 3300025908 Ga0207643_10309537 Ga0207643_103095371 221
128 3300025945 Ga0207679_10144034 Ga0207679_101440343 221
129 3300025960 Ga0207651_10491363 Ga0207651_104913632 221
130 3300026035 Ga0207703_10255558 Ga0207703_102555582 221
131 3300028380 Ga0268265_10088356 Ga0268265_100883563 221
132 3300031727 Ga0316576_10032559 Ga0316576_100325594 221
133 3300050507 nmdc:mga05p37_78875_c1 nmdc:mga05p37_78875_c1_1410_2192 221
134 3300050508 nmdc:mga09592_344226_c1 nmdc:mga09592_344226_c1_176_958 221
135 3300050510 nmdc:mga06r32_562787_c1 nmdc:mga06r32_562787_c1_77_859 221
136 3300050512 nmdc:mga0n895_285681_c1 nmdc:mga0n895_285681_c1_156_938 221
137 3300050513 nmdc:mga0rr50_392322_c1 nmdc:mga0rr50_392322_c1_336_1118 221
138 3300050515 nmdc:mga0a205_19169_c1 nmdc:mga0a205_19169_c1_5327_6109 221
139 3300005440 Ga0070705_100054979 Ga0070705_1000549792 222
140 3300005444 Ga0070694_100073290 Ga0070694_1000732902 222
141 3300005467 Ga0070706_100009582 Ga0070706_1000095827 222
142 3300005467 Ga0070706_100409113 Ga0070706_1004091132 222
143 3300005471 Ga0070698_100035909 Ga0070698_1000359094 222
144 3300005545 Ga0070695_100008345 Ga0070695_1000083455 222
145 3300005545 Ga0070695_100143162 Ga0070695_1001431623 222
146 3300005546 Ga0070696_100067331 Ga0070696_1000673312 222
147 3300006195 Ga0075366_10156105 Ga0075366_101561052 222
148 3300009093 Ga0105240_10192050 Ga0105240_101920505 222
149 3300025910 Ga0207684_10030634 Ga0207684_100306344 222
150 3300025910 Ga0207684_10354555 Ga0207684_103545551 222
151 3300049592 Ga0501076_0061179 Ga0501076_0061179_1064_1870 222
152 3300050511 nmdc:mga08y16_256119_c1 nmdc:mga08y16_256119_c1_130_915 222
153 3300005336 Ga0070680_100256474 Ga0070680_1002564742 223
154 3300005444 Ga0070694_100113025 Ga0070694_1001130251 223
155 3300005549 Ga0070704_100092322 Ga0070704_1000923223 223
156 3300005549 Ga0070704_100172805 Ga0070704_1001728052 223
157 3300005577 Ga0068857_100279658 Ga0068857_1002796582 223
158 3300005719 Ga0068861_100056244 Ga0068861_1000562443 223
159 3300005843 Ga0068860_100661073 Ga0068860_1006610732 223
160 3300005844 Ga0068862_100023616 Ga0068862_1000236164 223
161 3300006844 Ga0075428_100137393 Ga0075428_1001373932 223
162 3300006880 Ga0075429_100230084 Ga0075429_1002300842 223
163 3300009094 Ga0111539_10098867 Ga0111539_100988672 223
164 3300009147 Ga0114129_10261589 Ga0114129_102615893 223
165 3300014326 Ga0157380_10021379 Ga0157380_100213792 223
166 3300025885 Ga0207653_10088597 Ga0207653_100885972 223
167 3300026089 Ga0207648_10413548 Ga0207648_104135481 223
168 3300026116 Ga0207674_10329280 Ga0207674_103292802 223
169 3300027907 Ga0207428_10155376 Ga0207428_101553762 223
170 3300028380 Ga0268265_10231485 Ga0268265_102314852 223
171 3300049572 Ga0501036_0167093 Ga0501036_0167093_973_1818 223
172 3300050507 nmdc:mga05p37_207268_c1 nmdc:mga05p37_207268_c1_1042_1830 223
173 3300050510 nmdc:mga06r32_126168_c1 nmdc:mga06r32_126168_c1_431_1219 223
174 3300050511 nmdc:mga08y16_2569_c1 nmdc:mga08y16_2569_c1_13318_14106 223
175 3300050515 nmdc:mga0a205_153035_c2 nmdc:mga0a205_153035_c2_619_1407 223
176 3300009147 Ga0114129_10076822 Ga0114129_100768222 224
177 3300037471 Ga0395905_0436434 Ga0395905_0436434_26_817 224
178 3300049824 Ga0501045_0175736 Ga0501045_0175736_336_1136 224
179 3300005293 Ga0065715_10166266 Ga0065715_101662662 225
180 3300005295 Ga0065707_10208912 Ga0065707_102089122 225
181 3300005438 Ga0070701_10435536 Ga0070701_104355361 225
182 3300005471 Ga0070698_100174756 Ga0070698_1001747561 225
183 3300005844 Ga0068862_100489248 Ga0068862_1004892482 225
184 3300006358 Ga0068871_100227154 Ga0068871_1002271542 225
185 3300006844 Ga0075428_100000497 Ga0075428_10000049717 225
186 3300006847 Ga0075431_100169999 Ga0075431_1001699992 225
187 3300006880 Ga0075429_100678081 Ga0075429_1006780811 225
188 3300009094 Ga0111539_10000014 Ga0111539_10000014136 225
189 3300009094 Ga0111539_10102668 Ga0111539_101026684 225
190 3300009147 Ga0114129_10031829 Ga0114129_100318292 225
191 3300013297 Ga0157378_10106605 Ga0157378_101066053 225
192 3300025914 Ga0207671_10335159 Ga0207671_103351592 225
193 3300025940 Ga0207691_10174138 Ga0207691_101741382 225
194 3300027907 Ga0207428_10000005 Ga0207428_10000005110 225
195 3300027907 Ga0207428_10052174 Ga0207428_100521741 225
196 3300031824 Ga0307413_10180278 Ga0307413_101802782 225
197 3300032002 Ga0307416_100420988 Ga0307416_1004209882 225
198 3300046539 Ga0495621_0020651 Ga0495621_0020651_1139_1933 225
199 3300049571 Ga0501034_0023972 Ga0501034_0023972_4091_4888 225
200 3300049571 Ga0501034_0117012 Ga0501034_0117012_1559_2356 225
201 3300050507 nmdc:mga05p37_56962_c1 nmdc:mga05p37_56962_c1_1236_2009 225
202 3300050508 nmdc:mga09592_139323_c1 nmdc:mga09592_139323_c1_1265_2074 225
203 3300050509 nmdc:mga0qj67_44257_c1 nmdc:mga0qj67_44257_c1_1908_2717 225
204 3300050511 nmdc:mga08y16_26996_c1 nmdc:mga08y16_26996_c1_194_988 225
205 3300050511 nmdc:mga08y16_9_c1 nmdc:mga08y16_9_c1_425812_426621 225
206 3300050515 nmdc:mga0a205_84453_c1 nmdc:mga0a205_84453_c1_2250_3023 225
207 3300005293 Ga0065715_10000713 Ga0065715_100007134 226
208 3300005347 Ga0070668_100087313 Ga0070668_1000873132 226
209 3300005438 Ga0070701_10059804 Ga0070701_100598043 226
210 3300005444 Ga0070694_100067544 Ga0070694_1000675442 226
211 3300005457 Ga0070662_100151492 Ga0070662_1001514923 226
212 3300005467 Ga0070706_100243253 Ga0070706_1002432531 226
213 3300005545 Ga0070695_100188205 Ga0070695_1001882052 226
214 3300005549 Ga0070704_100006982 Ga0070704_1000069825 226
215 3300005719 Ga0068861_100089592 Ga0068861_1000895923 226
216 3300005843 Ga0068860_100332788 Ga0068860_1003327882 226
217 3300005844 Ga0068862_100043959 Ga0068862_1000439593 226
218 3300006847 Ga0075431_100037347 Ga0075431_1000373475 226
219 3300006871 Ga0075434_100001202 Ga0075434_10000120218 226
220 3300006914 Ga0075436_100008391 Ga0075436_1000083914 226
221 3300007076 Ga0075435_100000204 Ga0075435_10000020421 226
222 3300009094 Ga0111539_10904485 Ga0111539_109044852 226
223 3300009101 Ga0105247_10028671 Ga0105247_100286712 226
224 3300014325 Ga0163163_10085069 Ga0163163_100850692 226
225 3300014326 Ga0157380_10457115 Ga0157380_104571152 226
226 3300014968 Ga0157379_10002568 Ga0157379_1000256813 226
227 3300025900 Ga0207710_10016662 Ga0207710_100166623 226
228 3300025906 Ga0207699_10076147 Ga0207699_100761472 226
229 3300025910 Ga0207684_10262237 Ga0207684_102622372 226
230 3300025933 Ga0207706_10048053 Ga0207706_100480534 226
231 3300026075 Ga0207708_10143398 Ga0207708_101433982 226
232 3300026118 Ga0207675_100083523 Ga0207675_1000835232 226
233 3300026118 Ga0207675_100789129 Ga0207675_1007891291 226
234 3300027665 Ga0209983_1012400 Ga0209983_10124002 226
235 3300031548 Ga0307408_100045626 Ga0307408_1000456262 226
236 3300031711 Ga0265314_10145586 Ga0265314_101455862 226
237 3300031995 Ga0307409_100715394 Ga0307409_1007153942 226
238 3300032002 Ga0307416_100016217 Ga0307416_1000162174 226
239 3300042436 Ga0439435_0004236 Ga0439435_0004236_203_994 226
240 3300049574 Ga0501038_0422877 Ga0501038_0422877_92_883 226
241 3300049577 Ga0501041_0171645 Ga0501041_0171645_303_1100 226
242 3300049577 Ga0501041_0200061 Ga0501041_0200061_188_979 226
243 3300049578 Ga0501042_0138095 Ga0501042_0138095_263_1054 226
244 3300049580 Ga0501046_0127601 Ga0501046_0127601_675_1472 226
245 3300049582 Ga0501048_0141400 Ga0501048_0141400_480_1271 226
246 3300049587 Ga0501071_0355309 Ga0501071_0355309_138_929 226
247 3300049592 Ga0501076_0066885 Ga0501076_0066885_1143_1934 226
248 3300049741 Ga0501079_0044720 Ga0501079_0044720_1104_1901 226
249 3300049742 Ga0501080_0079581 Ga0501080_0079581_1440_2237 226
250 3300049743 Ga0501081_0075016 Ga0501081_0075016_264_1061 226
251 3300049743 Ga0501081_0235273 Ga0501081_0235273_101_892 226
252 3300049822 Ga0501035_0183138 Ga0501035_0183138_652_1443 226
253 3300049824 Ga0501045_0072142 Ga0501045_0072142_331_1122 226
254 3300050510 nmdc:mga06r32_79532_c1 nmdc:mga06r32_79532_c1_1963_2751 226
255 3300050512 nmdc:mga0n895_141_c1 nmdc:mga0n895_141_c1_14040_14831 226
256 3300050513 nmdc:mga0rr50_1_c1 nmdc:mga0rr50_1_c1_543889_544680 226
257 3300050514 nmdc:mga08x19_289185_c1 nmdc:mga08x19_289185_c1_271_1062 226
258 3300050514 nmdc:mga08x19_92_c1 nmdc:mga08x19_92_c1_66990_67781 226
259 3300060353 Ga0501082_0026771 Ga0501082_0026771_1680_2477 226
260 3300060353 Ga0501082_0114839 Ga0501082_0114839_705_1496 226
261 3300002239 JGI24034J26672_10012924 JGI24034J26672_100129241 227
262 3300003323 rootH1_10386755 rootH1_103867552 227
263 3300005288 Ga0065714_10112503 Ga0065714_101125033 227
264 3300005289 Ga0065704_10113837 Ga0065704_101138372 227
265 3300005290 Ga0065712_10000338 Ga0065712_100003385 227
266 3300005290 Ga0065712_10007252 Ga0065712_100072524 227
267 3300005290 Ga0065712_10027610 Ga0065712_100276101 227
268 3300005290 Ga0065712_10074095 Ga0065712_100740952 227
269 3300005290 Ga0065712_10079334 Ga0065712_100793344 227
270 3300005290 Ga0065712_10146177 Ga0065712_101461772 227
