F492271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1258 | 517 | 1225 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300005457|Ga0070662_100009196|Ga0070662_1000091968 |
| Length | 201 |
| Sequence | MVIAALPEPASDSYHLLHRVVDMTRTVQETSMTETASYRTVFGSLDRYEKGGVQAISDDVKHYAFSNCFEIASKSKPYEKVVFGQNQIYVLETLRAEGDSPWYTCAHDEFALVMDGEVDVHLVKLDAAQTVPDTEHNGAVRVEGEPRGTNMGWMRLRRGHQALLPKNTAYRFRSAKPGVVVLQTCKGDLSIERWAEICQTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 3 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 4 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 5 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 6 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 7 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 8 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 9 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 10 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 11 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 12 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 13 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 14 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 15 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 16 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 17 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 18 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 19 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 20 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 21 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 22 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 23 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 24 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 25 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 26 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 27 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 28 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 29 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 30 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 31 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 32 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 33 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 34 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 35 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 36 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 37 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 40 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 41 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 42 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 43 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 44 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 45 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 46 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 47 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 48 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 50 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 51 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 52 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 53 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 55 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 56 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 57 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 58 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 59 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 60 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 61 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 62 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 63 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 67 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 70 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 73 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 74 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 98 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 102 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 105 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 110 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 112 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 113 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 114 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 116 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 117 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 118 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 119 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 120 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 121 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 122 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 123 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 124 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 125 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 126 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 127 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 128 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 129 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 130 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 131 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 132 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 133 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 134 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 135 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 136 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 138 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 139 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 140 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 141 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 142 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 143 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 144 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 145 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 147 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 162 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 163 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 164 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 176 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 180 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 181 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 182 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 183 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 185 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 186 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 193 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 264 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 266 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 270 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 271 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 272 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 273 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 274 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 275 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 276 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 277 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 278 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 279 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 280 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 281 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 282 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 283 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 284 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 285 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 286 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 287 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 288 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 289 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 290 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 291 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 292 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 293 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 295 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 296 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 297 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 298 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 299 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 300 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 301 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 302 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 303 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 304 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 305 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 306 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 307 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 308 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 309 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 310 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 311 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 312 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 313 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 314 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 315 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 316 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 317 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 318 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 319 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 320 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 321 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 322 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 323 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 324 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 325 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 326 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 327 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 328 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 329 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 330 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 331 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 332 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 333 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 334 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 335 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 336 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 337 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 338 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 339 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 340 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 341 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 342 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 423 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 424 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 425 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 426 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 427 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 428 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 429 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 430 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 431 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 432 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 433 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 434 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 435 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 436 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 437 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 438 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 439 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 440 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 441 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 442 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 445 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 446 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 447 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 448 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 449 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 452 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 453 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 455 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 456 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 457 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 458 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 459 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 460 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 461 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 462 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 463 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 465 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 466 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 467 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 468 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 469 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 470 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 471 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 472 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 475 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 476 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 477 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 478 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 479 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 482 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 484 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 485 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 486 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 487 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 488 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 489 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 490 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 491 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 492 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 493 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 494 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 495 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 496 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 497 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 499 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 500 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 501 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 502 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 503 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 504 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 505 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 506 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 507 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 508 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 509 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 510 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 511 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 512 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 513 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 514 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 515 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 516 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 517 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.38 |
| Metatranscriptomes | 0 |
| Isolates | 2.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.41 |
| Nodule | 0.24 |
| Rhizoplane | 1.99 |
| Rhizosphere | 73.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10010212 | 3300001979 | Bacteria | 3628 |
| 2 | JGI25152J39213_1014372 | 3300002773 | Bacteria | 1609 |
| 3 | JGI25150J39212_1000692 | 3300002774 | Bacteria | 12226 |
| 4 | JGI25159J45721_1008171 | 3300002987 | Bacteria | 2904 |
| 5 | JGI25159J45721_1024032 | 3300002987 | Bacteria | 1093 |
| 6 | JGI25159J45721_1034896 | 3300002987 | Bacteria | 775 |
| 7 | JGI25151J46595_10000966 | 3300003187 | Bacteria | 21838 |
| 8 | JGI25151J46595_10032862 | 3300003187 | Bacteria | 2005 |
| 9 | JGI25151J46595_10033648 | 3300003187 | Bacteria | 1970 |
| 10 | JGI25151J46595_10049812 | 3300003187 | Bacteria | 1433 |
| 11 | JGI25153J46596_10015324 | 3300003215 | Bacteria | 3129 |
| 12 | JGI25153J46596_10038516 | 3300003215 | Bacteria | 1506 |
| 13 | rootH2_10009454 | 3300003320 | Bacteria | 2620 |
| 14 | rootL2_10020422 | 3300003322 | Bacteria | 3875 |
| 15 | rootL2_10113471 | 3300003322 | Bacteria | 1287 |
| 16 | JGI25160J50197_1051024 | 3300003354 | Bacteria | 877 |
| 17 | JGI25160J50197_1058914 | 3300003354 | Bacteria | 775 |
| 18 | JGI25407J50210_10071250 | 3300003373 | Bacteria | 867 |
| 19 | JGI25161J50226_1006587 | 3300003374 | Bacteria | 2076 |
| 20 | JGI25161J50226_1019299 | 3300003374 | Bacteria | 698 |
| 21 | Ga0055532_1015032 | 3300003758 | Bacteria | 860 |
| 22 | Ga0055527_1008415 | 3300003760 | Bacteria | 1232 |
| 23 | Ga0055535_1001074 | 3300003761 | Bacteria | 16812 |
| 24 | Ga0055542_1000074 | 3300003762 | Bacteria | 141185 |
| 25 | Ga0055526_1042004 | 3300003771 | Bacteria | 1132 |
| 26 | Ga0055526_1063622 | 3300003771 | Bacteria | 775 |
| 27 | Ga0055537_1013714 | 3300003773 | Bacteria | 1506 |
| 28 | Ga0055537_1014024 | 3300003773 | Bacteria | 1473 |
| 29 | Ga0055524_1061519 | 3300003775 | Bacteria | 775 |
| 30 | Ga0055536_1000980 | 3300003781 | Bacteria | 18127 |
| 31 | Ga0055536_1013599 | 3300003781 | Bacteria | 2920 |
| 32 | Ga0055534_1006770 | 3300003784 | Bacteria | 2834 |
| 33 | Ga0055534_1011553 | 3300003784 | Bacteria | 1789 |
| 34 | Ga0055534_1018300 | 3300003784 | Bacteria | 1221 |
| 35 | Ga0055534_1018301 | 3300003784 | Bacteria | 1221 |
| 36 | Ga0055528_1015002 | 3300003790 | Bacteria | 2823 |
| 37 | Ga0055528_1029096 | 3300003790 | Bacteria | 1506 |
| 38 | Ga0055530_10000437 | 3300003791 | Bacteria | 37027 |
| 39 | Ga0055530_10011577 | 3300003791 | Bacteria | 3153 |
| 40 | Ga0055540_1002229 | 3300003792 | Bacteria | 10495 |
| 41 | Ga0055540_1005977 | 3300003792 | Bacteria | 4940 |
| 42 | Ga0055540_1007891 | 3300003792 | Bacteria | 3927 |
| 43 | Ga0055531_10000809 | 3300003794 | Bacteria | 25914 |
| 44 | Ga0055531_10025336 | 3300003794 | Bacteria | 2158 |
| 45 | Ga0055531_10027333 | 3300003794 | Bacteria | 2005 |
| 46 | Ga0055543_1043910 | 3300004625 | Bacteria | 747 |
| 47 | Ga0065165_1011798 | 3300005262 | Bacteria | 3603 |
| 48 | Ga0065714_10104460 | 3300005288 | Bacteria | 1584 |
| 49 | Ga0065714_10204003 | 3300005288 | Bacteria | 886 |
| 50 | Ga0065704_10081990 | 3300005289 | Bacteria | 3672 |
| 51 | Ga0065712_10316088 | 3300005290 | Bacteria | 836 |
| 52 | Ga0065707_10101401 | 3300005295 | Bacteria | 2867 |
| 53 | Ga0070658_10057194 | 3300005327 | Bacteria | 3172 |
| 54 | Ga0070658_10382387 | 3300005327 | Bacteria | 1208 |
| 55 | Ga0070658_10682662 | 3300005327 | Bacteria | 891 |
| 56 | Ga0070676_10002959 | 3300005328 | Bacteria | 8775 |
| 57 | Ga0070676_10003006 | 3300005328 | Bacteria | 8721 |
| 58 | Ga0070676_10009607 | 3300005328 | Bacteria | 5226 |
| 59 | Ga0070676_10048770 | 3300005328 | Bacteria | 2476 |
| 60 | Ga0070676_10115300 | 3300005328 | Bacteria | 1678 |
| 61 | Ga0070683_100124461 | 3300005329 | Unclassified | 2437 |
| 62 | Ga0070683_100179924 | 3300005329 | Bacteria | 2007 |
| 63 | Ga0070683_100503711 | 3300005329 | Unclassified | 1157 |
| 64 | Ga0070690_100176086 | 3300005330 | Bacteria | 1475 |
| 65 | Ga0070690_100300565 | 3300005330 | Bacteria | 1151 |
| 66 | Ga0070670_100011371 | 3300005331 | Bacteria | 7609 |
| 67 | Ga0070670_100158075 | 3300005331 | Bacteria | 1964 |
| 68 | Ga0070670_100166921 | 3300005331 | Bacteria | 1909 |
| 69 | Ga0070670_100254958 | 3300005331 | Bacteria | 1529 |
| 70 | Ga0070677_10265891 | 3300005333 | Bacteria | 858 |
| 71 | Ga0068869_100004690 | 3300005334 | Bacteria | 8530 |
| 72 | Ga0068869_100014419 | 3300005334 | Bacteria | 5279 |
| 73 | Ga0068869_100066156 | 3300005334 | Bacteria | 2662 |
| 74 | Ga0068869_101290440 | 3300005334 | Bacteria | 644 |
| 75 | Ga0070666_10002130 | 3300005335 | Bacteria | 12031 |
| 76 | Ga0070666_10242878 | 3300005335 | Bacteria | 1274 |
| 77 | Ga0070666_10582288 | 3300005335 | Bacteria | 816 |
| 78 | Ga0070680_100051495 | 3300005336 | Bacteria | 3360 |
| 79 | Ga0070680_100311391 | 3300005336 | Bacteria | 1336 |
| 80 | Ga0068868_100051509 | 3300005338 | Bacteria | 3239 |
| 81 | Ga0068868_100054986 | 3300005338 | Bacteria | 3139 |
| 82 | Ga0068868_100155069 | 3300005338 | Bacteria | 1888 |
| 83 | Ga0068868_100964320 | 3300005338 | Unclassified | 778 |
| 84 | Ga0068868_101602450 | 3300005338 | Bacteria | 612 |
| 85 | Ga0070689_100014421 | 3300005340 | Bacteria | 5741 |
| 86 | Ga0070691_10218433 | 3300005341 | Bacteria | 1009 |
| 87 | Ga0070691_10281495 | 3300005341 | Bacteria | 902 |
| 88 | Ga0070687_100118412 | 3300005343 | Bacteria | 1511 |
| 89 | Ga0070661_100143938 | 3300005344 | Bacteria | 1798 |
| 90 | Ga0070668_100010950 | 3300005347 | Bacteria | 6748 |
| 91 | Ga0070668_100122730 | 3300005347 | Bacteria | 2078 |
| 92 | Ga0070668_100256205 | 3300005347 | Bacteria | 1454 |
| 93 | Ga0070668_100574926 | 3300005347 | Bacteria | 983 |
| 94 | Ga0070669_100250334 | 3300005353 | Bacteria | 1411 |
| 95 | Ga0070669_100568517 | 3300005353 | Bacteria | 947 |
| 96 | Ga0070669_100947023 | 3300005353 | Bacteria | 737 |
| 97 | Ga0070669_101122731 | 3300005353 | Unclassified | 677 |
| 98 | Ga0070675_100008998 | 3300005354 | Bacteria | 7757 |
| 99 | Ga0070675_100278711 | 3300005354 | Bacteria | 1469 |
| 100 | Ga0070675_100488535 | 3300005354 | Bacteria | 1108 |
| 101 | Ga0070671_100001982 | 3300005355 | Bacteria | 15714 |
| 102 | Ga0070671_100049526 | 3300005355 | Bacteria | 3495 |
| 103 | Ga0070671_100073564 | 3300005355 | Bacteria | 2854 |
| 104 | Ga0070671_100199979 | 3300005355 | Bacteria | 1694 |
| 105 | Ga0070671_100283273 | 3300005355 | Bacteria | 1410 |
| 106 | Ga0070671_101205393 | 3300005355 | Unclassified | 666 |
| 107 | Ga0070674_100031734 | 3300005356 | Bacteria | 3503 |
| 108 | Ga0070674_100104587 | 3300005356 | Bacteria | 2069 |
| 109 | Ga0070674_100388003 | 3300005356 | Bacteria | 1138 |
| 110 | Ga0070674_100775468 | 3300005356 | Bacteria | 826 |
| 111 | Ga0070673_100000636 | 3300005364 | Bacteria | 19252 |
| 112 | Ga0070673_100017149 | 3300005364 | Bacteria | 5140 |
| 113 | Ga0070673_100068716 | 3300005364 | Bacteria | 2838 |