271 3300005290 Ga0065712_10190043 Ga0065712_101900432 227
272 3300005293 Ga0065715_10003913 Ga0065715_100039135 227
273 3300005293 Ga0065715_10017317 Ga0065715_100173172 227
274 3300005293 Ga0065715_10115391 Ga0065715_101153913 227
275 3300005293 Ga0065715_10119676 Ga0065715_101196761 227
276 3300005293 Ga0065715_10130677 Ga0065715_101306772 227
277 3300005293 Ga0065715_10133885 Ga0065715_101338852 227
278 3300005293 Ga0065715_10194178 Ga0065715_101941782 227
279 3300005293 Ga0065715_10203018 Ga0065715_102030181 227
280 3300005293 Ga0065715_10277364 Ga0065715_102773641 227
281 3300005295 Ga0065707_10001316 Ga0065707_1000131611 227
282 3300005295 Ga0065707_10004595 Ga0065707_100045954 227
283 3300005295 Ga0065707_10084894 Ga0065707_100848943 227
284 3300005328 Ga0070676_10009864 Ga0070676_100098644 227
285 3300005329 Ga0070683_100027744 Ga0070683_1000277444 227
286 3300005331 Ga0070670_100003219 Ga0070670_1000032197 227
287 3300005331 Ga0070670_100130336 Ga0070670_1001303362 227
288 3300005331 Ga0070670_100311194 Ga0070670_1003111942 227
289 3300005334 Ga0068869_100142194 Ga0068869_1001421943 227
290 3300005334 Ga0068869_100198993 Ga0068869_1001989931 227
291 3300005336 Ga0070680_100049717 Ga0070680_1000497172 227
292 3300005336 Ga0070680_100207133 Ga0070680_1002071332 227
293 3300005338 Ga0068868_100073308 Ga0068868_1000733082 227
294 3300005338 Ga0068868_100082975 Ga0068868_1000829754 227
295 3300005338 Ga0068868_100205000 Ga0068868_1002050002 227
296 3300005339 Ga0070660_100061024 Ga0070660_1000610242 227
297 3300005341 Ga0070691_10000425 Ga0070691_1000042510 227
298 3300005343 Ga0070687_100038243 Ga0070687_1000382432 227
299 3300005343 Ga0070687_100265220 Ga0070687_1002652202 227
300 3300005344 Ga0070661_100204898 Ga0070661_1002048982 227
301 3300005345 Ga0070692_10140060 Ga0070692_101400602 227
302 3300005347 Ga0070668_100020029 Ga0070668_1000200294 227
303 3300005347 Ga0070668_100092920 Ga0070668_1000929201 227
304 3300005353 Ga0070669_100012308 Ga0070669_1000123085 227
305 3300005353 Ga0070669_100031389 Ga0070669_1000313893 227
306 3300005353 Ga0070669_100035365 Ga0070669_1000353653 227
307 3300005353 Ga0070669_100054145 Ga0070669_1000541452 227
308 3300005353 Ga0070669_100066391 Ga0070669_1000663913 227
309 3300005353 Ga0070669_100111672 Ga0070669_1001116722 227
310 3300005353 Ga0070669_100282274 Ga0070669_1002822742 227
311 3300005354 Ga0070675_100000433 Ga0070675_1000004333 227
312 3300005354 Ga0070675_100013560 Ga0070675_1000135603 227
313 3300005354 Ga0070675_100076205 Ga0070675_1000762052 227
314 3300005354 Ga0070675_100213132 Ga0070675_1002131322 227
315 3300005354 Ga0070675_100237759 Ga0070675_1002377592 227
316 3300005354 Ga0070675_100424300 Ga0070675_1004243002 227
317 3300005355 Ga0070671_100132674 Ga0070671_1001326742 227
318 3300005355 Ga0070671_100153385 Ga0070671_1001533853 227
319 3300005356 Ga0070674_100006653 Ga0070674_1000066538 227
320 3300005356 Ga0070674_100015693 Ga0070674_1000156934 227
321 3300005356 Ga0070674_100046578 Ga0070674_1000465783 227
322 3300005356 Ga0070674_100050368 Ga0070674_1000503682 227
323 3300005356 Ga0070674_100136656 Ga0070674_1001366562 227
324 3300005364 Ga0070673_100043665 Ga0070673_1000436653 227
325 3300005364 Ga0070673_100199696 Ga0070673_1001996963 227
326 3300005364 Ga0070673_100269804 Ga0070673_1002698042 227
327 3300005364 Ga0070673_100333156 Ga0070673_1003331562 227
328 3300005365 Ga0070688_100197684 Ga0070688_1001976842 227
329 3300005367 Ga0070667_100148419 Ga0070667_1001484193 227
330 3300005367 Ga0070667_100313348 Ga0070667_1003133481 227
331 3300005367 Ga0070667_100444870 Ga0070667_1004448701 227
332 3300005367 Ga0070667_100447016 Ga0070667_1004470162 227
333 3300005435 Ga0070714_100003070 Ga0070714_1000030707 227
334 3300005436 Ga0070713_100107478 Ga0070713_1001074782 227
335 3300005440 Ga0070705_100001404 Ga0070705_1000014045 227
336 3300005440 Ga0070705_100178065 Ga0070705_1001780651 227
337 3300005440 Ga0070705_100230195 Ga0070705_1002301951 227
338 3300005441 Ga0070700_100000788 Ga0070700_1000007883 227
339 3300005441 Ga0070700_100005290 Ga0070700_1000052904 227
340 3300005441 Ga0070700_100038754 Ga0070700_1000387542 227
341 3300005444 Ga0070694_100010045 Ga0070694_1000100454 227
342 3300005445 Ga0070708_100485294 Ga0070708_1004852942 227
343 3300005455 Ga0070663_100067506 Ga0070663_1000675063 227
344 3300005456 Ga0070678_100232500 Ga0070678_1002325002 227
345 3300005457 Ga0070662_100035211 Ga0070662_1000352114 227
346 3300005457 Ga0070662_100238789 Ga0070662_1002387892 227
347 3300005459 Ga0068867_100193137 Ga0068867_1001931373 227
348 3300005459 Ga0068867_100484532 Ga0068867_1004845321 227
349 3300005459 Ga0068867_100648856 Ga0068867_1006488561 227
350 3300005466 Ga0070685_10006374 Ga0070685_100063743 227
351 3300005468 Ga0070707_100434000 Ga0070707_1004340001 227
352 3300005518 Ga0070699_100013629 Ga0070699_1000136295 227
353 3300005518 Ga0070699_100271224 Ga0070699_1002712242 227
354 3300005530 Ga0070679_100068341 Ga0070679_1000683413 227
355 3300005535 Ga0070684_100412520 Ga0070684_1004125202 227
356 3300005536 Ga0070697_100123535 Ga0070697_1001235352 227
357 3300005536 Ga0070697_100187344 Ga0070697_1001873442 227
358 3300005539 Ga0068853_100635620 Ga0068853_1006356201 227
359 3300005543 Ga0070672_100106879 Ga0070672_1001068792 227
360 3300005543 Ga0070672_100150694 Ga0070672_1001506942 227
361 3300005543 Ga0070672_100203789 Ga0070672_1002037892 227
362 3300005543 Ga0070672_100235891 Ga0070672_1002358912 227
363 3300005544 Ga0070686_100232929 Ga0070686_1002329292 227
364 3300005544 Ga0070686_100261895 Ga0070686_1002618952 227
365 3300005544 Ga0070686_100448011 Ga0070686_1004480111 227
366 3300005544 Ga0070686_100480085 Ga0070686_1004800851 227
367 3300005545 Ga0070695_100032985 Ga0070695_1000329852 227
368 3300005545 Ga0070695_100072744 Ga0070695_1000727442 227
369 3300005545 Ga0070695_100074093 Ga0070695_1000740932 227
370 3300005545 Ga0070695_100174239 Ga0070695_1001742392 227
371 3300005546 Ga0070696_100008086 Ga0070696_1000080864 227
372 3300005546 Ga0070696_100148659 Ga0070696_1001486591 227
373 3300005548 Ga0070665_100008640 Ga0070665_1000086406 227
374 3300005548 Ga0070665_100021963 Ga0070665_1000219636 227
375 3300005548 Ga0070665_100045540 Ga0070665_1000455403 227
376 3300005548 Ga0070665_100086416 Ga0070665_1000864161 227
377 3300005548 Ga0070665_100888329 Ga0070665_1008883291 227
378 3300005549 Ga0070704_100035377 Ga0070704_1000353774 227
379 3300005549 Ga0070704_100293927 Ga0070704_1002939272 227
380 3300005549 Ga0070704_100396194 Ga0070704_1003961942 227
381 3300005549 Ga0070704_100633108 Ga0070704_1006331081 227
382 3300005563 Ga0068855_100092401 Ga0068855_1000924012 227
383 3300005577 Ga0068857_100000620 Ga0068857_1000006204 227
384 3300005578 Ga0068854_100008015 Ga0068854_1000080154 227
385 3300005614 Ga0068856_100063822 Ga0068856_1000638222 227
386 3300005615 Ga0070702_100004567 Ga0070702_1000045672 227
387 3300005615 Ga0070702_100021674 Ga0070702_1000216743 227
388 3300005615 Ga0070702_100145749 Ga0070702_1001457492 227
389 3300005616 Ga0068852_100205884 Ga0068852_1002058842 227
390 3300005617 Ga0068859_100118080 Ga0068859_1001180803 227
391 3300005617 Ga0068859_100271189 Ga0068859_1002711891 227
392 3300005617 Ga0068859_100277741 Ga0068859_1002777411 227
393 3300005617 Ga0068859_100306382 Ga0068859_1003063822 227
394 3300005617 Ga0068859_100453888 Ga0068859_1004538882 227
395 3300005617 Ga0068859_101184016 Ga0068859_1011840161 227
396 3300005618 Ga0068864_100007960 Ga0068864_1000079607 227
397 3300005618 Ga0068864_100013387 Ga0068864_1000133874 227
398 3300005618 Ga0068864_100164354 Ga0068864_1001643542 227
399 3300005718 Ga0068866_10025986 Ga0068866_100259863 227
400 3300005719 Ga0068861_100243873 Ga0068861_1002438732 227
401 3300005719 Ga0068861_100264318 Ga0068861_1002643181 227
402 3300005840 Ga0068870_10178904 Ga0068870_101789042 227
403 3300005841 Ga0068863_100003004 Ga0068863_10000300415 227
404 3300005841 Ga0068863_100008453 Ga0068863_1000084537 227
405 3300005841 Ga0068863_100036782 Ga0068863_1000367821 227
406 3300005841 Ga0068863_100061146 Ga0068863_1000611462 227
407 3300005842 Ga0068858_100020774 Ga0068858_1000207744 227
408 3300005842 Ga0068858_100047760 Ga0068858_1000477604 227
409 3300005842 Ga0068858_100078637 Ga0068858_1000786372 227
410 3300005842 Ga0068858_100114217 Ga0068858_1001142172 227
411 3300005842 Ga0068858_100115350 Ga0068858_1001153502 227
412 3300005842 Ga0068858_100184834 Ga0068858_1001848343 227
413 3300005842 Ga0068858_100589902 Ga0068858_1005899022 227
414 3300005843 Ga0068860_100126978 Ga0068860_1001269782 227
415 3300005843 Ga0068860_100167760 Ga0068860_1001677603 227
416 3300005843 Ga0068860_100283082 Ga0068860_1002830822 227
417 3300005843 Ga0068860_100352177 Ga0068860_1003521772 227
418 3300005843 Ga0068860_100390499 Ga0068860_1003904992 227
419 3300005843 Ga0068860_100522704 Ga0068860_1005227042 227
420 3300005844 Ga0068862_100003536 Ga0068862_10000353611 227