| 114 | Ga0070673_100582773 | 3300005364 | Bacteria | 1019 |
| 115 | Ga0070673_100772804 | 3300005364 | Bacteria | 886 |
| 116 | Ga0070688_100206154 | 3300005365 | Bacteria | 1378 |
| 117 | Ga0070688_100241403 | 3300005365 | Bacteria | 1282 |
| 118 | Ga0070659_100368624 | 3300005366 | Bacteria | 1208 |
| 119 | Ga0070667_100000916 | 3300005367 | Bacteria | 27234 |
| 120 | Ga0070667_100001639 | 3300005367 | Bacteria | 20014 |
| 121 | Ga0070667_100108331 | 3300005367 | Bacteria | 2407 |
| 122 | Ga0070667_100254517 | 3300005367 | Bacteria | 1570 |
| 123 | Ga0070667_100276685 | 3300005367 | Bacteria | 1506 |
| 124 | Ga0070667_101108948 | 3300005367 | Bacteria | 740 |
| 125 | Ga0070709_10041462 | 3300005434 | Bacteria | 2837 |
| 126 | Ga0070713_100079415 | 3300005436 | Bacteria | 2795 |
| 127 | Ga0070710_11181176 | 3300005437 | Bacteria | 565 |
| 128 | Ga0070701_10067484 | 3300005438 | Bacteria | 1903 |
| 129 | Ga0070701_10236218 | 3300005438 | Bacteria | 1097 |
| 130 | Ga0070705_100187047 | 3300005440 | Unclassified | 1408 |
| 131 | Ga0070700_100021338 | 3300005441 | Bacteria | 3764 |
| 132 | Ga0070700_100046369 | 3300005441 | Bacteria | 2685 |
| 133 | Ga0070700_100766040 | 3300005441 | Bacteria | 774 |
| 134 | Ga0070700_101235732 | 3300005441 | Bacteria | 625 |
| 135 | Ga0070708_100033241 | 3300005445 | Bacteria | 4481 |
| 136 | Ga0070708_100188876 | 3300005445 | Unclassified | 1927 |
| 137 | Ga0070708_100197772 | 3300005445 | Bacteria | 1881 |
| 138 | Ga0070708_100373113 | 3300005445 | Bacteria | 1345 |
| 139 | Ga0070708_100551649 | 3300005445 | Bacteria | 1087 |
| 140 | Ga0070663_100185389 | 3300005455 | Bacteria | 1617 |
| 141 | Ga0070663_101674885 | 3300005455 | Bacteria | 568 |
| 142 | Ga0070678_100005995 | 3300005456 | Bacteria | 7083 |
| 143 | Ga0070678_100178927 | 3300005456 | Bacteria | 1734 |
| 144 | Ga0070678_100282242 | 3300005456 | Bacteria | 1405 |
| 145 | Ga0070678_100296129 | 3300005456 | Bacteria | 1373 |
| 146 | Ga0070678_100581387 | 3300005456 | Bacteria | 998 |
| 147 | Ga0070678_101275078 | 3300005456 | Bacteria | 683 |
| 148 | Ga0070662_100002338 | 3300005457 | Bacteria | 11655 |
| 149 | Ga0070662_100009196 | 3300005457 | Bacteria | 6451 |
| 150 | Ga0070662_100074970 | 3300005457 | Bacteria | 2504 |
| 151 | Ga0070662_100189153 | 3300005457 | Bacteria | 1627 |
| 152 | Ga0070681_10029856 | 3300005458 | Bacteria | 5472 |
| 153 | Ga0070681_10631726 | 3300005458 | Unclassified | 986 |
| 154 | Ga0070681_10961264 | 3300005458 | Unclassified | 773 |
| 155 | Ga0068867_100000664 | 3300005459 | Bacteria | 22809 |
| 156 | Ga0068867_100013814 | 3300005459 | Bacteria | 5717 |
| 157 | Ga0068867_100029743 | 3300005459 | Bacteria | 3936 |
| 158 | Ga0068867_100032411 | 3300005459 | Bacteria | 3779 |
| 159 | Ga0068867_100142501 | 3300005459 | Bacteria | 1875 |
| 160 | Ga0068867_100154895 | 3300005459 | Bacteria | 1803 |
| 161 | Ga0068867_100212789 | 3300005459 | Bacteria | 1553 |
| 162 | Ga0068867_100843491 | 3300005459 | Bacteria | 820 |
| 163 | Ga0070685_10514457 | 3300005466 | Bacteria | 849 |
| 164 | Ga0070685_10633233 | 3300005466 | Bacteria | 773 |
| 165 | Ga0070685_10678964 | 3300005466 | Bacteria | 749 |
| 166 | Ga0070685_10681485 | 3300005466 | Bacteria | 748 |
| 167 | Ga0070707_100010736 | 3300005468 | Bacteria | 8530 |
| 168 | Ga0070698_100423339 | 3300005471 | Bacteria | 1266 |
| 169 | Ga0070698_100833995 | 3300005471 | Bacteria | 866 |
| 170 | Ga0070679_100183717 | 3300005530 | Bacteria | 2063 |
| 171 | Ga0070684_100026516 | 3300005535 | Bacteria | 4885 |
| 172 | Ga0070697_100010956 | 3300005536 | Bacteria | 7083 |
| 173 | Ga0068853_100009688 | 3300005539 | Bacteria | 7768 |
| 174 | Ga0068853_100011188 | 3300005539 | Bacteria | 7280 |
| 175 | Ga0068853_100509540 | 3300005539 | Bacteria | 1137 |
| 176 | Ga0068853_101150454 | 3300005539 | Bacteria | 749 |
| 177 | Ga0070672_100000215 | 3300005543 | Bacteria | 31837 |
| 178 | Ga0070672_100007533 | 3300005543 | Bacteria | 7394 |
| 179 | Ga0070672_100220183 | 3300005543 | Bacteria | 1592 |
| 180 | Ga0070672_100375068 | 3300005543 | Bacteria | 1216 |
| 181 | Ga0070672_100383809 | 3300005543 | Bacteria | 1202 |
| 182 | Ga0070672_100529513 | 3300005543 | Bacteria | 1021 |
| 183 | Ga0070672_101011538 | 3300005543 | Bacteria | 737 |
| 184 | Ga0070686_100058846 | 3300005544 | Bacteria | 2474 |
| 185 | Ga0070695_101196718 | 3300005545 | Unclassified | 625 |
| 186 | Ga0070665_100025474 | 3300005548 | Bacteria | 5959 |
| 187 | Ga0070665_100055275 | 3300005548 | Bacteria | 3981 |
| 188 | Ga0070665_100409201 | 3300005548 | Bacteria | 1365 |
| 189 | Ga0070665_100446518 | 3300005548 | Bacteria | 1303 |
| 190 | Ga0068855_100000166 | 3300005563 | Bacteria | 83838 |
| 191 | Ga0068855_100164792 | 3300005563 | Plasmid | 2513 |
| 192 | Ga0068855_100242436 | 3300005563 | Bacteria | 2013 |
| 193 | Ga0070664_100022201 | 3300005564 | Bacteria | 5235 |
| 194 | Ga0070664_100241622 | 3300005564 | Bacteria | 1621 |
| 195 | Ga0068857_100006977 | 3300005577 | Bacteria | 9719 |
| 196 | Ga0068857_100012327 | 3300005577 | Bacteria | 7440 |
| 197 | Ga0068857_100069621 | 3300005577 | Bacteria | 3133 |
| 198 | Ga0068857_100209974 | 3300005577 | Bacteria | 1776 |
| 199 | Ga0068854_100039212 | 3300005578 | Bacteria | 3336 |
| 200 | Ga0068854_100169572 | 3300005578 | Bacteria | 1697 |
| 201 | Ga0068856_100123773 | 3300005614 | Plasmid | 2588 |
| 202 | Ga0068856_100198462 | 3300005614 | Bacteria | 2021 |
| 203 | Ga0068856_100649653 | 3300005614 | Bacteria | 1075 |
| 204 | Ga0070702_101158956 | 3300005615 | Bacteria | 621 |
| 205 | Ga0068852_100180934 | 3300005616 | Bacteria | 1982 |
| 206 | Ga0068852_100291220 | 3300005616 | Bacteria | 1577 |
| 207 | Ga0068852_100516312 | 3300005616 | Bacteria | 1192 |
| 208 | Ga0068852_101004876 | 3300005616 | Bacteria | 853 |
| 209 | Ga0068852_102122197 | 3300005616 | Bacteria | 584 |
| 210 | Ga0068859_100010428 | 3300005617 | Bacteria | 9349 |
| 211 | Ga0068859_100154256 | 3300005617 | Bacteria | 2373 |
| 212 | Ga0068859_100175040 | 3300005617 | Bacteria | 2228 |
| 213 | Ga0068859_100252906 | 3300005617 | Bacteria | 1852 |
| 214 | Ga0068859_100338867 | 3300005617 | Bacteria | 1598 |
| 215 | Ga0068859_100413590 | 3300005617 | Bacteria | 1445 |
| 216 | Ga0068864_100011184 | 3300005618 | Bacteria | 7416 |
| 217 | Ga0068864_100015192 | 3300005618 | Bacteria | 6403 |
| 218 | Ga0068864_100735631 | 3300005618 | Bacteria | 966 |
| 219 | Ga0068866_10019710 | 3300005718 | Bacteria | 3077 |
| 220 | Ga0068866_10064676 | 3300005718 | Bacteria | 1910 |
| 221 | Ga0068861_100006063 | 3300005719 | Bacteria | 8218 |
| 222 | Ga0068861_100136966 | 3300005719 | Bacteria | 1993 |
| 223 | Ga0068851_10040298 | 3300005834 | Bacteria | 2348 |
| 224 | Ga0068851_10045449 | 3300005834 | Bacteria | 2219 |
| 225 | Ga0068870_10032629 | 3300005840 | Bacteria | 2650 |
| 226 | Ga0068870_10504622 | 3300005840 | Bacteria | 807 |
| 227 | Ga0068863_100001567 | 3300005841 | Bacteria | 22604 |
| 228 | Ga0068863_100001722 | 3300005841 | Bacteria | 21666 |
| 229 | Ga0068863_100380730 | 3300005841 | Bacteria | 1378 |
| 230 | Ga0068858_100000628 | 3300005842 | Bacteria | 36756 |
| 231 | Ga0068858_100058676 | 3300005842 | Bacteria | 3559 |
| 232 | Ga0068858_100323282 | 3300005842 | Bacteria | 1475 |
| 233 | Ga0068858_100488267 | 3300005842 | Bacteria | 1189 |
| 234 | Ga0068858_100852913 | 3300005842 | Bacteria | 890 |
| 235 | Ga0068858_101001619 | 3300005842 | Bacteria | 819 |
| 236 | Ga0068860_100002622 | 3300005843 | Bacteria | 18697 |
| 237 | Ga0068860_100008901 | 3300005843 | Bacteria | 10002 |
| 238 | Ga0068860_100184807 | 3300005843 | Bacteria | 2015 |
| 239 | Ga0068860_100474576 | 3300005843 | Bacteria | 1246 |
| 240 | Ga0068860_101064532 | 3300005843 | Bacteria | 828 |
| 241 | Ga0068862_100049227 | 3300005844 | Bacteria | 3599 |
| 242 | Ga0068862_100071248 | 3300005844 | Bacteria | 3001 |
| 243 | Ga0068862_100087624 | 3300005844 | Bacteria | 2707 |
| 244 | Ga0068862_100223968 | 3300005844 | Bacteria | 1704 |
| 245 | Ga0068862_100483613 | 3300005844 | Bacteria | 1172 |
| 246 | Ga0068862_101026749 | 3300005844 | Bacteria | 816 |
| 247 | Ga0081455_10732466 | 3300005937 | Bacteria | 627 |
| 248 | Ga0075365_10000402 | 3300006038 | Bacteria | 15892 |
| 249 | Ga0075365_10188804 | 3300006038 | Bacteria | 1442 |
| 250 | Ga0075368_10072401 | 3300006042 | Bacteria | 1394 |
| 251 | Ga0075363_100006788 | 3300006048 | Bacteria | 5228 |
| 252 | Ga0075364_10006947 | 3300006051 | Bacteria | 6686 |
| 253 | Ga0075432_10028523 | 3300006058 | Bacteria | 1926 |
| 254 | Ga0075362_10018359 | 3300006177 | Bacteria | 2892 |
| 255 | Ga0075362_10026331 | 3300006177 | Bacteria | 2483 |
| 256 | Ga0075362_10075241 | 3300006177 | Bacteria | 1548 |
| 257 | Ga0075362_10079367 | 3300006177 | Bacteria | 1511 |
| 258 | Ga0075362_10123620 | 3300006177 | Bacteria | 1226 |
| 259 | Ga0075367_10052723 | 3300006178 | Bacteria | 2408 |
| 260 | Ga0075367_10106928 | 3300006178 | Bacteria | 1715 |
| 261 | Ga0075367_10173445 | 3300006178 | Bacteria | 1343 |
| 262 | Ga0075367_10355351 | 3300006178 | Bacteria | 925 |
| 263 | Ga0075367_10371852 | 3300006178 | Bacteria | 903 |
| 264 | Ga0075369_10162193 | 3300006186 | Bacteria | 1025 |
| 265 | Ga0075366_10006489 | 3300006195 | Bacteria | 6413 |
| 266 | Ga0075366_10015968 | 3300006195 | Bacteria | 4311 |
| 267 | Ga0075366_10018726 | 3300006195 | Bacteria | 4000 |
| 268 | Ga0075366_10021592 | 3300006195 | Bacteria | 3742 |
| 269 | Ga0075366_10038020 | 3300006195 | Bacteria | 2842 |
| 270 | Ga0075366_10053152 | 3300006195 | Bacteria | 2406 |
| 271 | Ga0075366_10064372 | 3300006195 | Bacteria | 2181 |
| 272 | Ga0075366_10073073 | 3300006195 | Bacteria | 2044 |
| 273 | Ga0075366_10077864 | 3300006195 | Bacteria | 1979 |
| 274 | Ga0075366_10095547 | 3300006195 | Bacteria | 1782 |
| 275 | Ga0075366_10153377 | 3300006195 | Bacteria | 1395 |
| 276 | Ga0075366_10212788 | 3300006195 | Bacteria | 1177 |
| 277 | Ga0075366_10774203 | 3300006195 | Bacteria | 597 |
| 278 | Ga0097621_100007488 | 3300006237 | Bacteria | 7815 |
| 279 | Ga0097621_100019592 | 3300006237 | Bacteria | 5197 |
| 280 | Ga0097621_100186892 | 3300006237 | Bacteria | 1793 |
| 281 | Ga0097621_100763867 | 3300006237 | Bacteria | 893 |
| 282 | Ga0097621_100779391 | 3300006237 | Bacteria | 885 |
| 283 | Ga0075370_10023306 | 3300006353 | Bacteria | 3407 |
| 284 | Ga0075370_10024490 | 3300006353 | Bacteria | 3335 |
| 285 | Ga0075370_10031608 | 3300006353 | Bacteria | 2955 |
| 286 | Ga0075370_10053353 | 3300006353 | Bacteria | 2294 |
| 287 | Ga0075370_10070417 | 3300006353 | Bacteria | 2000 |
| 288 | Ga0075370_10177611 | 3300006353 | Bacteria | 1252 |
| 289 | Ga0075370_10361938 | 3300006353 | Bacteria | 867 |
| 290 | Ga0075370_10416635 | 3300006353 | Bacteria | 807 |
| 291 | Ga0068871_100003128 | 3300006358 | Bacteria | 11356 |
| 292 | Ga0068871_100012228 | 3300006358 | Bacteria | 6320 |
| 293 | Ga0068871_100066423 | 3300006358 | Bacteria | 2956 |
| 294 | Ga0075428_100002991 | 3300006844 | Bacteria | 18429 |
| 295 | Ga0075428_100004497 | 3300006844 | Bacteria | 15397 |
| 296 | Ga0075428_100600102 | 3300006844 | Bacteria | 1176 |
| 297 | Ga0075428_102160969 | 3300006844 | Bacteria | 575 |
| 298 | Ga0075430_100019067 | 3300006846 | Bacteria | 5836 |
| 299 | Ga0075430_100053854 | 3300006846 | Bacteria | 3387 |
| 300 | Ga0075431_100308981 | 3300006847 | Bacteria | 1596 |
| 301 | Ga0075431_100604847 | 3300006847 | Bacteria | 1080 |
| 302 | Ga0075433_10174388 | 3300006852 | Bacteria | 1913 |
| 303 | Ga0075429_100022565 | 3300006880 | Bacteria | 5457 |
| 304 | Ga0075429_100264976 | 3300006880 | Bacteria | 1505 |
| 305 | Ga0068865_100003193 | 3300006881 | Bacteria | 9812 |
| 306 | Ga0068865_100003621 | 3300006881 | Bacteria | 9279 |
| 307 | Ga0068865_100005535 | 3300006881 | Bacteria | 7663 |
| 308 | Ga0068865_100037561 | 3300006881 | Bacteria | 3271 |
| 309 | Ga0068865_100199681 | 3300006881 | Bacteria | 1552 |
| 310 | Ga0068865_100204342 | 3300006881 | Bacteria | 1535 |
| 311 | Ga0068865_100703363 | 3300006881 | Bacteria | 864 |
| 312 | Ga0097620_100010429 | 3300006931 | Bacteria | 9349 |
| 313 | Ga0097620_100154273 | 3300006931 | Bacteria | 2373 |
| 314 | Ga0097620_100175044 | 3300006931 | Bacteria | 2228 |
| 315 | Ga0097620_100252899 | 3300006931 | Bacteria | 1852 |
| 316 | Ga0097620_100338915 | 3300006931 | Bacteria | 1598 |
| 317 | Ga0097620_100413575 | 3300006931 | Bacteria | 1445 |
| 318 | Ga0099826_10065661 | 3300006948 | Bacteria | 2332 |
| 319 | Ga0105244_10017711 | 3300009036 | Bacteria | 4018 |
| 320 | Ga0105244_10140250 | 3300009036 | Bacteria | 1163 |
| 321 | Ga0105240_10000470 | 3300009093 | Bacteria | 74442 |
| 322 | Ga0105240_10002416 | 3300009093 | Bacteria | 30014 |
| 323 | Ga0105240_10173426 | 3300009093 | Bacteria | 2552 |
| 324 | Ga0105240_10876762 | 3300009093 | Bacteria | 967 |
| 325 | Ga0111539_10007916 | 3300009094 | Bacteria | 13552 |
| 326 | Ga0111539_10012627 | 3300009094 | Bacteria | 10584 |
| 327 | Ga0105245_10012561 | 3300009098 | Bacteria | 7370 |
| 328 | Ga0105245_10018645 | 3300009098 | Bacteria | 6069 |
| 329 | Ga0105245_10038455 | 3300009098 | Bacteria | 4257 |
| 330 | Ga0105245_10406613 | 3300009098 | Bacteria | 1362 |
| 331 | Ga0105245_10436021 | 3300009098 | Bacteria | 1316 |
| 332 | Ga0105245_10987911 | 3300009098 | Bacteria | 886 |
| 333 | Ga0114129_10008968 | 3300009147 | Bacteria | 14262 |
| 334 | Ga0105243_10000437 | 3300009148 | Bacteria | 43696 |
| 335 | Ga0105243_10002267 | 3300009148 | Bacteria | 16166 |
| 336 | Ga0105243_10016045 | 3300009148 | Bacteria | 5667 |
| 337 | Ga0105243_10035573 | 3300009148 | Bacteria | 3861 |
| 338 | Ga0105243_10149101 | 3300009148 | Bacteria | 2004 |
| 339 | Ga0105243_10214642 | 3300009148 | Bacteria | 1696 |
| 340 | Ga0105241_10024541 | 3300009174 | Bacteria | 4476 |
| 341 | Ga0105241_10076022 | 3300009174 | Bacteria | 2618 |
| 342 | Ga0105241_10198017 | 3300009174 | Bacteria | 1676 |
| 343 | Ga0105241_10228970 | 3300009174 | Unclassified | 1566 |
| 344 | Ga0105242_10005571 | 3300009176 | Bacteria | 9715 |
| 345 | Ga0105242_10025391 | 3300009176 | Bacteria | 4689 |
| 346 | Ga0105242_10172499 | 3300009176 | Bacteria | 1902 |
| 347 | Ga0105242_10295810 | 3300009176 | Bacteria | 1476 |
| 348 | Ga0105242_10356237 | 3300009176 | Bacteria | 1353 |
| 349 | Ga0105242_10640995 | 3300009176 | Bacteria | 1032 |
| 350 | Ga0105248_10002934 | 3300009177 | Bacteria | 18928 |
| 351 | Ga0105248_10110965 | 3300009177 | Bacteria | 3093 |
| 352 | Ga0105248_10315388 | 3300009177 | Bacteria | 1761 |
| 353 | Ga0105237_10001223 | 3300009545 | Bacteria | 34228 |
| 354 | Ga0105237_10004017 | 3300009545 | Bacteria | 17192 |
| 355 | Ga0105237_10010476 | 3300009545 | Bacteria | 9854 |
| 356 | Ga0105237_10066362 | 3300009545 | Bacteria | 3603 |
| 357 | Ga0105237_10102414 | 3300009545 | Bacteria | 2855 |
| 358 | Ga0105237_10189785 | 3300009545 | Bacteria | 2055 |
| 359 | Ga0105238_10000294 | 3300009551 | Bacteria | 55283 |
| 360 | Ga0105238_10006384 | 3300009551 | Bacteria | 11730 |
| 361 | Ga0105238_10017161 | 3300009551 | Bacteria | 7350 |
| 362 | Ga0105238_10071647 | 3300009551 | Bacteria | 3463 |
| 363 | Ga0105238_10122079 | 3300009551 | Bacteria | 2585 |
| 364 | Ga0105238_10158793 | 3300009551 | Bacteria | 2237 |
| 365 | Ga0105238_10500661 | 3300009551 | Bacteria | 1216 |
| 366 | Ga0105238_10848515 | 3300009551 | Unclassified | 930 |
| 367 | Ga0105249_10007568 | 3300009553 | Bacteria | 9475 |
| 368 | Ga0105249_10010948 | 3300009553 | Bacteria | 7972 |
| 369 | Ga0105249_10432539 | 3300009553 | Bacteria | 1352 |
| 370 | Ga0105239_10002071 | 3300010375 | Bacteria | 25990 |
| 371 | Ga0105239_10016024 | 3300010375 | Bacteria | 8296 |
| 372 | Ga0105239_10031117 | 3300010375 | Bacteria | 5871 |
| 373 | Ga0105239_10043988 | 3300010375 | Bacteria | 4896 |
| 374 | Ga0105239_10317522 | 3300010375 | Bacteria | 1756 |
| 375 | Ga0105239_10420815 | 3300010375 | Bacteria | 1513 |
| 376 | Ga0105239_10683668 | 3300010375 | Bacteria | 1173 |
| 377 | Ga0105246_10069868 | 3300011119 | Bacteria | 2468 |
| 378 | Ga0105246_10204120 | 3300011119 | Bacteria | 1539 |
| 379 | Ga0105246_10286655 | 3300011119 | Bacteria | 1323 |
| 380 | Ga0105246_10594420 | 3300011119 | Bacteria | 955 |
| 381 | Ga0105246_10833173 | 3300011119 | Bacteria | 821 |
| 382 | Ga0157322_1011987 | 3300012490 | Bacteria | 724 |
| 383 | Ga0157345_1008467 | 3300012498 | Bacteria | 860 |
| 384 | Ga0157339_1003029 | 3300012505 | Bacteria | 1183 |
| 385 | Ga0157373_10079134 | 3300013100 | Bacteria | 2318 |
| 386 | Ga0157371_10216837 | 3300013102 | Bacteria | 1374 |
| 387 | Ga0157370_10003332 | 3300013104 | Bacteria | 18929 |
| 388 | Ga0157370_10036164 | 3300013104 | Bacteria | 4794 |
| 389 | Ga0157369_10054666 | 3300013105 | Bacteria | 4311 |
| 390 | Ga0157369_10345339 | 3300013105 | Unclassified | 1546 |
| 391 | Ga0157374_10018835 | 3300013296 | Bacteria | 6102 |
| 392 | Ga0157374_10190956 | 3300013296 | Bacteria | 2004 |
| 393 | Ga0157374_10223789 | 3300013296 | Bacteria | 1847 |
| 394 | Ga0157374_10390070 | 3300013296 | Bacteria | 1388 |
| 395 | Ga0157374_10438862 | 3300013296 | Bacteria | 1306 |
| 396 | Ga0157378_10012717 | 3300013297 | Bacteria | 7364 |
| 397 | Ga0157378_10025572 | 3300013297 | Bacteria | 5198 |
| 398 | Ga0157378_10068930 | 3300013297 | Bacteria | 3172 |
| 399 | Ga0157378_10181822 | 3300013297 | Bacteria | 1979 |
| 400 | Ga0157378_10217874 | 3300013297 | Bacteria | 1813 |
| 401 | Ga0157378_10629129 | 3300013297 | Bacteria | 1087 |
| 402 | Ga0163162_10000954 | 3300013306 | Bacteria | 26824 |
| 403 | Ga0163162_10049343 | 3300013306 | Bacteria | 4218 |
| 404 | Ga0163162_10084244 | 3300013306 | Bacteria | 3254 |
| 405 | Ga0163162_10093337 | 3300013306 | Bacteria | 3094 |
| 406 | Ga0163162_10261827 | 3300013306 | Bacteria | 1861 |
| 407 | Ga0163162_10271330 | 3300013306 | Bacteria | 1828 |
| 408 | Ga0163162_11109334 | 3300013306 | Unclassified | 896 |
| 409 | Ga0163162_11322846 | 3300013306 | Bacteria | 819 |
| 410 | Ga0157372_10036787 | 3300013307 | Bacteria | 5398 |
| 411 | Ga0157372_10239142 | 3300013307 | Unclassified | 2107 |
| 412 | Ga0157372_10921368 | 3300013307 | Unclassified | 1013 |
| 413 | Ga0157375_10000550 | 3300013308 | Bacteria | 33739 |
| 414 | Ga0157375_10018289 | 3300013308 | Bacteria | 6353 |
| 415 | Ga0157375_10033787 | 3300013308 | Bacteria | 4864 |
| 416 | Ga0157375_10111508 | 3300013308 | Bacteria | 2834 |
| 417 | Ga0157375_11135788 | 3300013308 | Bacteria | 915 |
| 418 | Ga0163163_10018301 | 3300014325 | Bacteria | 6554 |
| 419 | Ga0163163_10146821 | 3300014325 | Bacteria | 2403 |
| 420 | Ga0157380_10000489 | 3300014326 | Bacteria | 24116 |
| 421 | Ga0157380_10009763 | 3300014326 | Bacteria | 6888 |
| 422 | Ga0157380_10012837 | 3300014326 | Bacteria | 6087 |
| 423 | Ga0157380_10117607 | 3300014326 | Bacteria | 2245 |
| 424 | Ga0157380_10124752 | 3300014326 | Bacteria | 2187 |
| 425 | Ga0182008_10007679 | 3300014497 | Bacteria | 5941 |
| 426 | Ga0182008_10050118 | 3300014497 | Bacteria | 2072 |
| 427 | Ga0157377_10324933 | 3300014745 | Bacteria | 1023 |
| 428 | Ga0157377_11084443 | 3300014745 | Unclassified | 612 |
| 429 | Ga0157379_10000439 | 3300014968 | Bacteria | 33735 |
| 430 | Ga0157379_10047612 | 3300014968 | Bacteria | 3825 |
| 431 | Ga0157379_10094579 | 3300014968 | Bacteria | 2681 |
| 432 | Ga0157379_10160691 | 3300014968 | Bacteria | 2028 |
| 433 | Ga0157379_10294445 | 3300014968 | Bacteria | 1478 |
| 434 | Ga0157379_10305253 | 3300014968 | Bacteria | 1451 |
| 435 | Ga0157376_10029133 | 3300014969 | Bacteria | 4397 |
| 436 | Ga0157376_10203034 | 3300014969 | Bacteria | 1825 |
| 437 | Ga0157376_10266833 | 3300014969 | Bacteria | 1606 |
| 438 | Ga0157376_10585657 | 3300014969 | Bacteria | 1108 |
| 439 | Ga0157376_10940849 | 3300014969 | Bacteria | 884 |
| 440 | Ga0182006_1001748 | 3300015261 | Bacteria | 12603 |
| 441 | Ga0182006_1003709 | 3300015261 | Bacteria | 7719 |
| 442 | Ga0182006_1127927 | 3300015261 | Bacteria | 876 |
| 443 | Ga0182007_10004346 | 3300015262 | Bacteria | 6440 |
| 444 | Ga0182005_1031429 | 3300015265 | Bacteria | 1446 |
| 445 | Ga0182005_1059851 | 3300015265 | Bacteria | 1040 |
| 446 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 447 | Ga0163161_10006931 | 3300017792 | Bacteria | 7836 |
| 448 | Ga0163161_10052953 | 3300017792 | Bacteria | 2942 |
| 449 | Ga0163161_10120687 | 3300017792 | Bacteria | 1970 |
| 450 | Ga0163161_10121160 | 3300017792 | Bacteria | 1966 |
| 451 | Ga0163161_10127999 | 3300017792 | Bacteria | 1913 |
| 452 | Ga0213872_10023309 | 3300021361 | Bacteria | 2848 |
| 453 | Ga0213876_10181594 | 3300021384 | Bacteria | 1119 |
| 454 | Ga0209436_115256 | 3300025208 | Bacteria | 1194 |
| 455 | Ga0209672_101328 | 3300025228 | Bacteria | 9426 |
| 456 | Ga0209147_101428 | 3300025229 | Bacteria | 8692 |
| 457 | Ga0209258_100176 | 3300025242 | Bacteria | 141261 |
| 458 | Ga0207425_1000133 | 3300025245 | Bacteria | 67802 |
| 459 | Ga0207425_1011401 | 3300025245 | Bacteria | 2123 |
| 460 | Ga0207425_1044847 | 3300025245 | Bacteria | 829 |
| 461 | Ga0209148_1000033 | 3300025254 | Bacteria | 555508 |
| 462 | Ga0209129_1000186 | 3300025258 | Bacteria | 85793 |
| 463 | Ga0209129_1007298 | 3300025258 | Bacteria | 3328 |
| 464 | Ga0209129_1009268 | 3300025258 | Bacteria | 2619 |
| 465 | Ga0209565_1000190 | 3300025263 | Bacteria | 75207 |
| 466 | Ga0209565_1004293 | 3300025263 | Bacteria | 4388 |
| 467 | Ga0209673_1000209 | 3300025273 | Bacteria | 117670 |
| 468 | Ga0209673_1000393 | 3300025273 | Bacteria | 78531 |
| 469 | Ga0209673_1001625 | 3300025273 | Bacteria | 19511 |
| 470 | Ga0209673_1008405 | 3300025273 | Bacteria | 4598 |
| 471 | Ga0209673_1051779 | 3300025273 | Bacteria | 1081 |
| 472 | Ga0209130_1000372 | 3300025284 | Bacteria | 50940 |
| 473 | Ga0209130_1010030 | 3300025284 | Bacteria | 2640 |
| 474 | Ga0209130_1015881 | 3300025284 | Bacteria | 1840 |
| 475 | Ga0209675_1000902 | 3300025291 | Bacteria | 19011 |
| 476 | Ga0209675_1001575 | 3300025291 | Bacteria | 12922 |
| 477 | Ga0209675_1006482 | 3300025291 | Bacteria | 4679 |
| 478 | Ga0209675_1017081 | 3300025291 | Bacteria | 2085 |
| 479 | Ga0209675_1037045 | 3300025291 | Bacteria | 1099 |
| 480 | Ga0209676_1000048 | 3300025292 | Bacteria | 403716 |
| 481 | Ga0209676_1000368 | 3300025292 | Bacteria | 83764 |
| 482 | Ga0209676_1000433 | 3300025292 | Bacteria | 72480 |
| 483 | Ga0209676_1000937 | 3300025292 | Bacteria | 35920 |
| 484 | Ga0209025_1000324 | 3300025294 | Bacteria | 106257 |
| 485 | Ga0209025_1001380 | 3300025294 | Bacteria | 32437 |
| 486 | Ga0209025_1001614 | 3300025294 | Bacteria | 28196 |
| 487 | Ga0209025_1019492 | 3300025294 | Bacteria | 3770 |
| 488 | Ga0209025_1079347 | 3300025294 | Bacteria | 1123 |
| 489 | Ga0209025_1096798 | 3300025294 | Bacteria | 947 |
| 490 | Ga0209564_1000417 | 3300025295 | Bacteria | 74808 |
| 491 | Ga0209564_1000423 | 3300025295 | Bacteria | 74528 |
| 492 | Ga0209758_1000092 | 3300025297 | Bacteria | 241910 |
| 493 | Ga0209758_1010418 | 3300025297 | Bacteria | 5566 |
| 494 | Ga0209050_1000012 | 3300025298 | Bacteria | 813717 |
| 495 | Ga0209050_1000912 | 3300025298 | Bacteria | 39073 |
| 496 | Ga0209050_1004084 | 3300025298 | Bacteria | 10213 |
| 497 | Ga0209050_1051799 | 3300025298 | Bacteria | 1032 |
| 498 | Ga0209256_1000094 | 3300025299 | Bacteria | 208177 |
| 499 | Ga0209256_1000095 | 3300025299 | Bacteria | 206120 |
| 500 | Ga0207426_1000084 | 3300025302 | Bacteria | 298123 |
| 501 | Ga0207426_1000161 | 3300025302 | Bacteria | 172765 |
| 502 | Ga0209051_1000178 | 3300025303 | Bacteria | 115109 |
| 503 | Ga0209051_1000207 | 3300025303 | Bacteria | 103683 |
| 504 | Ga0209051_1000931 | 3300025303 | Bacteria | 28957 |
| 505 | Ga0209051_1004369 | 3300025303 | Bacteria | 8755 |
| 506 | Ga0209051_1016148 | 3300025303 | Bacteria | 3400 |
| 507 | Ga0209051_1021299 | 3300025303 | Bacteria | 2764 |
| 508 | Ga0209051_1026224 | 3300025303 | Bacteria | 2354 |
| 509 | Ga0209257_1000024 | 3300025304 | Bacteria | 726068 |
| 510 | Ga0209257_1000249 | 3300025304 | Bacteria | 124522 |
| 511 | Ga0209257_1004734 | 3300025304 | Bacteria | 10176 |
| 512 | Ga0209257_1019883 | 3300025304 | Bacteria | 2508 |
| 513 | Ga0207697_10018594 | 3300025315 | Bacteria | 2849 |
| 514 | Ga0207656_10005089 | 3300025321 | Bacteria | 4623 |
| 515 | Ga0207656_10018338 | 3300025321 | Bacteria | 2754 |
| 516 | Ga0207655_1004770 | 3300025728 | Bacteria | 9456 |
| 517 | Ga0207655_1067730 | 3300025728 | Bacteria | 1342 |
| 518 | Ga0207655_1125068 | 3300025728 | Bacteria | 846 |
| 519 | Ga0207682_10019861 | 3300025893 | Bacteria | 2634 |
| 520 | Ga0207682_10366174 | 3300025893 | Bacteria | 680 |
| 521 | Ga0207642_10005581 | 3300025899 | Bacteria | 4117 |
| 522 | Ga0207642_10375526 | 3300025899 | Bacteria | 845 |
| 523 | Ga0207680_10086167 | 3300025903 | Bacteria | 1986 |
| 524 | Ga0207680_10152926 | 3300025903 | Bacteria | 1540 |
| 525 | Ga0207680_10320938 | 3300025903 | Bacteria | 1083 |
| 526 | Ga0207680_10338048 | 3300025903 | Bacteria | 1056 |
| 527 | Ga0207680_10509501 | 3300025903 | Bacteria | 857 |
| 528 | Ga0207680_10993635 | 3300025903 | Bacteria | 601 |
| 529 | Ga0207699_10035483 | 3300025906 | Bacteria | 2838 |
| 530 | Ga0207645_10002573 | 3300025907 | Bacteria | 14148 |
| 531 | Ga0207645_10008080 | 3300025907 | Bacteria | 7380 |
| 532 | Ga0207645_10017297 | 3300025907 | Bacteria | 4763 |
| 533 | Ga0207643_10014794 | 3300025908 | Bacteria | 4243 |
| 534 | Ga0207643_10087791 | 3300025908 | Bacteria | 1809 |
| 535 | Ga0207684_10007194 | 3300025910 | Bacteria | 10057 |
| 536 | Ga0207684_10536269 | 3300025910 | Bacteria | 1002 |
| 537 | Ga0207654_10125138 | 3300025911 | Unclassified | 1620 |
| 538 | Ga0207654_10299021 | 3300025911 | Unclassified | 1094 |
| 539 | Ga0207707_10006936 | 3300025912 | Bacteria | 9879 |
| 540 | Ga0207695_10005377 | 3300025913 | Bacteria | 17023 |
| 541 | Ga0207695_10007940 | 3300025913 | Bacteria | 13392 |
| 542 | Ga0207695_10138130 | 3300025913 | Bacteria | 2389 |
| 543 | Ga0207695_10376627 | 3300025913 | Bacteria | 1305 |
| 544 | Ga0207695_10665193 | 3300025913 | Bacteria | 922 |
| 545 | Ga0207671_10007085 | 3300025914 | Bacteria | 9808 |
| 546 | Ga0207671_10056053 | 3300025914 | Bacteria | 2920 |
| 547 | Ga0207671_10070997 | 3300025914 | Bacteria | 2597 |
| 548 | Ga0207671_10294875 | 3300025914 | Bacteria | 1281 |
| 549 | Ga0207671_10995659 | 3300025914 | Unclassified | 661 |
| 550 | Ga0207660_10068643 | 3300025917 | Bacteria | 2571 |
| 551 | Ga0207660_10532301 | 3300025917 | Bacteria | 955 |
| 552 | Ga0207662_10130324 | 3300025918 | Bacteria | 1585 |
| 553 | Ga0207657_10627702 | 3300025919 | Bacteria | 837 |
| 554 | Ga0207649_10266254 | 3300025920 | Bacteria | 1240 |
| 555 | Ga0207652_10145045 | 3300025921 | Unclassified | 2124 |
| 556 | Ga0207646_10101910 | 3300025922 | Bacteria | 2574 |
| 557 | Ga0207681_10000644 | 3300025923 | Bacteria | 23228 |
| 558 | Ga0207681_10185542 | 3300025923 | Bacteria | 1588 |
| 559 | Ga0207681_10238766 | 3300025923 | Bacteria | 1414 |
| 560 | Ga0207681_10245131 | 3300025923 | Bacteria | 1396 |
| 561 | Ga0207681_10904756 | 3300025923 | Bacteria | 739 |
| 562 | Ga0207694_10000601 | 3300025924 | Bacteria | 32556 |
| 563 | Ga0207694_10000920 | 3300025924 | Bacteria | 26083 |
| 564 | Ga0207694_10024601 | 3300025924 | Bacteria | 4574 |
| 565 | Ga0207694_10155247 | 3300025924 | Bacteria | 1845 |
| 566 | Ga0207650_10006427 | 3300025925 | Bacteria | 8009 |
| 567 | Ga0207650_10657425 | 3300025925 | Bacteria | 884 |
| 568 | Ga0207650_10704442 | 3300025925 | Bacteria | 853 |
| 569 | Ga0207659_10000751 | 3300025926 | Bacteria | 19207 |
| 570 | Ga0207659_10006069 | 3300025926 | Bacteria | 7376 |
| 571 | Ga0207659_10753015 | 3300025926 | Bacteria | 836 |
| 572 | Ga0207687_10011986 | 3300025927 | Bacteria | 5669 |
| 573 | Ga0207687_10038600 | 3300025927 | Bacteria | 3264 |
| 574 | Ga0207687_10071514 | 3300025927 | Bacteria | 2479 |
| 575 | Ga0207687_10547425 | 3300025927 | Bacteria | 971 |
| 576 | Ga0207687_10563588 | 3300025927 | Bacteria | 957 |
| 577 | Ga0207644_10010084 | 3300025931 | Bacteria | 6222 |
| 578 | Ga0207644_10020786 | 3300025931 | Bacteria | 4465 |
| 579 | Ga0207644_10031885 | 3300025931 | Bacteria | 3675 |
| 580 | Ga0207644_10039620 | 3300025931 | Bacteria | 3326 |
| 581 | Ga0207644_10248176 | 3300025931 | Bacteria | 1419 |
| 582 | Ga0207690_10147513 | 3300025932 | Bacteria | 1741 |
| 583 | Ga0207706_10006980 | 3300025933 | Bacteria | 10440 |
| 584 | Ga0207706_10017696 | 3300025933 | Bacteria | 6421 |
| 585 | Ga0207686_10080424 | 3300025934 | Bacteria | 2124 |
| 586 | Ga0207686_10104914 | 3300025934 | Bacteria | 1894 |
| 587 | Ga0207686_10167181 | 3300025934 | Bacteria | 1547 |
| 588 | Ga0207686_10402841 | 3300025934 | Bacteria | 1043 |
| 589 | Ga0207686_10627384 | 3300025934 | Bacteria | 848 |
| 590 | Ga0207709_10001937 | 3300025935 | Bacteria | 13608 |
| 591 | Ga0207709_10002102 | 3300025935 | Bacteria | 12830 |
| 592 | Ga0207709_10025447 | 3300025935 | Bacteria | 3389 |
| 593 | Ga0207709_10047583 | 3300025935 | Bacteria | 2608 |
| 594 | Ga0207709_10053433 | 3300025935 | Bacteria | 2486 |
| 595 | Ga0207709_10343225 | 3300025935 | Bacteria | 1125 |
| 596 | Ga0207709_10587663 | 3300025935 | Bacteria | 880 |
| 597 | Ga0207670_10008093 | 3300025936 | Bacteria | 5915 |
| 598 | Ga0207670_10197679 | 3300025936 | Bacteria | 1525 |
| 599 | Ga0207669_10001517 | 3300025937 | Bacteria | 9895 |
| 600 | Ga0207669_10013519 | 3300025937 | Bacteria | 4056 |
| 601 | Ga0207669_10074307 | 3300025937 | Bacteria | 2149 |
| 602 | Ga0207669_10138672 | 3300025937 | Bacteria | 1684 |
| 603 | Ga0207704_10001175 | 3300025938 | Bacteria | 11675 |
| 604 | Ga0207704_10055018 | 3300025938 | Bacteria | 2429 |
| 605 | Ga0207704_10056013 | 3300025938 | Bacteria | 2413 |
| 606 | Ga0207704_10207072 | 3300025938 | Bacteria | 1440 |
| 607 | Ga0207704_10225534 | 3300025938 | Bacteria | 1390 |
| 608 | Ga0207691_10000347 | 3300025940 | Bacteria | 46651 |
| 609 | Ga0207691_10003219 | 3300025940 | Bacteria | 15925 |
| 610 | Ga0207691_10061540 | 3300025940 | Bacteria | 3409 |
| 611 | Ga0207691_10093373 | 3300025940 | Bacteria | 2694 |
| 612 | Ga0207691_10170221 | 3300025940 | Bacteria | 1908 |
| 613 | Ga0207691_10175507 | 3300025940 | Bacteria | 1874 |
| 614 | Ga0207691_10564074 | 3300025940 | Bacteria | 965 |
| 615 | Ga0207711_10004936 | 3300025941 | Bacteria | 11328 |
| 616 | Ga0207711_10096742 | 3300025941 | Bacteria | 2606 |
| 617 | Ga0207689_10002269 | 3300025942 | Bacteria | 18022 |
| 618 | Ga0207689_10010698 | 3300025942 | Bacteria | 7893 |
| 619 | Ga0207689_10293180 | 3300025942 | Bacteria | 1348 |
| 620 | Ga0207661_10142452 | 3300025944 | Bacteria | 2064 |
| 621 | Ga0207661_10895452 | 3300025944 | Bacteria | 817 |
| 622 | Ga0207661_11124060 | 3300025944 | Unclassified | 723 |
| 623 | Ga0207679_10013107 | 3300025945 | Bacteria | 5428 |
| 624 | Ga0207679_10013127 | 3300025945 | Bacteria | 5425 |
| 625 | Ga0207679_10271542 | 3300025945 | Bacteria | 1450 |
| 626 | Ga0207667_10000078 | 3300025949 | Bacteria | 165061 |
| 627 | Ga0207667_10185710 | 3300025949 | Unclassified | 2134 |
| 628 | Ga0207667_10539441 | 3300025949 | Bacteria | 1180 |
| 629 | Ga0207651_10000398 | 3300025960 | Bacteria | 18449 |
| 630 | Ga0207651_10012112 | 3300025960 | Bacteria | 4862 |
| 631 | Ga0207651_10022279 | 3300025960 | Bacteria | 3870 |
| 632 | Ga0207712_10009709 | 3300025961 | Bacteria | 6099 |
| 633 | Ga0207712_10015478 | 3300025961 | Bacteria | 4922 |
| 634 | Ga0207668_10000809 | 3300025972 | Bacteria | 19171 |
| 635 | Ga0207668_10042364 | 3300025972 | Bacteria | 3083 |
| 636 | Ga0207668_10230808 | 3300025972 | Bacteria | 1492 |
| 637 | Ga0207668_10287476 | 3300025972 | Bacteria | 1351 |
| 638 | Ga0207668_10653087 | 3300025972 | Bacteria | 921 |
| 639 | Ga0207640_10057156 | 3300025981 | Bacteria | 2565 |
| 640 | Ga0207658_10002681 | 3300025986 | Bacteria | 12869 |
| 641 | Ga0207658_10010019 | 3300025986 | Bacteria | 6439 |
| 642 | Ga0207658_10035740 | 3300025986 | Bacteria | 3559 |
| 643 | Ga0207658_10074759 | 3300025986 | Bacteria | 2575 |
| 644 | Ga0207658_10380315 | 3300025986 | Bacteria | 1236 |
| 645 | Ga0207677_10004451 | 3300026023 | Bacteria | 7523 |
| 646 | Ga0207677_10008191 | 3300026023 | Bacteria | 5822 |
| 647 | Ga0207677_10011928 | 3300026023 | Bacteria | 4974 |
| 648 | Ga0207677_10031948 | 3300026023 | Bacteria | 3378 |
| 649 | Ga0207677_10138338 | 3300026023 | Bacteria | 1860 |
| 650 | Ga0207703_10002510 | 3300026035 | Bacteria | 15864 |
| 651 | Ga0207703_10013182 | 3300026035 | Bacteria | 6439 |
| 652 | Ga0207703_10800538 | 3300026035 | Bacteria | 900 |
| 653 | Ga0207639_10053359 | 3300026041 | Bacteria | 3084 |
| 654 | Ga0207639_10801366 | 3300026041 | Bacteria | 878 |
| 655 | Ga0207678_10013862 | 3300026067 | Bacteria | 7082 |
| 656 | Ga0207678_10083066 | 3300026067 | Bacteria | 2740 |
| 657 | Ga0207678_10247629 | 3300026067 | Bacteria | 1526 |
| 658 | Ga0207678_10786432 | 3300026067 | Bacteria | 840 |
| 659 | Ga0207708_10013570 | 3300026075 | Bacteria | 6091 |
| 660 | Ga0207708_10022713 | 3300026075 | Bacteria | 4737 |
| 661 | Ga0207708_10083169 | 3300026075 | Bacteria | 2461 |
| 662 | Ga0207708_10144528 | 3300026075 | Bacteria | 1868 |
| 663 | Ga0207702_10311891 | 3300026078 | Bacteria | 1496 |
| 664 | Ga0207702_10352657 | 3300026078 | Bacteria | 1408 |
| 665 | Ga0207702_10760449 | 3300026078 | Unclassified | 957 |
| 666 | Ga0207641_10017015 | 3300026088 | Bacteria | 5951 |
| 667 | Ga0207641_10055684 | 3300026088 | Bacteria | 3358 |
| 668 | Ga0207648_10001863 | 3300026089 | Bacteria | 23045 |
| 669 | Ga0207648_10002881 | 3300026089 | Bacteria | 18214 |
| 670 | Ga0207648_10007895 | 3300026089 | Bacteria | 10381 |
| 671 | Ga0207648_10021442 | 3300026089 | Bacteria | 5807 |
| 672 | Ga0207648_10047745 | 3300026089 | Bacteria | 3751 |
| 673 | Ga0207648_10078374 | 3300026089 | Bacteria | 2882 |
| 674 | Ga0207648_10179559 | 3300026089 | Bacteria | 1873 |
| 675 | Ga0207676_10000082 | 3300026095 | Bacteria | 92500 |
| 676 | Ga0207676_10050076 | 3300026095 | Bacteria | 3254 |
| 677 | Ga0207676_11089170 | 3300026095 | Bacteria | 790 |
| 678 | Ga0207674_10018126 | 3300026116 | Bacteria | 7660 |
| 679 | Ga0207674_10048359 | 3300026116 | Bacteria | 4354 |
| 680 | Ga0207674_10063779 | 3300026116 | Bacteria | 3718 |
| 681 | Ga0207674_10144755 | 3300026116 | Bacteria | 2335 |
| 682 | Ga0207674_10352299 | 3300026116 | Bacteria | 1423 |
| 683 | Ga0207675_100000927 | 3300026118 | Bacteria | 29280 |
| 684 | Ga0207675_100001409 | 3300026118 | Bacteria | 24039 |
| 685 | Ga0207675_100309568 | 3300026118 | Bacteria | 1540 |
| 686 | Ga0207675_100866912 | 3300026118 | Bacteria | 918 |
| 687 | Ga0207675_100940636 | 3300026118 | Bacteria | 881 |
| 688 | Ga0207683_10210587 | 3300026121 | Bacteria | 1769 |
| 689 | Ga0207683_10214579 | 3300026121 | Bacteria | 1752 |
| 690 | Ga0207683_10216547 | 3300026121 | Bacteria | 1744 |
| 691 | Ga0207683_10242335 | 3300026121 | Bacteria | 1645 |
| 692 | Ga0207683_10624846 | 3300026121 | Bacteria | 998 |
| 693 | Ga0207683_10951444 | 3300026121 | Bacteria | 798 |
| 694 | Ga0207698_10100486 | 3300026142 | Bacteria | 2396 |
| 695 | Ga0207698_10255540 | 3300026142 | Bacteria | 1606 |
| 696 | Ga0207698_10292253 | 3300026142 | Bacteria | 1513 |
| 697 | Ga0207698_10353948 | 3300026142 | Bacteria | 1388 |
| 698 | Ga0207698_10661934 | 3300026142 | Bacteria | 1035 |
| 699 | Ga0207698_10688782 | 3300026142 | Bacteria | 1016 |
| 700 | Ga0209282_1105991 | 3300027666 | Bacteria | 1437 |
| 701 | Ga0209813_10122536 | 3300027866 | Bacteria | 906 |
| 702 | Ga0207428_10041116 | 3300027907 | Bacteria | 3745 |
| 703 | Ga0268266_10066894 | 3300028379 | Bacteria | 3109 |
| 704 | Ga0268266_10244025 | 3300028379 | Bacteria | 1659 |
| 705 | Ga0268266_10368331 | 3300028379 | Bacteria | 1353 |
| 706 | Ga0268265_10093044 | 3300028380 | Bacteria | 2414 |
| 707 | Ga0268265_10110441 | 3300028380 | Bacteria | 2243 |
| 708 | Ga0268264_10002202 | 3300028381 | Bacteria | 17310 |
| 709 | Ga0268264_10012690 | 3300028381 | Bacteria | 6936 |
| 710 | Ga0268264_10041350 | 3300028381 | Bacteria | 3813 |
| 711 | Ga0268264_10377324 | 3300028381 | Bacteria | 1357 |
| 712 | Ga0268264_10762697 | 3300028381 | Bacteria | 964 |
| 713 | Ga0307517_10004553 | 3300028786 | Bacteria | 21271 |
| 714 | Ga0307517_10179854 | 3300028786 | Bacteria | 1368 |
| 715 | Ga0307517_10413969 | 3300028786 | Bacteria | 709 |
| 716 | Ga0307515_10000419 | 3300028794 | Bacteria | 102271 |
| 717 | Ga0307515_10000425 | 3300028794 | Bacteria | 101790 |
| 718 | Ga0307515_10000672 | 3300028794 | Bacteria | 78835 |
| 719 | Ga0307515_10011668 | 3300028794 | Bacteria | 16643 |
| 720 | Ga0307515_10023797 | 3300028794 | Bacteria | 10710 |
| 721 | Ga0307515_10050319 | 3300028794 | Bacteria | 6244 |
| 722 | Ga0307515_10083885 | 3300028794 | Bacteria | 4101 |
| 723 | Ga0307515_10102188 | 3300028794 | Bacteria | 3451 |
| 724 | Ga0307515_10126323 | 3300028794 | Bacteria | 2854 |
| 725 | Ga0307515_10470527 | 3300028794 | Bacteria | 870 |
| 726 | Ga0307512_10022817 | 3300030522 | Bacteria | 5609 |
| 727 | Ga0307512_10023039 | 3300030522 | Bacteria | 5573 |
| 728 | Ga0307512_10063478 | 3300030522 | Bacteria | 2823 |
| 729 | Ga0307512_10124236 | 3300030522 | Bacteria | 1645 |
| 730 | Ga0307512_10285754 | 3300030522 | Bacteria | 783 |
| 731 | Ga0265316_10316812 | 3300031344 | Unclassified | 1134 |
| 732 | Ga0307513_10001868 | 3300031456 | Bacteria | 29930 |
| 733 | Ga0307513_10008367 | 3300031456 | Bacteria | 13248 |
| 734 | Ga0307513_10077369 | 3300031456 | Bacteria | 3446 |
| 735 | Ga0307513_10086955 | 3300031456 | Bacteria | 3202 |
| 736 | Ga0307513_10090348 | 3300031456 | Bacteria | 3124 |
| 737 | Ga0307513_10203853 | 3300031456 | Bacteria | 1815 |
| 738 | Ga0307513_10323141 | 3300031456 | Bacteria | 1300 |
| 739 | Ga0307513_10550424 | 3300031456 | Bacteria | 866 |
| 740 | Ga0307509_10003708 | 3300031507 | Bacteria | 22858 |
| 741 | Ga0307509_10004745 | 3300031507 | Bacteria | 19393 |
| 742 | Ga0307509_10007851 | 3300031507 | Bacteria | 13797 |
| 743 | Ga0307509_10038154 | 3300031507 | Bacteria | 5244 |
| 744 | Ga0307509_10236325 | 3300031507 | Bacteria | 1625 |
| 745 | Ga0307509_10332143 | 3300031507 | Bacteria | 1251 |
| 746 | Ga0307509_10603647 | 3300031507 | Bacteria | 770 |
| 747 | Ga0307408_100564043 | 3300031548 | Bacteria | 1006 |
| 748 | Ga0307408_100947544 | 3300031548 | Bacteria | 790 |
| 749 | Ga0307408_101100691 | 3300031548 | Bacteria | 737 |
| 750 | Ga0307508_10000278 | 3300031616 | Bacteria | 62985 |
| 751 | Ga0307508_10008282 | 3300031616 | Bacteria | 9624 |
| 752 | Ga0307508_10016618 | 3300031616 | Bacteria | 6696 |
| 753 | Ga0307508_10072891 | 3300031616 | Bacteria | 3009 |
| 754 | Ga0307514_10001174 | 3300031649 | Bacteria | 35389 |
| 755 | Ga0307514_10009496 | 3300031649 | Bacteria | 8170 |
| 756 | Ga0307514_10096609 | 3300031649 | Bacteria | 2134 |
| 757 | Ga0307514_10237904 | 3300031649 | Bacteria | 1095 |
| 758 | Ga0265314_10178784 | 3300031711 | Bacteria | 1273 |
| 759 | Ga0265314_10231927 | 3300031711 | Bacteria | 1070 |
| 760 | Ga0307516_10000237 | 3300031730 | Bacteria | 70929 |
| 761 | Ga0307516_10099481 | 3300031730 | Bacteria | 2725 |
| 762 | Ga0307516_10344365 | 3300031730 | Bacteria | 1157 |
| 763 | Ga0307405_10164268 | 3300031731 | Bacteria | 1576 |
| 764 | Ga0307405_10254616 | 3300031731 | Bacteria | 1308 |
| 765 | Ga0307413_10201349 | 3300031824 | Bacteria | 1438 |
| 766 | Ga0307410_10087844 | 3300031852 | Bacteria | 2200 |
| 767 | Ga0307406_10033320 | 3300031901 | Bacteria | 3153 |
| 768 | Ga0307406_10123962 | 3300031901 | Bacteria | 1801 |
| 769 | Ga0307406_10365334 | 3300031901 | Bacteria | 1133 |
| 770 | Ga0307406_10442887 | 3300031901 | Bacteria | 1040 |
| 771 | Ga0307406_10472442 | 3300031901 | Bacteria | 1011 |
| 772 | Ga0307412_10034281 | 3300031911 | Bacteria | 3234 |
| 773 | Ga0307412_10431217 | 3300031911 | Bacteria | 1081 |
| 774 | Ga0307412_10692821 | 3300031911 | Bacteria | 874 |
| 775 | Ga0307412_10714539 | 3300031911 | Bacteria | 861 |
| 776 | Ga0307412_11382326 | 3300031911 | Bacteria | 636 |
| 777 | Ga0307409_100028240 | 3300031995 | Bacteria | 3993 |
| 778 | Ga0307409_100030037 | 3300031995 | Bacteria | 3899 |
| 779 | Ga0307409_100566255 | 3300031995 | Bacteria | 1118 |
| 780 | Ga0307416_100033297 | 3300032002 | Bacteria | 3905 |
| 781 | Ga0307416_100106923 | 3300032002 | Bacteria | 2454 |
| 782 | Ga0307416_100287504 | 3300032002 | Unclassified | 1625 |
| 783 | Ga0307416_101019003 | 3300032002 | Unclassified | 931 |
| 784 | Ga0307416_101020974 | 3300032002 | Bacteria | 930 |
| 785 | Ga0307411_10057995 | 3300032005 | Bacteria | 2560 |
| 786 | Ga0307411_11475033 | 3300032005 | Bacteria | 624 |
| 787 | Ga0307415_100151750 | 3300032126 | Bacteria | 1784 |
| 788 | Ga0307415_101284880 | 3300032126 | Bacteria | 693 |
| 789 | Ga0307507_10104119 | 3300033179 | Bacteria | 2357 |
| 790 | Ga0307510_10022805 | 3300033180 | Bacteria | 7262 |
| 791 | Ga0307510_10173630 | 3300033180 | Bacteria | 1730 |
| 792 | Ga0307510_10276625 | 3300033180 | Bacteria | 1151 |
| 793 | Ga0373944_0067142 | 3300035089 | Bacteria | 1161 |
| 794 | Ga0373944_0115874 | 3300035089 | Bacteria | 919 |
| 795 | Ga0373939_0195590 | 3300035114 | Bacteria | 762 |
| 796 | Ga0373945_0182128 | 3300035116 | Bacteria | 865 |
| 797 | Ga0373943_0005469 | 3300035170 | Bacteria | 5718 |
| 798 | Ga0373946_0021686 | 3300035171 | Bacteria | 2493 |
| 799 | Ga0373946_0095441 | 3300035171 | Bacteria | 1325 |
| 800 | Ga0373931_0495605 | 3300035691 | Bacteria | 787 |
| 801 | Ga0373935_0115537 | 3300035692 | Bacteria | 1786 |
| 802 | Ga0373935_0669197 | 3300035692 | Bacteria | 762 |
| 803 | Ga0373927_0031372 | 3300035695 | Bacteria | 3464 |
| 804 | Ga0373927_0040785 | 3300035695 | Bacteria | 3011 |
| 805 | Ga0373947_0008740 | 3300035725 | Bacteria | 5824 |
| 806 | Ga0373937_0047465 | 3300036401 | Bacteria | 3929 |
| 807 | Ga0373937_0125469 | 3300036401 | Bacteria | 2394 |
| 808 | Ga0373925_0004060 | 3300037068 | Bacteria | 11121 |
| 809 | Ga0373925_0122348 | 3300037068 | Bacteria | 2021 |
| 810 | Ga0373925_0193640 | 3300037068 | Bacteria | 1614 |
| 811 | Ga0395898_0237105 | 3300037466 | Bacteria | 1740 |
| 812 | Ga0395905_0005642 | 3300037471 | Bacteria | 12729 |
| 813 | Ga0395905_0006264 | 3300037471 | Bacteria | 12008 |
| 814 | Ga0395905_0115347 | 3300037471 | Bacteria | 2524 |
| 815 | Ga0395905_0285411 | 3300037471 | Bacteria | 1537 |
| 816 | Ga0395905_0489662 | 3300037471 | Bacteria | 1129 |
| 817 | Ga0395901_0518233 | 3300038443 | Bacteria | 1212 |
| 818 | Ga0436365_1402919 | 3300039437 | Bacteria | 1910 |
| 819 | Ga0436361_0221167 | 3300039447 | Bacteria | 2159 |
| 820 | Ga0436361_0644663 | 3300039447 | Bacteria | 3077 |
| 821 | Ga0436363_1469836 | 3300039450 | Bacteria | 2615 |
| 822 | Ga0439436_0000134 | 3300041404 | Bacteria | 16918 |
| 823 | Ga0439436_0000962 | 3300041404 | Bacteria | 7953 |
| 824 | Ga0439438_125193 | 3300041405 | Bacteria | 617 |
| 825 | Ga0439439_0004760 | 3300041406 | Bacteria | 3073 |
| 826 | Ga0439439_0038287 | 3300041406 | Bacteria | 1238 |
| 827 | Ga0439447_031631 | 3300041407 | Bacteria | 1327 |
| 828 | Ga0439461_0004034 | 3300041410 | Bacteria | 2437 |
| 829 | Ga0439461_0024933 | 3300041410 | Bacteria | 1212 |
| 830 | Ga0439466_0006068 | 3300041411 | Bacteria | 4600 |
| 831 | Ga0439465_0000339 | 3300041413 | Bacteria | 13362 |
| 832 | Ga0451791_0210227 | 3300041451 | Bacteria | 865 |
| 833 | Ga0451793_0124799 | 3300041452 | Bacteria | 983 |
| 834 | Ga0451800_0939557 | 3300041459 | Bacteria | 628 |
| 835 | Ga0451853_1321958 | 3300041512 | Bacteria | 925 |
| 836 | Ga0439431_0009901 | 3300041997 | Bacteria | 2157 |
| 837 | Ga0439433_0000087 | 3300041999 | Bacteria | 12676 |
| 838 | Ga0439441_021416 | 3300042001 | Unclassified | 1193 |
| 839 | Ga0439442_001006 | 3300042002 | Bacteria | 5694 |
| 840 | Ga0439445_0009738 | 3300042004 | Bacteria | 2267 |
| 841 | Ga0439445_0018295 | 3300042004 | Bacteria | 1738 |
| 842 | Ga0439432_000527 | 3300042006 | Bacteria | 14248 |
| 843 | Ga0439432_036027 | 3300042006 | Bacteria | 1584 |
| 844 | Ga0439449_0000385 | 3300042007 | Bacteria | 16338 |
| 845 | Ga0439449_0004263 | 3300042007 | Bacteria | 5531 |
| 846 | Ga0439449_0011605 | 3300042007 | Bacteria | 3313 |
| 847 | Ga0439450_052174 | 3300042008 | Bacteria | 974 |
| 848 | Ga0439452_002869 | 3300042010 | Bacteria | 6196 |
| 849 | Ga0439455_0018540 | 3300042012 | Bacteria | 1632 |
| 850 | Ga0439455_0089309 | 3300042012 | Bacteria | 844 |
| 851 | Ga0439457_021681 | 3300042014 | Bacteria | 1424 |
| 852 | Ga0439462_0001243 | 3300042015 | Bacteria | 5579 |
| 853 | Ga0439462_0005291 | 3300042015 | Bacteria | 3178 |
| 854 | Ga0450911_000225 | 3300042115 | Bacteria | 21810 |
| 855 | Ga0450923_002780 | 3300042125 | Bacteria | 2560 |
| 856 | Ga0450894_015107 | 3300042131 | Bacteria | 1021 |
| 857 | Ga0450896_024752 | 3300042133 | Bacteria | 890 |
| 858 | Ga0450898_015921 | 3300042134 | Bacteria | 1279 |
| 859 | Ga0450898_025829 | 3300042134 | Bacteria | 1056 |
| 860 | Ga0450898_028365 | 3300042134 | Bacteria | 1017 |
| 861 | Ga0450905_009627 | 3300042142 | Bacteria | 1331 |
| 862 | Ga0439446_0035330 | 3300042156 | Bacteria | 1457 |
| 863 | Ga0439434_0003391 | 3300042435 | Bacteria | 4665 |
| 864 | Ga0439434_0116530 | 3300042435 | Bacteria | 868 |
| 865 | Ga0450918_040166 | 3300042531 | Bacteria | 838 |
| 866 | Ga0451577_0068194 | 3300042876 | Bacteria | 3173 |
| 867 | Ga0466960_0143879 | 3300044901 | Bacteria | 1268 |
| 868 | Ga0495617_001251 | 3300046452 | Bacteria | 11401 |
| 869 | Ga0495592_0000211 | 3300046454 | Bacteria | 49780 |
| 870 | Ga0495603_0362366 | 3300046455 | Bacteria | 832 |
| 871 | Ga0495590_0000092 | 3300046457 | Bacteria | 55212 |
| 872 | Ga0495590_0001972 | 3300046457 | Bacteria | 8648 |