421 3300005844 Ga0068862_100010510 Ga0068862_1000105104 227
422 3300005844 Ga0068862_100030779 Ga0068862_1000307795 227
423 3300005844 Ga0068862_100043918 Ga0068862_1000439183 227
424 3300005844 Ga0068862_100055505 Ga0068862_1000555052 227
425 3300005844 Ga0068862_100148446 Ga0068862_1001484463 227
426 3300005937 Ga0081455_10246321 Ga0081455_102463212 227
427 3300005985 Ga0081539_10002012 Ga0081539_1000201218 227
428 3300006038 Ga0075365_10182173 Ga0075365_101821732 227
429 3300006048 Ga0075363_100048986 Ga0075363_1000489862 227
430 3300006051 Ga0075364_10004634 Ga0075364_100046346 227
431 3300006051 Ga0075364_10038175 Ga0075364_100381754 227
432 3300006051 Ga0075364_10258665 Ga0075364_102586652 227
433 3300006178 Ga0075367_10011763 Ga0075367_100117634 227
434 3300006178 Ga0075367_10178504 Ga0075367_101785042 227
435 3300006195 Ga0075366_10013017 Ga0075366_100130175 227
436 3300006195 Ga0075366_10022649 Ga0075366_100226494 227
437 3300006237 Ga0097621_100026539 Ga0097621_1000265393 227
438 3300006237 Ga0097621_100062060 Ga0097621_1000620602 227
439 3300006237 Ga0097621_100072124 Ga0097621_1000721243 227
440 3300006237 Ga0097621_100119238 Ga0097621_1001192383 227
441 3300006237 Ga0097621_100225496 Ga0097621_1002254961 227
442 3300006237 Ga0097621_100485043 Ga0097621_1004850432 227
443 3300006353 Ga0075370_10011509 Ga0075370_100115095 227
444 3300006358 Ga0068871_100026101 Ga0068871_1000261013 227
445 3300006358 Ga0068871_100058115 Ga0068871_1000581153 227
446 3300006358 Ga0068871_100082538 Ga0068871_1000825383 227
447 3300006358 Ga0068871_100246275 Ga0068871_1002462753 227
448 3300006358 Ga0068871_100388015 Ga0068871_1003880153 227
449 3300006844 Ga0075428_100017486 Ga0075428_1000174867 227
450 3300006844 Ga0075428_100551365 Ga0075428_1005513652 227
451 3300006846 Ga0075430_100007706 Ga0075430_1000077066 227
452 3300006847 Ga0075431_100001219 Ga0075431_10000121914 227
453 3300006847 Ga0075431_100063779 Ga0075431_1000637793 227
454 3300006847 Ga0075431_100640812 Ga0075431_1006408122 227
455 3300006852 Ga0075433_10017226 Ga0075433_100172262 227
456 3300006852 Ga0075433_10048453 Ga0075433_100484533 227
457 3300006852 Ga0075433_10085553 Ga0075433_100855532 227
458 3300006852 Ga0075433_10441294 Ga0075433_104412942 227
459 3300006852 Ga0075433_10443053 Ga0075433_104430532 227
460 3300006871 Ga0075434_100005743 Ga0075434_1000057439 227
461 3300006871 Ga0075434_100011171 Ga0075434_1000111716 227
462 3300006871 Ga0075434_100022294 Ga0075434_1000222942 227
463 3300006871 Ga0075434_100253564 Ga0075434_1002535641 227
464 3300006871 Ga0075434_100281293 Ga0075434_1002812932 227
465 3300006871 Ga0075434_100298717 Ga0075434_1002987172 227
466 3300006871 Ga0075434_100334989 Ga0075434_1003349892 227
467 3300006871 Ga0075434_100338747 Ga0075434_1003387472 227
468 3300006871 Ga0075434_100948707 Ga0075434_1009487071 227
469 3300006880 Ga0075429_100147434 Ga0075429_1001474342 227
470 3300006880 Ga0075429_100302614 Ga0075429_1003026142 227
471 3300006880 Ga0075429_100320962 Ga0075429_1003209622 227
472 3300006881 Ga0068865_100020188 Ga0068865_1000201885 227
473 3300006914 Ga0075436_100012571 Ga0075436_1000125713 227
474 3300006914 Ga0075436_100035274 Ga0075436_1000352741 227
475 3300006914 Ga0075436_100259270 Ga0075436_1002592702 227
476 3300006931 Ga0097620_100118068 Ga0097620_1001180682 227
477 3300006931 Ga0097620_100271200 Ga0097620_1002712001 227
478 3300006931 Ga0097620_100277750 Ga0097620_1002777501 227
479 3300006931 Ga0097620_100306358 Ga0097620_1003063582 227
480 3300006931 Ga0097620_100453863 Ga0097620_1004538632 227
481 3300006931 Ga0097620_101184035 Ga0097620_1011840351 227
482 3300007076 Ga0075435_100006762 Ga0075435_1000067624 227
483 3300007076 Ga0075435_100017729 Ga0075435_1000177293 227
484 3300007076 Ga0075435_100091589 Ga0075435_1000915892 227
485 3300007076 Ga0075435_100186497 Ga0075435_1001864972 227
486 3300009011 Ga0105251_10098546 Ga0105251_100985462 227
487 3300009093 Ga0105240_10175286 Ga0105240_101752862 227
488 3300009093 Ga0105240_10415973 Ga0105240_104159732 227
489 3300009093 Ga0105240_10438407 Ga0105240_104384072 227
490 3300009094 Ga0111539_10000230 Ga0111539_1000023032 227
491 3300009094 Ga0111539_10028028 Ga0111539_100280283 227
492 3300009094 Ga0111539_10040677 Ga0111539_100406773 227
493 3300009094 Ga0111539_10127730 Ga0111539_101277303 227
494 3300009094 Ga0111539_10135036 Ga0111539_101350364 227
495 3300009094 Ga0111539_10159169 Ga0111539_101591693 227
496 3300009098 Ga0105245_10013815 Ga0105245_100138154 227
497 3300009098 Ga0105245_10044522 Ga0105245_100445223 227
498 3300009098 Ga0105245_10079527 Ga0105245_100795273 227
499 3300009098 Ga0105245_10114957 Ga0105245_101149571 227
500 3300009098 Ga0105245_10286834 Ga0105245_102868343 227
501 3300009098 Ga0105245_10522377 Ga0105245_105223772 227
502 3300009101 Ga0105247_10006319 Ga0105247_100063191 227
503 3300009101 Ga0105247_10171594 Ga0105247_101715942 227
504 3300009101 Ga0105247_10212071 Ga0105247_102120711 227
505 3300009101 Ga0105247_10213035 Ga0105247_102130352 227
506 3300009147 Ga0114129_10000426 Ga0114129_1000042619 227
507 3300009147 Ga0114129_10004086 Ga0114129_1000408618 227
508 3300009147 Ga0114129_10011201 Ga0114129_100112019 227
509 3300009147 Ga0114129_10015649 Ga0114129_100156496 227
510 3300009147 Ga0114129_10016744 Ga0114129_100167449 227
511 3300009147 Ga0114129_10062276 Ga0114129_100622762 227
512 3300009147 Ga0114129_10109545 Ga0114129_101095452 227
513 3300009147 Ga0114129_10147890 Ga0114129_101478902 227
514 3300009147 Ga0114129_10474098 Ga0114129_104740982 227
515 3300009148 Ga0105243_10016270 Ga0105243_100162705 227
516 3300009148 Ga0105243_10039489 Ga0105243_100394894 227
517 3300009148 Ga0105243_10425097 Ga0105243_104250971 227
518 3300009174 Ga0105241_10183968 Ga0105241_101839682 227
519 3300009176 Ga0105242_10006391 Ga0105242_100063919 227
520 3300009176 Ga0105242_10042783 Ga0105242_100427832 227
521 3300009176 Ga0105242_10333526 Ga0105242_103335261 227
522 3300009176 Ga0105242_10374269 Ga0105242_103742692 227
523 3300009176 Ga0105242_10652596 Ga0105242_106525962 227
524 3300009177 Ga0105248_10001823 Ga0105248_100018233 227
525 3300009177 Ga0105248_10002172 Ga0105248_100021725 227
526 3300009177 Ga0105248_10026358 Ga0105248_100263582 227
527 3300009177 Ga0105248_10033883 Ga0105248_100338834 227
528 3300009177 Ga0105248_10039647 Ga0105248_100396472 227
529 3300009177 Ga0105248_10042359 Ga0105248_100423594 227
530 3300009177 Ga0105248_10063280 Ga0105248_100632803 227
531 3300009177 Ga0105248_10082243 Ga0105248_100822433 227
532 3300009177 Ga0105248_10207165 Ga0105248_102071653 227
533 3300009177 Ga0105248_10285506 Ga0105248_102855063 227
534 3300009177 Ga0105248_10341898 Ga0105248_103418982 227
535 3300009177 Ga0105248_10396596 Ga0105248_103965962 227
536 3300009177 Ga0105248_10712052 Ga0105248_107120521 227
537 3300009545 Ga0105237_10085659 Ga0105237_100856592 227
538 3300009551 Ga0105238_10346104 Ga0105238_103461042 227
539 3300009553 Ga0105249_10009745 Ga0105249_100097457 227
540 3300009553 Ga0105249_10029901 Ga0105249_100299014 227
541 3300009553 Ga0105249_10171846 Ga0105249_101718463 227
542 3300009553 Ga0105249_10224863 Ga0105249_102248632 227
543 3300009553 Ga0105249_10760151 Ga0105249_107601511 227
544 3300010375 Ga0105239_10442152 Ga0105239_104421522 227
545 3300011119 Ga0105246_10215283 Ga0105246_102152831 227
546 3300013104 Ga0157370_10209227 Ga0157370_102092273 227
547 3300013296 Ga0157374_10086749 Ga0157374_100867492 227
548 3300013296 Ga0157374_10125215 Ga0157374_101252152 227
549 3300013296 Ga0157374_10171463 Ga0157374_101714633 227
550 3300013297 Ga0157378_10322007 Ga0157378_103220072 227
551 3300013306 Ga0163162_10027287 Ga0163162_100272875 227
552 3300013306 Ga0163162_10174086 Ga0163162_101740862 227
553 3300013306 Ga0163162_10193677 Ga0163162_101936772 227
554 3300013306 Ga0163162_10828631 Ga0163162_108286311 227
555 3300013307 Ga0157372_10346601 Ga0157372_103466012 227
556 3300013308 Ga0157375_10011898 Ga0157375_100118982 227
557 3300013308 Ga0157375_10220474 Ga0157375_102204741 227
558 3300013308 Ga0157375_10327702 Ga0157375_103277023 227
559 3300013308 Ga0157375_10523597 Ga0157375_105235972 227
560 3300014325 Ga0163163_10089531 Ga0163163_100895314 227
561 3300014325 Ga0163163_10634742 Ga0163163_106347422 227
562 3300014326 Ga0157380_10002775 Ga0157380_100027755 227
563 3300014326 Ga0157380_10003534 Ga0157380_100035346 227
564 3300014326 Ga0157380_10042674 Ga0157380_100426742 227
565 3300014326 Ga0157380_10057183 Ga0157380_100571833 227
566 3300014326 Ga0157380_10236872 Ga0157380_102368722 227
567 3300014326 Ga0157380_10575995 Ga0157380_105759952 227
568 3300014745 Ga0157377_10045403 Ga0157377_100454032 227
569 3300014745 Ga0157377_10054221 Ga0157377_100542212 227
570 3300014968 Ga0157379_10008620 Ga0157379_100086205 227
571 3300014968 Ga0157379_10010535 Ga0157379_100105358 227
572 3300014968 Ga0157379_10104470 Ga0157379_101044702 227
573 3300014968 Ga0157379_10121832 Ga0157379_101218323 227