| 873 | Ga0495590_0013034 | 3300046457 | Bacteria | 3065 |
| 874 | Ga0495629_0032522 | 3300046459 | Bacteria | 3692 |
| 875 | Ga0495629_0042748 | 3300046459 | Bacteria | 3184 |
| 876 | Ga0495638_0015754 | 3300046460 | Bacteria | 5066 |
| 877 | Ga0495638_0022034 | 3300046460 | Bacteria | 4187 |
| 878 | Ga0495638_0074021 | 3300046460 | Bacteria | 2078 |
| 879 | Ga0495638_0090658 | 3300046460 | Bacteria | 1842 |
| 880 | Ga0495653_0380860 | 3300046463 | Bacteria | 901 |
| 881 | Ga0495650_0008406 | 3300046471 | Bacteria | 6028 |
| 882 | Ga0495650_0136472 | 3300046471 | Bacteria | 891 |
| 883 | Ga0495580_0074019 | 3300046472 | Bacteria | 2378 |
| 884 | Ga0495582_0085048 | 3300046473 | Bacteria | 1759 |
| 885 | Ga0495582_0185706 | 3300046473 | Bacteria | 1185 |
| 886 | Ga0495605_0039596 | 3300046474 | Bacteria | 2360 |
| 887 | Ga0495605_0045936 | 3300046474 | Bacteria | 2149 |
| 888 | Ga0495605_0133015 | 3300046474 | Bacteria | 1120 |
| 889 | Ga0495605_0309183 | 3300046474 | Bacteria | 667 |
| 890 | Ga0495639_0071706 | 3300046475 | Bacteria | 1600 |
| 891 | Ga0495639_0106342 | 3300046475 | Bacteria | 1328 |
| 892 | Ga0495639_0235238 | 3300046475 | Bacteria | 903 |
| 893 | Ga0495584_0000300 | 3300046491 | Bacteria | 34910 |
| 894 | Ga0495584_0296713 | 3300046491 | Bacteria | 821 |
| 895 | Ga0495584_0489128 | 3300046491 | Unclassified | 627 |
| 896 | Ga0495585_0018990 | 3300046492 | Bacteria | 3966 |
| 897 | Ga0495585_0022023 | 3300046492 | Bacteria | 3658 |
| 898 | Ga0495585_0053439 | 3300046492 | Bacteria | 2235 |
| 899 | Ga0495594_0164175 | 3300046499 | Bacteria | 1263 |
| 900 | Ga0495594_0472226 | 3300046499 | Unclassified | 713 |
| 901 | Ga0495596_0006345 | 3300046500 | Bacteria | 5452 |
| 902 | Ga0495596_0023058 | 3300046500 | Bacteria | 2528 |
| 903 | Ga0495607_0000359 | 3300046501 | Bacteria | 47053 |
| 904 | Ga0495607_0041673 | 3300046501 | Bacteria | 2725 |
| 905 | Ga0495607_0071949 | 3300046501 | Bacteria | 1926 |
| 906 | Ga0495607_0293988 | 3300046501 | Bacteria | 766 |
| 907 | Ga0495583_0000067 | 3300046506 | Bacteria | 189381 |
| 908 | Ga0495583_0000563 | 3300046506 | Bacteria | 51367 |
| 909 | Ga0495583_0067301 | 3300046506 | Bacteria | 1583 |
| 910 | Ga0495583_0167731 | 3300046506 | Bacteria | 903 |
| 911 | Ga0495583_0168690 | 3300046506 | Bacteria | 900 |
| 912 | Ga0495583_0375639 | 3300046506 | Bacteria | 559 |
| 913 | Ga0495606_0002420 | 3300046507 | Bacteria | 21749 |
| 914 | Ga0495606_0256544 | 3300046507 | Bacteria | 967 |
| 915 | Ga0495606_0262079 | 3300046507 | Bacteria | 954 |
| 916 | Ga0495610_0089206 | 3300046512 | Bacteria | 1400 |
| 917 | Ga0495610_0298873 | 3300046512 | Bacteria | 621 |
| 918 | Ga0495616_0000933 | 3300046513 | Bacteria | 21041 |
| 919 | Ga0495616_0006364 | 3300046513 | Bacteria | 7157 |
| 920 | Ga0495616_0040782 | 3300046513 | Bacteria | 2370 |
| 921 | Ga0495618_0318948 | 3300046514 | Bacteria | 963 |
| 922 | Ga0495620_0010656 | 3300046515 | Bacteria | 4840 |
| 923 | Ga0495628_0124485 | 3300046516 | Bacteria | 1976 |
| 924 | Ga0495628_0404365 | 3300046516 | Bacteria | 997 |
| 925 | Ga0495631_0000176 | 3300046518 | Bacteria | 43388 |
| 926 | Ga0495631_0050645 | 3300046518 | Bacteria | 1816 |
| 927 | Ga0495632_0023431 | 3300046519 | Bacteria | 3297 |
| 928 | Ga0495637_0003577 | 3300046520 | Bacteria | 8236 |
| 929 | Ga0495637_0026699 | 3300046520 | Bacteria | 2589 |
| 930 | Ga0495637_0232339 | 3300046520 | Bacteria | 668 |
| 931 | Ga0495643_0009326 | 3300046522 | Bacteria | 6109 |
| 932 | Ga0495643_0048890 | 3300046522 | Bacteria | 2283 |
| 933 | Ga0495643_0121266 | 3300046522 | Bacteria | 1321 |
| 934 | Ga0495644_0000501 | 3300046523 | Bacteria | 16743 |
| 935 | Ga0495648_0000831 | 3300046524 | Bacteria | 32651 |
| 936 | Ga0495648_0012948 | 3300046524 | Bacteria | 6194 |
| 937 | Ga0495648_0026694 | 3300046524 | Bacteria | 3884 |
| 938 | Ga0495648_0139802 | 3300046524 | Bacteria | 1276 |
| 939 | Ga0495663_0065291 | 3300046525 | Bacteria | 1150 |
| 940 | Ga0495642_0001270 | 3300046528 | Bacteria | 11421 |
| 941 | Ga0495642_0092321 | 3300046528 | Bacteria | 1282 |
| 942 | Ga0495642_0359572 | 3300046528 | Bacteria | 640 |
| 943 | Ga0495654_0003149 | 3300046530 | Bacteria | 10235 |
| 944 | Ga0495654_0003294 | 3300046530 | Bacteria | 9952 |
| 945 | Ga0495654_0115443 | 3300046530 | Bacteria | 1221 |
| 946 | Ga0495654_0211074 | 3300046530 | Bacteria | 826 |
| 947 | Ga0495665_0103479 | 3300046531 | Bacteria | 1494 |
| 948 | Ga0495640_0123366 | 3300046533 | Bacteria | 1682 |
| 949 | Ga0495640_0240409 | 3300046533 | Bacteria | 1137 |
| 950 | Ga0495609_0001479 | 3300046538 | Bacteria | 15589 |
| 951 | Ga0495609_0036063 | 3300046538 | Bacteria | 2235 |
| 952 | Ga0495609_0212485 | 3300046538 | Bacteria | 805 |
| 953 | Ga0495621_0003592 | 3300046539 | Bacteria | 4282 |
| 954 | Ga0495597_0005431 | 3300046542 | Bacteria | 6745 |
| 955 | Ga0495597_0020388 | 3300046542 | Bacteria | 3089 |
| 956 | Ga0495597_0039235 | 3300046542 | Bacteria | 2121 |
| 957 | Ga0495597_0082577 | 3300046542 | Bacteria | 1372 |
| 958 | Ga0495622_0000011 | 3300046557 | Bacteria | 201507 |
| 959 | Ga0495622_0017968 | 3300046557 | Bacteria | 3294 |
| 960 | Ga0495622_0062685 | 3300046557 | Bacteria | 1721 |
| 961 | Ga0495633_0013261 | 3300046558 | Bacteria | 4350 |
| 962 | Ga0495633_0015014 | 3300046558 | Bacteria | 4026 |
| 963 | Ga0495656_0000055 | 3300046615 | Bacteria | 53908 |
| 964 | Ga0495656_0001368 | 3300046615 | Bacteria | 7975 |
| 965 | Ga0495656_0014289 | 3300046615 | Bacteria | 2974 |
| 966 | Ga0495656_0029376 | 3300046615 | Bacteria | 2213 |
| 967 | Ga0495656_0306741 | 3300046615 | Bacteria | 815 |
| 968 | Ga0495668_0009680 | 3300046616 | Bacteria | 5893 |
| 969 | Ga0495668_0014680 | 3300046616 | Bacteria | 4587 |
| 970 | Ga0495668_0032416 | 3300046616 | Bacteria | 2940 |
| 971 | Ga0495668_0049884 | 3300046616 | Bacteria | 2321 |
| 972 | Ga0495668_0211190 | 3300046616 | Bacteria | 1063 |
| 973 | Ga0495634_0268308 | 3300046642 | Bacteria | 1039 |
| 974 | Ga0495611_0008860 | 3300046648 | Bacteria | 4254 |
| 975 | Ga0495625_0000708 | 3300046660 | Bacteria | 47135 |
| 976 | Ga0495625_0019127 | 3300046660 | Bacteria | 5326 |
| 977 | Ga0495625_0019215 | 3300046660 | Bacteria | 5307 |
| 978 | Ga0495625_0020257 | 3300046660 | Bacteria | 5139 |
| 979 | Ga0495625_0056406 | 3300046660 | Bacteria | 2796 |
| 980 | Ga0495625_0069863 | 3300046660 | Bacteria | 2467 |
| 981 | Ga0495635_0102477 | 3300046663 | Bacteria | 1956 |
| 982 | Ga0495635_0171602 | 3300046663 | Bacteria | 1475 |
| 983 | Ga0495635_0320566 | 3300046663 | Bacteria | 1037 |
| 984 | Ga0495659_0000193 | 3300046664 | Bacteria | 26723 |
| 985 | Ga0495659_0048214 | 3300046664 | Bacteria | 1543 |
| 986 | Ga0495661_0000755 | 3300046665 | Bacteria | 31313 |
| 987 | Ga0495661_0000987 | 3300046665 | Bacteria | 25699 |
| 988 | Ga0495661_0004847 | 3300046665 | Bacteria | 9638 |
| 989 | Ga0495661_0185973 | 3300046665 | Bacteria | 1097 |
| 990 | Ga0495661_0261924 | 3300046665 | Bacteria | 878 |
| 991 | Ga0495661_0266886 | 3300046665 | Bacteria | 867 |
| 992 | Ga0495661_0315951 | 3300046665 | Bacteria | 777 |
| 993 | Ga0495588_0097954 | 3300046674 | Bacteria | 1539 |
| 994 | Ga0495588_0368698 | 3300046674 | Bacteria | 754 |
| 995 | Ga0495599_0297918 | 3300046678 | Bacteria | 974 |
| 996 | Ga0495646_0259762 | 3300046680 | Bacteria | 928 |
| 997 | Ga0495647_0037297 | 3300046681 | Bacteria | 1833 |
| 998 | Ga0495647_0053062 | 3300046681 | Bacteria | 1580 |
| 999 | Ga0495647_0159299 | 3300046681 | Bacteria | 972 |
| 1000 | Ga0495647_0176505 | 3300046681 | Bacteria | 928 |
| 1001 | Ga0495658_0015016 | 3300046683 | Bacteria | 3968 |
| 1002 | Ga0495658_0070109 | 3300046683 | Bacteria | 2033 |
| 1003 | Ga0495658_0081857 | 3300046683 | Bacteria | 1896 |
| 1004 | Ga0495658_0354995 | 3300046683 | Bacteria | 932 |
| 1005 | Ga0495613_0669775 | 3300046689 | Bacteria | 685 |
| 1006 | Ga0495624_0073836 | 3300046690 | Bacteria | 2120 |
| 1007 | Ga0495624_0084705 | 3300046690 | Bacteria | 1959 |
| 1008 | Ga0495670_0005694 | 3300046691 | Bacteria | 6109 |
| 1009 | Ga0495670_0005878 | 3300046691 | Bacteria | 6015 |
| 1010 | Ga0495670_0105166 | 3300046691 | Bacteria | 1457 |
| 1011 | Ga0495670_0401552 | 3300046691 | Bacteria | 740 |
| 1012 | Ga0495671_0001321 | 3300046692 | Bacteria | 16827 |
| 1013 | Ga0495671_0005250 | 3300046692 | Bacteria | 7605 |
| 1014 | Ga0495671_0125520 | 3300046692 | Bacteria | 1251 |
| 1015 | Ga0495671_0135871 | 3300046692 | Bacteria | 1199 |
| 1016 | Ga0495671_0441055 | 3300046692 | Bacteria | 622 |
| 1017 | Ga0495649_0001209 | 3300046694 | Bacteria | 19919 |
| 1018 | Ga0495589_0020773 | 3300046794 | Bacteria | 3357 |
| 1019 | Ga0495589_0069801 | 3300046794 | Bacteria | 1718 |
| 1020 | Ga0495600_0032003 | 3300046809 | Bacteria | 3411 |
| 1021 | Ga0495600_0425893 | 3300046809 | Bacteria | 823 |
| 1022 | Ga0495600_0564390 | 3300046809 | Bacteria | 694 |
| 1023 | Ga0495660_0004413 | 3300046810 | Bacteria | 8519 |
| 1024 | Ga0495660_0015585 | 3300046810 | Bacteria | 4391 |
| 1025 | Ga0495660_0046913 | 3300046810 | Bacteria | 2368 |
| 1026 | Ga0495660_0057750 | 3300046810 | Bacteria | 2093 |
| 1027 | Ga0495581_0205380 | 3300047315 | Bacteria | 1152 |
| 1028 | Ga0495636_0000302 | 3300047318 | Bacteria | 19376 |
| 1029 | Ga0495674_0152238 | 3300047319 | Bacteria | 1939 |
| 1030 | Ga0495674_0466405 | 3300047319 | Bacteria | 1013 |
| 1031 | Ga0495672_0003302 | 3300047320 | Bacteria | 13939 |
| 1032 | Ga0495672_0150664 | 3300047320 | Bacteria | 1206 |
| 1033 | Ga0495676_0061675 | 3300047321 | Bacteria | 2932 |
| 1034 | Ga0495676_0109107 | 3300047321 | Bacteria | 2035 |
| 1035 | Ga0495676_0236496 | 3300047321 | Bacteria | 1252 |
| 1036 | Ga0495683_0068546 | 3300047323 | Bacteria | 1744 |
| 1037 | Ga0495683_0181697 | 3300047323 | Bacteria | 960 |
| 1038 | Ga0495687_000153 | 3300047443 | Bacteria | 105215 |
| 1039 | Ga0495687_003793 | 3300047443 | Bacteria | 10667 |
| 1040 | Ga0495687_008489 | 3300047443 | Bacteria | 5875 |
| 1041 | Ga0495687_012212 | 3300047443 | Bacteria | 4556 |
| 1042 | Ga0495677_0001414 | 3300047445 | Bacteria | 9642 |
| 1043 | Ga0495677_0184931 | 3300047445 | Bacteria | 808 |
| 1044 | Ga0495679_001633 | 3300047446 | Bacteria | 12492 |
| 1045 | Ga0495685_000011 | 3300047447 | Bacteria | 83484 |
| 1046 | Ga0495685_086382 | 3300047447 | Bacteria | 1042 |
| 1047 | Ga0495685_176602 | 3300047447 | Bacteria | 689 |
| 1048 | Ga0495673_0004503 | 3300047469 | Bacteria | 8702 |
| 1049 | Ga0495681_0055933 | 3300047470 | Bacteria | 1838 |
| 1050 | Ga0495684_0115155 | 3300047471 | Bacteria | 2027 |
| 1051 | Ga0495684_0666773 | 3300047471 | Bacteria | 694 |
| 1052 | Ga0495686_0001736 | 3300047472 | Bacteria | 22399 |
| 1053 | Ga0495593_0017494 | 3300047673 | Bacteria | 4035 |
| 1054 | Ga0495593_0090851 | 3300047673 | Bacteria | 1572 |
| 1055 | Ga0495614_0081431 | 3300048089 | Bacteria | 1402 |
| 1056 | Ga0495614_0082709 | 3300048089 | Bacteria | 1392 |
| 1057 | Ga0495614_0452816 | 3300048089 | Bacteria | 607 |
| 1058 | Ga0495615_0068733 | 3300048090 | Bacteria | 950 |
| 1059 | Ga0495626_0000657 | 3300048091 | Bacteria | 33248 |
| 1060 | Ga0495626_0000701 | 3300048091 | Bacteria | 31837 |
| 1061 | Ga0495626_0009276 | 3300048091 | Bacteria | 5323 |
| 1062 | Ga0495626_0022010 | 3300048091 | Bacteria | 3153 |
| 1063 | Ga0495626_0198048 | 3300048091 | Bacteria | 825 |
| 1064 | Ga0496100_0101842 | 3300048903 | Bacteria | 1980 |
| 1065 | Ga0496101_0010546 | 3300048904 | Bacteria | 6103 |
| 1066 | Ga0496102_0014578 | 3300048905 | Bacteria | 6831 |
| 1067 | Ga0496102_0125873 | 3300048905 | Bacteria | 2395 |
| 1068 | Ga0496103_0010336 | 3300048906 | Bacteria | 5523 |
| 1069 | Ga0496104_0015327 | 3300048907 | Bacteria | 6941 |
| 1070 | Ga0496104_1466667 | 3300048907 | Bacteria | 585 |
| 1071 | Ga0496105_0002074 | 3300048908 | Bacteria | 14503 |
| 1072 | Ga0496106_0024302 | 3300048909 | Bacteria | 4504 |
| 1073 | Ga0496106_0894476 | 3300048909 | Bacteria | 701 |
| 1074 | Ga0496107_0036652 | 3300048910 | Bacteria | 3518 |
| 1075 | Ga0496108_0022182 | 3300048911 | Bacteria | 5220 |
| 1076 | Ga0496110_0029223 | 3300048913 | Bacteria | 4741 |
| 1077 | Ga0496111_0124593 | 3300048914 | Bacteria | 1904 |
| 1078 | Ga0496113_0350757 | 3300048916 | Bacteria | 1184 |
| 1079 | Ga0496113_0780584 | 3300048916 | Unclassified | 760 |
| 1080 | Ga0496114_0069772 | 3300048917 | Bacteria | 2951 |
| 1081 | Ga0496114_0485770 | 3300048917 | Bacteria | 1093 |
| 1082 | Ga0496114_1502968 | 3300048917 | Bacteria | 561 |
| 1083 | Ga0496116_0057954 | 3300048919 | Bacteria | 2528 |
| 1084 | Ga0496116_0089477 | 3300048919 | Bacteria | 1877 |
| 1085 | Ga0496117_0013969 | 3300048920 | Bacteria | 6958 |
| 1086 | Ga0496117_0016300 | 3300048920 | Bacteria | 6278 |
| 1087 | Ga0496117_0076287 | 3300048920 | Bacteria | 2223 |
| 1088 | Ga0496118_0027766 | 3300048921 | Bacteria | 4781 |
| 1089 | Ga0496118_0028081 | 3300048921 | Bacteria | 4747 |
| 1090 | Ga0496121_0199642 | 3300048924 | Bacteria | 1426 |
| 1091 | Ga0496121_0453743 | 3300048924 | Bacteria | 825 |
| 1092 | Ga0496123_0103082 | 3300048926 | Bacteria | 1654 |
| 1093 | Ga0496123_0127159 | 3300048926 | Bacteria | 1420 |
| 1094 | Ga0496124_0300654 | 3300048927 | Bacteria | 1159 |
| 1095 | Ga0496125_0027812 | 3300048928 | Bacteria | 5118 |
| 1096 | Ga0496125_0438466 | 3300048928 | Bacteria | 752 |
| 1097 | Ga0496126_0081296 | 3300048929 | Bacteria | 2865 |
| 1098 | Ga0496126_0639021 | 3300048929 | Bacteria | 834 |
| 1099 | Ga0495678_000367 | 3300049459 | Bacteria | 46226 |
| 1100 | Ga0495678_008149 | 3300049459 | Bacteria | 5331 |
| 1101 | Ga0495682_0000199 | 3300049460 | Bacteria | 48422 |
| 1102 | Ga0495682_0001987 | 3300049460 | Bacteria | 10110 |
| 1103 | Ga0495682_0109679 | 3300049460 | Bacteria | 989 |
| 1104 | Ga0495682_0271472 | 3300049460 | Bacteria | 599 |
| 1105 | Ga0501292_009487 | 3300049515 | Bacteria | 1445 |
| 1106 | Ga0501292_022134 | 3300049515 | Unclassified | 1033 |
| 1107 | Ga0501294_008077 | 3300049517 | Bacteria | 1022 |
| 1108 | Ga0501298_002185 | 3300049521 | Bacteria | 2946 |
| 1109 | Ga0501299_032863 | 3300049522 | Bacteria | 1009 |
| 1110 | Ga0501032_0110228 | 3300049569 | Bacteria | 1822 |
| 1111 | Ga0501041_0406562 | 3300049577 | Bacteria | 863 |
| 1112 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 1113 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 1114 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 1115 | Ga0501048_0000926 | 3300049582 | Bacteria | 21609 |
| 1116 | Ga0501048_0791366 | 3300049582 | Bacteria | 681 |
| 1117 | Ga0501071_0041686 | 3300049587 | Plasmid | 3288 |
| 1118 | Ga0501071_0114982 | 3300049587 | Bacteria | 1991 |
| 1119 | Ga0501071_1111199 | 3300049587 | Archaea | 611 |
| 1120 | Ga0501199_013270 | 3300049650 | Bacteria | 906 |
| 1121 | Ga0501206_002813 | 3300049653 | Bacteria | 2190 |
| 1122 | Ga0501257_037872 | 3300049686 | Bacteria | 1177 |
| 1123 | Ga0501259_058687 | 3300049688 | Bacteria | 799 |
| 1124 | Ga0501081_0455501 | 3300049743 | Bacteria | 951 |
| 1125 | Ga0501262_009881 | 3300049759 | Bacteria | 1186 |
| 1126 | Ga0501273_006673 | 3300049770 | Bacteria | 1341 |
| 1127 | Ga0501281_03099 | 3300049777 | Bacteria | 1191 |
| 1128 | Ga0501045_0002191 | 3300049824 | Bacteria | 13251 |
| 1129 | Ga0501045_0704258 | 3300049824 | Unclassified | 745 |
| 1130 | nmdc:mga03683_107284_c1 | 3300050489 | Bacteria | 1232 |
| 1131 | nmdc:mga03683_12530_c1 | 3300050489 | Bacteria | 3100 |
| 1132 | nmdc:mga03683_37272_c1 | 3300050489 | Bacteria | 1981 |
| 1133 | nmdc:mga03n38_19665_c1 | 3300050490 | Bacteria | 2687 |
| 1134 | nmdc:mga03n38_62210_c1 | 3300050490 | Bacteria | 1702 |
| 1135 | nmdc:mga00v17_152623_c1 | 3300050491 | Bacteria | 1484 |
| 1136 | nmdc:mga00v17_2771_c1 | 3300050491 | Bacteria | 8996 |
| 1137 | nmdc:mga00v17_344318_c1 | 3300050491 | Bacteria | 969 |
| 1138 | nmdc:mga0yw44_119897_c1 | 3300050492 | Bacteria | 1693 |
| 1139 | nmdc:mga0yw44_5627_c1 | 3300050492 | Bacteria | 5959 |
| 1140 | nmdc:mga0k408_19767_c1 | 3300050493 | Bacteria | 3768 |
| 1141 | nmdc:mga0k408_251645_c1 | 3300050493 | Bacteria | 1055 |
| 1142 | nmdc:mga0k408_31050_c1 | 3300050493 | Bacteria | 3049 |
| 1143 | nmdc:mga0k408_33051_c1 | 3300050493 | Bacteria | 2957 |
| 1144 | nmdc:mga0k408_33349_c1 | 3300050493 | Bacteria | 2945 |
| 1145 | nmdc:mga0k408_33984_c1 | 3300050493 | Bacteria | 2918 |
| 1146 | nmdc:mga0k408_36165_c1 | 3300050493 | Bacteria | 2834 |
| 1147 | nmdc:mga0k408_44858_c1 | 3300050493 | Bacteria | 2550 |
| 1148 | nmdc:mga0k408_55074_c1 | 3300050493 | Bacteria | 2306 |
| 1149 | nmdc:mga0k408_5871_c1 | 3300050493 | Bacteria | 6542 |
| 1150 | nmdc:mga0k408_60655_c1 | 3300050493 | Bacteria | 2198 |
| 1151 | nmdc:mga0k408_73875_c1 | 3300050493 | Bacteria | 1992 |
| 1152 | nmdc:mga0k408_80835_c1 | 3300050493 | Bacteria | 1903 |
| 1153 | nmdc:mga0k408_92205_c1 | 3300050493 | Bacteria | 1475 |
| 1154 | nmdc:mga06z11_707678_c1 | 3300050494 | Bacteria | 614 |
| 1155 | nmdc:mga04h51_150436_c1 | 3300050495 | Bacteria | 889 |
| 1156 | nmdc:mga07m45_103848_c1 | 3300050496 | Bacteria | 1634 |
| 1157 | nmdc:mga07m45_1144_c1 | 3300050496 | Bacteria | 11893 |
| 1158 | nmdc:mga07m45_2026_c2 | 3300050496 | Bacteria | 4488 |
| 1159 | nmdc:mga07m45_245524_c1 | 3300050496 | Bacteria | 1042 |
| 1160 | nmdc:mga07m45_2594_c1 | 3300050496 | Bacteria | 8516 |
| 1161 | nmdc:mga07m45_397680_c1 | 3300050496 | Bacteria | 800 |
| 1162 | nmdc:mga07m45_607872_c1 | 3300050496 | Bacteria | 631 |
| 1163 | nmdc:mga07m45_83596_c1 | 3300050496 | Bacteria | 1825 |
| 1164 | nmdc:mga05p37_286583_c1 | 3300050507 | Bacteria | 1962 |
| 1165 | nmdc:mga05p37_922713_c1 | 3300050507 | Bacteria | 938 |
| 1166 | nmdc:mga09592_288559_c1 | 3300050508 | Bacteria | 1423 |
| 1167 | nmdc:mga0qj67_520062_c1 | 3300050509 | Unclassified | 956 |
| 1168 | nmdc:mga06r32_186776_c1 | 3300050510 | Bacteria | 2060 |
| 1169 | nmdc:mga08y16_183385_c1 | 3300050511 | Bacteria | 2172 |
| 1170 | nmdc:mga08y16_62434_c1 | 3300050511 | Bacteria | 3891 |
| 1171 | nmdc:mga08y16_755306_c1 | 3300050511 | Bacteria | 968 |
| 1172 | nmdc:mga0a205_191393_c1 | 3300050515 | Bacteria | 1938 |
| 1173 | nmdc:mga0sz30_110451_c1 | 3300050516 | Bacteria | 1205 |
| 1174 | nmdc:mga0sz30_230223_c1 | 3300050516 | Bacteria | 825 |
| 1175 | nmdc:mga0sz30_34397_c1 | 3300050516 | Bacteria | 2109 |
| 1176 | Ga0495601_0018255 | 3300053077 | Bacteria | 4267 |
| 1177 | Ga0495612_0084174 | 3300053078 | Bacteria | 1339 |
| 1178 | Ga0495612_0123928 | 3300053078 | Bacteria | 1113 |
| 1179 | Ga0500610_0003534 | 3300053079 | Bacteria | 6027 |
| 1180 | Ga0500610_0032538 | 3300053079 | Bacteria | 2655 |
| 1181 | Ga0495619_0048380 | 3300053085 | Bacteria | 2802 |
| 1182 | Ga0500643_008391 | 3300053087 | Bacteria | 4062 |
| 1183 | Ga0500644_0007132 | 3300053088 | Bacteria | 2898 |
| 1184 | Ga0500583_0049976 | 3300053092 | Bacteria | 1937 |
| 1185 | Ga0500651_0000289 | 3300053093 | Bacteria | 29197 |
| 1186 | Ga0500651_0135524 | 3300053093 | Bacteria | 1487 |
| 1187 | Ga0500566_0078985 | 3300053094 | Bacteria | 1835 |
| 1188 | Ga0500562_004272 | 3300053108 | Bacteria | 3615 |
| 1189 | Ga0500562_020605 | 3300053108 | Bacteria | 1712 |
| 1190 | Ga0500571_000089 | 3300053110 | Bacteria | 29120 |
| 1191 | Ga0500572_076012 | 3300053111 | Bacteria | 1045 |
| 1192 | Ga0500592_004261 | 3300053116 | Bacteria | 2284 |
| 1193 | Ga0500594_0010549 | 3300053118 | Bacteria | 2147 |
| 1194 | Ga0500607_000942 | 3300053121 | Bacteria | 27845 |
| 1195 | Ga0500607_012041 | 3300053121 | Bacteria | 5094 |
| 1196 | Ga0500608_011017 | 3300053122 | Bacteria | 3908 |
| 1197 | Ga0500608_075230 | 3300053122 | Bacteria | 1601 |
| 1198 | Ga0500618_027127 | 3300053125 | Bacteria | 1364 |
| 1199 | Ga0500618_027711 | 3300053125 | Bacteria | 1346 |
| 1200 | Ga0500628_060006 | 3300053129 | Bacteria | 927 |
| 1201 | Ga0500658_0000137 | 3300053134 | Bacteria | 34691 |
| 1202 | Ga0500658_0000140 | 3300053134 | Bacteria | 34349 |
| 1203 | Ga0500658_0015270 | 3300053134 | Bacteria | 2849 |
| 1204 | Ga0500559_0000166 | 3300053136 | Bacteria | 51944 |
| 1205 | Ga0500564_057811 | 3300053138 | Bacteria | 1764 |
| 1206 | Ga0500564_066507 | 3300053138 | Bacteria | 1630 |
| 1207 | Ga0500568_0000735 | 3300053139 | Bacteria | 23510 |
| 1208 | Ga0500568_0025308 | 3300053139 | Bacteria | 2505 |
| 1209 | Ga0500574_019578 | 3300053141 | Bacteria | 1687 |
| 1210 | Ga0500577_0079072 | 3300053142 | Bacteria | 1307 |
| 1211 | Ga0500586_016719 | 3300053145 | Bacteria | 2232 |
| 1212 | Ga0500589_010275 | 3300053147 | Bacteria | 3996 |
| 1213 | Ga0500616_0079167 | 3300053153 | Bacteria | 1655 |
| 1214 | Ga0500619_069489 | 3300053154 | Bacteria | 1169 |
| 1215 | Ga0500627_0043809 | 3300053158 | Bacteria | 1931 |
| 1216 | Ga0500634_0011590 | 3300053161 | Bacteria | 4557 |
| 1217 | Ga0500634_0018046 | 3300053161 | Bacteria | 3784 |
| 1218 | Ga0500638_046305 | 3300053162 | Bacteria | 2108 |
| 1219 | Ga0500636_0044573 | 3300053177 | Bacteria | 2616 |
| 1220 | Ga0500625_029427 | 3300053729 | Bacteria | 2608 |
| 1221 | Ga0500587_002063 | 3300053739 | Bacteria | 2868 |
| 1222 | Ga0501084_0280439 | 3300054114 | Bacteria | 1407 |
| 1223 | Ga0590071_021025 | 3300059421 | Bacteria | 1537 |
| 1224 | Ga0466962_0096217 | 3300061719 | Bacteria | 1420 |
| 1225 | Ga0530510_0390804 | 3300061734 | Unclassified | 1048 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8047673197 | 8047673713 | 162 |
| 2 | 3300035691 | Ga0373931_0495605 | Ga0373931_0495605_263_754 | 163 |
| 3 | 3300046455 | Ga0495603_0362366 | Ga0495603_0362366_108_599 | 163 |
| 4 | 3300046499 | Ga0495594_0472226 | Ga0495594_0472226_106_597 | 163 |
| 5 | 3300046615 | Ga0495656_0306741 | Ga0495656_0306741_41_532 | 163 |
| 6 | 3300048916 | Ga0496113_0780584 | Ga0496113_0780584_236_727 | 163 |
| 7 | 3300048917 | Ga0496114_1502968 | Ga0496114_1502968_56_547 | 163 |
| 8 | 3300005327 | Ga0070658_10682662 | Ga0070658_106826622 | 164 |
| 9 | 3300005329 | Ga0070683_100124461 | Ga0070683_1001244613 | 164 |
| 10 | 3300005329 | Ga0070683_100503711 | Ga0070683_1005037112 | 164 |
| 11 | 3300005336 | Ga0070680_100311391 | Ga0070680_1003113912 | 164 |
| 12 | 3300005445 | Ga0070708_100188876 | Ga0070708_1001888762 | 164 |
| 13 | 3300005458 | Ga0070681_10029856 | Ga0070681_100298562 | 164 |
| 14 | 3300005458 | Ga0070681_10631726 | Ga0070681_106317261 | 164 |
| 15 | 3300005458 | Ga0070681_10961264 | Ga0070681_109612641 | 164 |
| 16 | 3300005530 | Ga0070679_100183717 | Ga0070679_1001837171 | 164 |
| 17 | 3300005535 | Ga0070684_100026516 | Ga0070684_1000265163 | 164 |
| 18 | 3300005539 | Ga0068853_100009688 | Ga0068853_1000096887 | 164 |
| 19 | 3300005545 | Ga0070695_101196718 | Ga0070695_1011967181 | 164 |
| 20 | 3300005563 | Ga0068855_100164792 | Ga0068855_1001647922 | 164 |
| 21 | 3300005577 | Ga0068857_100006977 | Ga0068857_1000069777 | 164 |
| 22 | 3300005614 | Ga0068856_100123773 | Ga0068856_1001237732 | 164 |
| 23 | 3300005614 | Ga0068856_100198462 | Ga0068856_1001984622 | 164 |
| 24 | 3300006237 | Ga0097621_100007488 | Ga0097621_1000074884 | 164 |
| 25 | 3300006358 | Ga0068871_100003128 | Ga0068871_10000312811 | 164 |
| 26 | 3300006881 | Ga0068865_100003193 | Ga0068865_10000319313 | 164 |
| 27 | 3300009093 | Ga0105240_10876762 | Ga0105240_108767622 | 164 |
| 28 | 3300009174 | Ga0105241_10024541 | Ga0105241_100245413 | 164 |
| 29 | 3300009174 | Ga0105241_10076022 | Ga0105241_100760223 | 164 |
| 30 | 3300009174 | Ga0105241_10198017 | Ga0105241_101980172 | 164 |
| 31 | 3300009176 | Ga0105242_10005571 | Ga0105242_100055716 | 164 |
| 32 | 3300009176 | Ga0105242_10025391 | Ga0105242_100253912 | 164 |
| 33 | 3300009177 | Ga0105248_10315388 | Ga0105248_103153882 | 164 |
| 34 | 3300009545 | Ga0105237_10004017 | Ga0105237_1000401714 | 164 |
| 35 | 3300009545 | Ga0105237_10066362 | Ga0105237_100663621 | 164 |
| 36 | 3300009551 | Ga0105238_10017161 | Ga0105238_100171616 | 164 |
| 37 | 3300009551 | Ga0105238_10500661 | Ga0105238_105006612 | 164 |
| 38 | 3300010375 | Ga0105239_10016024 | Ga0105239_100160243 | 164 |
| 39 | 3300010375 | Ga0105239_10043988 | Ga0105239_100439882 | 164 |
| 40 | 3300011119 | Ga0105246_10069868 | Ga0105246_100698683 | 164 |
| 41 | 3300013104 | Ga0157370_10036164 | Ga0157370_100361643 | 164 |
| 42 | 3300013105 | Ga0157369_10345339 | Ga0157369_103453392 | 164 |
| 43 | 3300013296 | Ga0157374_10018835 | Ga0157374_100188351 | 164 |
| 44 | 3300013297 | Ga0157378_10012717 | Ga0157378_100127176 | 164 |
| 45 | 3300013306 | Ga0163162_11109334 | Ga0163162_111093342 | 164 |
| 46 | 3300013307 | Ga0157372_10239142 | Ga0157372_102391422 | 164 |
| 47 | 3300013307 | Ga0157372_10921368 | Ga0157372_109213681 | 164 |
| 48 | 3300014325 | Ga0163163_10018301 | Ga0163163_100183014 | 164 |
| 49 | 3300014745 | Ga0157377_11084443 | Ga0157377_110844431 | 164 |
| 50 | 3300014969 | Ga0157376_10029133 | Ga0157376_100291333 | 164 |
| 51 | 3300025911 | Ga0207654_10125138 | Ga0207654_101251381 | 164 |
| 52 | 3300025911 | Ga0207654_10299021 | Ga0207654_102990212 | 164 |
| 53 | 3300025912 | Ga0207707_10006936 | Ga0207707_100069362 | 164 |
| 54 | 3300025913 | Ga0207695_10665193 | Ga0207695_106651931 | 164 |
| 55 | 3300025914 | Ga0207671_10007085 | Ga0207671_100070856 | 164 |
| 56 | 3300025914 | Ga0207671_10995659 | Ga0207671_109956591 | 164 |
| 57 | 3300025917 | Ga0207660_10532301 | Ga0207660_105323012 | 164 |
| 58 | 3300025920 | Ga0207649_10266254 | Ga0207649_102662542 | 164 |
| 59 | 3300025921 | Ga0207652_10145045 | Ga0207652_101450452 | 164 |
| 60 | 3300025924 | Ga0207694_10000601 | Ga0207694_100006019 | 164 |
| 61 | 3300025934 | Ga0207686_10104914 | Ga0207686_101049142 | 164 |
| 62 | 3300025938 | Ga0207704_10055018 | Ga0207704_100550183 | 164 |
| 63 | 3300025941 | Ga0207711_10096742 | Ga0207711_100967423 | 164 |
| 64 | 3300025944 | Ga0207661_10895452 | Ga0207661_108954521 | 164 |
| 65 | 3300025944 | Ga0207661_11124060 | Ga0207661_111240601 | 164 |
| 66 | 3300025945 | Ga0207679_10013107 | Ga0207679_100131073 | 164 |
| 67 | 3300025949 | Ga0207667_10185710 | Ga0207667_101857103 | 164 |
| 68 | 3300026023 | Ga0207677_10004451 | Ga0207677_1000445110 | 164 |
| 69 | 3300026078 | Ga0207702_10311891 | Ga0207702_103118912 | 164 |
| 70 | 3300026078 | Ga0207702_10760449 | Ga0207702_107604491 | 164 |
| 71 | 3300026089 | Ga0207648_10047745 | Ga0207648_100477452 | 164 |
| 72 | 3300026116 | Ga0207674_10063779 | Ga0207674_100637794 | 164 |
| 73 | 3300028379 | Ga0268266_10066894 | Ga0268266_100668943 | 164 |
| 74 | 3300031344 | Ga0265316_10316812 | Ga0265316_103168122 | 164 |
| 75 | 3300031711 | Ga0265314_10178784 | Ga0265314_101787842 | 164 |
| 76 | 3300003322 | rootL2_10113471 | rootL2_101134711 | 165 |
| 77 | 3300005434 | Ga0070709_10041462 | Ga0070709_100414621 | 165 |
| 78 | 3300005844 | Ga0068862_100483613 | Ga0068862_1004836132 | 165 |
| 79 | 3300013296 | Ga0157374_10438862 | Ga0157374_104388622 | 165 |
| 80 | 3300025906 | Ga0207699_10035483 | Ga0207699_100354832 | 165 |
| 81 | 3300035170 | Ga0373943_0005469 | Ga0373943_0005469_2480_2980 | 165 |
| 82 | 3300035171 | Ga0373946_0021686 | Ga0373946_0021686_157_657 | 165 |
| 83 | 3300035692 | Ga0373935_0669197 | Ga0373935_0669197_146_646 | 165 |
| 84 | 3300035695 | Ga0373927_0040785 | Ga0373927_0040785_661_1161 | 165 |
| 85 | 3300035725 | Ga0373947_0008740 | Ga0373947_0008740_1443_1943 | 165 |
| 86 | 3300037068 | Ga0373925_0004060 | Ga0373925_0004060_7025_7525 | 165 |
| 87 | 3300042001 | Ga0439441_021416 | Ga0439441_021416_577_1089 | 165 |
| 88 | 3300046472 | Ga0495580_0074019 | Ga0495580_0074019_846_1346 | 165 |
| 89 | 3300046473 | Ga0495582_0085048 | Ga0495582_0085048_391_891 | 165 |
| 90 | 3300046499 | Ga0495594_0164175 | Ga0495594_0164175_141_641 | 165 |
| 91 | 3300046514 | Ga0495618_0318948 | Ga0495618_0318948_127_627 | 165 |
| 92 | 3300046531 | Ga0495665_0103479 | Ga0495665_0103479_10_510 | 165 |
| 93 | 3300046663 | Ga0495635_0320566 | Ga0495635_0320566_227_727 | 165 |
| 94 | 3300046683 | Ga0495658_0015016 | Ga0495658_0015016_2755_3255 | 165 |
| 95 | 3300047319 | Ga0495674_0152238 | Ga0495674_0152238_94_594 | 165 |
| 96 | 3300048089 | Ga0495614_0082709 | Ga0495614_0082709_717_1217 | 165 |
| 97 | 3300053078 | Ga0495612_0084174 | Ga0495612_0084174_11_511 | 165 |
| 98 | iso_pu_bacteria | 2643221660 | 2644338858 | 165 |
| 99 | iso_pu_bacteria | 2643221683 | 2644465032 | 165 |
| 100 | iso_pu_bacteria | 2904449895 | 2904456480 | 165 |
| 101 | iso_pu_bacteria | 2904456579 | 2904461462 | 165 |
| 102 | iso_pu_bacteria | 2929520902 | 2929522996 | 165 |
| 103 | 3300003373 | JGI25407J50210_10071250 | JGI25407J50210_100712502 | 166 |
| 104 | 3300005327 | Ga0070658_10057194 | Ga0070658_100571944 | 166 |
| 105 | 3300005353 | Ga0070669_101122731 | Ga0070669_1011227311 | 166 |
| 106 | 3300005440 | Ga0070705_100187047 | Ga0070705_1001870472 | 166 |
| 107 | 3300005445 | Ga0070708_100033241 | Ga0070708_1000332414 | 166 |
| 108 | 3300005445 | Ga0070708_100197772 | Ga0070708_1001977722 | 166 |
| 109 | 3300005445 | Ga0070708_100373113 | Ga0070708_1003731131 | 166 |
| 110 | 3300005445 | Ga0070708_100551649 | Ga0070708_1005516492 | 166 |
| 111 | 3300005536 | Ga0070697_100010956 | Ga0070697_1000109566 | 166 |
| 112 | 3300005563 | Ga0068855_100000166 | Ga0068855_10000016638 | 166 |
| 113 | 3300006844 | Ga0075428_100004497 | Ga0075428_1000044977 | 166 |
| 114 | 3300006846 | Ga0075430_100019067 | Ga0075430_1000190676 | 166 |
| 115 | 3300006847 | Ga0075431_100308981 | Ga0075431_1003089812 | 166 |
| 116 | 3300006847 | Ga0075431_100604847 | Ga0075431_1006048472 | 166 |
| 117 | 3300006880 | Ga0075429_100264976 | Ga0075429_1002649762 | 166 |
| 118 | 3300009093 | Ga0105240_10000470 | Ga0105240_1000047020 | 166 |
| 119 | 3300009147 | Ga0114129_10008968 | Ga0114129_100089685 | 166 |
| 120 | 3300009551 | Ga0105238_10000294 | Ga0105238_100002949 | 166 |
| 121 | 3300010375 | Ga0105239_10420815 | Ga0105239_104208151 | 166 |
| 122 | 3300014326 | Ga0157380_10117607 | Ga0157380_101176073 | 166 |
| 123 | 3300025910 | Ga0207684_10536269 | Ga0207684_105362692 | 166 |
| 124 | 3300025913 | Ga0207695_10005377 | Ga0207695_1000537710 | 166 |
| 125 | 3300025923 | Ga0207681_10185542 | Ga0207681_101855423 | 166 |
| 126 | 3300025924 | Ga0207694_10000920 | Ga0207694_1000092019 | 166 |
| 127 | 3300025949 | Ga0207667_10000078 | Ga0207667_1000007894 | 166 |
| 128 | 3300031731 | Ga0307405_10254616 | Ga0307405_102546161 | 166 |
| 129 | 3300031901 | Ga0307406_10033320 | Ga0307406_100333202 | 166 |
| 130 | 3300031911 | Ga0307412_10692821 | Ga0307412_106928212 | 166 |
| 131 | 3300031995 | Ga0307409_100028240 | Ga0307409_1000282401 | 166 |
| 132 | 3300031995 | Ga0307409_100030037 | Ga0307409_1000300372 | 166 |
| 133 | 3300032002 | Ga0307416_100106923 | Ga0307416_1001069232 | 166 |
| 134 | 3300032002 | Ga0307416_100287504 | Ga0307416_1002875041 | 166 |
| 135 | 3300032126 | Ga0307415_100151750 | Ga0307415_1001517502 | 166 |
| 136 | 3300038443 | Ga0395901_0518233 | Ga0395901_0518233_396_896 | 166 |
| 137 | 3300042008 | Ga0439450_052174 | Ga0439450_052174_161_721 | 166 |
| 138 | 3300046457 | Ga0495590_0000092 | Ga0495590_0000092_18663_19163 | 166 |
| 139 | 3300046457 | Ga0495590_0001972 | Ga0495590_0001972_3959_4459 | 166 |
| 140 | 3300046460 | Ga0495638_0015754 | Ga0495638_0015754_3190_3690 | 166 |
| 141 | 3300046474 | Ga0495605_0133015 | Ga0495605_0133015_156_656 | 166 |
| 142 | 3300046474 | Ga0495605_0309183 | Ga0495605_0309183_156_656 | 166 |
| 143 | 3300046491 | Ga0495584_0296713 | Ga0495584_0296713_138_638 | 166 |
| 144 | 3300046491 | Ga0495584_0489128 | Ga0495584_0489128_45_590 | 166 |
| 145 | 3300046500 | Ga0495596_0006345 | Ga0495596_0006345_489_989 | 166 |
| 146 | 3300046500 | Ga0495596_0023058 | Ga0495596_0023058_1575_2075 | 166 |
| 147 | 3300046501 | Ga0495607_0000359 | Ga0495607_0000359_33173_33673 | 166 |
| 148 | 3300046501 | Ga0495607_0071949 | Ga0495607_0071949_1298_1798 | 166 |
| 149 | 3300046501 | Ga0495607_0293988 | Ga0495607_0293988_137_637 | 166 |
| 150 | 3300046506 | Ga0495583_0167731 | Ga0495583_0167731_391_891 | 166 |
| 151 | 3300046507 | Ga0495606_0256544 | Ga0495606_0256544_404_904 | 166 |
| 152 | 3300046513 | Ga0495616_0040782 | Ga0495616_0040782_1498_1998 | 166 |
| 153 | 3300046518 | Ga0495631_0050645 | Ga0495631_0050645_93_593 | 166 |
| 154 | 3300046520 | Ga0495637_0232339 | Ga0495637_0232339_155_655 | 166 |
| 155 | 3300046522 | Ga0495643_0009326 | Ga0495643_0009326_155_655 | 166 |
| 156 | 3300046522 | Ga0495643_0048890 | Ga0495643_0048890_1461_1961 | 166 |
| 157 | 3300046524 | Ga0495648_0012948 | Ga0495648_0012948_3186_3686 | 166 |
| 158 | 3300046524 | Ga0495648_0026694 | Ga0495648_0026694_568_1068 | 166 |
| 159 | 3300046528 | Ga0495642_0001270 | Ga0495642_0001270_7162_7662 | 166 |
| 160 | 3300046530 | Ga0495654_0003149 | Ga0495654_0003149_2349_2849 | 166 |
| 161 | 3300046538 | Ga0495609_0036063 | Ga0495609_0036063_1139_1639 | 166 |
| 162 | 3300046542 | Ga0495597_0005431 | Ga0495597_0005431_5859_6359 | 166 |
| 163 | 3300046542 | Ga0495597_0020388 | Ga0495597_0020388_2042_2542 | 166 |
| 164 | 3300046542 | Ga0495597_0082577 | Ga0495597_0082577_119_619 | 166 |
| 165 | 3300046557 | Ga0495622_0000011 | Ga0495622_0000011_39244_39744 | 166 |
| 166 | 3300046616 | Ga0495668_0014680 | Ga0495668_0014680_3504_4004 | 166 |
| 167 | 3300046616 | Ga0495668_0032416 | Ga0495668_0032416_167_667 | 166 |
| 168 | 3300046665 | Ga0495661_0000987 | Ga0495661_0000987_11323_11823 | 166 |
| 169 | 3300046665 | Ga0495661_0004847 | Ga0495661_0004847_6856_7356 | 166 |
| 170 | 3300046665 | Ga0495661_0185973 | Ga0495661_0185973_442_942 | 166 |
| 171 | 3300046665 | Ga0495661_0266886 | Ga0495661_0266886_108_608 | 166 |
| 172 | 3300046665 | Ga0495661_0315951 | Ga0495661_0315951_17_517 | 166 |
| 173 | 3300046692 | Ga0495671_0005250 | Ga0495671_0005250_5273_5773 | 166 |
| 174 | 3300046794 | Ga0495589_0069801 | Ga0495589_0069801_1025_1525 | 166 |
| 175 | 3300046810 | Ga0495660_0015585 | Ga0495660_0015585_3233_3733 | 166 |
| 176 | 3300046810 | Ga0495660_0057750 | Ga0495660_0057750_449_949 | 166 |
| 177 | 3300047443 | Ga0495687_008489 | Ga0495687_008489_2000_2500 | 166 |
| 178 | 3300047446 | Ga0495679_001633 | Ga0495679_001633_4391_4891 | 166 |
| 179 | 3300047447 | Ga0495685_176602 | Ga0495685_176602_60_560 | 166 |
| 180 | 3300048091 | Ga0495626_0000657 | Ga0495626_0000657_7857_8357 | 166 |
| 181 | 3300048091 | Ga0495626_0000701 | Ga0495626_0000701_10598_11098 | 166 |
| 182 | 3300048091 | Ga0495626_0009276 | Ga0495626_0009276_3702_4202 | 166 |
| 183 | 3300049459 | Ga0495678_000367 | Ga0495678_000367_37337_37837 | 166 |
| 184 | 3300049515 | Ga0501292_022134 | Ga0501292_022134_232_747 | 166 |
| 185 | 3300049587 | Ga0501071_1111199 | Ga0501071_1111199_57_590 | 166 |
| 186 | 3300050507 | nmdc:mga05p37_286583_c1 | nmdc:mga05p37_286583_c1_1445_1945 | 166 |
| 187 | 3300050508 | nmdc:mga09592_288559_c1 | nmdc:mga09592_288559_c1_675_1175 | 166 |
| 188 | 3300050510 | nmdc:mga06r32_186776_c1 | nmdc:mga06r32_186776_c1_409_909 | 166 |
| 189 | 3300059421 | Ga0590071_021025 | Ga0590071_021025_156_716 | 166 |
| 190 | 3300061719 | Ga0466962_0096217 | Ga0466962_0096217_93_593 | 166 |
| 191 | iso_pu_bacteria | 2513020051 | 2513230589 | 166 |
| 192 | iso_pu_bacteria | 2643221658 | 2644328564 | 166 |
| 193 | iso_pu_bacteria | 2643221672 | 2644399804 | 166 |
| 194 | iso_pu_bacteria | 2738541277 | 2738721379 | 166 |
| 195 | iso_pu_bacteria | 2738543013 | 2739249625 | 166 |
| 196 | iso_pu_bacteria | 2738543019 | 2739281048 | 166 |
| 197 | iso_pu_bacteria | 2885192300 | 2885195012 | 166 |
| 198 | 3300003322 | rootL2_10020422 | rootL2_100204225 | 167 |
| 199 | 3300005295 | Ga0065707_10101401 | Ga0065707_101014012 | 167 |
| 200 | 3300005338 | Ga0068868_100964320 | Ga0068868_1009643202 | 167 |
| 201 | 3300005338 | Ga0068868_101602450 | Ga0068868_1016024501 | 167 |
| 202 | 3300005354 | Ga0070675_100488535 | Ga0070675_1004885351 | 167 |
| 203 | 3300005355 | Ga0070671_101205393 | Ga0070671_1012053931 | 167 |
| 204 | 3300005356 | Ga0070674_100388003 | Ga0070674_1003880031 | 167 |
| 205 | 3300005441 | Ga0070700_100766040 | Ga0070700_1007660401 | 167 |
| 206 | 3300005455 | Ga0070663_100185389 | Ga0070663_1001853891 | 167 |
| 207 | 3300005455 | Ga0070663_101674885 | Ga0070663_1016748851 | 167 |
| 208 | 3300005456 | Ga0070678_100178927 | Ga0070678_1001789271 | 167 |
| 209 | 3300005456 | Ga0070678_101275078 | Ga0070678_1012750782 | 167 |
| 210 | 3300005466 | Ga0070685_10514457 | Ga0070685_105144571 | 167 |
| 211 | 3300005543 | Ga0070672_100220183 | Ga0070672_1002201832 | 167 |
| 212 | 3300005564 | Ga0070664_100241622 | Ga0070664_1002416222 | 167 |
| 213 | 3300005614 | Ga0068856_100649653 | Ga0068856_1006496531 | 167 |
| 214 | 3300005616 | Ga0068852_102122197 | Ga0068852_1021221971 | 167 |
| 215 | 3300005617 | Ga0068859_100338867 | Ga0068859_1003388672 | 167 |
| 216 | 3300005842 | Ga0068858_100488267 | Ga0068858_1004882672 | 167 |
| 217 | 3300006881 | Ga0068865_100204342 | Ga0068865_1002043422 | 167 |
| 218 | 3300006931 | Ga0097620_100338915 | Ga0097620_1003389152 | 167 |
| 219 | 3300009036 | Ga0105244_10017711 | Ga0105244_100177114 | 167 |
| 220 | 3300009098 | Ga0105245_10012561 | Ga0105245_100125618 | 167 |
| 221 | 3300009098 | Ga0105245_10436021 | Ga0105245_104360212 | 167 |
| 222 | 3300009098 | Ga0105245_10987911 | Ga0105245_109879111 | 167 |
| 223 | 3300009174 | Ga0105241_10228970 | Ga0105241_102289702 | 167 |
| 224 | 3300009176 | Ga0105242_10295810 | Ga0105242_102958102 | 167 |
| 225 | 3300009176 | Ga0105242_10356237 | Ga0105242_103562372 | 167 |
| 226 | 3300009545 | Ga0105237_10189785 | Ga0105237_101897852 | 167 |
| 227 | 3300009551 | Ga0105238_10848515 | Ga0105238_108485151 | 167 |
| 228 | 3300010375 | Ga0105239_10317522 | Ga0105239_103175221 | 167 |
| 229 | 3300013296 | Ga0157374_10223789 | Ga0157374_102237892 | 167 |
| 230 | 3300013306 | Ga0163162_10261827 | Ga0163162_102618272 | 167 |
| 231 | 3300013306 | Ga0163162_11322846 | Ga0163162_113228461 | 167 |
| 232 | 3300013308 | Ga0157375_11135788 | Ga0157375_111357882 | 167 |
| 233 | 3300014969 | Ga0157376_10940849 | Ga0157376_109408491 | 167 |
| 234 | 3300025728 | Ga0207655_1067730 | Ga0207655_10677302 | 167 |
| 235 | 3300025903 | Ga0207680_10338048 | Ga0207680_103380481 | 167 |
| 236 | 3300025914 | Ga0207671_10294875 | Ga0207671_102948752 | 167 |
| 237 | 3300025923 | Ga0207681_10904756 | Ga0207681_109047562 | 167 |
| 238 | 3300025926 | Ga0207659_10753015 | Ga0207659_107530151 | 167 |
| 239 | 3300025927 | Ga0207687_10547425 | Ga0207687_105474251 | 167 |
| 240 | 3300025937 | Ga0207669_10074307 | Ga0207669_100743072 | 167 |
| 241 | 3300025940 | Ga0207691_10564074 | Ga0207691_105640741 | 167 |
| 242 | 3300026041 | Ga0207639_10801366 | Ga0207639_108013661 | 167 |
| 243 | 3300026067 | Ga0207678_10247629 | Ga0207678_102476291 | 167 |
| 244 | 3300026075 | Ga0207708_10083169 | Ga0207708_100831693 | 167 |
| 245 | 3300026078 | Ga0207702_10352657 | Ga0207702_103526572 | 167 |
| 246 | 3300026118 | Ga0207675_100940636 | Ga0207675_1009406361 | 167 |
| 247 | 3300026121 | Ga0207683_10242335 | Ga0207683_102423351 | 167 |
| 248 | 3300028794 | Ga0307515_10011668 | Ga0307515_1001166816 | 167 |
| 249 | 3300030522 | Ga0307512_10022817 | Ga0307512_100228176 | 167 |
| 250 | 3300030522 | Ga0307512_10023039 | Ga0307512_100230392 | 167 |
| 251 | 3300031507 | Ga0307509_10236325 | Ga0307509_102363252 | 167 |
| 252 | 3300031616 | Ga0307508_10000278 | Ga0307508_1000027862 | 167 |
| 253 | 3300031649 | Ga0307514_10009496 | Ga0307514_100094963 | 167 |
| 254 | 3300031901 | Ga0307406_10365334 | Ga0307406_103653342 | 167 |
| 255 | 3300033179 | Ga0307507_10104119 | Ga0307507_101041192 | 167 |
| 256 | 3300035089 | Ga0373944_0067142 | Ga0373944_0067142_136_639 | 167 |
| 257 | 3300035116 | Ga0373945_0182128 | Ga0373945_0182128_176_679 | 167 |
| 258 | 3300035695 | Ga0373927_0031372 | Ga0373927_0031372_1551_2054 | 167 |
| 259 | 3300037471 | Ga0395905_0005642 | Ga0395905_0005642_3841_4344 | 167 |
| 260 | 3300046475 | Ga0495639_0106342 | Ga0495639_0106342_371_874 | 167 |
| 261 | 3300046665 | Ga0495661_0000755 | Ga0495661_0000755_10422_10925 | 167 |
| 262 | 3300046681 | Ga0495647_0053062 | Ga0495647_0053062_727_1230 | 167 |
| 263 | 3300050511 | nmdc:mga08y16_183385_c1 | nmdc:mga08y16_183385_c1_1516_2112 | 167 |
| 264 | iso_pu_bacteria | 2904541872 | 2904545375 | 167 |
| 265 | 3300005328 | Ga0070676_10048770 | Ga0070676_100487703 | 168 |
| 266 | 3300005329 | Ga0070683_100179924 | Ga0070683_1001799242 | 168 |
| 267 | 3300005330 | Ga0070690_100300565 | Ga0070690_1003005652 | 168 |
| 268 | 3300005334 | Ga0068869_100066156 | Ga0068869_1000661563 | 168 |
| 269 | 3300005347 | Ga0070668_100122730 | Ga0070668_1001227301 | 168 |
| 270 | 3300005353 | Ga0070669_100250334 | Ga0070669_1002503341 | 168 |
| 271 | 3300005355 | Ga0070671_100073564 | Ga0070671_1000735642 | 168 |
| 272 | 3300005356 | Ga0070674_100104587 | Ga0070674_1001045871 | 168 |
| 273 | 3300005356 | Ga0070674_100775468 | Ga0070674_1007754681 | 168 |
| 274 | 3300005436 | Ga0070713_100079415 | Ga0070713_1000794153 | 168 |
| 275 | 3300005437 | Ga0070710_11181176 | Ga0070710_111811761 | 168 |
| 276 | 3300005441 | Ga0070700_100046369 | Ga0070700_1000463691 | 168 |
| 277 | 3300005456 | Ga0070678_100282242 | Ga0070678_1002822422 | 168 |
| 278 | 3300005459 | Ga0068867_100032411 | Ga0068867_1000324113 | 168 |
| 279 | 3300005459 | Ga0068867_100843491 | Ga0068867_1008434912 | 168 |
| 280 | 3300005539 | Ga0068853_100509540 | Ga0068853_1005095402 | 168 |
| 281 | 3300005543 | Ga0070672_100383809 | Ga0070672_1003838091 | 168 |
| 282 | 3300005615 | Ga0070702_101158956 | Ga0070702_1011589561 | 168 |
| 283 | 3300005616 | Ga0068852_101004876 | Ga0068852_1010048761 | 168 |
| 284 | 3300005617 | Ga0068859_100252906 | Ga0068859_1002529062 | 168 |
| 285 | 3300005618 | Ga0068864_100735631 | Ga0068864_1007356312 | 168 |
| 286 | 3300005718 | Ga0068866_10064676 | Ga0068866_100646762 | 168 |
| 287 | 3300005719 | Ga0068861_100006063 | Ga0068861_1000060631 | 168 |
| 288 | 3300005842 | Ga0068858_100058676 | Ga0068858_1000586762 | 168 |
| 289 | 3300005843 | Ga0068860_100008901 | Ga0068860_1000089012 | 168 |
| 290 | 3300005843 | Ga0068860_100184807 | Ga0068860_1001848072 | 168 |
| 291 | 3300005844 | Ga0068862_100087624 | Ga0068862_1000876243 | 168 |
| 292 | 3300005844 | Ga0068862_101026749 | Ga0068862_1010267492 | 168 |
| 293 | 3300006177 | Ga0075362_10026331 | Ga0075362_100263313 | 168 |
| 294 | 3300006178 | Ga0075367_10173445 | Ga0075367_101734452 | 168 |
| 295 | 3300006178 | Ga0075367_10371852 | Ga0075367_103718521 | 168 |
| 296 | 3300006195 | Ga0075366_10015968 | Ga0075366_100159683 | 168 |
| 297 | 3300006195 | Ga0075366_10153377 | Ga0075366_101533771 | 168 |
| 298 | 3300006881 | Ga0068865_100005535 | Ga0068865_1000055354 | 168 |
| 299 | 3300006931 | Ga0097620_100252899 | Ga0097620_1002528992 | 168 |
| 300 | 3300009148 | Ga0105243_10214642 | Ga0105243_102146422 | 168 |
| 301 | 3300009553 | Ga0105249_10010948 | Ga0105249_100109487 | 168 |
| 302 | 3300013297 | Ga0157378_10025572 | Ga0157378_100255724 | 168 |
| 303 | 3300013306 | Ga0163162_10049343 | Ga0163162_100493433 | 168 |
| 304 | 3300013308 | Ga0157375_10111508 | Ga0157375_101115082 | 168 |
| 305 | 3300014326 | Ga0157380_10009763 | Ga0157380_100097634 | 168 |
| 306 | 3300014968 | Ga0157379_10047612 | Ga0157379_100476123 | 168 |
| 307 | 3300014968 | Ga0157379_10160691 | Ga0157379_101606912 | 168 |
| 308 | 3300014969 | Ga0157376_10266833 | Ga0157376_102668332 | 168 |
| 309 | 3300017792 | Ga0163161_10121160 | Ga0163161_101211602 | 168 |
| 310 | 3300025899 | Ga0207642_10375526 | Ga0207642_103755262 | 168 |
| 311 | 3300025934 | Ga0207686_10402841 | Ga0207686_104028411 | 168 |
| 312 | 3300025935 | Ga0207709_10053433 | Ga0207709_100534334 | 168 |
| 313 | 3300025935 | Ga0207709_10343225 | Ga0207709_103432252 | 168 |
| 314 | 3300025937 | Ga0207669_10138672 | Ga0207669_101386722 | 168 |
| 315 | 3300025940 | Ga0207691_10061540 | Ga0207691_100615402 | 168 |
| 316 | 3300025942 | Ga0207689_10293180 | Ga0207689_102931802 | 168 |
| 317 | 3300025944 | Ga0207661_10142452 | Ga0207661_101424522 | 168 |
| 318 | 3300025961 | Ga0207712_10015478 | Ga0207712_100154783 | 168 |
| 319 | 3300025972 | Ga0207668_10230808 | Ga0207668_102308081 | 168 |
| 320 | 3300026035 | Ga0207703_10800538 | Ga0207703_108005382 | 168 |
| 321 | 3300026075 | Ga0207708_10022713 | Ga0207708_100227132 | 168 |
| 322 | 3300026089 | Ga0207648_10001863 | Ga0207648_1000186322 | 168 |
| 323 | 3300026118 | Ga0207675_100001409 | Ga0207675_10000140924 | 168 |
| 324 | 3300026118 | Ga0207675_100309568 | Ga0207675_1003095682 | 168 |
| 325 | 3300026121 | Ga0207683_10951444 | Ga0207683_109514441 | 168 |
| 326 | 3300026142 | Ga0207698_10353948 | Ga0207698_103539482 | 168 |
| 327 | 3300028381 | Ga0268264_10012690 | Ga0268264_100126907 | 168 |
| 328 | 3300028381 | Ga0268264_10762697 | Ga0268264_107626972 | 168 |
| 329 | 3300031901 | Ga0307406_10472442 | Ga0307406_104724422 | 168 |
| 330 | 3300032005 | Ga0307411_11475033 | Ga0307411_114750331 | 168 |
| 331 | 3300032126 | Ga0307415_101284880 | Ga0307415_1012848801 | 168 |
| 332 | 3300042133 | Ga0450896_024752 | Ga0450896_024752_118_624 | 168 |
| 333 | 3300042134 | Ga0450898_028365 | Ga0450898_028365_457_963 | 168 |
| 334 | 3300046452 | Ga0495617_001251 | Ga0495617_001251_10744_11250 | 168 |
| 335 | 3300046460 | Ga0495638_0090658 | Ga0495638_0090658_20_526 | 168 |
| 336 | 3300046471 | Ga0495650_0136472 | Ga0495650_0136472_133_639 | 168 |
| 337 | 3300046474 | Ga0495605_0045936 | Ga0495605_0045936_147_653 | 168 |
| 338 | 3300046491 | Ga0495584_0000300 | Ga0495584_0000300_25039_25545 | 168 |
| 339 | 3300046492 | Ga0495585_0018990 | Ga0495585_0018990_412_918 | 168 |
| 340 | 3300046492 | Ga0495585_0022023 | Ga0495585_0022023_3017_3523 | 168 |
| 341 | 3300046492 | Ga0495585_0053439 | Ga0495585_0053439_732_1238 | 168 |