574 3300014969 Ga0157376_10115833 Ga0157376_101158333 227
575 3300014969 Ga0157376_10244175 Ga0157376_102441751 227
576 3300017792 Ga0163161_10597223 Ga0163161_105972232 227
577 3300025271 Ga0207666_1002799 Ga0207666_10027991 227
578 3300025899 Ga0207642_10021638 Ga0207642_100216383 227
579 3300025899 Ga0207642_10043309 Ga0207642_100433093 227
580 3300025899 Ga0207642_10102248 Ga0207642_101022482 227
581 3300025900 Ga0207710_10192084 Ga0207710_101920841 227
582 3300025901 Ga0207688_10035785 Ga0207688_100357852 227
583 3300025901 Ga0207688_10045030 Ga0207688_100450303 227
584 3300025901 Ga0207688_10174167 Ga0207688_101741672 227
585 3300025903 Ga0207680_10043788 Ga0207680_100437883 227
586 3300025903 Ga0207680_10055163 Ga0207680_100551632 227
587 3300025907 Ga0207645_10001406 Ga0207645_100014068 227
588 3300025907 Ga0207645_10082041 Ga0207645_100820413 227
589 3300025908 Ga0207643_10026892 Ga0207643_100268922 227
590 3300025908 Ga0207643_10424821 Ga0207643_104248211 227
591 3300025909 Ga0207705_10047753 Ga0207705_100477533 227
592 3300025913 Ga0207695_10145674 Ga0207695_101456742 227
593 3300025913 Ga0207695_10271060 Ga0207695_102710602 227
594 3300025913 Ga0207695_10372230 Ga0207695_103722301 227
595 3300025916 Ga0207663_10472861 Ga0207663_104728611 227
596 3300025917 Ga0207660_10052773 Ga0207660_100527733 227
597 3300025917 Ga0207660_10180894 Ga0207660_101808942 227
598 3300025917 Ga0207660_10417344 Ga0207660_104173442 227
599 3300025918 Ga0207662_10093116 Ga0207662_100931162 227
600 3300025918 Ga0207662_10103102 Ga0207662_101031021 227
601 3300025918 Ga0207662_10194372 Ga0207662_101943722 227
602 3300025919 Ga0207657_10006096 Ga0207657_1000609610 227
603 3300025922 Ga0207646_10118951 Ga0207646_101189512 227
604 3300025922 Ga0207646_10226959 Ga0207646_102269592 227
605 3300025923 Ga0207681_10004564 Ga0207681_100045644 227
606 3300025923 Ga0207681_10007710 Ga0207681_100077103 227
607 3300025923 Ga0207681_10010304 Ga0207681_100103047 227
608 3300025923 Ga0207681_10022128 Ga0207681_100221284 227
609 3300025923 Ga0207681_10049070 Ga0207681_100490702 227
610 3300025924 Ga0207694_10512040 Ga0207694_105120402 227
611 3300025925 Ga0207650_10012873 Ga0207650_100128735 227
612 3300025925 Ga0207650_10045925 Ga0207650_100459254 227
613 3300025925 Ga0207650_10094452 Ga0207650_100944522 227
614 3300025926 Ga0207659_10000079 Ga0207659_1000007924 227
615 3300025926 Ga0207659_10107113 Ga0207659_101071132 227
616 3300025926 Ga0207659_10110120 Ga0207659_101101202 227
617 3300025927 Ga0207687_10032490 Ga0207687_100324903 227
618 3300025927 Ga0207687_10042449 Ga0207687_100424493 227
619 3300025928 Ga0207700_10284527 Ga0207700_102845272 227
620 3300025931 Ga0207644_10231817 Ga0207644_102318172 227
621 3300025933 Ga0207706_10045569 Ga0207706_100455694 227
622 3300025933 Ga0207706_10260904 Ga0207706_102609042 227
623 3300025933 Ga0207706_10293356 Ga0207706_102933562 227
624 3300025934 Ga0207686_10004099 Ga0207686_100040998 227
625 3300025936 Ga0207670_10293954 Ga0207670_102939542 227
626 3300025936 Ga0207670_10614512 Ga0207670_106145121 227
627 3300025937 Ga0207669_10005378 Ga0207669_100053784 227
628 3300025937 Ga0207669_10007871 Ga0207669_100078714 227
629 3300025937 Ga0207669_10065074 Ga0207669_100650743 227
630 3300025937 Ga0207669_10122108 Ga0207669_101221083 227
631 3300025937 Ga0207669_10140110 Ga0207669_101401102 227
632 3300025939 Ga0207665_10136872 Ga0207665_101368723 227
633 3300025940 Ga0207691_10033053 Ga0207691_100330536 227
634 3300025940 Ga0207691_10061749 Ga0207691_100617494 227
635 3300025940 Ga0207691_10225366 Ga0207691_102253662 227
636 3300025940 Ga0207691_10301962 Ga0207691_103019622 227
637 3300025941 Ga0207711_10006268 Ga0207711_100062688 227
638 3300025941 Ga0207711_10006976 Ga0207711_100069767 227
639 3300025941 Ga0207711_10011151 Ga0207711_100111514 227
640 3300025941 Ga0207711_10026659 Ga0207711_100266592 227
641 3300025941 Ga0207711_10034866 Ga0207711_100348663 227
642 3300025941 Ga0207711_10084364 Ga0207711_100843642 227
643 3300025941 Ga0207711_10101916 Ga0207711_101019162 227
644 3300025941 Ga0207711_10160725 Ga0207711_101607253 227
645 3300025941 Ga0207711_10595480 Ga0207711_105954802 227
646 3300025944 Ga0207661_10104972 Ga0207661_101049723 227
647 3300025949 Ga0207667_10118454 Ga0207667_101184543 227
648 3300025960 Ga0207651_10018039 Ga0207651_100180393 227
649 3300025960 Ga0207651_10060323 Ga0207651_100603232 227
650 3300025960 Ga0207651_10162608 Ga0207651_101626083 227
651 3300025960 Ga0207651_10224658 Ga0207651_102246582 227
652 3300025960 Ga0207651_10236597 Ga0207651_102365972 227
653 3300025961 Ga0207712_10055161 Ga0207712_100551613 227
654 3300025961 Ga0207712_10062928 Ga0207712_100629282 227
655 3300025961 Ga0207712_10287650 Ga0207712_102876502 227
656 3300025981 Ga0207640_10037408 Ga0207640_100374083 227
657 3300025981 Ga0207640_10042397 Ga0207640_100423973 227
658 3300025986 Ga0207658_10106488 Ga0207658_101064883 227
659 3300025986 Ga0207658_10417522 Ga0207658_104175222 227
660 3300025986 Ga0207658_10462845 Ga0207658_104628452 227
661 3300026023 Ga0207677_10006085 Ga0207677_100060852 227
662 3300026023 Ga0207677_10065561 Ga0207677_100655614 227
663 3300026023 Ga0207677_10312829 Ga0207677_103128291 227
664 3300026035 Ga0207703_10011918 Ga0207703_100119187 227
665 3300026035 Ga0207703_10024349 Ga0207703_100243494 227
666 3300026035 Ga0207703_10028554 Ga0207703_100285543 227
667 3300026035 Ga0207703_10032058 Ga0207703_100320583 227
668 3300026035 Ga0207703_10091644 Ga0207703_100916442 227
669 3300026035 Ga0207703_10321376 Ga0207703_103213762 227
670 3300026035 Ga0207703_10334288 Ga0207703_103342882 227
671 3300026035 Ga0207703_10407661 Ga0207703_104076612 227
672 3300026067 Ga0207678_10016500 Ga0207678_100165003 227
673 3300026067 Ga0207678_10075340 Ga0207678_100753402 227
674 3300026075 Ga0207708_10004337 Ga0207708_100043377 227
675 3300026075 Ga0207708_10011869 Ga0207708_100118694 227
676 3300026075 Ga0207708_10027833 Ga0207708_100278334 227
677 3300026075 Ga0207708_10073587 Ga0207708_100735874 227
678 3300026078 Ga0207702_10008196 Ga0207702_100081965 227
679 3300026088 Ga0207641_10000955 Ga0207641_100009558 227
680 3300026088 Ga0207641_10029587 Ga0207641_100295873 227
681 3300026088 Ga0207641_10098340 Ga0207641_100983402 227
682 3300026089 Ga0207648_10002536 Ga0207648_100025367 227
683 3300026089 Ga0207648_10100441 Ga0207648_101004413 227
684 3300026089 Ga0207648_10147181 Ga0207648_101471811 227
685 3300026089 Ga0207648_10202798 Ga0207648_102027982 227
686 3300026089 Ga0207648_10259085 Ga0207648_102590852 227
687 3300026095 Ga0207676_10058841 Ga0207676_100588413 227
688 3300026116 Ga0207674_10001555 Ga0207674_1000155530 227
689 3300026118 Ga0207675_100020327 Ga0207675_1000203275 227
690 3300026118 Ga0207675_100077824 Ga0207675_1000778242 227
691 3300026118 Ga0207675_100101869 Ga0207675_1001018692 227
692 3300026118 Ga0207675_100512448 Ga0207675_1005124482 227
693 3300026121 Ga0207683_10012041 Ga0207683_100120413 227
694 3300026121 Ga0207683_10084754 Ga0207683_100847543 227
695 3300026121 Ga0207683_10091968 Ga0207683_100919682 227
696 3300026121 Ga0207683_10158638 Ga0207683_101586383 227
697 3300027907 Ga0207428_10003214 Ga0207428_100032147 227
698 3300027907 Ga0207428_10008933 Ga0207428_100089332 227
699 3300027907 Ga0207428_10032836 Ga0207428_100328363 227
700 3300027907 Ga0207428_10046855 Ga0207428_100468554 227
701 3300027907 Ga0207428_10079831 Ga0207428_100798313 227
702 3300027907 Ga0207428_10088301 Ga0207428_100883012 227
703 3300027907 Ga0207428_10199150 Ga0207428_101991501 227
704 3300028379 Ga0268266_10015925 Ga0268266_100159252 227
705 3300028379 Ga0268266_10019822 Ga0268266_100198224 227
706 3300028379 Ga0268266_10070132 Ga0268266_100701322 227
707 3300028379 Ga0268266_10156520 Ga0268266_101565202 227
708 3300028380 Ga0268265_10002223 Ga0268265_1000222313 227
709 3300028380 Ga0268265_10007125 Ga0268265_100071253 227
710 3300028380 Ga0268265_10106633 Ga0268265_101066333 227
711 3300028380 Ga0268265_10206043 Ga0268265_102060432 227
712 3300028380 Ga0268265_10378570 Ga0268265_103785702 227
713 3300028381 Ga0268264_10235681 Ga0268264_102356812 227
714 3300028381 Ga0268264_10239234 Ga0268264_102392342 227
715 3300028381 Ga0268264_10240731 Ga0268264_102407312 227
716 3300028381 Ga0268264_10453774 Ga0268264_104537742 227
717 3300031727 Ga0316576_10165464 Ga0316576_101654642 227
718 3300031728 Ga0316578_10258961 Ga0316578_102589612 227
719 3300031731 Ga0307405_10388539 Ga0307405_103885392 227
720 3300031852 Ga0307410_10027381 Ga0307410_100273813 227
721 3300031852 Ga0307410_10205258 Ga0307410_102052582 227
722 3300031903 Ga0307407_10296114 Ga0307407_102961142 227
723 3300031911 Ga0307412_10407952 Ga0307412_104079522 227
724 3300032002 Ga0307416_100059474 Ga0307416_1000594741 227
725 3300032004 Ga0307414_10016170 Ga0307414_100161705 227
726 3300032005 Ga0307411_10343281 Ga0307411_103432812 227
727 3300032126 Ga0307415_100025699 Ga0307415_1000256994 227
728 3300035170 Ga0373943_0090563 Ga0373943_0090563_617_1408 227