| 342 | 3300046501 | Ga0495607_0041673 | Ga0495607_0041673_1902_2408 | 168 |
| 343 | 3300046506 | Ga0495583_0000067 | Ga0495583_0000067_14864_15370 | 168 |
| 344 | 3300046506 | Ga0495583_0000563 | Ga0495583_0000563_2779_3285 | 168 |
| 345 | 3300046506 | Ga0495583_0375639 | Ga0495583_0375639_28_534 | 168 |
| 346 | 3300046513 | Ga0495616_0006364 | Ga0495616_0006364_5407_5913 | 168 |
| 347 | 3300046522 | Ga0495643_0121266 | Ga0495643_0121266_132_644 | 168 |
| 348 | 3300046523 | Ga0495644_0000501 | Ga0495644_0000501_10777_11283 | 168 |
| 349 | 3300046524 | Ga0495648_0000831 | Ga0495648_0000831_14734_15240 | 168 |
| 350 | 3300046530 | Ga0495654_0115443 | Ga0495654_0115443_192_698 | 168 |
| 351 | 3300046538 | Ga0495609_0001479 | Ga0495609_0001479_220_726 | 168 |
| 352 | 3300046538 | Ga0495609_0212485 | Ga0495609_0212485_80_586 | 168 |
| 353 | 3300046542 | Ga0495597_0039235 | Ga0495597_0039235_1155_1667 | 168 |
| 354 | 3300046557 | Ga0495622_0062685 | Ga0495622_0062685_519_1025 | 168 |
| 355 | 3300046558 | Ga0495633_0013261 | Ga0495633_0013261_3264_3770 | 168 |
| 356 | 3300046558 | Ga0495633_0015014 | Ga0495633_0015014_1545_2051 | 168 |
| 357 | 3300046615 | Ga0495656_0001368 | Ga0495656_0001368_162_668 | 168 |
| 358 | 3300046615 | Ga0495656_0014289 | Ga0495656_0014289_1433_1939 | 168 |
| 359 | 3300046648 | Ga0495611_0008860 | Ga0495611_0008860_2836_3342 | 168 |
| 360 | 3300046660 | Ga0495625_0019127 | Ga0495625_0019127_3386_3892 | 168 |
| 361 | 3300046664 | Ga0495659_0000193 | Ga0495659_0000193_9773_10279 | 168 |
| 362 | 3300046691 | Ga0495670_0005694 | Ga0495670_0005694_722_1228 | 168 |
| 363 | 3300046691 | Ga0495670_0005878 | Ga0495670_0005878_5472_5978 | 168 |
| 364 | 3300046692 | Ga0495671_0125520 | Ga0495671_0125520_60_566 | 168 |
| 365 | 3300046692 | Ga0495671_0441055 | Ga0495671_0441055_89_595 | 168 |
| 366 | 3300047318 | Ga0495636_0000302 | Ga0495636_0000302_17555_18061 | 168 |
| 367 | 3300047320 | Ga0495672_0003302 | Ga0495672_0003302_849_1355 | 168 |
| 368 | 3300047320 | Ga0495672_0150664 | Ga0495672_0150664_255_761 | 168 |
| 369 | 3300047323 | Ga0495683_0068546 | Ga0495683_0068546_48_554 | 168 |
| 370 | 3300047443 | Ga0495687_000153 | Ga0495687_000153_49939_50451 | 168 |
| 371 | 3300047443 | Ga0495687_003793 | Ga0495687_003793_6732_7238 | 168 |
| 372 | 3300047445 | Ga0495677_0001414 | Ga0495677_0001414_8576_9082 | 168 |
| 373 | 3300047447 | Ga0495685_000011 | Ga0495685_000011_51089_51595 | 168 |
| 374 | 3300047469 | Ga0495673_0004503 | Ga0495673_0004503_6937_7443 | 168 |
| 375 | 3300048091 | Ga0495626_0198048 | Ga0495626_0198048_156_668 | 168 |
| 376 | 3300049459 | Ga0495678_008149 | Ga0495678_008149_4806_5312 | 168 |
| 377 | 3300049460 | Ga0495682_0000199 | Ga0495682_0000199_22491_22997 | 168 |
| 378 | 3300049460 | Ga0495682_0001987 | Ga0495682_0001987_86_592 | 168 |
| 379 | 3300050493 | nmdc:mga0k408_5871_c1 | nmdc:mga0k408_5871_c1_3362_3868 | 168 |
| 380 | 3300050494 | nmdc:mga06z11_707678_c1 | nmdc:mga06z11_707678_c1_59_598 | 168 |
| 381 | 3300050507 | nmdc:mga05p37_922713_c1 | nmdc:mga05p37_922713_c1_403_912 | 168 |
| 382 | iso_pu_bacteria | 2929160207 | 2929165565 | 168 |
| 383 | 3300003781 | Ga0055536_1013599 | Ga0055536_10135992 | 169 |
| 384 | 3300003792 | Ga0055540_1002229 | Ga0055540_100222913 | 169 |
| 385 | 3300003792 | Ga0055540_1005977 | Ga0055540_10059772 | 169 |
| 386 | 3300003792 | Ga0055540_1007891 | Ga0055540_10078913 | 169 |
| 387 | 3300005288 | Ga0065714_10104460 | Ga0065714_101044602 | 169 |
| 388 | 3300005288 | Ga0065714_10204003 | Ga0065714_102040031 | 169 |
| 389 | 3300005289 | Ga0065704_10081990 | Ga0065704_100819904 | 169 |
| 390 | 3300005290 | Ga0065712_10316088 | Ga0065712_103160881 | 169 |
| 391 | 3300005327 | Ga0070658_10382387 | Ga0070658_103823872 | 169 |
| 392 | 3300005328 | Ga0070676_10002959 | Ga0070676_100029594 | 169 |
| 393 | 3300005328 | Ga0070676_10003006 | Ga0070676_100030066 | 169 |
| 394 | 3300005328 | Ga0070676_10009607 | Ga0070676_100096074 | 169 |
| 395 | 3300005328 | Ga0070676_10115300 | Ga0070676_101153002 | 169 |
| 396 | 3300005330 | Ga0070690_100176086 | Ga0070690_1001760862 | 169 |
| 397 | 3300005331 | Ga0070670_100011371 | Ga0070670_1000113715 | 169 |
| 398 | 3300005331 | Ga0070670_100158075 | Ga0070670_1001580752 | 169 |
| 399 | 3300005331 | Ga0070670_100166921 | Ga0070670_1001669212 | 169 |
| 400 | 3300005331 | Ga0070670_100254958 | Ga0070670_1002549582 | 169 |
| 401 | 3300005333 | Ga0070677_10265891 | Ga0070677_102658911 | 169 |
| 402 | 3300005334 | Ga0068869_100004690 | Ga0068869_1000046901 | 169 |
| 403 | 3300005334 | Ga0068869_100014419 | Ga0068869_1000144194 | 169 |
| 404 | 3300005334 | Ga0068869_101290440 | Ga0068869_1012904401 | 169 |
| 405 | 3300005335 | Ga0070666_10002130 | Ga0070666_100021303 | 169 |
| 406 | 3300005335 | Ga0070666_10242878 | Ga0070666_102428781 | 169 |
| 407 | 3300005335 | Ga0070666_10582288 | Ga0070666_105822881 | 169 |
| 408 | 3300005338 | Ga0068868_100051509 | Ga0068868_1000515094 | 169 |
| 409 | 3300005338 | Ga0068868_100054986 | Ga0068868_1000549864 | 169 |
| 410 | 3300005338 | Ga0068868_100155069 | Ga0068868_1001550691 | 169 |
| 411 | 3300005340 | Ga0070689_100014421 | Ga0070689_1000144212 | 169 |
| 412 | 3300005343 | Ga0070687_100118412 | Ga0070687_1001184122 | 169 |
| 413 | 3300005347 | Ga0070668_100010950 | Ga0070668_1000109502 | 169 |
| 414 | 3300005347 | Ga0070668_100256205 | Ga0070668_1002562052 | 169 |
| 415 | 3300005347 | Ga0070668_100574926 | Ga0070668_1005749262 | 169 |
| 416 | 3300005353 | Ga0070669_100568517 | Ga0070669_1005685171 | 169 |
| 417 | 3300005353 | Ga0070669_100947023 | Ga0070669_1009470231 | 169 |
| 418 | 3300005354 | Ga0070675_100008998 | Ga0070675_1000089984 | 169 |
| 419 | 3300005354 | Ga0070675_100278711 | Ga0070675_1002787112 | 169 |
| 420 | 3300005355 | Ga0070671_100001982 | Ga0070671_1000019827 | 169 |
| 421 | 3300005355 | Ga0070671_100049526 | Ga0070671_1000495262 | 169 |
| 422 | 3300005355 | Ga0070671_100199979 | Ga0070671_1001999791 | 169 |
| 423 | 3300005355 | Ga0070671_100283273 | Ga0070671_1002832732 | 169 |
| 424 | 3300005356 | Ga0070674_100031734 | Ga0070674_1000317342 | 169 |
| 425 | 3300005364 | Ga0070673_100000636 | Ga0070673_10000063613 | 169 |
| 426 | 3300005364 | Ga0070673_100017149 | Ga0070673_1000171495 | 169 |
| 427 | 3300005364 | Ga0070673_100068716 | Ga0070673_1000687162 | 169 |
| 428 | 3300005364 | Ga0070673_100582773 | Ga0070673_1005827731 | 169 |
| 429 | 3300005364 | Ga0070673_100772804 | Ga0070673_1007728041 | 169 |
| 430 | 3300005365 | Ga0070688_100206154 | Ga0070688_1002061542 | 169 |
| 431 | 3300005365 | Ga0070688_100241403 | Ga0070688_1002414031 | 169 |
| 432 | 3300005366 | Ga0070659_100368624 | Ga0070659_1003686242 | 169 |
| 433 | 3300005367 | Ga0070667_100000916 | Ga0070667_1000009166 | 169 |
| 434 | 3300005367 | Ga0070667_100108331 | Ga0070667_1001083312 | 169 |
| 435 | 3300005367 | Ga0070667_100254517 | Ga0070667_1002545172 | 169 |
| 436 | 3300005367 | Ga0070667_100276685 | Ga0070667_1002766851 | 169 |
| 437 | 3300005438 | Ga0070701_10236218 | Ga0070701_102362182 | 169 |
| 438 | 3300005441 | Ga0070700_100021338 | Ga0070700_1000213382 | 169 |
| 439 | 3300005456 | Ga0070678_100005995 | Ga0070678_1000059952 | 169 |
| 440 | 3300005456 | Ga0070678_100296129 | Ga0070678_1002961292 | 169 |
| 441 | 3300005457 | Ga0070662_100002338 | Ga0070662_1000023383 | 169 |
| 442 | 3300005457 | Ga0070662_100189153 | Ga0070662_1001891532 | 169 |
| 443 | 3300005459 | Ga0068867_100000664 | Ga0068867_10000066417 | 169 |
| 444 | 3300005459 | Ga0068867_100013814 | Ga0068867_1000138142 | 169 |
| 445 | 3300005459 | Ga0068867_100029743 | Ga0068867_1000297433 | 169 |
| 446 | 3300005459 | Ga0068867_100154895 | Ga0068867_1001548952 | 169 |
| 447 | 3300005459 | Ga0068867_100212789 | Ga0068867_1002127891 | 169 |
| 448 | 3300005466 | Ga0070685_10633233 | Ga0070685_106332331 | 169 |
| 449 | 3300005466 | Ga0070685_10678964 | Ga0070685_106789641 | 169 |
| 450 | 3300005539 | Ga0068853_101150454 | Ga0068853_1011504541 | 169 |
| 451 | 3300005543 | Ga0070672_100000215 | Ga0070672_10000021521 | 169 |
| 452 | 3300005543 | Ga0070672_100007533 | Ga0070672_1000075333 | 169 |
| 453 | 3300005543 | Ga0070672_100375068 | Ga0070672_1003750682 | 169 |
| 454 | 3300005543 | Ga0070672_100529513 | Ga0070672_1005295132 | 169 |
| 455 | 3300005543 | Ga0070672_101011538 | Ga0070672_1010115381 | 169 |
| 456 | 3300005544 | Ga0070686_100058846 | Ga0070686_1000588461 | 169 |
| 457 | 3300005548 | Ga0070665_100025474 | Ga0070665_1000254746 | 169 |
| 458 | 3300005548 | Ga0070665_100055275 | Ga0070665_1000552755 | 169 |
| 459 | 3300005577 | Ga0068857_100012327 | Ga0068857_1000123276 | 169 |
| 460 | 3300005616 | Ga0068852_100180934 | Ga0068852_1001809342 | 169 |
| 461 | 3300005617 | Ga0068859_100010428 | Ga0068859_1000104288 | 169 |
| 462 | 3300005617 | Ga0068859_100175040 | Ga0068859_1001750402 | 169 |
| 463 | 3300005617 | Ga0068859_100413590 | Ga0068859_1004135902 | 169 |
| 464 | 3300005618 | Ga0068864_100011184 | Ga0068864_1000111844 | 169 |
| 465 | 3300005618 | Ga0068864_100015192 | Ga0068864_1000151922 | 169 |
| 466 | 3300005718 | Ga0068866_10019710 | Ga0068866_100197102 | 169 |
| 467 | 3300005719 | Ga0068861_100136966 | Ga0068861_1001369662 | 169 |
| 468 | 3300005834 | Ga0068851_10040298 | Ga0068851_100402983 | 169 |
| 469 | 3300005840 | Ga0068870_10032629 | Ga0068870_100326292 | 169 |
| 470 | 3300005840 | Ga0068870_10504622 | Ga0068870_105046222 | 169 |
| 471 | 3300005841 | Ga0068863_100001567 | Ga0068863_1000015672 | 169 |
| 472 | 3300005841 | Ga0068863_100001722 | Ga0068863_10000172224 | 169 |
| 473 | 3300005841 | Ga0068863_100380730 | Ga0068863_1003807302 | 169 |
| 474 | 3300005842 | Ga0068858_100000628 | Ga0068858_10000062833 | 169 |
| 475 | 3300005842 | Ga0068858_100323282 | Ga0068858_1003232822 | 169 |
| 476 | 3300005842 | Ga0068858_100852913 | Ga0068858_1008529132 | 169 |
| 477 | 3300005842 | Ga0068858_101001619 | Ga0068858_1010016191 | 169 |
| 478 | 3300005843 | Ga0068860_100002622 | Ga0068860_1000026222 | 169 |
| 479 | 3300005843 | Ga0068860_100474576 | Ga0068860_1004745762 | 169 |
| 480 | 3300005844 | Ga0068862_100049227 | Ga0068862_1000492273 | 169 |
| 481 | 3300005937 | Ga0081455_10732466 | Ga0081455_107324661 | 169 |
| 482 | 3300006038 | Ga0075365_10188804 | Ga0075365_101888042 | 169 |
| 483 | 3300006195 | Ga0075366_10006489 | Ga0075366_100064893 | 169 |
| 484 | 3300006195 | Ga0075366_10064372 | Ga0075366_100643722 | 169 |
| 485 | 3300006195 | Ga0075366_10077864 | Ga0075366_100778642 | 169 |
| 486 | 3300006195 | Ga0075366_10095547 | Ga0075366_100955472 | 169 |
| 487 | 3300006195 | Ga0075366_10212788 | Ga0075366_102127882 | 169 |
| 488 | 3300006237 | Ga0097621_100019592 | Ga0097621_1000195922 | 169 |
| 489 | 3300006237 | Ga0097621_100779391 | Ga0097621_1007793912 | 169 |
| 490 | 3300006358 | Ga0068871_100012228 | Ga0068871_1000122281 | 169 |
| 491 | 3300006844 | Ga0075428_102160969 | Ga0075428_1021609691 | 169 |
| 492 | 3300006881 | Ga0068865_100003621 | Ga0068865_1000036212 | 169 |
| 493 | 3300006881 | Ga0068865_100037561 | Ga0068865_1000375613 | 169 |
| 494 | 3300006881 | Ga0068865_100703363 | Ga0068865_1007033632 | 169 |
| 495 | 3300006931 | Ga0097620_100010429 | Ga0097620_1000104298 | 169 |
| 496 | 3300006931 | Ga0097620_100175044 | Ga0097620_1001750442 | 169 |
| 497 | 3300006931 | Ga0097620_100413575 | Ga0097620_1004135752 | 169 |
| 498 | 3300009098 | Ga0105245_10018645 | Ga0105245_100186454 | 169 |
| 499 | 3300009098 | Ga0105245_10038455 | Ga0105245_100384555 | 169 |
| 500 | 3300009098 | Ga0105245_10406613 | Ga0105245_104066131 | 169 |
| 501 | 3300009148 | Ga0105243_10000437 | Ga0105243_1000043722 | 169 |
| 502 | 3300009148 | Ga0105243_10002267 | Ga0105243_100022674 | 169 |
| 503 | 3300009176 | Ga0105242_10172499 | Ga0105242_101724992 | 169 |
| 504 | 3300009176 | Ga0105242_10640995 | Ga0105242_106409952 | 169 |
| 505 | 3300009177 | Ga0105248_10002934 | Ga0105248_1000293419 | 169 |
| 506 | 3300009177 | Ga0105248_10110965 | Ga0105248_101109652 | 169 |
| 507 | 3300009551 | Ga0105238_10158793 | Ga0105238_101587932 | 169 |
| 508 | 3300009553 | Ga0105249_10007568 | Ga0105249_100075687 | 169 |
| 509 | 3300009553 | Ga0105249_10432539 | Ga0105249_104325392 | 169 |
| 510 | 3300011119 | Ga0105246_10204120 | Ga0105246_102041201 | 169 |
| 511 | 3300011119 | Ga0105246_10594420 | Ga0105246_105944202 | 169 |
| 512 | 3300011119 | Ga0105246_10833173 | Ga0105246_108331732 | 169 |
| 513 | 3300013100 | Ga0157373_10079134 | Ga0157373_100791343 | 169 |
| 514 | 3300013296 | Ga0157374_10190956 | Ga0157374_101909562 | 169 |
| 515 | 3300013296 | Ga0157374_10390070 | Ga0157374_103900702 | 169 |
| 516 | 3300013297 | Ga0157378_10068930 | Ga0157378_100689303 | 169 |
| 517 | 3300013297 | Ga0157378_10181822 | Ga0157378_101818222 | 169 |
| 518 | 3300013297 | Ga0157378_10217874 | Ga0157378_102178742 | 169 |
| 519 | 3300013306 | Ga0163162_10000954 | Ga0163162_1000095420 | 169 |
| 520 | 3300013306 | Ga0163162_10093337 | Ga0163162_100933372 | 169 |
| 521 | 3300013306 | Ga0163162_10271330 | Ga0163162_102713302 | 169 |
| 522 | 3300013308 | Ga0157375_10000550 | Ga0157375_100005507 | 169 |
| 523 | 3300013308 | Ga0157375_10018289 | Ga0157375_100182893 | 169 |
| 524 | 3300013308 | Ga0157375_10033787 | Ga0157375_100337875 | 169 |
| 525 | 3300014325 | Ga0163163_10146821 | Ga0163163_101468214 | 169 |
| 526 | 3300014326 | Ga0157380_10000489 | Ga0157380_100004892 | 169 |
| 527 | 3300014497 | Ga0182008_10050118 | Ga0182008_100501182 | 169 |
| 528 | 3300014745 | Ga0157377_10324933 | Ga0157377_103249331 | 169 |
| 529 | 3300014968 | Ga0157379_10000439 | Ga0157379_1000043926 | 169 |
| 530 | 3300014968 | Ga0157379_10094579 | Ga0157379_100945792 | 169 |
| 531 | 3300014968 | Ga0157379_10294445 | Ga0157379_102944452 | 169 |
| 532 | 3300014968 | Ga0157379_10305253 | Ga0157379_103052532 | 169 |
| 533 | 3300014969 | Ga0157376_10203034 | Ga0157376_102030342 | 169 |
| 534 | 3300014969 | Ga0157376_10585657 | Ga0157376_105856572 | 169 |
| 535 | 3300015261 | Ga0182006_1001748 | Ga0182006_100174818 | 169 |
| 536 | 3300015261 | Ga0182006_1127927 | Ga0182006_11279271 | 169 |
| 537 | 3300015262 | Ga0182007_10004346 | Ga0182007_100043469 | 169 |
| 538 | 3300015265 | Ga0182005_1031429 | Ga0182005_10314292 | 169 |
| 539 | 3300015683 | Ga0183362_10005 | Ga0183362_10005228 | 169 |
| 540 | 3300017792 | Ga0163161_10006931 | Ga0163161_100069317 | 169 |
| 541 | 3300017792 | Ga0163161_10052953 | Ga0163161_100529534 | 169 |
| 542 | 3300017792 | Ga0163161_10120687 | Ga0163161_101206872 | 169 |
| 543 | 3300021384 | Ga0213876_10181594 | Ga0213876_101815941 | 169 |
| 544 | 3300025292 | Ga0209676_1000368 | Ga0209676_100036883 | 169 |
| 545 | 3300025298 | Ga0209050_1051799 | Ga0209050_10517991 | 169 |
| 546 | 3300025303 | Ga0209051_1000178 | Ga0209051_10001782 | 169 |
| 547 | 3300025303 | Ga0209051_1000931 | Ga0209051_100093129 | 169 |
| 548 | 3300025303 | Ga0209051_1016148 | Ga0209051_10161483 | 169 |
| 549 | 3300025315 | Ga0207697_10018594 | Ga0207697_100185942 | 169 |
| 550 | 3300025321 | Ga0207656_10005089 | Ga0207656_100050893 | 169 |
| 551 | 3300025893 | Ga0207682_10019861 | Ga0207682_100198614 | 169 |
| 552 | 3300025893 | Ga0207682_10366174 | Ga0207682_103661741 | 169 |
| 553 | 3300025899 | Ga0207642_10005581 | Ga0207642_100055812 | 169 |
| 554 | 3300025903 | Ga0207680_10086167 | Ga0207680_100861672 | 169 |
| 555 | 3300025903 | Ga0207680_10152926 | Ga0207680_101529262 | 169 |
| 556 | 3300025903 | Ga0207680_10320938 | Ga0207680_103209382 | 169 |
| 557 | 3300025903 | Ga0207680_10509501 | Ga0207680_105095012 | 169 |
| 558 | 3300025903 | Ga0207680_10993635 | Ga0207680_109936351 | 169 |
| 559 | 3300025907 | Ga0207645_10002573 | Ga0207645_100025737 | 169 |
| 560 | 3300025907 | Ga0207645_10008080 | Ga0207645_100080807 | 169 |
| 561 | 3300025907 | Ga0207645_10017297 | Ga0207645_100172973 | 169 |
| 562 | 3300025908 | Ga0207643_10014794 | Ga0207643_100147943 | 169 |
| 563 | 3300025908 | Ga0207643_10087791 | Ga0207643_100877911 | 169 |
| 564 | 3300025918 | Ga0207662_10130324 | Ga0207662_101303242 | 169 |
| 565 | 3300025919 | Ga0207657_10627702 | Ga0207657_106277021 | 169 |
| 566 | 3300025923 | Ga0207681_10000644 | Ga0207681_1000064412 | 169 |
| 567 | 3300025923 | Ga0207681_10238766 | Ga0207681_102387662 | 169 |
| 568 | 3300025923 | Ga0207681_10245131 | Ga0207681_102451311 | 169 |
| 569 | 3300025925 | Ga0207650_10006427 | Ga0207650_100064274 | 169 |
| 570 | 3300025925 | Ga0207650_10657425 | Ga0207650_106574252 | 169 |
| 571 | 3300025926 | Ga0207659_10000751 | Ga0207659_1000075112 | 169 |
| 572 | 3300025926 | Ga0207659_10006069 | Ga0207659_100060694 | 169 |
| 573 | 3300025927 | Ga0207687_10011986 | Ga0207687_100119865 | 169 |
| 574 | 3300025927 | Ga0207687_10038600 | Ga0207687_100386002 | 169 |
| 575 | 3300025927 | Ga0207687_10563588 | Ga0207687_105635882 | 169 |
| 576 | 3300025931 | Ga0207644_10010084 | Ga0207644_100100842 | 169 |
| 577 | 3300025931 | Ga0207644_10031885 | Ga0207644_100318852 | 169 |
| 578 | 3300025931 | Ga0207644_10039620 | Ga0207644_100396205 | 169 |
| 579 | 3300025931 | Ga0207644_10248176 | Ga0207644_102481761 | 169 |
| 580 | 3300025933 | Ga0207706_10006980 | Ga0207706_100069801 | 169 |
| 581 | 3300025934 | Ga0207686_10167181 | Ga0207686_101671812 | 169 |
| 582 | 3300025934 | Ga0207686_10627384 | Ga0207686_106273841 | 169 |
| 583 | 3300025935 | Ga0207709_10002102 | Ga0207709_100021025 | 169 |
| 584 | 3300025935 | Ga0207709_10025447 | Ga0207709_100254471 | 169 |
| 585 | 3300025936 | Ga0207670_10008093 | Ga0207670_100080932 | 169 |
| 586 | 3300025936 | Ga0207670_10197679 | Ga0207670_101976791 | 169 |
| 587 | 3300025937 | Ga0207669_10001517 | Ga0207669_100015175 | 169 |
| 588 | 3300025937 | Ga0207669_10013519 | Ga0207669_100135192 | 169 |
| 589 | 3300025938 | Ga0207704_10001175 | Ga0207704_100011757 | 169 |
| 590 | 3300025938 | Ga0207704_10056013 | Ga0207704_100560133 | 169 |
| 591 | 3300025938 | Ga0207704_10207072 | Ga0207704_102070722 | 169 |
| 592 | 3300025940 | Ga0207691_10000347 | Ga0207691_100003472 | 169 |
| 593 | 3300025940 | Ga0207691_10003219 | Ga0207691_100032199 | 169 |
| 594 | 3300025940 | Ga0207691_10093373 | Ga0207691_100933732 | 169 |
| 595 | 3300025940 | Ga0207691_10170221 | Ga0207691_101702212 | 169 |
| 596 | 3300025940 | Ga0207691_10175507 | Ga0207691_101755072 | 169 |
| 597 | 3300025941 | Ga0207711_10004936 | Ga0207711_100049367 | 169 |
| 598 | 3300025942 | Ga0207689_10002269 | Ga0207689_100022694 | 169 |
| 599 | 3300025942 | Ga0207689_10010698 | Ga0207689_100106984 | 169 |
| 600 | 3300025945 | Ga0207679_10271542 | Ga0207679_102715422 | 169 |
| 601 | 3300025960 | Ga0207651_10000398 | Ga0207651_1000039814 | 169 |
| 602 | 3300025960 | Ga0207651_10012112 | Ga0207651_100121122 | 169 |
| 603 | 3300025960 | Ga0207651_10022279 | Ga0207651_100222793 | 169 |
| 604 | 3300025961 | Ga0207712_10009709 | Ga0207712_100097095 | 169 |
| 605 | 3300025972 | Ga0207668_10000809 | Ga0207668_1000080911 | 169 |
| 606 | 3300025972 | Ga0207668_10042364 | Ga0207668_100423642 | 169 |
| 607 | 3300025972 | Ga0207668_10287476 | Ga0207668_102874762 | 169 |
| 608 | 3300025972 | Ga0207668_10653087 | Ga0207668_106530871 | 169 |
| 609 | 3300025986 | Ga0207658_10002681 | Ga0207658_100026811 | 169 |
| 610 | 3300025986 | Ga0207658_10010019 | Ga0207658_100100192 | 169 |
| 611 | 3300025986 | Ga0207658_10074759 | Ga0207658_100747591 | 169 |
| 612 | 3300025986 | Ga0207658_10380315 | Ga0207658_103803151 | 169 |
| 613 | 3300026023 | Ga0207677_10008191 | Ga0207677_100081915 | 169 |
| 614 | 3300026023 | Ga0207677_10011928 | Ga0207677_100119282 | 169 |
| 615 | 3300026023 | Ga0207677_10031948 | Ga0207677_100319482 | 169 |
| 616 | 3300026023 | Ga0207677_10138338 | Ga0207677_101383382 | 169 |
| 617 | 3300026035 | Ga0207703_10002510 | Ga0207703_100025107 | 169 |
| 618 | 3300026035 | Ga0207703_10013182 | Ga0207703_100131822 | 169 |
| 619 | 3300026067 | Ga0207678_10013862 | Ga0207678_100138626 | 169 |
| 620 | 3300026067 | Ga0207678_10786432 | Ga0207678_107864322 | 169 |
| 621 | 3300026075 | Ga0207708_10013570 | Ga0207708_100135703 | 169 |
| 622 | 3300026075 | Ga0207708_10144528 | Ga0207708_101445282 | 169 |
| 623 | 3300026088 | Ga0207641_10017015 | Ga0207641_100170152 | 169 |
| 624 | 3300026088 | Ga0207641_10055684 | Ga0207641_100556842 | 169 |
| 625 | 3300026089 | Ga0207648_10002881 | Ga0207648_100028812 | 169 |
| 626 | 3300026089 | Ga0207648_10007895 | Ga0207648_100078956 | 169 |
| 627 | 3300026089 | Ga0207648_10021442 | Ga0207648_100214422 | 169 |
| 628 | 3300026089 | Ga0207648_10078374 | Ga0207648_100783742 | 169 |
| 629 | 3300026095 | Ga0207676_10000082 | Ga0207676_1000008238 | 169 |
| 630 | 3300026095 | Ga0207676_10050076 | Ga0207676_100500765 | 169 |
| 631 | 3300026095 | Ga0207676_11089170 | Ga0207676_110891701 | 169 |
| 632 | 3300026116 | Ga0207674_10018126 | Ga0207674_100181265 | 169 |
| 633 | 3300026118 | Ga0207675_100000927 | Ga0207675_10000092727 | 169 |
| 634 | 3300026121 | Ga0207683_10210587 | Ga0207683_102105872 | 169 |
| 635 | 3300026121 | Ga0207683_10214579 | Ga0207683_102145792 | 169 |
| 636 | 3300026121 | Ga0207683_10216547 | Ga0207683_102165472 | 169 |
| 637 | 3300026142 | Ga0207698_10292253 | Ga0207698_102922532 | 169 |
| 638 | 3300026142 | Ga0207698_10661934 | Ga0207698_106619341 | 169 |
| 639 | 3300026142 | Ga0207698_10688782 | Ga0207698_106887821 | 169 |
| 640 | 3300028380 | Ga0268265_10110441 | Ga0268265_101104412 | 169 |
| 641 | 3300028381 | Ga0268264_10002202 | Ga0268264_100022029 | 169 |
| 642 | 3300028381 | Ga0268264_10041350 | Ga0268264_100413505 | 169 |
| 643 | 3300028786 | Ga0307517_10004553 | Ga0307517_1000455322 | 169 |
| 644 | 3300028786 | Ga0307517_10179854 | Ga0307517_101798542 | 169 |
| 645 | 3300028794 | Ga0307515_10023797 | Ga0307515_100237979 | 169 |
| 646 | 3300028794 | Ga0307515_10102188 | Ga0307515_101021883 | 169 |
| 647 | 3300028794 | Ga0307515_10126323 | Ga0307515_101263232 | 169 |
| 648 | 3300031456 | Ga0307513_10001868 | Ga0307513_1000186823 | 169 |
| 649 | 3300031456 | Ga0307513_10086955 | Ga0307513_100869552 | 169 |
| 650 | 3300031507 | Ga0307509_10007851 | Ga0307509_100078516 | 169 |
| 651 | 3300031507 | Ga0307509_10038154 | Ga0307509_100381544 | 169 |
| 652 | 3300031507 | Ga0307509_10603647 | Ga0307509_106036471 | 169 |
| 653 | 3300031548 | Ga0307408_100947544 | Ga0307408_1009475441 | 169 |
| 654 | 3300031548 | Ga0307408_101100691 | Ga0307408_1011006911 | 169 |
| 655 | 3300031616 | Ga0307508_10008282 | Ga0307508_100082825 | 169 |
| 656 | 3300031649 | Ga0307514_10096609 | Ga0307514_100966093 | 169 |
| 657 | 3300031649 | Ga0307514_10237904 | Ga0307514_102379042 | 169 |
| 658 | 3300031711 | Ga0265314_10231927 | Ga0265314_102319271 | 169 |
| 659 | 3300031730 | Ga0307516_10000237 | Ga0307516_1000023727 | 169 |
| 660 | 3300031852 | Ga0307410_10087844 | Ga0307410_100878442 | 169 |
| 661 | 3300031901 | Ga0307406_10123962 | Ga0307406_101239622 | 169 |
| 662 | 3300031995 | Ga0307409_100566255 | Ga0307409_1005662552 | 169 |
| 663 | 3300032002 | Ga0307416_101020974 | Ga0307416_1010209742 | 169 |
| 664 | 3300035114 | Ga0373939_0195590 | Ga0373939_0195590_226_735 | 169 |
| 665 | 3300035171 | Ga0373946_0095441 | Ga0373946_0095441_284_793 | 169 |
| 666 | 3300035692 | Ga0373935_0115537 | Ga0373935_0115537_470_979 | 169 |
| 667 | 3300036401 | Ga0373937_0047465 | Ga0373937_0047465_2478_2987 | 169 |
| 668 | 3300036401 | Ga0373937_0125469 | Ga0373937_0125469_1726_2235 | 169 |
| 669 | 3300037068 | Ga0373925_0122348 | Ga0373925_0122348_1003_1512 | 169 |
| 670 | 3300037466 | Ga0395898_0237105 | Ga0395898_0237105_1040_1549 | 169 |
| 671 | 3300037471 | Ga0395905_0006264 | Ga0395905_0006264_896_1405 | 169 |
| 672 | 3300037471 | Ga0395905_0115347 | Ga0395905_0115347_401_910 | 169 |
| 673 | 3300037471 | Ga0395905_0285411 | Ga0395905_0285411_613_1122 | 169 |
| 674 | 3300037471 | Ga0395905_0489662 | Ga0395905_0489662_212_721 | 169 |
| 675 | 3300039437 | Ga0436365_1402919 | Ga0436365_1402919_1263_1772 | 169 |
| 676 | 3300039450 | Ga0436363_1469836 | Ga0436363_1469836_607_1116 | 169 |
| 677 | 3300041451 | Ga0451791_0210227 | Ga0451791_0210227_163_678 | 169 |
| 678 | 3300041452 | Ga0451793_0124799 | Ga0451793_0124799_83_598 | 169 |
| 679 | 3300041459 | Ga0451800_0939557 | Ga0451800_0939557_49_558 | 169 |
| 680 | 3300041512 | Ga0451853_1321958 | Ga0451853_1321958_216_731 | 169 |
| 681 | 3300042012 | Ga0439455_0018540 | Ga0439455_0018540_223_732 | 169 |
| 682 | 3300042134 | Ga0450898_015921 | Ga0450898_015921_160_669 | 169 |
| 683 | 3300042876 | Ga0451577_0068194 | Ga0451577_0068194_1864_2373 | 169 |
| 684 | 3300046454 | Ga0495592_0000211 | Ga0495592_0000211_13287_13796 | 169 |
| 685 | 3300046457 | Ga0495590_0013034 | Ga0495590_0013034_1234_1743 | 169 |
| 686 | 3300046459 | Ga0495629_0032522 | Ga0495629_0032522_2325_2834 | 169 |
| 687 | 3300046459 | Ga0495629_0042748 | Ga0495629_0042748_1669_2178 | 169 |
| 688 | 3300046460 | Ga0495638_0074021 | Ga0495638_0074021_1237_1746 | 169 |
| 689 | 3300046463 | Ga0495653_0380860 | Ga0495653_0380860_187_696 | 169 |
| 690 | 3300046473 | Ga0495582_0185706 | Ga0495582_0185706_159_668 | 169 |
| 691 | 3300046475 | Ga0495639_0071706 | Ga0495639_0071706_575_1084 | 169 |
| 692 | 3300046475 | Ga0495639_0235238 | Ga0495639_0235238_286_795 | 169 |
| 693 | 3300046506 | Ga0495583_0067301 | Ga0495583_0067301_17_526 | 169 |
| 694 | 3300046507 | Ga0495606_0262079 | Ga0495606_0262079_158_673 | 169 |
| 695 | 3300046516 | Ga0495628_0124485 | Ga0495628_0124485_160_669 | 169 |
| 696 | 3300046516 | Ga0495628_0404365 | Ga0495628_0404365_73_621 | 169 |
| 697 | 3300046528 | Ga0495642_0092321 | Ga0495642_0092321_464_973 | 169 |
| 698 | 3300046533 | Ga0495640_0123366 | Ga0495640_0123366_569_1078 | 169 |
| 699 | 3300046533 | Ga0495640_0240409 | Ga0495640_0240409_162_671 | 169 |
| 700 | 3300046539 | Ga0495621_0003592 | Ga0495621_0003592_833_1342 | 169 |
| 701 | 3300046615 | Ga0495656_0000055 | Ga0495656_0000055_29662_30171 | 169 |
| 702 | 3300046615 | Ga0495656_0029376 | Ga0495656_0029376_34_543 | 169 |
| 703 | 3300046616 | Ga0495668_0049884 | Ga0495668_0049884_744_1253 | 169 |
| 704 | 3300046616 | Ga0495668_0211190 | Ga0495668_0211190_274_783 | 169 |
| 705 | 3300046642 | Ga0495634_0268308 | Ga0495634_0268308_502_1011 | 169 |
| 706 | 3300046660 | Ga0495625_0069863 | Ga0495625_0069863_469_978 | 169 |
| 707 | 3300046663 | Ga0495635_0102477 | Ga0495635_0102477_404_913 | 169 |
| 708 | 3300046663 | Ga0495635_0171602 | Ga0495635_0171602_254_763 | 169 |
| 709 | 3300046674 | Ga0495588_0097954 | Ga0495588_0097954_520_1029 | 169 |
| 710 | 3300046678 | Ga0495599_0297918 | Ga0495599_0297918_342_851 | 169 |
| 711 | 3300046680 | Ga0495646_0259762 | Ga0495646_0259762_57_566 | 169 |
| 712 | 3300046681 | Ga0495647_0037297 | Ga0495647_0037297_147_656 | 169 |
| 713 | 3300046681 | Ga0495647_0159299 | Ga0495647_0159299_203_712 | 169 |
| 714 | 3300046681 | Ga0495647_0176505 | Ga0495647_0176505_345_854 | 169 |
| 715 | 3300046683 | Ga0495658_0070109 | Ga0495658_0070109_1371_1880 | 169 |
| 716 | 3300046683 | Ga0495658_0354995 | Ga0495658_0354995_241_789 | 169 |
| 717 | 3300046689 | Ga0495613_0669775 | Ga0495613_0669775_151_660 | 169 |
| 718 | 3300046691 | Ga0495670_0105166 | Ga0495670_0105166_371_880 | 169 |
| 719 | 3300046809 | Ga0495600_0032003 | Ga0495600_0032003_2290_2799 | 169 |
| 720 | 3300046809 | Ga0495600_0564390 | Ga0495600_0564390_138_647 | 169 |
| 721 | 3300046810 | Ga0495660_0046913 | Ga0495660_0046913_937_1446 | 169 |
| 722 | 3300047315 | Ga0495581_0205380 | Ga0495581_0205380_215_724 | 169 |
| 723 | 3300047319 | Ga0495674_0466405 | Ga0495674_0466405_261_770 | 169 |
| 724 | 3300047321 | Ga0495676_0109107 | Ga0495676_0109107_1126_1635 | 169 |
| 725 | 3300047445 | Ga0495677_0184931 | Ga0495677_0184931_75_584 | 169 |
| 726 | 3300047447 | Ga0495685_086382 | Ga0495685_086382_393_902 | 169 |
| 727 | 3300047470 | Ga0495681_0055933 | Ga0495681_0055933_887_1396 | 169 |
| 728 | 3300047471 | Ga0495684_0115155 | Ga0495684_0115155_866_1375 | 169 |
| 729 | 3300047471 | Ga0495684_0666773 | Ga0495684_0666773_16_525 | 169 |
| 730 | 3300048089 | Ga0495614_0452816 | Ga0495614_0452816_58_567 | 169 |
| 731 | 3300048090 | Ga0495615_0068733 | Ga0495615_0068733_367_876 | 169 |
| 732 | 3300048903 | Ga0496100_0101842 | Ga0496100_0101842_540_1049 | 169 |
| 733 | 3300048904 | Ga0496101_0010546 | Ga0496101_0010546_2841_3350 | 169 |
| 734 | 3300048905 | Ga0496102_0014578 | Ga0496102_0014578_3117_3626 | 169 |
| 735 | 3300048906 | Ga0496103_0010336 | Ga0496103_0010336_2635_3144 | 169 |
| 736 | 3300048907 | Ga0496104_0015327 | Ga0496104_0015327_1317_1826 | 169 |
| 737 | 3300048907 | Ga0496104_1466667 | Ga0496104_1466667_51_560 | 169 |
| 738 | 3300048908 | Ga0496105_0002074 | Ga0496105_0002074_1284_1793 | 169 |
| 739 | 3300048909 | Ga0496106_0024302 | Ga0496106_0024302_1100_1609 | 169 |
| 740 | 3300048910 | Ga0496107_0036652 | Ga0496107_0036652_215_724 | 169 |
| 741 | 3300048911 | Ga0496108_0022182 | Ga0496108_0022182_376_885 | 169 |
| 742 | 3300048913 | Ga0496110_0029223 | Ga0496110_0029223_4001_4510 | 169 |
| 743 | 3300048914 | Ga0496111_0124593 | Ga0496111_0124593_328_837 | 169 |
| 744 | 3300048916 | Ga0496113_0350757 | Ga0496113_0350757_132_641 | 169 |
| 745 | 3300048917 | Ga0496114_0069772 | Ga0496114_0069772_1471_1980 | 169 |
| 746 | 3300048928 | Ga0496125_0438466 | Ga0496125_0438466_54_563 | 169 |
| 747 | 3300049515 | Ga0501292_009487 | Ga0501292_009487_663_1172 | 169 |
| 748 | 3300049517 | Ga0501294_008077 | Ga0501294_008077_235_744 | 169 |
| 749 | 3300049521 | Ga0501298_002185 | Ga0501298_002185_1396_1905 | 169 |
| 750 | 3300049522 | Ga0501299_032863 | Ga0501299_032863_373_882 | 169 |
| 751 | 3300049650 | Ga0501199_013270 | Ga0501199_013270_21_530 | 169 |
| 752 | 3300049653 | Ga0501206_002813 | Ga0501206_002813_490_999 | 169 |
| 753 | 3300049686 | Ga0501257_037872 | Ga0501257_037872_117_626 | 169 |
| 754 | 3300049688 | Ga0501259_058687 | Ga0501259_058687_83_592 | 169 |
| 755 | 3300049759 | Ga0501262_009881 | Ga0501262_009881_380_889 | 169 |
| 756 | 3300049770 | Ga0501273_006673 | Ga0501273_006673_362_871 | 169 |
| 757 | 3300049777 | Ga0501281_03099 | Ga0501281_03099_439_948 | 169 |
| 758 | 3300050489 | nmdc:mga03683_107284_c1 | nmdc:mga03683_107284_c1_682_1191 | 169 |
| 759 | 3300050493 | nmdc:mga0k408_251645_c1 | nmdc:mga0k408_251645_c1_23_532 | 169 |
| 760 | 3300050493 | nmdc:mga0k408_36165_c1 | nmdc:mga0k408_36165_c1_1013_1522 | 169 |
| 761 | 3300050493 | nmdc:mga0k408_73875_c1 | nmdc:mga0k408_73875_c1_737_1246 | 169 |
| 762 | 3300050493 | nmdc:mga0k408_92205_c1 | nmdc:mga0k408_92205_c1_931_1440 | 169 |
| 763 | 3300050496 | nmdc:mga07m45_397680_c1 | nmdc:mga07m45_397680_c1_268_777 | 169 |
| 764 | 3300050496 | nmdc:mga07m45_607872_c1 | nmdc:mga07m45_607872_c1_97_606 | 169 |
| 765 | 3300050516 | nmdc:mga0sz30_34397_c1 | nmdc:mga0sz30_34397_c1_427_936 | 169 |
| 766 | 3300053077 | Ga0495601_0018255 | Ga0495601_0018255_11_520 | 169 |
| 767 | 3300053078 | Ga0495612_0123928 | Ga0495612_0123928_486_995 | 169 |
| 768 | 3300053085 | Ga0495619_0048380 | Ga0495619_0048380_1489_1998 | 169 |
| 769 | 3300053088 | Ga0500644_0007132 | Ga0500644_0007132_649_1158 | 169 |
| 770 | 3300053092 | Ga0500583_0049976 | Ga0500583_0049976_732_1244 | 169 |
| 771 | 3300053108 | Ga0500562_020605 | Ga0500562_020605_1160_1669 | 169 |
| 772 | 3300053118 | Ga0500594_0010549 | Ga0500594_0010549_871_1380 | 169 |
| 773 | 3300053136 | Ga0500559_0000166 | Ga0500559_0000166_15727_16236 | 169 |
| 774 | 3300053138 | Ga0500564_057811 | Ga0500564_057811_633_1142 | 169 |
| 775 | 3300053154 | Ga0500619_069489 | Ga0500619_069489_76_585 | 169 |
| 776 | 3300053739 | Ga0500587_002063 | Ga0500587_002063_1123_1632 | 169 |
| 777 | iso_pu_bacteria | 2928084124 | 2928088461 | 169 |
| 778 | iso_pu_bacteria | 2945909444 | 2945909761 | 169 |
| 779 | 3300003187 | JGI25151J46595_10000966 | JGI25151J46595_100009661 | 170 |
| 780 | 3300003781 | Ga0055536_1000980 | Ga0055536_10009801 | 170 |
| 781 | 3300003784 | Ga0055534_1018300 | Ga0055534_10183002 | 170 |
| 782 | 3300003791 | Ga0055530_10011577 | Ga0055530_100115773 | 170 |
| 783 | 3300003794 | Ga0055531_10000809 | Ga0055531_100008092 | 170 |
| 784 | 3300005344 | Ga0070661_100143938 | Ga0070661_1001439382 | 170 |
| 785 | 3300005367 | Ga0070667_101108948 | Ga0070667_1011089481 | 170 |
| 786 | 3300005456 | Ga0070678_100581387 | Ga0070678_1005813871 | 170 |
| 787 | 3300005457 | Ga0070662_100074970 | Ga0070662_1000749702 | 170 |
| 788 | 3300005548 | Ga0070665_100409201 | Ga0070665_1004092011 | 170 |
| 789 | 3300005564 | Ga0070664_100022201 | Ga0070664_1000222017 | 170 |
| 790 | 3300005577 | Ga0068857_100209974 | Ga0068857_1002099742 | 170 |
| 791 | 3300005844 | Ga0068862_100223968 | Ga0068862_1002239682 | 170 |
| 792 | 3300006038 | Ga0075365_10000402 | Ga0075365_100004023 | 170 |
| 793 | 3300006048 | Ga0075363_100006788 | Ga0075363_1000067887 | 170 |
| 794 | 3300006051 | Ga0075364_10006947 | Ga0075364_100069475 | 170 |
| 795 | 3300006058 | Ga0075432_10028523 | Ga0075432_100285233 | 170 |
| 796 | 3300006177 | Ga0075362_10018359 | Ga0075362_100183593 | 170 |
| 797 | 3300006177 | Ga0075362_10075241 | Ga0075362_100752411 | 170 |
| 798 | 3300006178 | Ga0075367_10106928 | Ga0075367_101069282 | 170 |
| 799 | 3300006195 | Ga0075366_10021592 | Ga0075366_100215923 | 170 |
| 800 | 3300006195 | Ga0075366_10038020 | Ga0075366_100380202 | 170 |
| 801 | 3300006195 | Ga0075366_10774203 | Ga0075366_107742031 | 170 |
| 802 | 3300006237 | Ga0097621_100763867 | Ga0097621_1007638672 | 170 |
| 803 | 3300006353 | Ga0075370_10024490 | Ga0075370_100244902 | 170 |
| 804 | 3300006353 | Ga0075370_10053353 | Ga0075370_100533532 | 170 |
| 805 | 3300006353 | Ga0075370_10177611 | Ga0075370_101776112 | 170 |
| 806 | 3300006353 | Ga0075370_10416635 | Ga0075370_104166351 | 170 |
| 807 | 3300006948 | Ga0099826_10065661 | Ga0099826_100656612 | 170 |
| 808 | 3300009093 | Ga0105240_10002416 | Ga0105240_1000241625 | 170 |
| 809 | 3300009148 | Ga0105243_10016045 | Ga0105243_100160457 | 170 |
| 810 | 3300009148 | Ga0105243_10149101 | Ga0105243_101491012 | 170 |
| 811 | 3300009545 | Ga0105237_10001223 | Ga0105237_100012238 | 170 |
| 812 | 3300009551 | Ga0105238_10006384 | Ga0105238_100063847 | 170 |
| 813 | 3300009551 | Ga0105238_10071647 | Ga0105238_100716474 | 170 |
| 814 | 3300010375 | Ga0105239_10002071 | Ga0105239_100020718 | 170 |
| 815 | 3300012498 | Ga0157345_1008467 | Ga0157345_10084672 | 170 |
| 816 | 3300014497 | Ga0182008_10007679 | Ga0182008_100076794 | 170 |
| 817 | 3300015261 | Ga0182006_1003709 | Ga0182006_10037095 | 170 |
| 818 | 3300021361 | Ga0213872_10023309 | Ga0213872_100233092 | 170 |
| 819 | 3300025258 | Ga0209129_1007298 | Ga0209129_10072982 | 170 |
| 820 | 3300025273 | Ga0209673_1001625 | Ga0209673_100162513 | 170 |
| 821 | 3300025291 | Ga0209675_1017081 | Ga0209675_10170812 | 170 |
| 822 | 3300025291 | Ga0209675_1037045 | Ga0209675_10370452 | 170 |
| 823 | 3300025292 | Ga0209676_1000433 | Ga0209676_100043311 | 170 |
| 824 | 3300025294 | Ga0209025_1001614 | Ga0209025_100161425 | 170 |
| 825 | 3300025294 | Ga0209025_1096798 | Ga0209025_10967982 | 170 |
| 826 | 3300025298 | Ga0209050_1000912 | Ga0209050_100091225 | 170 |
| 827 | 3300025298 | Ga0209050_1004084 | Ga0209050_10040842 | 170 |
| 828 | 3300025303 | Ga0209051_1000207 | Ga0209051_100020731 | 170 |
| 829 | 3300025304 | Ga0209257_1000249 | Ga0209257_100024989 | 170 |
| 830 | 3300025728 | Ga0207655_1004770 | Ga0207655_10047708 | 170 |
| 831 | 3300025913 | Ga0207695_10007940 | Ga0207695_1000794013 | 170 |
| 832 | 3300025914 | Ga0207671_10070997 | Ga0207671_100709971 | 170 |
| 833 | 3300025924 | Ga0207694_10024601 | Ga0207694_100246013 | 170 |
| 834 | 3300025924 | Ga0207694_10155247 | Ga0207694_101552472 | 170 |
| 835 | 3300025925 | Ga0207650_10704442 | Ga0207650_107044421 | 170 |
| 836 | 3300025932 | Ga0207690_10147513 | Ga0207690_101475132 | 170 |
| 837 | 3300025934 | Ga0207686_10080424 | Ga0207686_100804243 | 170 |
| 838 | 3300025935 | Ga0207709_10001937 | Ga0207709_1000193713 | 170 |
| 839 | 3300025935 | Ga0207709_10047583 | Ga0207709_100475832 | 170 |
| 840 | 3300025945 | Ga0207679_10013127 | Ga0207679_100131277 | 170 |
| 841 | 3300026116 | Ga0207674_10144755 | Ga0207674_101447552 | 170 |
| 842 | 3300026116 | Ga0207674_10352299 | Ga0207674_103522991 | 170 |
| 843 | 3300027666 | Ga0209282_1105991 | Ga0209282_11059912 | 170 |
| 844 | 3300028379 | Ga0268266_10244025 | Ga0268266_102440252 | 170 |
| 845 | 3300028379 | Ga0268266_10368331 | Ga0268266_103683312 | 170 |
| 846 | 3300028380 | Ga0268265_10093044 | Ga0268265_100930442 | 170 |
| 847 | 3300028794 | Ga0307515_10000419 | Ga0307515_10000419100 | 170 |
| 848 | 3300028794 | Ga0307515_10000425 | Ga0307515_1000042590 | 170 |
| 849 | 3300028794 | Ga0307515_10000672 | Ga0307515_100006729 | 170 |
| 850 | 3300028794 | Ga0307515_10050319 | Ga0307515_100503196 | 170 |
| 851 | 3300030522 | Ga0307512_10285754 | Ga0307512_102857542 | 170 |
| 852 | 3300031456 | Ga0307513_10077369 | Ga0307513_100773693 | 170 |
| 853 | 3300031456 | Ga0307513_10203853 | Ga0307513_102038532 | 170 |
| 854 | 3300031548 | Ga0307408_100564043 | Ga0307408_1005640432 | 170 |
| 855 | 3300031649 | Ga0307514_10001174 | Ga0307514_1000117419 | 170 |
| 856 | 3300031731 | Ga0307405_10164268 | Ga0307405_101642682 | 170 |
| 857 | 3300031901 | Ga0307406_10442887 | Ga0307406_104428872 | 170 |
| 858 | 3300031911 | Ga0307412_10034281 | Ga0307412_100342811 | 170 |
| 859 | 3300031911 | Ga0307412_10714539 | Ga0307412_107145391 | 170 |
| 860 | 3300031911 | Ga0307412_11382326 | Ga0307412_113823261 | 170 |
| 861 | 3300032005 | Ga0307411_10057995 | Ga0307411_100579952 | 170 |
| 862 | 3300039447 | Ga0436361_0221167 | Ga0436361_0221167_369_881 | 170 |
| 863 | 3300039447 | Ga0436361_0644663 | Ga0436361_0644663_738_1250 | 170 |
| 864 | 3300041404 | Ga0439436_0000134 | Ga0439436_0000134_15773_16285 | 170 |
| 865 | 3300041404 | Ga0439436_0000962 | Ga0439436_0000962_4844_5356 | 170 |
| 866 | 3300041405 | Ga0439438_125193 | Ga0439438_125193_61_573 | 170 |
| 867 | 3300041406 | Ga0439439_0004760 | Ga0439439_0004760_2079_2591 | 170 |
| 868 | 3300041406 | Ga0439439_0038287 | Ga0439439_0038287_527_1039 | 170 |
| 869 | 3300041410 | Ga0439461_0004034 | Ga0439461_0004034_1824_2336 | 170 |
| 870 | 3300041410 | Ga0439461_0024933 | Ga0439461_0024933_583_1095 | 170 |
| 871 | 3300041411 | Ga0439466_0006068 | Ga0439466_0006068_2192_2704 | 170 |
| 872 | 3300041413 | Ga0439465_0000339 | Ga0439465_0000339_4149_4661 | 170 |
| 873 | 3300041997 | Ga0439431_0009901 | Ga0439431_0009901_754_1266 | 170 |
| 874 | 3300041999 | Ga0439433_0000087 | Ga0439433_0000087_11970_12482 | 170 |
| 875 | 3300042002 | Ga0439442_001006 | Ga0439442_001006_2886_3398 | 170 |
| 876 | 3300042004 | Ga0439445_0009738 | Ga0439445_0009738_1411_1923 | 170 |
| 877 | 3300042004 | Ga0439445_0018295 | Ga0439445_0018295_929_1441 | 170 |
| 878 | 3300042006 | Ga0439432_000527 | Ga0439432_000527_13_525 | 170 |
| 879 | 3300042006 | Ga0439432_036027 | Ga0439432_036027_743_1255 | 170 |
| 880 | 3300042007 | Ga0439449_0000385 | Ga0439449_0000385_10013_10525 | 170 |
| 881 | 3300042007 | Ga0439449_0004263 | Ga0439449_0004263_2380_2892 | 170 |
| 882 | 3300042007 | Ga0439449_0011605 | Ga0439449_0011605_2329_2841 | 170 |
| 883 | 3300042010 | Ga0439452_002869 | Ga0439452_002869_5045_5557 | 170 |
| 884 | 3300042014 | Ga0439457_021681 | Ga0439457_021681_588_1100 | 170 |
| 885 | 3300042015 | Ga0439462_0001243 | Ga0439462_0001243_4766_5278 | 170 |
| 886 | 3300042015 | Ga0439462_0005291 | Ga0439462_0005291_465_977 | 170 |
| 887 | 3300042115 | Ga0450911_000225 | Ga0450911_000225_18018_18530 | 170 |
| 888 | 3300042125 | Ga0450923_002780 | Ga0450923_002780_797_1309 | 170 |
| 889 | 3300042131 | Ga0450894_015107 | Ga0450894_015107_329_841 | 170 |
| 890 | 3300042134 | Ga0450898_025829 | Ga0450898_025829_308_820 | 170 |
| 891 | 3300042142 | Ga0450905_009627 | Ga0450905_009627_210_722 | 170 |
| 892 | 3300042156 | Ga0439446_0035330 | Ga0439446_0035330_467_979 | 170 |
| 893 | 3300042435 | Ga0439434_0003391 | Ga0439434_0003391_1106_1618 | 170 |
| 894 | 3300042435 | Ga0439434_0116530 | Ga0439434_0116530_342_854 | 170 |
| 895 | 3300044901 | Ga0466960_0143879 | Ga0466960_0143879_22_534 | 170 |
| 896 | 3300046660 | Ga0495625_0000708 | Ga0495625_0000708_17596_18108 | 170 |
| 897 | 3300046664 | Ga0495659_0048214 | Ga0495659_0048214_869_1381 | 170 |
| 898 | 3300048905 | Ga0496102_0125873 | Ga0496102_0125873_1032_1544 | 170 |
| 899 | 3300048917 | Ga0496114_0485770 | Ga0496114_0485770_347_859 | 170 |
| 900 | 3300048919 | Ga0496116_0057954 | Ga0496116_0057954_896_1408 | 170 |
| 901 | 3300048919 | Ga0496116_0089477 | Ga0496116_0089477_779_1291 | 170 |
| 902 | 3300048920 | Ga0496117_0016300 | Ga0496117_0016300_3019_3531 | 170 |
| 903 | 3300048920 | Ga0496117_0076287 | Ga0496117_0076287_773_1285 | 170 |
| 904 | 3300048921 | Ga0496118_0027766 | Ga0496118_0027766_442_954 | 170 |
| 905 | 3300048924 | Ga0496121_0453743 | Ga0496121_0453743_35_547 | 170 |
| 906 | 3300048926 | Ga0496123_0103082 | Ga0496123_0103082_97_609 | 170 |
| 907 | 3300050489 | nmdc:mga03683_12530_c1 | nmdc:mga03683_12530_c1_2528_3040 | 170 |
| 908 | 3300050490 | nmdc:mga03n38_19665_c1 | nmdc:mga03n38_19665_c1_1311_1823 | 170 |
| 909 | 3300050490 | nmdc:mga03n38_62210_c1 | nmdc:mga03n38_62210_c1_454_966 | 170 |
| 910 | 3300050491 | nmdc:mga00v17_2771_c1 | nmdc:mga00v17_2771_c1_6192_6704 | 170 |
| 911 | 3300050492 | nmdc:mga0yw44_5627_c1 | nmdc:mga0yw44_5627_c1_3635_4147 | 170 |
| 912 | 3300050493 | nmdc:mga0k408_33051_c1 | nmdc:mga0k408_33051_c1_830_1342 | 170 |
| 913 | 3300050493 | nmdc:mga0k408_33984_c1 | nmdc:mga0k408_33984_c1_1541_2053 | 170 |
| 914 | 3300050493 | nmdc:mga0k408_60655_c1 | nmdc:mga0k408_60655_c1_77_589 | 170 |
| 915 | 3300050496 | nmdc:mga07m45_2026_c2 | nmdc:mga07m45_2026_c2_1494_2006 | 170 |
| 916 | 3300050516 | nmdc:mga0sz30_110451_c1 | nmdc:mga0sz30_110451_c1_671_1183 | 170 |
| 917 | 3300053108 | Ga0500562_004272 | Ga0500562_004272_784_1392 | 170 |
| 918 | 3300053121 | Ga0500607_012041 | Ga0500607_012041_1892_2404 | 170 |
| 919 | 3300053125 | Ga0500618_027711 | Ga0500618_027711_585_1124 | 170 |
| 920 | 3300053142 | Ga0500577_0079072 | Ga0500577_0079072_193_705 | 170 |
| 921 | 3300053145 | Ga0500586_016719 | Ga0500586_016719_391_903 | 170 |
| 922 | 3300053729 | Ga0500625_029427 | Ga0500625_029427_591_1103 | 170 |
| 923 | iso_pu_bacteria | 2818991446 | 2819601682 | 170 |
| 924 | iso_pu_bacteria | 2831265667 | 2831272118 | 170 |
| 925 | iso_pu_bacteria | 2838054893 | 2838059281 | 170 |
| 926 | iso_pu_bacteria | 2885198086 | 2885202982 | 170 |
| 927 | iso_pu_bacteria | 2885211737 | 2885216621 | 170 |
| 928 | iso_pu_bacteria | 2899924645 | 2899930749 | 170 |
| 929 | iso_pu_bacteria | 2928037797 | 2928040930 | 170 |
| 930 | iso_pu_bacteria | 2928044640 | 2928047772 | 170 |
| 931 | iso_pu_bacteria | 2928051484 | 2928055663 | 170 |
| 932 | iso_pu_bacteria | 2928064002 | 2928069761 | 170 |
| 933 | 3300002987 | JGI25159J45721_1008171 | JGI25159J45721_10081713 | 171 |
| 934 | 3300003784 | Ga0055534_1006770 | Ga0055534_10067703 | 171 |
| 935 | 3300025273 | Ga0209673_1051779 | Ga0209673_10517791 | 171 |
| 936 | 3300025284 | Ga0209130_1010030 | Ga0209130_10100303 | 171 |
| 937 | 3300025291 | Ga0209675_1001575 | Ga0209675_10015759 | 171 |
| 938 | 3300025292 | Ga0209676_1000937 | Ga0209676_100093722 | 171 |
| 939 | 3300025294 | Ga0209025_1079347 | Ga0209025_10793472 | 171 |
| 940 | 3300025303 | Ga0209051_1026224 | Ga0209051_10262242 | 171 |
| 941 | 3300025304 | Ga0209257_1019883 | Ga0209257_10198833 | 171 |
| 942 | 3300026121 | Ga0207683_10624846 | Ga0207683_106248462 | 171 |
| 943 | 3300028794 | Ga0307515_10083885 | Ga0307515_100838853 | 171 |
| 944 | 3300031456 | Ga0307513_10323141 | Ga0307513_103231412 | 171 |
| 945 | 3300035089 | Ga0373944_0115874 | Ga0373944_0115874_298_813 | 171 |
| 946 | 3300037068 | Ga0373925_0193640 | Ga0373925_0193640_90_605 | 171 |
| 947 | 3300041407 | Ga0439447_031631 | Ga0439447_031631_670_1188 | 171 |
| 948 | 3300046690 | Ga0495624_0073836 | Ga0495624_0073836_919_1434 | 171 |
| 949 | 3300047321 | Ga0495676_0061675 | Ga0495676_0061675_1580_2095 | 171 |
| 950 | 3300047673 | Ga0495593_0017494 | Ga0495593_0017494_161_676 | 171 |
| 951 | 3300048929 | Ga0496126_0639021 | Ga0496126_0639021_49_564 | 171 |
| 952 | 3300049460 | Ga0495682_0271472 | Ga0495682_0271472_48_566 | 171 |
| 953 | 3300003187 | JGI25151J46595_10049812 | JGI25151J46595_100498121 | 172 |
| 954 | 3300005367 | Ga0070667_100001639 | Ga0070667_10000163912 | 172 |
| 955 | 3300005466 | Ga0070685_10681485 | Ga0070685_106814852 | 172 |
| 956 | 3300005468 | Ga0070707_100010736 | Ga0070707_10001073610 | 172 |
| 957 | 3300005471 | Ga0070698_100833995 | Ga0070698_1008339952 | 172 |
| 958 | 3300005843 | Ga0068860_101064532 | Ga0068860_1010645321 | 172 |
| 959 | 3300006237 | Ga0097621_100186892 | Ga0097621_1001868922 | 172 |
| 960 | 3300006358 | Ga0068871_100066423 | Ga0068871_1000664233 | 172 |
| 961 | 3300013306 | Ga0163162_10084244 | Ga0163162_100842443 | 172 |
| 962 | 3300025245 | Ga0207425_1044847 | Ga0207425_10448471 | 172 |
| 963 | 3300025294 | Ga0209025_1000324 | Ga0209025_100032426 | 172 |
| 964 | 3300025922 | Ga0207646_10101910 | Ga0207646_101019103 | 172 |
| 965 | 3300025927 | Ga0207687_10071514 | Ga0207687_100715143 | 172 |
| 966 | 3300025986 | Ga0207658_10035740 | Ga0207658_100357403 | 172 |
| 967 | 3300028381 | Ga0268264_10377324 | Ga0268264_103773242 | 172 |
| 968 | 3300030522 | Ga0307512_10063478 | Ga0307512_100634782 | 172 |
| 969 | 3300031456 | Ga0307513_10008367 | Ga0307513_1000836710 | 172 |
| 970 | 3300031507 | Ga0307509_10003708 | Ga0307509_1000370823 | 172 |
| 971 | 3300031507 | Ga0307509_10004745 | Ga0307509_100047452 | 172 |