729 3300035725 Ga0373947_0139066 Ga0373947_0139066_47_844 227
730 3300036712 Ga0316584_0199055 Ga0316584_0199055_50_790 227
731 3300041486 Ga0451807_0932481 Ga0451807_0932481_66_872 227
732 3300042007 Ga0439449_0133081 Ga0439449_0133081_55_849 227
733 3300042133 Ga0450896_013328 Ga0450896_013328_75_881 227
734 3300042156 Ga0439446_0003549 Ga0439446_0003549_2588_3388 227
735 3300042184 Ga0450908_000601 Ga0450908_000601_4079_4885 227
736 3300042435 Ga0439434_0163745 Ga0439434_0163745_13_729 227
737 3300042436 Ga0439435_0001680 Ga0439435_0001680_2316_3110 227
738 3300042436 Ga0439435_0020268 Ga0439435_0020268_252_1070 227
739 3300044694 Ga0466963_0155679 Ga0466963_0155679_118_975 227
740 3300045051 Ga0451576_0129865 Ga0451576_0129865_1760_2554 227
741 3300045051 Ga0451576_0692611 Ga0451576_0692611_111_905 227
742 3300045976 Ga0466967_0134331 Ga0466967_0134331_813_1607 227
743 3300046455 Ga0495603_0162083 Ga0495603_0162083_12_809 227
744 3300046460 Ga0495638_0002169 Ga0495638_0002169_13754_14548 227
745 3300046473 Ga0495582_0100665 Ga0495582_0100665_91_888 227
746 3300046473 Ga0495582_0133801 Ga0495582_0133801_117_914 227
747 3300046539 Ga0495621_0023373 Ga0495621_0023373_847_1602 227
748 3300046543 Ga0495645_0002325 Ga0495645_0002325_2455_3252 227
749 3300046559 Ga0495667_0280297 Ga0495667_0280297_210_1007 227
750 3300046615 Ga0495656_0095821 Ga0495656_0095821_328_1122 227
751 3300046642 Ga0495634_0140850 Ga0495634_0140850_200_940 227
752 3300048904 Ga0496101_0178336 Ga0496101_0178336_684_1514 227
753 3300048904 Ga0496101_0217405 Ga0496101_0217405_18_812 227
754 3300048905 Ga0496102_0252039 Ga0496102_0252039_158_952 227
755 3300048907 Ga0496104_0010482 Ga0496104_0010482_6557_7357 227
756 3300048907 Ga0496104_0018381 Ga0496104_0018381_2807_3637 227
757 3300048907 Ga0496104_0138434 Ga0496104_0138434_623_1417 227
758 3300048907 Ga0496104_0138762 Ga0496104_0138762_1195_1995 227
759 3300048907 Ga0496104_0439341 Ga0496104_0439341_282_1079 227
760 3300048909 Ga0496106_0234342 Ga0496106_0234342_424_1218 227
761 3300048909 Ga0496106_0234768 Ga0496106_0234768_379_1173 227
762 3300048911 Ga0496108_0001834 Ga0496108_0001834_5701_6531 227
763 3300048911 Ga0496108_0021565 Ga0496108_0021565_4381_5181 227
764 3300048912 Ga0496109_0007547 Ga0496109_0007547_747_1577 227
765 3300048912 Ga0496109_0349301 Ga0496109_0349301_351_1145 227
766 3300048913 Ga0496110_0222729 Ga0496110_0222729_818_1624 227
767 3300048915 Ga0496112_0003880 Ga0496112_0003880_10885_11715 227
768 3300048915 Ga0496112_0007942 Ga0496112_0007942_2667_3467 227
769 3300048915 Ga0496112_0373262 Ga0496112_0373262_196_993 227
770 3300048916 Ga0496113_0032239 Ga0496113_0032239_2522_3322 227
771 3300048917 Ga0496114_0065893 Ga0496114_0065893_464_1264 227
772 3300048917 Ga0496114_0083151 Ga0496114_0083151_392_1189 227
773 3300048917 Ga0496114_0210557 Ga0496114_0210557_185_979 227
774 3300048917 Ga0496114_0226940 Ga0496114_0226940_593_1390 227
775 3300048918 Ga0496115_0040595 Ga0496115_0040595_460_1260 227
776 3300049568 Ga0501031_0035339 Ga0501031_0035339_2332_3123 227
777 3300049572 Ga0501036_0036647 Ga0501036_0036647_1555_2349 227
778 3300049572 Ga0501036_0047881 Ga0501036_0047881_123_914 227
779 3300049572 Ga0501036_0229712 Ga0501036_0229712_707_1498 227
780 3300049576 Ga0501040_0158582 Ga0501040_0158582_301_1092 227
781 3300049578 Ga0501042_0145774 Ga0501042_0145774_668_1462 227
782 3300049582 Ga0501048_0085239 Ga0501048_0085239_1318_2109 227
783 3300049582 Ga0501048_0215063 Ga0501048_0215063_32_826 227
784 3300049587 Ga0501071_0124780 Ga0501071_0124780_30_824 227
785 3300049588 Ga0501072_0021203 Ga0501072_0021203_554_1348 227
786 3300049588 Ga0501072_0082222 Ga0501072_0082222_848_1639 227
787 3300049588 Ga0501072_0097786 Ga0501072_0097786_1508_2299 227
788 3300049590 Ga0501074_0349795 Ga0501074_0349795_71_862 227
789 3300049591 Ga0501075_0074374 Ga0501075_0074374_1459_2250 227
790 3300049592 Ga0501076_0027186 Ga0501076_0027186_610_1401 227
791 3300049592 Ga0501076_0175950 Ga0501076_0175950_309_1103 227
792 3300049592 Ga0501076_0234633 Ga0501076_0234633_219_1010 227
793 3300049663 Ga0501223_023820 Ga0501223_023820_79_870 227
794 3300049665 Ga0501227_035557 Ga0501227_035557_119_919 227
795 3300049686 Ga0501257_043102 Ga0501257_043102_32_832 227
796 3300049741 Ga0501079_0034747 Ga0501079_0034747_1505_2299 227
797 3300049741 Ga0501079_0198369 Ga0501079_0198369_717_1508 227
798 3300049742 Ga0501080_0332121 Ga0501080_0332121_164_955 227
799 3300049742 Ga0501080_0460588 Ga0501080_0460588_231_1025 227
800 3300049743 Ga0501081_0031923 Ga0501081_0031923_1084_1878 227
801 3300049743 Ga0501081_0118790 Ga0501081_0118790_560_1354 227
802 3300049744 Ga0501083_0213119 Ga0501083_0213119_157_948 227
803 3300049823 Ga0501044_0586603 Ga0501044_0586603_174_965 227
804 3300049824 Ga0501045_0002867 Ga0501045_0002867_9045_9836 227
805 3300049824 Ga0501045_0081056 Ga0501045_0081056_836_1630 227
806 3300049824 Ga0501045_0102406 Ga0501045_0102406_956_1750 227
807 3300050489 nmdc:mga03683_165606_c1 nmdc:mga03683_165606_c1_86_892 227
808 3300050490 nmdc:mga03n38_171283_c1 nmdc:mga03n38_171283_c1_246_1052 227
809 3300050491 nmdc:mga00v17_100512_c1 nmdc:mga00v17_100512_c1_230_1036 227
810 3300050491 nmdc:mga00v17_141508_c1 nmdc:mga00v17_141508_c1_242_1048 227
811 3300050491 nmdc:mga00v17_154947_c1 nmdc:mga00v17_154947_c1_218_1012 227
812 3300050491 nmdc:mga00v17_9452_c1 nmdc:mga00v17_9452_c1_4014_4808 227
813 3300050492 nmdc:mga0yw44_377032_c1 nmdc:mga0yw44_377032_c1_112_906 227
814 3300050493 nmdc:mga0k408_115359_c1 nmdc:mga0k408_115359_c1_816_1568 227
815 3300050493 nmdc:mga0k408_144587_c1 nmdc:mga0k408_144587_c1_339_1133 227
816 3300050493 nmdc:mga0k408_35990_c1 nmdc:mga0k408_35990_c1_1817_2623 227
817 3300050493 nmdc:mga0k408_36941_c1 nmdc:mga0k408_36941_c1_1673_2479 227
818 3300050493 nmdc:mga0k408_54275_c1 nmdc:mga0k408_54275_c1_639_1445 227
819 3300050494 nmdc:mga06z11_12223_c1 nmdc:mga06z11_12223_c1_411_1217 227
820 3300050494 nmdc:mga06z11_65126_c1 nmdc:mga06z11_65126_c1_650_1456 227
821 3300050496 nmdc:mga07m45_39437_c1 nmdc:mga07m45_39437_c1_1701_2507 227
822 3300050507 nmdc:mga05p37_11473_c2 nmdc:mga05p37_11473_c2_1842_2633 227
823 3300050507 nmdc:mga05p37_199303_c1 nmdc:mga05p37_199303_c1_1048_1842 227
824 3300050507 nmdc:mga05p37_1997_c1 nmdc:mga05p37_1997_c1_87_881 227
825 3300050507 nmdc:mga05p37_24358_c1 nmdc:mga05p37_24358_c1_4291_5085 227
826 3300050507 nmdc:mga05p37_2445_c1 nmdc:mga05p37_2445_c1_15186_15980 227
827 3300050507 nmdc:mga05p37_248566_c1 nmdc:mga05p37_248566_c1_1185_1979 227
828 3300050507 nmdc:mga05p37_47044_c1 nmdc:mga05p37_47044_c1_3448_4242 227
829 3300050507 nmdc:mga05p37_492589_c1 nmdc:mga05p37_492589_c1_23_817 227
830 3300050507 nmdc:mga05p37_678423_c1 nmdc:mga05p37_678423_c1_11_805 227
831 3300050507 nmdc:mga05p37_7856_c1 nmdc:mga05p37_7856_c1_10481_11275 227
832 3300050508 nmdc:mga09592_349478_c1 nmdc:mga09592_349478_c1_295_1086 227
833 3300050510 nmdc:mga06r32_56326_c1 nmdc:mga06r32_56326_c1_232_1023 227
834 3300050510 nmdc:mga06r32_686776_c1 nmdc:mga06r32_686776_c1_125_916 227
835 3300050511 nmdc:mga08y16_119763_c1 nmdc:mga08y16_119763_c1_774_1574 227
836 3300050511 nmdc:mga08y16_169922_c1 nmdc:mga08y16_169922_c1_1113_1913 227
837 3300050511 nmdc:mga08y16_20322_c1 nmdc:mga08y16_20322_c1_515_1315 227
838 3300050511 nmdc:mga08y16_28335_c1 nmdc:mga08y16_28335_c1_594_1412 227
839 3300050511 nmdc:mga08y16_3154_c1 nmdc:mga08y16_3154_c1_6174_6992 227
840 3300050511 nmdc:mga08y16_316062_c1 nmdc:mga08y16_316062_c1_462_1268 227
841 3300050511 nmdc:mga08y16_335389_c1 nmdc:mga08y16_335389_c1_118_936 227
842 3300050511 nmdc:mga08y16_444223_c1 nmdc:mga08y16_444223_c1_166_960 227
843 3300050511 nmdc:mga08y16_4998_c1 nmdc:mga08y16_4998_c1_9086_9880 227
844 3300050511 nmdc:mga08y16_59749_c1 nmdc:mga08y16_59749_c1_1401_2195 227
845 3300050512 nmdc:mga0n895_153557_c1 nmdc:mga0n895_153557_c1_124_918 227
846 3300050512 nmdc:mga0n895_197724_c1 nmdc:mga0n895_197724_c1_239_1033 227
847 3300050512 nmdc:mga0n895_25107_c1 nmdc:mga0n895_25107_c1_3743_4540 227
848 3300050512 nmdc:mga0n895_287861_c1 nmdc:mga0n895_287861_c1_206_1000 227
849 3300050512 nmdc:mga0n895_2881_c1 nmdc:mga0n895_2881_c1_8489_9307 227
850 3300050512 nmdc:mga0n895_296283_c1 nmdc:mga0n895_296283_c1_668_1462 227
851 3300050512 nmdc:mga0n895_305048_c1 nmdc:mga0n895_305048_c1_706_1500 227
852 3300050513 nmdc:mga0rr50_10070_c1 nmdc:mga0rr50_10070_c1_4714_5511 227
853 3300050513 nmdc:mga0rr50_12958_c1 nmdc:mga0rr50_12958_c1_4065_4859 227
854 3300050513 nmdc:mga0rr50_360533_c1 nmdc:mga0rr50_360533_c1_279_1073 227
855 3300050513 nmdc:mga0rr50_84673_c1 nmdc:mga0rr50_84673_c1_1325_2119 227
856 3300050514 nmdc:mga08x19_140516_c1 nmdc:mga08x19_140516_c1_383_1177 227
857 3300050514 nmdc:mga08x19_153025_c1 nmdc:mga08x19_153025_c1_688_1482 227
858 3300050514 nmdc:mga08x19_40819_c1 nmdc:mga08x19_40819_c1_278_1075 227
859 3300050514 nmdc:mga08x19_96803_c1 nmdc:mga08x19_96803_c1_56_850 227
860 3300050515 nmdc:mga0a205_31626_c1 nmdc:mga0a205_31626_c1_3417_4235 227
861 3300050515 nmdc:mga0a205_487952_c1 nmdc:mga0a205_487952_c1_110_904 227
862 3300050515 nmdc:mga0a205_620484_c1 nmdc:mga0a205_620484_c1_36_830 227
863 3300050515 nmdc:mga0a205_69222_c1 nmdc:mga0a205_69222_c1_265_1059 227
864 3300050515 nmdc:mga0a205_8884_c1 nmdc:mga0a205_8884_c1_4239_5033 227
865 3300053077 Ga0495601_0119219 Ga0495601_0119219_586_1383 227
866 3300053085 Ga0495619_0061168 Ga0495619_0061168_926_1723 227
867 3300053085 Ga0495619_0212332 Ga0495619_0212332_174_971 227
868 3300053153 Ga0500616_0000286 Ga0500616_0000286_66858_67652 227
869 3300053736 Ga0500599_002802 Ga0500599_002802_847_1641 227
870 3300054114 Ga0501084_0013745 Ga0501084_0013745_2810_3601 227
871 3300054114 Ga0501084_0039063 Ga0501084_0039063_1012_1806 227
872 3300059421 Ga0590071_000390 Ga0590071_000390_1829_2620 227
873 3300059421 Ga0590071_022752 Ga0590071_022752_586_1380 227
874 3300059423 Ga0590074_000745 Ga0590074_000745_1017_1808 227
875 3300059424 Ga0590075_000031 Ga0590075_000031_26189_26980 227
876 3300059426 Ga0590077_001677 Ga0590077_001677_4196_4987 227
877 3300059426 Ga0590077_008805 Ga0590077_008805_490_1284 227
878 3300060353 Ga0501082_0223038 Ga0501082_0223038_669_1463 227
879 3300005618 Ga0068864_100354497 Ga0068864_1003544972 228
880 3300005937 Ga0081455_10228568 Ga0081455_102285681 228
881 3300006038 Ga0075365_10155941 Ga0075365_101559412 228
882 3300006042 Ga0075368_10010324 Ga0075368_100103243 228
883 3300006042 Ga0075368_10010466 Ga0075368_100104664 228
884 3300006177 Ga0075362_10075871 Ga0075362_100758712 228
885 3300006178 Ga0075367_10030782 Ga0075367_100307822 228
886 3300006178 Ga0075367_10321863 Ga0075367_103218631 228
887 3300006195 Ga0075366_10002821 Ga0075366_100028216 228
888 3300006195 Ga0075366_10095486 Ga0075366_100954862 228
889 3300006237 Ga0097621_100000125 Ga0097621_10000012521 228
890 3300006353 Ga0075370_10221881 Ga0075370_102218812 228
891 3300006358 Ga0068871_100000134 Ga0068871_10000013432 228
892 3300006881 Ga0068865_100430411 Ga0068865_1004304111 228
893 3300013296 Ga0157374_10017943 Ga0157374_100179434 228
894 3300013297 Ga0157378_10009109 Ga0157378_100091097 228
895 3300013297 Ga0157378_10256121 Ga0157378_102561212 228
896 3300014325 Ga0163163_10840245 Ga0163163_108402452 228
897 3300014326 Ga0157380_10476386 Ga0157380_104763862 228
898 3300014969 Ga0157376_10086235 Ga0157376_100862353 228
899 3300021384 Ga0213876_10047185 Ga0213876_100471853 228
900 3300025912 Ga0207707_10310721 Ga0207707_103107212 228
901 3300025928 Ga0207700_10027277 Ga0207700_100272774 228
902 3300026095 Ga0207676_10223923 Ga0207676_102239232 228
903 3300026118 Ga0207675_100028863 Ga0207675_1000288634 228
904 3300027866 Ga0209813_10017732 Ga0209813_100177322 228
905 3300027866 Ga0209813_10029849 Ga0209813_100298492 228
906 3300028381 Ga0268264_10804815 Ga0268264_108048151 228
907 3300028577 Ga0265318_10046670 Ga0265318_100466702 228
908 3300031238 Ga0265332_10033437 Ga0265332_100334372 228
909 3300031247 Ga0265340_10177401 Ga0265340_101774012 228
910 3300031711 Ga0265314_10011701 Ga0265314_100117015 228
911 3300031911 Ga0307412_10134435 Ga0307412_101344353 228
912 3300035111 Ga0373923_0032199 Ga0373923_0032199_1100_1894 228
913 3300035170 Ga0373943_0006653 Ga0373943_0006653_2943_3737 228
914 3300035171 Ga0373946_0121619 Ga0373946_0121619_13_717 228
915 3300035172 Ga0373955_0069986 Ga0373955_0069986_653_1447 228
916 3300035725 Ga0373947_0013719 Ga0373947_0013719_1910_2704 228
917 3300036401 Ga0373937_0202511 Ga0373937_0202511_791_1582 228
918 3300037068 Ga0373925_0019339 Ga0373925_0019339_3607_4401 228
919 3300039437 Ga0436365_1823118 Ga0436365_1823118_528_1319 228
920 3300046454 Ga0495592_0065872 Ga0495592_0065872_1649_2440 228
921 3300046454 Ga0495592_0109176 Ga0495592_0109176_158_967 228
922 3300046463 Ga0495653_0037508 Ga0495653_0037508_2345_3139 228
923 3300046475 Ga0495639_0227769 Ga0495639_0227769_84_875 228
924 3300046516 Ga0495628_0024037 Ga0495628_0024037_2684_3475 228
925 3300046517 Ga0495630_0024902 Ga0495630_0024902_2571_3362 228
926 3300046543 Ga0495645_0119351 Ga0495645_0119351_980_1771 228
927 3300046684 Ga0495669_0003820 Ga0495669_0003820_4710_5504 228
928 3300046689 Ga0495613_0001676 Ga0495613_0001676_15082_15873 228
929 3300046809 Ga0495600_0015351 Ga0495600_0015351_725_1516 228
930 3300047319 Ga0495674_0233145 Ga0495674_0233145_176_970 228
931 3300047471 Ga0495684_0004473 Ga0495684_0004473_5028_5819 228
932 3300050491 nmdc:mga00v17_360854_c1 nmdc:mga00v17_360854_c1_54_812 228
933 3300050493 nmdc:mga0k408_8436_c1 nmdc:mga0k408_8436_c1_547_1359 228
934 3300050494 nmdc:mga06z11_3006_c1 nmdc:mga06z11_3006_c1_4506_5318 228
935 3300050494 nmdc:mga06z11_4077_c1 nmdc:mga06z11_4077_c1_34_828 228
936 3300050495 nmdc:mga04h51_21091_c1 nmdc:mga04h51_21091_c1_578_1390 228
937 3300050495 nmdc:mga04h51_7352_c1 nmdc:mga04h51_7352_c1_1837_2631 228
938 3300050496 nmdc:mga07m45_66706_c2 nmdc:mga07m45_66706_c2_456_1268 228
939 3300053077 Ga0495601_0002903 Ga0495601_0002903_5441_6232 228
940 3300053077 Ga0495601_0029644 Ga0495601_0029644_951_1742 228
941 3300053084 Ga0495595_0029864 Ga0495595_0029864_827_1618 228
942 3300053085 Ga0495619_0003133 Ga0495619_0003133_1192_1983 228
943 3300005290 Ga0065712_10002509 Ga0065712_100025094 229
944 3300005293 Ga0065715_10011643 Ga0065715_100116432 229
945 3300005330 Ga0070690_100036906 Ga0070690_1000369064 229
946 3300005331 Ga0070670_100264128 Ga0070670_1002641282 229
947 3300005331 Ga0070670_100422345 Ga0070670_1004223452 229
948 3300005338 Ga0068868_100098127 Ga0068868_1000981272 229
949 3300005340 Ga0070689_100061998 Ga0070689_1000619982 229
950 3300005353 Ga0070669_100324982 Ga0070669_1003249821 229
951 3300005354 Ga0070675_100185718 Ga0070675_1001857182 229
952 3300005356 Ga0070674_100081488 Ga0070674_1000814882 229
953 3300005365 Ga0070688_100139381 Ga0070688_1001393812 229
954 3300005438 Ga0070701_10036525 Ga0070701_100365252 229
955 3300005564 Ga0070664_100608073 Ga0070664_1006080732 229
956 3300005578 Ga0068854_100182992 Ga0068854_1001829922 229
957 3300005617 Ga0068859_100362391 Ga0068859_1003623912 229
958 3300005841 Ga0068863_100139481 Ga0068863_1001394814 229
959 3300005844 Ga0068862_100429636 Ga0068862_1004296362 229
960 3300006195 Ga0075366_10107433 Ga0075366_101074332 229
961 3300006358 Ga0068871_100210412 Ga0068871_1002104122 229
962 3300006846 Ga0075430_100000389 Ga0075430_10000038931 229
963 3300006847 Ga0075431_100013197 Ga0075431_1000131976 229
964 3300006847 Ga0075431_100309364 Ga0075431_1003093642 229
965 3300006871 Ga0075434_100149199 Ga0075434_1001491994 229
966 3300006880 Ga0075429_100238132 Ga0075429_1002381322 229
967 3300006880 Ga0075429_100597973 Ga0075429_1005979732 229
968 3300006881 Ga0068865_100102993 Ga0068865_1001029932 229
969 3300006881 Ga0068865_100175809 Ga0068865_1001758092 229
970 3300006881 Ga0068865_100280136 Ga0068865_1002801362 229
971 3300006931 Ga0097620_100004515 Ga0097620_10000451510 229
972 3300006931 Ga0097620_100362378 Ga0097620_1003623782 229
973 3300009094 Ga0111539_10000466 Ga0111539_1000046624 229
974 3300009094 Ga0111539_10002605 Ga0111539_100026054 229
975 3300009094 Ga0111539_10115714 Ga0111539_101157142 229
976 3300009147 Ga0114129_10019817 Ga0114129_100198175 229
977 3300009176 Ga0105242_10116182 Ga0105242_101161823 229
978 3300009176 Ga0105242_10480302 Ga0105242_104803022 229
979 3300009177 Ga0105248_10023946 Ga0105248_100239462 229
980 3300009553 Ga0105249_10136382 Ga0105249_101363823 229
981 3300009553 Ga0105249_10163395 Ga0105249_101633952 229
982 3300009553 Ga0105249_10805182 Ga0105249_108051821 229
983 3300013306 Ga0163162_10076478 Ga0163162_100764782 229
984 3300014325 Ga0163163_10000001 Ga0163163_10000001413 229
985 3300014326 Ga0157380_10239969 Ga0157380_102399693 229
986 3300014326 Ga0157380_10505618 Ga0157380_105056182 229
987 3300025925 Ga0207650_10219084 Ga0207650_102190842 229
988 3300025936 Ga0207670_10054263 Ga0207670_100542632 229
989 3300025945 Ga0207679_10109615 Ga0207679_101096152 229
990 3300025961 Ga0207712_10135348 Ga0207712_101353482 229
991 3300025961 Ga0207712_10142701 Ga0207712_101427012 229
992 3300025961 Ga0207712_10476076 Ga0207712_104760762 229
993 3300026023 Ga0207677_10577700 Ga0207677_105777002 229
994 3300026088 Ga0207641_10155543 Ga0207641_101555431 229
995 3300026118 Ga0207675_100218517 Ga0207675_1002185172 229
996 3300027682 Ga0209971_1061955 Ga0209971_10619551 229
997 3300027907 Ga0207428_10030121 Ga0207428_100301214 229
998 3300027907 Ga0207428_10089480 Ga0207428_100894803 229
999 3300027907 Ga0207428_10195328 Ga0207428_101953282 229
1000 3300028380 Ga0268265_10125407 Ga0268265_101254072 229
1001 3300028381 Ga0268264_10077566 Ga0268264_100775662 229
1002 3300031995 Ga0307409_100728351 Ga0307409_1007283511 229
1003 3300032005 Ga0307411_10029640 Ga0307411_100296404 229
1004 3300035086 Ga0373934_0003832 Ga0373934_0003832_2157_2951 229
1005 3300035119 Ga0373956_0002659 Ga0373956_0002659_5563_6357 229
1006 3300035120 Ga0373957_0003805 Ga0373957_0003805_1511_2305 229
1007 3300035172 Ga0373955_0004470 Ga0373955_0004470_4740_5534 229
1008 3300035724 Ga0373933_0002143 Ga0373933_0002143_2065_2859 229
1009 3300036401 Ga0373937_0000088 Ga0373937_0000088_24950_25744 229
1010 3300044712 Ga0453684_0015096 Ga0453684_0015096_1143_1964 229
1011 3300045051 Ga0451576_0014174 Ga0451576_0014174_4979_5773 229
1012 3300047319 Ga0495674_0233461 Ga0495674_0233461_125_925 229
1013 3300048913 Ga0496110_0657348 Ga0496110_0657348_144_938 229
1014 3300049568 Ga0501031_0006245 Ga0501031_0006245_1957_2772 229
1015 3300049568 Ga0501031_0044128 Ga0501031_0044128_1562_2377 229
1016 3300049569 Ga0501032_0003850 Ga0501032_0003850_9279_10094 229
1017 3300049569 Ga0501032_0011090 Ga0501032_0011090_416_1231 229
1018 3300049569 Ga0501032_0032071 Ga0501032_0032071_2157_2972 229
1019 3300049569 Ga0501032_0165201 Ga0501032_0165201_185_1000 229
1020 3300049570 Ga0501033_0003710 Ga0501033_0003710_32_847 229
1021 3300049570 Ga0501033_0010678 Ga0501033_0010678_155_970 229
1022 3300049570 Ga0501033_0020306 Ga0501033_0020306_227_1042 229
1023 3300049571 Ga0501034_0001559 Ga0501034_0001559_15104_15919 229
1024 3300049571 Ga0501034_0036744 Ga0501034_0036744_3094_3909 229
1025 3300049571 Ga0501034_0077462 Ga0501034_0077462_183_998 229
1026 3300049571 Ga0501034_0099937 Ga0501034_0099937_193_1008 229
1027 3300049571 Ga0501034_0141126 Ga0501034_0141126_1044_1859 229
1028 3300049571 Ga0501034_0234814 Ga0501034_0234814_216_1031 229
1029 3300049572 Ga0501036_0001288 Ga0501036_0001288_9210_10025 229
1030 3300049572 Ga0501036_0003430 Ga0501036_0003430_10604_11419 229
1031 3300049572 Ga0501036_0027045 Ga0501036_0027045_1933_2748 229
1032 3300049572 Ga0501036_0139212 Ga0501036_0139212_751_1566 229
1033 3300049573 Ga0501037_0005114 Ga0501037_0005114_6285_7100 229
1034 3300049573 Ga0501037_0027399 Ga0501037_0027399_761_1576 229
1035 3300049574 Ga0501038_0013284 Ga0501038_0013284_5083_5898 229
1036 3300049574 Ga0501038_0025440 Ga0501038_0025440_1239_2054 229
1037 3300049574 Ga0501038_0044353 Ga0501038_0044353_1809_2624 229
1038 3300049575 Ga0501039_0039864 Ga0501039_0039864_1869_2684 229
1039 3300049575 Ga0501039_0044494 Ga0501039_0044494_1790_2605 229
1040 3300049575 Ga0501039_0104120 Ga0501039_0104120_132_947 229
1041 3300049575 Ga0501039_0275998 Ga0501039_0275998_291_1106 229
1042 3300049578 Ga0501042_0011496 Ga0501042_0011496_3116_3931 229
1043 3300049578 Ga0501042_0046566 Ga0501042_0046566_672_1487 229
1044 3300049579 Ga0501043_0001015 Ga0501043_0001015_21696_22511 229
1045 3300049579 Ga0501043_0019720 Ga0501043_0019720_4095_4910 229
1046 3300049580 Ga0501046_0003506 Ga0501046_0003506_12071_12886 229
1047 3300049580 Ga0501046_0010413 Ga0501046_0010413_5781_6596 229
1048 3300049580 Ga0501046_0048701 Ga0501046_0048701_266_1081 229
1049 3300049581 Ga0501047_0000134 Ga0501047_0000134_27931_28746 229
1050 3300049581 Ga0501047_0007600 Ga0501047_0007600_2158_2973 229
1051 3300049581 Ga0501047_0025544 Ga0501047_0025544_1707_2522 229
1052 3300049581 Ga0501047_0046619 Ga0501047_0046619_876_1691 229
1053 3300049581 Ga0501047_0049039 Ga0501047_0049039_706_1521 229
1054 3300049581 Ga0501047_0116186 Ga0501047_0116186_992_1807 229
1055 3300049582 Ga0501048_0012101 Ga0501048_0012101_5124_5939 229
1056 3300049582 Ga0501048_0018801 Ga0501048_0018801_607_1422 229
1057 3300049583 Ga0501067_0009296 Ga0501067_0009296_1751_2566 229
1058 3300049583 Ga0501067_0040369 Ga0501067_0040369_120_935 229
1059 3300049584 Ga0501068_0007676 Ga0501068_0007676_4639_5454 229
1060 3300049584 Ga0501068_0096422 Ga0501068_0096422_303_1118 229
1061 3300049585 Ga0501069_0000277 Ga0501069_0000277_10766_11581 229
1062 3300049585 Ga0501069_0019992 Ga0501069_0019992_1228_2043 229
1063 3300049586 Ga0501070_0004794 Ga0501070_0004794_3697_4512 229
1064 3300049586 Ga0501070_0018320 Ga0501070_0018320_1632_2447 229
1065 3300049586 Ga0501070_0050600 Ga0501070_0050600_1718_2533 229
1066 3300049586 Ga0501070_0092740 Ga0501070_0092740_650_1465 229
1067 3300049587 Ga0501071_0000369 Ga0501071_0000369_11765_12580 229
1068 3300049587 Ga0501071_0003389 Ga0501071_0003389_4417_5217 229
1069 3300049587 Ga0501071_0030947 Ga0501071_0030947_1913_2728 229
1070 3300049588 Ga0501072_0088680 Ga0501072_0088680_356_1171 229
1071 3300049588 Ga0501072_0230675 Ga0501072_0230675_165_965 229
1072 3300049589 Ga0501073_0003611 Ga0501073_0003611_4095_4910 229
1073 3300049589 Ga0501073_0007039 Ga0501073_0007039_4798_5613 229
1074 3300049589 Ga0501073_0022571 Ga0501073_0022571_352_1167 229
1075 3300049589 Ga0501073_0037072 Ga0501073_0037072_2449_3264 229
1076 3300049589 Ga0501073_0045589 Ga0501073_0045589_1344_2159 229
1077 3300049589 Ga0501073_0252384 Ga0501073_0252384_358_1173 229
1078 3300049590 Ga0501074_0000449 Ga0501074_0000449_18764_19579 229
1079 3300049590 Ga0501074_0241206 Ga0501074_0241206_95_910 229
1080 3300049591 Ga0501075_0018528 Ga0501075_0018528_2279_3079 229
1081 3300049591 Ga0501075_0221368 Ga0501075_0221368_391_1212 229
1082 3300049741 Ga0501079_0005948 Ga0501079_0005948_1712_2527 229
1083 3300049741 Ga0501079_0055947 Ga0501079_0055947_1094_1909 229
1084 3300049741 Ga0501079_0065500 Ga0501079_0065500_1816_2616 229
1085 3300049741 Ga0501079_0262579 Ga0501079_0262579_503_1318 229
1086 3300049742 Ga0501080_0005720 Ga0501080_0005720_3569_4384 229
1087 3300049742 Ga0501080_0536090 Ga0501080_0536090_160_975 229
1088 3300049742 Ga0501080_0657930 Ga0501080_0657930_80_895 229
1089 3300049744 Ga0501083_0007272 Ga0501083_0007272_844_1659 229
1090 3300049744 Ga0501083_0023357 Ga0501083_0023357_1310_2125 229
1091 3300049744 Ga0501083_0037056 Ga0501083_0037056_942_1757 229
1092 3300049770 Ga0501273_007020 Ga0501273_007020_165_974 229
1093 3300049822 Ga0501035_0003099 Ga0501035_0003099_394_1209 229
1094 3300049822 Ga0501035_0003483 Ga0501035_0003483_14182_14997 229
1095 3300049822 Ga0501035_0007716 Ga0501035_0007716_4843_5658 229
1096 3300049822 Ga0501035_0008187 Ga0501035_0008187_1743_2558 229
1097 3300049822 Ga0501035_0014236 Ga0501035_0014236_3577_4392 229
1098 3300049823 Ga0501044_0001440 Ga0501044_0001440_173_988 229
1099 3300049823 Ga0501044_0010848 Ga0501044_0010848_8915_9730 229
1100 3300049823 Ga0501044_0013275 Ga0501044_0013275_2109_2924 229
1101 3300049823 Ga0501044_0249962 Ga0501044_0249962_293_1108 229
1102 3300049824 Ga0501045_0029810 Ga0501045_0029810_1988_2803 229
1103 3300050493 nmdc:mga0k408_23075_c1 nmdc:mga0k408_23075_c1_2199_3044 229
1104 3300050507 nmdc:mga05p37_3977_c1 nmdc:mga05p37_3977_c1_12596_13417 229
1105 3300050510 nmdc:mga06r32_360691_c1 nmdc:mga06r32_360691_c1_32_850 229
1106 3300050511 nmdc:mga08y16_17155_c1 nmdc:mga08y16_17155_c1_1570_2364 229
1107 3300050511 nmdc:mga08y16_614_c1 nmdc:mga08y16_614_c1_7251_8051 229
1108 3300050511 nmdc:mga08y16_83503_c1 nmdc:mga08y16_83503_c1_1516_2313 229
1109 3300050512 nmdc:mga0n895_841578_c1 nmdc:mga0n895_841578_c1_162_893 229
1110 3300053085 Ga0495619_0067328 Ga0495619_0067328_1053_1847 229
1111 3300054114 Ga0501084_0008020 Ga0501084_0008020_5719_6534 229
1112 3300054114 Ga0501084_0052098 Ga0501084_0052098_1355_2170 229
1113 3300054114 Ga0501084_0144787 Ga0501084_0144787_1046_1861 229
1114 3300054114 Ga0501084_0151446 Ga0501084_0151446_437_1237 229
1115 3300060353 Ga0501082_0002846 Ga0501082_0002846_9746_10561 229
1116 3300060353 Ga0501082_0127913 Ga0501082_0127913_1000_1815 229
1117 3300060353 Ga0501082_0163449 Ga0501082_0163449_250_1065 229
1118 3300005290 Ga0065712_10007813 Ga0065712_100078134 230
1119 3300005293 Ga0065715_10114755 Ga0065715_101147552 230
1120 3300005293 Ga0065715_10146179 Ga0065715_101461792 230
1121 3300005293 Ga0065715_10243328 Ga0065715_102433281 230
1122 3300005295 Ga0065707_10224647 Ga0065707_102246471 230
1123 3300005295 Ga0065707_10329934 Ga0065707_103299341 230
1124 3300005335 Ga0070666_10149520 Ga0070666_101495202 230
1125 3300005353 Ga0070669_100213605 Ga0070669_1002136052 230
1126 3300005354 Ga0070675_100221171 Ga0070675_1002211712 230
1127 3300005356 Ga0070674_100149028 Ga0070674_1001490282 230
1128 3300005364 Ga0070673_100132094 Ga0070673_1001320942 230
1129 3300005439 Ga0070711_100315544 Ga0070711_1003155442 230
1130 3300005456 Ga0070678_100049265 Ga0070678_1000492653 230
1131 3300005457 Ga0070662_100415692 Ga0070662_1004156922 230
1132 3300005535 Ga0070684_100041153 Ga0070684_1000411532 230
1133 3300005547 Ga0070693_100200729 Ga0070693_1002007292 230
1134 3300006844 Ga0075428_100002189 Ga0075428_10000218918 230
1135 3300006844 Ga0075428_100011781 Ga0075428_1000117816 230
1136 3300006844 Ga0075428_100235960 Ga0075428_1002359602 230
1137 3300006846 Ga0075430_100000722 Ga0075430_10000072217 230
1138 3300006846 Ga0075430_100137176 Ga0075430_1001371762 230
1139 3300006847 Ga0075431_100019089 Ga0075431_1000190895 230
1140 3300006847 Ga0075431_100086340 Ga0075431_1000863404 230
1141 3300006852 Ga0075433_10005767 Ga0075433_100057676 230
1142 3300006852 Ga0075433_10028350 Ga0075433_100283506 230
1143 3300006852 Ga0075433_10076283 Ga0075433_100762833 230
1144 3300006871 Ga0075434_100154420 Ga0075434_1001544202 230
1145 3300006880 Ga0075429_100002690 Ga0075429_10000269013 230
1146 3300006880 Ga0075429_100051671 Ga0075429_1000516714 230
1147 3300006880 Ga0075429_100125991 Ga0075429_1001259914 230
1148 3300006880 Ga0075429_100477268 Ga0075429_1004772681 230
1149 3300009094 Ga0111539_10003342 Ga0111539_100033424 230
1150 3300009094 Ga0111539_10015022 Ga0111539_100150229 230
1151 3300009147 Ga0114129_10013149 Ga0114129_100131494 230
1152 3300009147 Ga0114129_10017204 Ga0114129_100172046 230
1153 3300009147 Ga0114129_10019409 Ga0114129_100194095 230
1154 3300009147 Ga0114129_10286990 Ga0114129_102869904 230
1155 3300009148 Ga0105243_10670225 Ga0105243_106702251 230
1156 3300013306 Ga0163162_10360614 Ga0163162_103606142 230
1157 3300014325 Ga0163163_10362623 Ga0163163_103626232 230
1158 3300021384 Ga0213876_10104207 Ga0213876_101042072 230
1159 3300025315 Ga0207697_10002984 Ga0207697_100029844 230
1160 3300025901 Ga0207688_10018825 Ga0207688_100188252 230
1161 3300025912 Ga0207707_10072644 Ga0207707_100726443 230
1162 3300025925 Ga0207650_10089217 Ga0207650_100892172 230
1163 3300025937 Ga0207669_10167628 Ga0207669_101676282 230
1164 3300025940 Ga0207691_10400216 Ga0207691_104002162 230
1165 3300025945 Ga0207679_10052501 Ga0207679_100525012 230
1166 3300025986 Ga0207658_10185036 Ga0207658_101850362 230
1167 3300026067 Ga0207678_10026289 Ga0207678_100262896 230
1168 3300026095 Ga0207676_10363959 Ga0207676_103639592 230
1169 3300026118 Ga0207675_100029006 Ga0207675_1000290063 230
1170 3300027682 Ga0209971_1005060 Ga0209971_10050602 230
1171 3300027907 Ga0207428_10000531 Ga0207428_1000053124 230
1172 3300027907 Ga0207428_10067695 Ga0207428_100676952 230
1173 3300031548 Ga0307408_100013807 Ga0307408_1000138074 230
1174 3300031548 Ga0307408_100082347 Ga0307408_1000823473 230
1175 3300031731 Ga0307405_10077332 Ga0307405_100773323 230
1176 3300031995 Ga0307409_100136343 Ga0307409_1001363432 230
1177 3300032002 Ga0307416_100031387 Ga0307416_1000313874 230
1178 3300032002 Ga0307416_100051654 Ga0307416_1000516543 230
1179 3300032002 Ga0307416_100874177 Ga0307416_1008741772 230
1180 3300032005 Ga0307411_10110149 Ga0307411_101101492 230
1181 3300039437 Ga0436365_0603834 Ga0436365_0603834_119_919 230
1182 3300041460 Ga0451802_1074021 Ga0451802_1074021_730_1548 230
1183 3300042000 Ga0439437_004082 Ga0439437_004082_412_1227 230
1184 3300042008 Ga0439450_001044 Ga0439450_001044_225_1040 230
1185 3300042439 Ga0439464_0002262 Ga0439464_0002262_1961_2776 230
1186 3300042876 Ga0451577_0036902 Ga0451577_0036902_1024_1842 230
1187 3300044712 Ga0453684_0238100 Ga0453684_0238100_1189_2007 230
1188 3300045051 Ga0451576_0191819 Ga0451576_0191819_1079_1897 230
1189 3300048904 Ga0496101_0647389 Ga0496101_0647389_47_775 230
1190 3300048905 Ga0496102_0010247 Ga0496102_0010247_3488_4306 230
1191 3300048910 Ga0496107_0073966 Ga0496107_0073966_1567_2385 230
1192 3300048911 Ga0496108_0250105 Ga0496108_0250105_88_906 230
1193 3300048912 Ga0496109_0428121 Ga0496109_0428121_283_1083 230
1194 3300048913 Ga0496110_0025373 Ga0496110_0025373_4055_4873 230
1195 3300048915 Ga0496112_0028083 Ga0496112_0028083_1887_2705 230
1196 3300049515 Ga0501292_003919 Ga0501292_003919_442_1257 230
1197 3300049518 Ga0501295_030850 Ga0501295_030850_50_865 230
1198 3300049522 Ga0501299_001454 Ga0501299_001454_1235_2050 230
1199 3300049591 Ga0501075_0152726 Ga0501075_0152726_470_1267 230
1200 3300049592 Ga0501076_0269868 Ga0501076_0269868_391_1209 230
1201 3300049652 Ga0501202_019612 Ga0501202_019612_359_1174 230
1202 3300049689 Ga0501260_007122 Ga0501260_007122_136_951 230
1203 3300049704 Ga0501221_007064 Ga0501221_007064_957_1772 230
1204 3300049705 Ga0501225_0038322 Ga0501225_0038322_459_1274 230
1205 3300049741 Ga0501079_0524765 Ga0501079_0524765_71_889 230
1206 3300049742 Ga0501080_0074665 Ga0501080_0074665_259_1077 230
1207 3300049744 Ga0501083_0409890 Ga0501083_0409890_109_852 230
1208 3300049779 Ga0501283_003346 Ga0501283_003346_162_977 230
1209 3300050507 nmdc:mga05p37_21_c1 nmdc:mga05p37_21_c1_57879_58691 230
1210 3300050507 nmdc:mga05p37_2516_c1 nmdc:mga05p37_2516_c1_12405_13220 230
1211 3300050508 nmdc:mga09592_255414_c1 nmdc:mga09592_255414_c1_630_1445 230
1212 3300050508 nmdc:mga09592_32171_c1 nmdc:mga09592_32171_c1_2123_2938 230
1213 3300050509 nmdc:mga0qj67_160782_c1 nmdc:mga0qj67_160782_c1_971_1783 230
1214 3300050509 nmdc:mga0qj67_403551_c1 nmdc:mga0qj67_403551_c1_190_1005 230
1215 3300050509 nmdc:mga0qj67_4908_c1 nmdc:mga0qj67_4908_c1_7502_8317 230
1216 3300050510 nmdc:mga06r32_21546_c1 nmdc:mga06r32_21546_c1_557_1372 230
1217 3300050510 nmdc:mga06r32_7703_c1 nmdc:mga06r32_7703_c1_4849_5664 230
1218 3300050510 nmdc:mga06r32_82852_c1 nmdc:mga06r32_82852_c1_1844_2656 230
1219 3300050511 nmdc:mga08y16_11940_c1 nmdc:mga08y16_11940_c1_4744_5556 230
1220 3300050511 nmdc:mga08y16_41792_c1 nmdc:mga08y16_41792_c1_1564_2379 230
1221 3300050512 nmdc:mga0n895_96237_c1 nmdc:mga0n895_96237_c1_1393_2211 230
1222 3300050515 nmdc:mga0a205_12745_c1 nmdc:mga0a205_12745_c1_4505_5323 230
1223 3300050515 nmdc:mga0a205_53491_c1 nmdc:mga0a205_53491_c1_1344_2162 230
1224 3300050515 nmdc:mga0a205_679409_c1 nmdc:mga0a205_679409_c1_29_841 230
1225 3300059421 Ga0590071_031688 Ga0590071_031688_320_1132 230
1226 3300060353 Ga0501082_0275754 Ga0501082_0275754_653_1450 230
1227 2162886007 SwRhRL2b_contig_235890 SwRhRL2b_0784.00002000 231
1228 3300005289 Ga0065704_10002200 Ga0065704_100022003 231
1229 3300005295 Ga0065707_10000865 Ga0065707_100008657 231
1230 3300005335 Ga0070666_10326109 Ga0070666_103261091 231
1231 3300005354 Ga0070675_100490361 Ga0070675_1004903611 231
1232 3300005440 Ga0070705_100382639 Ga0070705_1003826392 231
1233 3300005444 Ga0070694_100680906 Ga0070694_1006809061 231
1234 3300005445 Ga0070708_100029801 Ga0070708_1000298015 231
1235 3300005459 Ga0068867_100052763 Ga0068867_1000527632 231
1236 3300005471 Ga0070698_100261779 Ga0070698_1002617792 231
1237 3300005535 Ga0070684_100072483 Ga0070684_1000724833 231
1238 3300005546 Ga0070696_100393324 Ga0070696_1003933242 231
1239 3300005564 Ga0070664_100029409 Ga0070664_1000294093 231
1240 3300005618 Ga0068864_100182739 Ga0068864_1001827391 231
1241 3300006852 Ga0075433_10230196 Ga0075433_102301961 231
1242 3300006871 Ga0075434_100001546 Ga0075434_10000154618 231
1243 3300006881 Ga0068865_100203298 Ga0068865_1002032982 231
1244 3300009147 Ga0114129_10070085 Ga0114129_100700854 231
1245 3300014325 Ga0163163_10240755 Ga0163163_102407551 231
1246 3300025903 Ga0207680_10266201 Ga0207680_102662012 231
1247 3300025926 Ga0207659_10131900 Ga0207659_101319003 231
1248 3300025944 Ga0207661_10255896 Ga0207661_102558962 231
1249 3300025945 Ga0207679_10040639 Ga0207679_100406393 231
1250 3300025960 Ga0207651_10010494 Ga0207651_100104943 231
1251 3300028381 Ga0268264_10678721 Ga0268264_106787212 231
1252 3300045051 Ga0451576_0689132 Ga0451576_0689132_35_826 231
1253 3300046522 Ga0495643_0002984 Ga0495643_0002984_6849_7643 231
1254 3300046528 Ga0495642_0094024 Ga0495642_0094024_217_945 231
1255 3300046674 Ga0495588_0138723 Ga0495588_0138723_295_1089 231
1256 3300049580 Ga0501046_0022162 Ga0501046_0022162_83_826 231
1257 3300050515 nmdc:mga0a205_78897_c1 nmdc:mga0a205_78897_c1_900_1691 231
1258 3300059424 Ga0590075_001820 Ga0590075_001820_3645_4439 231

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

34

245

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oih-assembly1.cif.gz_D crystal structure of o-antigen polysaccharide abc-transporter 0.8707 2 225
6oih-assembly2.cif.gz_C crystal structure of o-antigen polysaccharide abc-transporter 0.8685 2 225
7k2t-assembly1.cif.gz_B mg2+/atp-bound structure of the full-length wzmwzt o antigen abc transporter in lipid nanodiscs 0.8611 3 225
6m96-assembly1.cif.gz_B-2 atp-bound conformation of the wzmwzt o antigen abc transporter 0.8424 1 225
8dku-assembly1.cif.gz_B cryoem structure of the a. aeolicus wzmwzt transporter bound to the native o antigen 0.8385 3 225
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6943 34 220 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6912 34 219 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6124 14 219 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.579 34 220 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5764 34 219 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A3N5G2W3-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9137 44 230 GO:0015920
GO:0043190
GO:0140359
AF-M9SIA6-F1-model_v4 O-antigen export system permease protein RfbD 0.9122 2 231 GO:0005886
GO:0015920
GO:0140359
AF-A0A2V9RIV5-F1-model_v4 Transport permease protein 0.9076 2 226 GO:0005886
GO:0015920
GO:0140359
AF-A0A1F9V5P3-F1-model_v4 Transport permease protein 0.9074 3 231 GO:0005886
GO:0015920
GO:0140359
AF-C0B9B4-F1-model_v4 Transport permease protein 0.9057 1 219 GO:0015920
GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
85.49 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map