| 972 | 3300031507 | Ga0307509_10332143 | Ga0307509_103321432 | 172 |
| 973 | 3300031616 | Ga0307508_10016618 | Ga0307508_100166183 | 172 |
| 974 | 3300031616 | Ga0307508_10072891 | Ga0307508_100728912 | 172 |
| 975 | 3300033180 | Ga0307510_10022805 | Ga0307510_100228052 | 172 |
| 976 | 3300033180 | Ga0307510_10276625 | Ga0307510_102766252 | 172 |
| 977 | 3300046692 | Ga0495671_0135871 | Ga0495671_0135871_402_923 | 172 |
| 978 | 3300047472 | Ga0495686_0001736 | Ga0495686_0001736_5361_5879 | 172 |
| 979 | 3300053093 | Ga0500651_0135524 | Ga0500651_0135524_640_1161 | 172 |
| 980 | iso_pu_bacteria | 2599185214 | 2599626406 | 172 |
| 981 | iso_pu_bacteria | 2599185226 | 2599676270 | 172 |
| 982 | iso_pu_bacteria | 2599185227 | 2599682108 | 172 |
| 983 | iso_pu_bacteria | 2599185229 | 2599695758 | 172 |
| 984 | iso_pu_bacteria | 2738541307 | 2738880738 | 172 |
| 985 | iso_pu_bacteria | 2928070936 | 2928075381 | 172 |
| 986 | 3300005336 | Ga0070680_100051495 | Ga0070680_1000514953 | 173 |
| 987 | 3300005341 | Ga0070691_10218433 | Ga0070691_102184332 | 173 |
| 988 | 3300005341 | Ga0070691_10281495 | Ga0070691_102814951 | 173 |
| 989 | 3300005438 | Ga0070701_10067484 | Ga0070701_100674842 | 173 |
| 990 | 3300005441 | Ga0070700_101235732 | Ga0070700_1012357321 | 173 |
| 991 | 3300005457 | Ga0070662_100009196 | Ga0070662_1000091968 | 173 |
| 992 | 3300005459 | Ga0068867_100142501 | Ga0068867_1001425012 | 173 |
| 993 | 3300005471 | Ga0070698_100423339 | Ga0070698_1004233391 | 173 |
| 994 | 3300005548 | Ga0070665_100446518 | Ga0070665_1004465182 | 173 |
| 995 | 3300005563 | Ga0068855_100242436 | Ga0068855_1002424362 | 173 |
| 996 | 3300005577 | Ga0068857_100069621 | Ga0068857_1000696213 | 173 |
| 997 | 3300005578 | Ga0068854_100039212 | Ga0068854_1000392123 | 173 |
| 998 | 3300005578 | Ga0068854_100169572 | Ga0068854_1001695722 | 173 |
| 999 | 3300005616 | Ga0068852_100291220 | Ga0068852_1002912202 | 173 |
| 1000 | 3300005616 | Ga0068852_100516312 | Ga0068852_1005163122 | 173 |
| 1001 | 3300005617 | Ga0068859_100154256 | Ga0068859_1001542562 | 173 |
| 1002 | 3300005844 | Ga0068862_100071248 | Ga0068862_1000712482 | 173 |
| 1003 | 3300006042 | Ga0075368_10072401 | Ga0075368_100724012 | 173 |
| 1004 | 3300006177 | Ga0075362_10079367 | Ga0075362_100793672 | 173 |
| 1005 | 3300006177 | Ga0075362_10123620 | Ga0075362_101236202 | 173 |
| 1006 | 3300006178 | Ga0075367_10052723 | Ga0075367_100527232 | 173 |
| 1007 | 3300006178 | Ga0075367_10355351 | Ga0075367_103553511 | 173 |
| 1008 | 3300006186 | Ga0075369_10162193 | Ga0075369_101621932 | 173 |
| 1009 | 3300006195 | Ga0075366_10018726 | Ga0075366_100187262 | 173 |
| 1010 | 3300006195 | Ga0075366_10053152 | Ga0075366_100531522 | 173 |
| 1011 | 3300006195 | Ga0075366_10073073 | Ga0075366_100730732 | 173 |
| 1012 | 3300006353 | Ga0075370_10023306 | Ga0075370_100233062 | 173 |
| 1013 | 3300006353 | Ga0075370_10031608 | Ga0075370_100316082 | 173 |
| 1014 | 3300006353 | Ga0075370_10070417 | Ga0075370_100704172 | 173 |
| 1015 | 3300006353 | Ga0075370_10361938 | Ga0075370_103619381 | 173 |
| 1016 | 3300006844 | Ga0075428_100002991 | Ga0075428_1000029914 | 173 |
| 1017 | 3300006844 | Ga0075428_100600102 | Ga0075428_1006001021 | 173 |
| 1018 | 3300006846 | Ga0075430_100053854 | Ga0075430_1000538543 | 173 |
| 1019 | 3300006852 | Ga0075433_10174388 | Ga0075433_101743882 | 173 |
| 1020 | 3300006880 | Ga0075429_100022565 | Ga0075429_1000225654 | 173 |
| 1021 | 3300006881 | Ga0068865_100199681 | Ga0068865_1001996812 | 173 |
| 1022 | 3300006931 | Ga0097620_100154273 | Ga0097620_1001542732 | 173 |
| 1023 | 3300009036 | Ga0105244_10140250 | Ga0105244_101402502 | 173 |
| 1024 | 3300009093 | Ga0105240_10173426 | Ga0105240_101734262 | 173 |
| 1025 | 3300009094 | Ga0111539_10007916 | Ga0111539_100079168 | 173 |
| 1026 | 3300009094 | Ga0111539_10012627 | Ga0111539_100126274 | 173 |
| 1027 | 3300009148 | Ga0105243_10035573 | Ga0105243_100355734 | 173 |
| 1028 | 3300009545 | Ga0105237_10010476 | Ga0105237_100104764 | 173 |
| 1029 | 3300009545 | Ga0105237_10102414 | Ga0105237_101024143 | 173 |
| 1030 | 3300009551 | Ga0105238_10122079 | Ga0105238_101220793 | 173 |
| 1031 | 3300010375 | Ga0105239_10031117 | Ga0105239_100311178 | 173 |
| 1032 | 3300011119 | Ga0105246_10286655 | Ga0105246_102866552 | 173 |
| 1033 | 3300012490 | Ga0157322_1011987 | Ga0157322_10119871 | 173 |
| 1034 | 3300013104 | Ga0157370_10003332 | Ga0157370_1000333218 | 173 |
| 1035 | 3300013105 | Ga0157369_10054666 | Ga0157369_100546663 | 173 |
| 1036 | 3300013297 | Ga0157378_10629129 | Ga0157378_106291292 | 173 |
| 1037 | 3300014326 | Ga0157380_10012837 | Ga0157380_100128373 | 173 |
| 1038 | 3300014326 | Ga0157380_10124752 | Ga0157380_101247522 | 173 |
| 1039 | 3300015265 | Ga0182005_1059851 | Ga0182005_10598511 | 173 |
| 1040 | 3300017792 | Ga0163161_10127999 | Ga0163161_101279992 | 173 |
| 1041 | 3300025910 | Ga0207684_10007194 | Ga0207684_100071944 | 173 |
| 1042 | 3300025913 | Ga0207695_10138130 | Ga0207695_101381301 | 173 |
| 1043 | 3300025913 | Ga0207695_10376627 | Ga0207695_103766272 | 173 |
| 1044 | 3300025914 | Ga0207671_10056053 | Ga0207671_100560532 | 173 |
| 1045 | 3300025917 | Ga0207660_10068643 | Ga0207660_100686432 | 173 |
| 1046 | 3300025931 | Ga0207644_10020786 | Ga0207644_100207862 | 173 |
| 1047 | 3300025933 | Ga0207706_10017696 | Ga0207706_100176962 | 173 |
| 1048 | 3300025935 | Ga0207709_10587663 | Ga0207709_105876631 | 173 |
| 1049 | 3300025938 | Ga0207704_10225534 | Ga0207704_102255342 | 173 |
| 1050 | 3300025949 | Ga0207667_10539441 | Ga0207667_105394412 | 173 |
| 1051 | 3300025981 | Ga0207640_10057156 | Ga0207640_100571563 | 173 |
| 1052 | 3300026067 | Ga0207678_10083066 | Ga0207678_100830661 | 173 |
| 1053 | 3300026089 | Ga0207648_10179559 | Ga0207648_101795592 | 173 |
| 1054 | 3300026116 | Ga0207674_10048359 | Ga0207674_100483592 | 173 |
| 1055 | 3300026118 | Ga0207675_100866912 | Ga0207675_1008669122 | 173 |
| 1056 | 3300026142 | Ga0207698_10100486 | Ga0207698_101004862 | 173 |
| 1057 | 3300026142 | Ga0207698_10255540 | Ga0207698_102555402 | 173 |
| 1058 | 3300027866 | Ga0209813_10122536 | Ga0209813_101225361 | 173 |
| 1059 | 3300027907 | Ga0207428_10041116 | Ga0207428_100411162 | 173 |
| 1060 | 3300028786 | Ga0307517_10413969 | Ga0307517_104139691 | 173 |
| 1061 | 3300028794 | Ga0307515_10470527 | Ga0307515_104705272 | 173 |
| 1062 | 3300030522 | Ga0307512_10124236 | Ga0307512_101242362 | 173 |
| 1063 | 3300031456 | Ga0307513_10090348 | Ga0307513_100903483 | 173 |
| 1064 | 3300031456 | Ga0307513_10550424 | Ga0307513_105504241 | 173 |
| 1065 | 3300031730 | Ga0307516_10099481 | Ga0307516_100994812 | 173 |
| 1066 | 3300031730 | Ga0307516_10344365 | Ga0307516_103443652 | 173 |
| 1067 | 3300031824 | Ga0307413_10201349 | Ga0307413_102013492 | 173 |
| 1068 | 3300031911 | Ga0307412_10431217 | Ga0307412_104312172 | 173 |
| 1069 | 3300032002 | Ga0307416_100033297 | Ga0307416_1000332973 | 173 |
| 1070 | 3300032002 | Ga0307416_101019003 | Ga0307416_1010190031 | 173 |
| 1071 | 3300033180 | Ga0307510_10173630 | Ga0307510_101736302 | 173 |
| 1072 | 3300042531 | Ga0450918_040166 | Ga0450918_040166_59_583 | 173 |
| 1073 | 3300046460 | Ga0495638_0022034 | Ga0495638_0022034_2673_3194 | 173 |
| 1074 | 3300046471 | Ga0495650_0008406 | Ga0495650_0008406_1107_1628 | 173 |
| 1075 | 3300046474 | Ga0495605_0039596 | Ga0495605_0039596_1746_2267 | 173 |
| 1076 | 3300046506 | Ga0495583_0168690 | Ga0495583_0168690_53_574 | 173 |
| 1077 | 3300046507 | Ga0495606_0002420 | Ga0495606_0002420_14443_14964 | 173 |
| 1078 | 3300046512 | Ga0495610_0089206 | Ga0495610_0089206_624_1145 | 173 |
| 1079 | 3300046512 | Ga0495610_0298873 | Ga0495610_0298873_54_575 | 173 |
| 1080 | 3300046513 | Ga0495616_0000933 | Ga0495616_0000933_14300_14821 | 173 |
| 1081 | 3300046515 | Ga0495620_0010656 | Ga0495620_0010656_1416_1937 | 173 |
| 1082 | 3300046518 | Ga0495631_0000176 | Ga0495631_0000176_27663_28184 | 173 |
| 1083 | 3300046519 | Ga0495632_0023431 | Ga0495632_0023431_709_1230 | 173 |
| 1084 | 3300046520 | Ga0495637_0003577 | Ga0495637_0003577_6612_7133 | 173 |
| 1085 | 3300046520 | Ga0495637_0026699 | Ga0495637_0026699_1194_1715 | 173 |
| 1086 | 3300046524 | Ga0495648_0139802 | Ga0495648_0139802_320_841 | 173 |
| 1087 | 3300046525 | Ga0495663_0065291 | Ga0495663_0065291_317_838 | 173 |
| 1088 | 3300046528 | Ga0495642_0359572 | Ga0495642_0359572_84_605 | 173 |
| 1089 | 3300046530 | Ga0495654_0003294 | Ga0495654_0003294_2302_2823 | 173 |
| 1090 | 3300046530 | Ga0495654_0211074 | Ga0495654_0211074_260_781 | 173 |
| 1091 | 3300046557 | Ga0495622_0017968 | Ga0495622_0017968_2536_3057 | 173 |
| 1092 | 3300046616 | Ga0495668_0009680 | Ga0495668_0009680_4662_5183 | 173 |
| 1093 | 3300046660 | Ga0495625_0019215 | Ga0495625_0019215_3462_3983 | 173 |
| 1094 | 3300046660 | Ga0495625_0020257 | Ga0495625_0020257_3030_3551 | 173 |
| 1095 | 3300046660 | Ga0495625_0056406 | Ga0495625_0056406_1441_1962 | 173 |
| 1096 | 3300046665 | Ga0495661_0261924 | Ga0495661_0261924_224_745 | 173 |
| 1097 | 3300046674 | Ga0495588_0368698 | Ga0495588_0368698_168_689 | 173 |
| 1098 | 3300046683 | Ga0495658_0081857 | Ga0495658_0081857_106_627 | 173 |
| 1099 | 3300046690 | Ga0495624_0084705 | Ga0495624_0084705_486_1007 | 173 |
| 1100 | 3300046691 | Ga0495670_0401552 | Ga0495670_0401552_90_611 | 173 |
| 1101 | 3300046692 | Ga0495671_0001321 | Ga0495671_0001321_15674_16195 | 173 |
| 1102 | 3300046694 | Ga0495649_0001209 | Ga0495649_0001209_13059_13580 | 173 |
| 1103 | 3300046794 | Ga0495589_0020773 | Ga0495589_0020773_2551_3072 | 173 |
| 1104 | 3300046809 | Ga0495600_0425893 | Ga0495600_0425893_24_545 | 173 |
| 1105 | 3300046810 | Ga0495660_0004413 | Ga0495660_0004413_7213_7734 | 173 |
| 1106 | 3300047321 | Ga0495676_0236496 | Ga0495676_0236496_115_636 | 173 |
| 1107 | 3300047323 | Ga0495683_0181697 | Ga0495683_0181697_39_560 | 173 |
| 1108 | 3300047443 | Ga0495687_012212 | Ga0495687_012212_1689_2210 | 173 |
| 1109 | 3300047673 | Ga0495593_0090851 | Ga0495593_0090851_834_1355 | 173 |
| 1110 | 3300048089 | Ga0495614_0081431 | Ga0495614_0081431_86_607 | 173 |
| 1111 | 3300048091 | Ga0495626_0022010 | Ga0495626_0022010_1640_2161 | 173 |
| 1112 | 3300048909 | Ga0496106_0894476 | Ga0496106_0894476_55_576 | 173 |
| 1113 | 3300048924 | Ga0496121_0199642 | Ga0496121_0199642_557_1078 | 173 |
| 1114 | 3300048926 | Ga0496123_0127159 | Ga0496123_0127159_157_678 | 173 |
| 1115 | 3300048927 | Ga0496124_0300654 | Ga0496124_0300654_463_984 | 173 |
| 1116 | 3300048929 | Ga0496126_0081296 | Ga0496126_0081296_1558_2079 | 173 |
| 1117 | 3300049460 | Ga0495682_0109679 | Ga0495682_0109679_24_545 | 173 |
| 1118 | 3300049569 | Ga0501032_0110228 | Ga0501032_0110228_427_966 | 173 |
| 1119 | 3300049577 | Ga0501041_0406562 | Ga0501041_0406562_69_593 | 173 |
| 1120 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_94611_95150 | 173 |
| 1121 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_196686_197225 | 173 |
| 1122 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_196366_196905 | 173 |
| 1123 | 3300049582 | Ga0501048_0000926 | Ga0501048_0000926_3821_4360 | 173 |
| 1124 | 3300049582 | Ga0501048_0791366 | Ga0501048_0791366_67_591 | 173 |
| 1125 | 3300049587 | Ga0501071_0041686 | Ga0501071_0041686_534_1058 | 173 |
| 1126 | 3300049587 | Ga0501071_0114982 | Ga0501071_0114982_1171_1695 | 173 |
| 1127 | 3300049743 | Ga0501081_0455501 | Ga0501081_0455501_79_603 | 173 |
| 1128 | 3300049824 | Ga0501045_0002191 | Ga0501045_0002191_11463_12002 | 173 |
| 1129 | 3300049824 | Ga0501045_0704258 | Ga0501045_0704258_105_629 | 173 |
| 1130 | 3300050489 | nmdc:mga03683_37272_c1 | nmdc:mga03683_37272_c1_1173_1778 | 173 |
| 1131 | 3300050491 | nmdc:mga00v17_152623_c1 | nmdc:mga00v17_152623_c1_834_1439 | 173 |
| 1132 | 3300050491 | nmdc:mga00v17_344318_c1 | nmdc:mga00v17_344318_c1_354_875 | 173 |
| 1133 | 3300050492 | nmdc:mga0yw44_119897_c1 | nmdc:mga0yw44_119897_c1_916_1437 | 173 |
| 1134 | 3300050493 | nmdc:mga0k408_19767_c1 | nmdc:mga0k408_19767_c1_104_625 | 173 |
| 1135 | 3300050493 | nmdc:mga0k408_31050_c1 | nmdc:mga0k408_31050_c1_1929_2534 | 173 |
| 1136 | 3300050493 | nmdc:mga0k408_33349_c1 | nmdc:mga0k408_33349_c1_568_1089 | 173 |
| 1137 | 3300050493 | nmdc:mga0k408_44858_c1 | nmdc:mga0k408_44858_c1_188_709 | 173 |
| 1138 | 3300050493 | nmdc:mga0k408_55074_c1 | nmdc:mga0k408_55074_c1_1747_2271 | 173 |
| 1139 | 3300050493 | nmdc:mga0k408_80835_c1 | nmdc:mga0k408_80835_c1_340_861 | 173 |
| 1140 | 3300050495 | nmdc:mga04h51_150436_c1 | nmdc:mga04h51_150436_c1_141_662 | 173 |
| 1141 | 3300050496 | nmdc:mga07m45_103848_c1 | nmdc:mga07m45_103848_c1_781_1305 | 173 |
| 1142 | 3300050496 | nmdc:mga07m45_1144_c1 | nmdc:mga07m45_1144_c1_438_959 | 173 |
| 1143 | 3300050496 | nmdc:mga07m45_245524_c1 | nmdc:mga07m45_245524_c1_273_803 | 173 |
| 1144 | 3300050496 | nmdc:mga07m45_2594_c1 | nmdc:mga07m45_2594_c1_2696_3217 | 173 |
| 1145 | 3300050496 | nmdc:mga07m45_83596_c1 | nmdc:mga07m45_83596_c1_573_1094 | 173 |
| 1146 | 3300050509 | nmdc:mga0qj67_520062_c1 | nmdc:mga0qj67_520062_c1_137_661 | 173 |
| 1147 | 3300050511 | nmdc:mga08y16_62434_c1 | nmdc:mga08y16_62434_c1_3329_3853 | 173 |
| 1148 | 3300050511 | nmdc:mga08y16_755306_c1 | nmdc:mga08y16_755306_c1_176_700 | 173 |
| 1149 | 3300050515 | nmdc:mga0a205_191393_c1 | nmdc:mga0a205_191393_c1_311_835 | 173 |
| 1150 | 3300050516 | nmdc:mga0sz30_230223_c1 | nmdc:mga0sz30_230223_c1_102_623 | 173 |
| 1151 | 3300053079 | Ga0500610_0003534 | Ga0500610_0003534_1595_2116 | 173 |
| 1152 | 3300053079 | Ga0500610_0032538 | Ga0500610_0032538_1064_1585 | 173 |
| 1153 | 3300053087 | Ga0500643_008391 | Ga0500643_008391_2770_3291 | 173 |
| 1154 | 3300053093 | Ga0500651_0000289 | Ga0500651_0000289_27589_28110 | 173 |
| 1155 | 3300053094 | Ga0500566_0078985 | Ga0500566_0078985_794_1315 | 173 |
| 1156 | 3300053110 | Ga0500571_000089 | Ga0500571_000089_1076_1597 | 173 |
| 1157 | 3300053111 | Ga0500572_076012 | Ga0500572_076012_195_716 | 173 |
| 1158 | 3300053116 | Ga0500592_004261 | Ga0500592_004261_102_623 | 173 |
| 1159 | 3300053121 | Ga0500607_000942 | Ga0500607_000942_26263_26784 | 173 |
| 1160 | 3300053122 | Ga0500608_011017 | Ga0500608_011017_1577_2098 | 173 |
| 1161 | 3300053122 | Ga0500608_075230 | Ga0500608_075230_387_908 | 173 |
| 1162 | 3300053125 | Ga0500618_027127 | Ga0500618_027127_827_1348 | 173 |
| 1163 | 3300053129 | Ga0500628_060006 | Ga0500628_060006_86_607 | 173 |
| 1164 | 3300053134 | Ga0500658_0000137 | Ga0500658_0000137_11871_12392 | 173 |
| 1165 | 3300053134 | Ga0500658_0000140 | Ga0500658_0000140_21161_21682 | 173 |
| 1166 | 3300053134 | Ga0500658_0015270 | Ga0500658_0015270_1640_2161 | 173 |
| 1167 | 3300053138 | Ga0500564_066507 | Ga0500564_066507_747_1268 | 173 |
| 1168 | 3300053139 | Ga0500568_0000735 | Ga0500568_0000735_5591_6112 | 173 |
| 1169 | 3300053139 | Ga0500568_0025308 | Ga0500568_0025308_1518_2039 | 173 |
| 1170 | 3300053141 | Ga0500574_019578 | Ga0500574_019578_474_995 | 173 |
| 1171 | 3300053147 | Ga0500589_010275 | Ga0500589_010275_951_1472 | 173 |
| 1172 | 3300053153 | Ga0500616_0079167 | Ga0500616_0079167_23_544 | 173 |
| 1173 | 3300053158 | Ga0500627_0043809 | Ga0500627_0043809_570_1091 | 173 |
| 1174 | 3300053161 | Ga0500634_0011590 | Ga0500634_0011590_804_1325 | 173 |
| 1175 | 3300053161 | Ga0500634_0018046 | Ga0500634_0018046_2212_2733 | 173 |
| 1176 | 3300053162 | Ga0500638_046305 | Ga0500638_046305_895_1416 | 173 |
| 1177 | 3300053177 | Ga0500636_0044573 | Ga0500636_0044573_1109_1630 | 173 |
| 1178 | 3300054114 | Ga0501084_0280439 | Ga0501084_0280439_13_537 | 173 |
| 1179 | 3300061734 | Ga0530510_0390804 | Ga0530510_0390804_114_638 | 173 |
| 1180 | 3300001979 | JGI24740J21852_10010212 | JGI24740J21852_100102123 | 174 |
| 1181 | 3300002773 | JGI25152J39213_1014372 | JGI25152J39213_10143721 | 174 |
| 1182 | 3300002774 | JGI25150J39212_1000692 | JGI25150J39212_10006922 | 174 |
| 1183 | 3300002987 | JGI25159J45721_1024032 | JGI25159J45721_10240321 | 174 |
| 1184 | 3300002987 | JGI25159J45721_1034896 | JGI25159J45721_10348961 | 174 |
| 1185 | 3300003187 | JGI25151J46595_10032862 | JGI25151J46595_100328621 | 174 |
| 1186 | 3300003187 | JGI25151J46595_10033648 | JGI25151J46595_100336482 | 174 |
| 1187 | 3300003215 | JGI25153J46596_10015324 | JGI25153J46596_100153243 | 174 |
| 1188 | 3300003215 | JGI25153J46596_10038516 | JGI25153J46596_100385162 | 174 |
| 1189 | 3300003320 | rootH2_10009454 | rootH2_100094542 | 174 |
| 1190 | 3300003354 | JGI25160J50197_1051024 | JGI25160J50197_10510241 | 174 |
| 1191 | 3300003354 | JGI25160J50197_1058914 | JGI25160J50197_10589141 | 174 |
| 1192 | 3300003374 | JGI25161J50226_1006587 | JGI25161J50226_10065871 | 174 |
| 1193 | 3300003374 | JGI25161J50226_1019299 | JGI25161J50226_10192991 | 174 |
| 1194 | 3300003758 | Ga0055532_1015032 | Ga0055532_10150321 | 174 |
| 1195 | 3300003760 | Ga0055527_1008415 | Ga0055527_10084152 | 174 |
| 1196 | 3300003761 | Ga0055535_1001074 | Ga0055535_100107411 | 174 |
| 1197 | 3300003762 | Ga0055542_1000074 | Ga0055542_100007426 | 174 |
| 1198 | 3300003771 | Ga0055526_1042004 | Ga0055526_10420041 | 174 |
| 1199 | 3300003771 | Ga0055526_1063622 | Ga0055526_10636221 | 174 |
| 1200 | 3300003773 | Ga0055537_1013714 | Ga0055537_10137142 | 174 |
| 1201 | 3300003773 | Ga0055537_1014024 | Ga0055537_10140241 | 174 |
| 1202 | 3300003775 | Ga0055524_1061519 | Ga0055524_10615191 | 174 |
| 1203 | 3300003784 | Ga0055534_1011553 | Ga0055534_10115533 | 174 |
| 1204 | 3300003784 | Ga0055534_1018301 | Ga0055534_10183012 | 174 |
| 1205 | 3300003790 | Ga0055528_1015002 | Ga0055528_10150021 | 174 |
| 1206 | 3300003790 | Ga0055528_1029096 | Ga0055528_10290962 | 174 |
| 1207 | 3300003791 | Ga0055530_10000437 | Ga0055530_1000043712 | 174 |
| 1208 | 3300003794 | Ga0055531_10025336 | Ga0055531_100253362 | 174 |
| 1209 | 3300003794 | Ga0055531_10027333 | Ga0055531_100273332 | 174 |
| 1210 | 3300004625 | Ga0055543_1043910 | Ga0055543_10439101 | 174 |
| 1211 | 3300005262 | Ga0065165_1011798 | Ga0065165_10117982 | 174 |
| 1212 | 3300005539 | Ga0068853_100011188 | Ga0068853_1000111882 | 174 |
| 1213 | 3300005834 | Ga0068851_10045449 | Ga0068851_100454492 | 174 |
| 1214 | 3300010375 | Ga0105239_10683668 | Ga0105239_106836682 | 174 |
| 1215 | 3300012505 | Ga0157339_1003029 | Ga0157339_10030292 | 174 |
| 1216 | 3300013102 | Ga0157371_10216837 | Ga0157371_102168372 | 174 |
| 1217 | 3300013307 | Ga0157372_10036787 | Ga0157372_100367873 | 174 |
| 1218 | 3300025208 | Ga0209436_115256 | Ga0209436_1152562 | 174 |
| 1219 | 3300025228 | Ga0209672_101328 | Ga0209672_1013286 | 174 |
| 1220 | 3300025229 | Ga0209147_101428 | Ga0209147_1014289 | 174 |
| 1221 | 3300025242 | Ga0209258_100176 | Ga0209258_100176114 | 174 |
| 1222 | 3300025245 | Ga0207425_1000133 | Ga0207425_100013350 | 174 |
| 1223 | 3300025245 | Ga0207425_1011401 | Ga0207425_10114012 | 174 |
| 1224 | 3300025254 | Ga0209148_1000033 | Ga0209148_1000033245 | 174 |
| 1225 | 3300025258 | Ga0209129_1000186 | Ga0209129_100018635 | 174 |
| 1226 | 3300025258 | Ga0209129_1009268 | Ga0209129_10092682 | 174 |
| 1227 | 3300025263 | Ga0209565_1000190 | Ga0209565_100019026 | 174 |
| 1228 | 3300025263 | Ga0209565_1004293 | Ga0209565_10042933 | 174 |
| 1229 | 3300025273 | Ga0209673_1000209 | Ga0209673_100020922 | 174 |
| 1230 | 3300025273 | Ga0209673_1000393 | Ga0209673_100039326 | 174 |
| 1231 | 3300025273 | Ga0209673_1008405 | Ga0209673_10084053 | 174 |
| 1232 | 3300025284 | Ga0209130_1000372 | Ga0209130_10003722 | 174 |
| 1233 | 3300025284 | Ga0209130_1015881 | Ga0209130_10158812 | 174 |
| 1234 | 3300025291 | Ga0209675_1000902 | Ga0209675_10009022 | 174 |
| 1235 | 3300025291 | Ga0209675_1006482 | Ga0209675_10064822 | 174 |
| 1236 | 3300025292 | Ga0209676_1000048 | Ga0209676_100004875 | 174 |
| 1237 | 3300025294 | Ga0209025_1001380 | Ga0209025_10013803 | 174 |
| 1238 | 3300025294 | Ga0209025_1019492 | Ga0209025_10194923 | 174 |
| 1239 | 3300025295 | Ga0209564_1000417 | Ga0209564_100041750 | 174 |
| 1240 | 3300025295 | Ga0209564_1000423 | Ga0209564_10004232 | 174 |
| 1241 | 3300025297 | Ga0209758_1000092 | Ga0209758_1000092183 | 174 |
| 1242 | 3300025297 | Ga0209758_1010418 | Ga0209758_10104183 | 174 |
| 1243 | 3300025298 | Ga0209050_1000012 | Ga0209050_100001275 | 174 |
| 1244 | 3300025299 | Ga0209256_1000094 | Ga0209256_1000094153 | 174 |
| 1245 | 3300025299 | Ga0209256_1000095 | Ga0209256_1000095213 | 174 |
| 1246 | 3300025302 | Ga0207426_1000084 | Ga0207426_100008450 | 174 |
| 1247 | 3300025302 | Ga0207426_1000161 | Ga0207426_100016198 | 174 |
| 1248 | 3300025303 | Ga0209051_1004369 | Ga0209051_10043692 | 174 |
| 1249 | 3300025303 | Ga0209051_1021299 | Ga0209051_10212992 | 174 |
| 1250 | 3300025304 | Ga0209257_1000024 | Ga0209257_100002421 | 174 |
| 1251 | 3300025304 | Ga0209257_1004734 | Ga0209257_100473410 | 174 |
| 1252 | 3300025321 | Ga0207656_10018338 | Ga0207656_100183381 | 174 |
| 1253 | 3300025728 | Ga0207655_1125068 | Ga0207655_11250681 | 174 |
| 1254 | 3300026041 | Ga0207639_10053359 | Ga0207639_100533592 | 174 |
| 1255 | 3300042012 | Ga0439455_0089309 | Ga0439455_0089309_166_690 | 174 |
| 1256 | 3300048920 | Ga0496117_0013969 | Ga0496117_0013969_5044_5568 | 174 |
| 1257 | 3300048921 | Ga0496118_0028081 | Ga0496118_0028081_3660_4184 | 174 |
| 1258 | 3300048928 | Ga0496125_0027812 | Ga0496125_0027812_2414_2938 | 174 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d40-assembly1.cif.gz_C | crystal structure of z3393 from escherichia coli o157:h7 | 0.8775 | 60 | 157 |
| 5m21-assembly1.cif.gz_C | crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound | 0.8749 | 10 | 174 |
| 4zxa-assembly1.cif.gz_B | crystal structure of hydroquinone 1,2-dioxygenase pnpcd in complex with cd2+ and 4-hydroxybenzonitrile | 0.8706 | 6 | 173 |
| 3nl1-assembly1.cif.gz_A | crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with gentisate | 0.8676 | 60 | 157 |
| 5m21-assembly1.cif.gz_D | crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound | 0.8658 | 41 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8399 | 56 | 157 | 2.60.120.10 |
| 4i4aA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8338 | 56 | 159 | 2.60.120.10 |
| 1zx5A02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8312 | 56 | 159 | 2.60.120.10 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8306 | 52 | 158 | 2.60.120.10 |
| 5fpxA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8269 | 54 | 159 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2G4J352-F1-model_v4 | Hydroxyquinol 1,2-dioxygenase | 0.9839 | 40 | 173 |
GO:0051213
|
| AF-A0A2G4J352-F1-model_v4 | Hydroxyquinol 1,2-dioxygenase | 0.955 | 40 | 173 |
GO:0051213
|
| AF-A0A7C5EWE8-F1-model_v4 | Cupin domain-containing protein | 0.908 | 45 | 159 |
|
| AF-A0A0F0HFM9-F1-model_v4 | Cupin | 0.9065 | 43 | 158 |
|
| AF-A0A7Y8RJY2-F1-model_v4 | Hydroxyquinol 1,2-dioxygenase | 0.9046 | 10 | 174 |
GO:0051213
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar