F492271

General Info

Members Datasets Scaffolds Average Seq Length
1258 517 1225 170

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100009196|Ga0070662_1000091968
Length 201
Sequence MVIAALPEPASDSYHLLHRVVDMTRTVQETSMTETASYRTVFGSLDRYEKGGVQAISDDVKHYAFSNCFEIASKSKPYEKVVFGQNQIYVLETLRAEGDSPWYTCAHDEFALVMDGEVDVHLVKLDAAQTVPDTEHNGAVRVEGEPRGTNMGWMRLRRGHQALLPKNTAYRFRSAKPGVVVLQTCKGDLSIERWAEICQTA

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
3 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
4 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
5 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
6 2643221658 Variovorax sp. Root411 Isolate Unclassified
7 2643221660 Methylibium sp. Root1272 Isolate Unclassified
8 2643221672 Variovorax sp. Root434 Isolate Unclassified
9 2643221683 Variovorax sp. Root473 Isolate Unclassified
10 2738541277 Variovorax sp. GV051 Isolate Unclassified
11 2738541307 Variovorax sp. GV008 Isolate Unclassified
12 2738543013 Variovorax sp. BT01 Isolate Unclassified
13 2738543019 Variovorax sp. GV040 Isolate Unclassified
14 2818991446 Variovorax sp. 1180 Isolate Unclassified
15 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
16 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
17 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
18 2885198086 Variovorax sp. 679 Isolate Unclassified
19 2885211737 Variovorax sp. 553 Isolate Unclassified
20 2899924645 Variovorax sp. 369 Isolate Unclassified
21 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
22 2904456579 Variovorax sp. 2002 Isolate Unclassified
23 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
24 2928037797 Variovorax sp. 1126 Isolate Unclassified
25 2928044640 Variovorax sp. 1128 Isolate Unclassified
26 2928051484 Variovorax sp. 1133 Isolate Unclassified
27 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
28 2928070936 Variovorax gossypii 1167 Isolate Unclassified
29 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
30 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
31 2929520902 Variovorax beijingensis 502 Isolate Unclassified
32 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
33 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
34 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
35 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
36 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
40 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
41 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
42 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
44 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
45 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
46 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
47 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
50 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
51 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
52 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
55 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
56 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
57 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
58 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
59 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
61 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
62 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
65 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
66 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
67 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
68 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
69 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
70 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
71 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
72 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
73 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
74 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
75 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
76 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
77 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
78 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
79 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
80 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
81 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
82 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
83 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
86 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
87 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
88 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
89 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
90 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
91 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
92 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
93 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
94 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
95 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
96 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
97 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
98 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
99 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
100 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
101 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
102 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
103 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
104 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
105 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
106 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
107 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
115 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
116 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
117 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
118 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
119 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
120 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
121 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
122 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
123 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
124 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
125 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
126 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
127 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
128 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
129 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
130 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
131 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
132 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
133 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
134 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
135 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
136 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
138 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
139 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
140 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
141 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
142 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
143 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
144 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
145 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
146 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
147 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
148 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
149 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
150 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
151 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
152 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
153 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
154 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
155 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
156 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
157 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
158 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
159 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
160 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
161 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
162 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
163 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
169 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
170 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
171 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
172 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
173 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
174 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
175 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
176 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
177 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
178 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
179 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
180 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
181 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
182 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
183 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
184 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
185 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
186 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
191 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
193 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
204 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
264 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
265 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
266 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
270 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
271 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
272 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
273 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
274 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
275 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
276 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
277 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
278 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
279 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
280 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
281 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
282 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
283 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
284 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
285 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
286 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
287 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
288 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
289 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
290 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
291 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
292 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
293 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
294 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
295 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
296 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
297 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
298 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
299 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
300 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
302 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
305 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
306 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
307 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
308 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
309 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
310 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
311 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
312 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
313 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
314 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
315 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
316 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
317 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
318 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
319 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
320 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
321 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
322 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
323 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
324 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
325 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
326 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
327 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
328 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
329 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
330 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
331 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
332 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
333 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
334 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
335 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
336 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
337 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
338 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
339 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
340 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
341 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
342 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
343 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
344 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
345 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
346 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
349 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
350 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
351 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
352 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
353 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
354 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
355 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
356 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
357 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
358 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
359 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
360 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
361 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
362 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
363 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
364 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
365 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
366 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
367 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
368 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
369 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
370 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
371 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
372 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
373 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
374 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
375 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
376 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
377 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
378 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
379 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
380 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
381 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
382 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
383 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
384 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
385 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
386 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
387 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
388 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
389 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
390 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
391 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
392 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
393 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
394 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
395 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
396 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
397 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
398 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
399 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
400 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
401 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
402 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
403 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
404 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
405 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
406 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
407 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
408 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
409 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
410 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
411 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
412 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
413 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
414 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
415 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
416 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
417 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
418 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
419 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
420 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
421 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
422 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
423 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
424 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
425 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
426 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
427 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
428 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
429 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
430 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
431 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
432 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
433 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
434 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
435 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
436 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
437 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
438 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
439 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
440 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
441 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
442 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
443 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
444 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
445 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
446 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
447 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
448 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
449 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
455 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
456 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
457 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
458 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
459 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
460 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
461 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
462 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
463 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
464 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
465 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
466 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
467 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
468 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
469 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
470 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
471 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
472 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
473 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
474 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
475 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
476 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
477 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
478 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
479 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
480 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
481 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
482 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
483 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
484 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
485 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
486 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
487 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
488 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
489 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
490 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
491 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
492 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
493 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
494 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
495 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
496 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
497 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
498 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
499 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
500 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
501 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
502 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
503 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
504 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
505 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
506 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
507 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
508 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
509 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
510 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
511 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
512 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
513 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
514 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
515 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
516 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
517 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.38
Metatranscriptomes 0
Isolates 2.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.41
Nodule 0.24
Rhizoplane 1.99
Rhizosphere 73.13
Stem 0
Stem Tuber 0
Unclassified 7.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10010212 3300001979 Bacteria 3628
2 JGI25152J39213_1014372 3300002773 Bacteria 1609
3 JGI25150J39212_1000692 3300002774 Bacteria 12226
4 JGI25159J45721_1008171 3300002987 Bacteria 2904
5 JGI25159J45721_1024032 3300002987 Bacteria 1093
6 JGI25159J45721_1034896 3300002987 Bacteria 775
7 JGI25151J46595_10000966 3300003187 Bacteria 21838
8 JGI25151J46595_10032862 3300003187 Bacteria 2005
9 JGI25151J46595_10033648 3300003187 Bacteria 1970
10 JGI25151J46595_10049812 3300003187 Bacteria 1433
11 JGI25153J46596_10015324 3300003215 Bacteria 3129
12 JGI25153J46596_10038516 3300003215 Bacteria 1506
13 rootH2_10009454 3300003320 Bacteria 2620
14 rootL2_10020422 3300003322 Bacteria 3875
15 rootL2_10113471 3300003322 Bacteria 1287
16 JGI25160J50197_1051024 3300003354 Bacteria 877
17 JGI25160J50197_1058914 3300003354 Bacteria 775
18 JGI25407J50210_10071250 3300003373 Bacteria 867
19 JGI25161J50226_1006587 3300003374 Bacteria 2076
20 JGI25161J50226_1019299 3300003374 Bacteria 698
21 Ga0055532_1015032 3300003758 Bacteria 860
22 Ga0055527_1008415 3300003760 Bacteria 1232
23 Ga0055535_1001074 3300003761 Bacteria 16812
24 Ga0055542_1000074 3300003762 Bacteria 141185
25 Ga0055526_1042004 3300003771 Bacteria 1132
26 Ga0055526_1063622 3300003771 Bacteria 775
27 Ga0055537_1013714 3300003773 Bacteria 1506
28 Ga0055537_1014024 3300003773 Bacteria 1473
29 Ga0055524_1061519 3300003775 Bacteria 775
30 Ga0055536_1000980 3300003781 Bacteria 18127
31 Ga0055536_1013599 3300003781 Bacteria 2920
32 Ga0055534_1006770 3300003784 Bacteria 2834
33 Ga0055534_1011553 3300003784 Bacteria 1789
34 Ga0055534_1018300 3300003784 Bacteria 1221
35 Ga0055534_1018301 3300003784 Bacteria 1221
36 Ga0055528_1015002 3300003790 Bacteria 2823
37 Ga0055528_1029096 3300003790 Bacteria 1506
38 Ga0055530_10000437 3300003791 Bacteria 37027
39 Ga0055530_10011577 3300003791 Bacteria 3153
40 Ga0055540_1002229 3300003792 Bacteria 10495
41 Ga0055540_1005977 3300003792 Bacteria 4940
42 Ga0055540_1007891 3300003792 Bacteria 3927
43 Ga0055531_10000809 3300003794 Bacteria 25914
44 Ga0055531_10025336 3300003794 Bacteria 2158
45 Ga0055531_10027333 3300003794 Bacteria 2005
46 Ga0055543_1043910 3300004625 Bacteria 747
47 Ga0065165_1011798 3300005262 Bacteria 3603
48 Ga0065714_10104460 3300005288 Bacteria 1584
49 Ga0065714_10204003 3300005288 Bacteria 886
50 Ga0065704_10081990 3300005289 Bacteria 3672
51 Ga0065712_10316088 3300005290 Bacteria 836
52 Ga0065707_10101401 3300005295 Bacteria 2867
53 Ga0070658_10057194 3300005327 Bacteria 3172
54 Ga0070658_10382387 3300005327 Bacteria 1208
55 Ga0070658_10682662 3300005327 Bacteria 891
56 Ga0070676_10002959 3300005328 Bacteria 8775
57 Ga0070676_10003006 3300005328 Bacteria 8721
58 Ga0070676_10009607 3300005328 Bacteria 5226
59 Ga0070676_10048770 3300005328 Bacteria 2476
60 Ga0070676_10115300 3300005328 Bacteria 1678
61 Ga0070683_100124461 3300005329 Unclassified 2437
62 Ga0070683_100179924 3300005329 Bacteria 2007
63 Ga0070683_100503711 3300005329 Unclassified 1157
64 Ga0070690_100176086 3300005330 Bacteria 1475
65 Ga0070690_100300565 3300005330 Bacteria 1151
66 Ga0070670_100011371 3300005331 Bacteria 7609
67 Ga0070670_100158075 3300005331 Bacteria 1964
68 Ga0070670_100166921 3300005331 Bacteria 1909
69 Ga0070670_100254958 3300005331 Bacteria 1529
70 Ga0070677_10265891 3300005333 Bacteria 858
71 Ga0068869_100004690 3300005334 Bacteria 8530
72 Ga0068869_100014419 3300005334 Bacteria 5279
73 Ga0068869_100066156 3300005334 Bacteria 2662
74 Ga0068869_101290440 3300005334 Bacteria 644
75 Ga0070666_10002130 3300005335 Bacteria 12031
76 Ga0070666_10242878 3300005335 Bacteria 1274
77 Ga0070666_10582288 3300005335 Bacteria 816
78 Ga0070680_100051495 3300005336 Bacteria 3360
79 Ga0070680_100311391 3300005336 Bacteria 1336
80 Ga0068868_100051509 3300005338 Bacteria 3239
81 Ga0068868_100054986 3300005338 Bacteria 3139
82 Ga0068868_100155069 3300005338 Bacteria 1888
83 Ga0068868_100964320 3300005338 Unclassified 778
84 Ga0068868_101602450 3300005338 Bacteria 612
85 Ga0070689_100014421 3300005340 Bacteria 5741
86 Ga0070691_10218433 3300005341 Bacteria 1009
87 Ga0070691_10281495 3300005341 Bacteria 902
88 Ga0070687_100118412 3300005343 Bacteria 1511
89 Ga0070661_100143938 3300005344 Bacteria 1798
90 Ga0070668_100010950 3300005347 Bacteria 6748
91 Ga0070668_100122730 3300005347 Bacteria 2078
92 Ga0070668_100256205 3300005347 Bacteria 1454
93 Ga0070668_100574926 3300005347 Bacteria 983
94 Ga0070669_100250334 3300005353 Bacteria 1411
95 Ga0070669_100568517 3300005353 Bacteria 947
96 Ga0070669_100947023 3300005353 Bacteria 737
97 Ga0070669_101122731 3300005353 Unclassified 677
98 Ga0070675_100008998 3300005354 Bacteria 7757
99 Ga0070675_100278711 3300005354 Bacteria 1469
100 Ga0070675_100488535 3300005354 Bacteria 1108
101 Ga0070671_100001982 3300005355 Bacteria 15714
102 Ga0070671_100049526 3300005355 Bacteria 3495
103 Ga0070671_100073564 3300005355 Bacteria 2854
104 Ga0070671_100199979 3300005355 Bacteria 1694
105 Ga0070671_100283273 3300005355 Bacteria 1410
106 Ga0070671_101205393 3300005355 Unclassified 666
107 Ga0070674_100031734 3300005356 Bacteria 3503
108 Ga0070674_100104587 3300005356 Bacteria 2069
109 Ga0070674_100388003 3300005356 Bacteria 1138
110 Ga0070674_100775468 3300005356 Bacteria 826
111 Ga0070673_100000636 3300005364 Bacteria 19252
112 Ga0070673_100017149 3300005364 Bacteria 5140
113 Ga0070673_100068716 3300005364 Bacteria 2838
114 Ga0070673_100582773 3300005364 Bacteria 1019
115 Ga0070673_100772804 3300005364 Bacteria 886
116 Ga0070688_100206154 3300005365 Bacteria 1378
117 Ga0070688_100241403 3300005365 Bacteria 1282
118 Ga0070659_100368624 3300005366 Bacteria 1208
119 Ga0070667_100000916 3300005367 Bacteria 27234
120 Ga0070667_100001639 3300005367 Bacteria 20014
121 Ga0070667_100108331 3300005367 Bacteria 2407
122 Ga0070667_100254517 3300005367 Bacteria 1570
123 Ga0070667_100276685 3300005367 Bacteria 1506
124 Ga0070667_101108948 3300005367 Bacteria 740
125 Ga0070709_10041462 3300005434 Bacteria 2837
126 Ga0070713_100079415 3300005436 Bacteria 2795
127 Ga0070710_11181176 3300005437 Bacteria 565
128 Ga0070701_10067484 3300005438 Bacteria 1903
129 Ga0070701_10236218 3300005438 Bacteria 1097
130 Ga0070705_100187047 3300005440 Unclassified 1408
131 Ga0070700_100021338 3300005441 Bacteria 3764
132 Ga0070700_100046369 3300005441 Bacteria 2685
133 Ga0070700_100766040 3300005441 Bacteria 774
134 Ga0070700_101235732 3300005441 Bacteria 625
135 Ga0070708_100033241 3300005445 Bacteria 4481
136 Ga0070708_100188876 3300005445 Unclassified 1927
137 Ga0070708_100197772 3300005445 Bacteria 1881
138 Ga0070708_100373113 3300005445 Bacteria 1345
139 Ga0070708_100551649 3300005445 Bacteria 1087
140 Ga0070663_100185389 3300005455 Bacteria 1617
141 Ga0070663_101674885 3300005455 Bacteria 568
142 Ga0070678_100005995 3300005456 Bacteria 7083
143 Ga0070678_100178927 3300005456 Bacteria 1734
144 Ga0070678_100282242 3300005456 Bacteria 1405
145 Ga0070678_100296129 3300005456 Bacteria 1373
146 Ga0070678_100581387 3300005456 Bacteria 998
147 Ga0070678_101275078 3300005456 Bacteria 683
148 Ga0070662_100002338 3300005457 Bacteria 11655
149 Ga0070662_100009196 3300005457 Bacteria 6451
150 Ga0070662_100074970 3300005457 Bacteria 2504
151 Ga0070662_100189153 3300005457 Bacteria 1627
152 Ga0070681_10029856 3300005458 Bacteria 5472
153 Ga0070681_10631726 3300005458 Unclassified 986
154 Ga0070681_10961264 3300005458 Unclassified 773
155 Ga0068867_100000664 3300005459 Bacteria 22809
156 Ga0068867_100013814 3300005459 Bacteria 5717
157 Ga0068867_100029743 3300005459 Bacteria 3936
158 Ga0068867_100032411 3300005459 Bacteria 3779
159 Ga0068867_100142501 3300005459 Bacteria 1875
160 Ga0068867_100154895 3300005459 Bacteria 1803
161 Ga0068867_100212789 3300005459 Bacteria 1553
162 Ga0068867_100843491 3300005459 Bacteria 820
163 Ga0070685_10514457 3300005466 Bacteria 849
164 Ga0070685_10633233 3300005466 Bacteria 773
165 Ga0070685_10678964 3300005466 Bacteria 749
166 Ga0070685_10681485 3300005466 Bacteria 748
167 Ga0070707_100010736 3300005468 Bacteria 8530
168 Ga0070698_100423339 3300005471 Bacteria 1266
169 Ga0070698_100833995 3300005471 Bacteria 866
170 Ga0070679_100183717 3300005530 Bacteria 2063
171 Ga0070684_100026516 3300005535 Bacteria 4885
172 Ga0070697_100010956 3300005536 Bacteria 7083
173 Ga0068853_100009688 3300005539 Bacteria 7768
174 Ga0068853_100011188 3300005539 Bacteria 7280
175 Ga0068853_100509540 3300005539 Bacteria 1137
176 Ga0068853_101150454 3300005539 Bacteria 749
177 Ga0070672_100000215 3300005543 Bacteria 31837
178 Ga0070672_100007533 3300005543 Bacteria 7394
179 Ga0070672_100220183 3300005543 Bacteria 1592
180 Ga0070672_100375068 3300005543 Bacteria 1216
181 Ga0070672_100383809 3300005543 Bacteria 1202
182 Ga0070672_100529513 3300005543 Bacteria 1021
183 Ga0070672_101011538 3300005543 Bacteria 737
184 Ga0070686_100058846 3300005544 Bacteria 2474
185 Ga0070695_101196718 3300005545 Unclassified 625
186 Ga0070665_100025474 3300005548 Bacteria 5959
187 Ga0070665_100055275 3300005548 Bacteria 3981
188 Ga0070665_100409201 3300005548 Bacteria 1365
189 Ga0070665_100446518 3300005548 Bacteria 1303
190 Ga0068855_100000166 3300005563 Bacteria 83838
191 Ga0068855_100164792 3300005563 Plasmid 2513
192 Ga0068855_100242436 3300005563 Bacteria 2013
193 Ga0070664_100022201 3300005564 Bacteria 5235
194 Ga0070664_100241622 3300005564 Bacteria 1621
195 Ga0068857_100006977 3300005577 Bacteria 9719
196 Ga0068857_100012327 3300005577 Bacteria 7440
197 Ga0068857_100069621 3300005577 Bacteria 3133
198 Ga0068857_100209974 3300005577 Bacteria 1776
199 Ga0068854_100039212 3300005578 Bacteria 3336
200 Ga0068854_100169572 3300005578 Bacteria 1697
201 Ga0068856_100123773 3300005614 Plasmid 2588
202 Ga0068856_100198462 3300005614 Bacteria 2021
203 Ga0068856_100649653 3300005614 Bacteria 1075
204 Ga0070702_101158956 3300005615 Bacteria 621
205 Ga0068852_100180934 3300005616 Bacteria 1982
206 Ga0068852_100291220 3300005616 Bacteria 1577
207 Ga0068852_100516312 3300005616 Bacteria 1192
208 Ga0068852_101004876 3300005616 Bacteria 853
209 Ga0068852_102122197 3300005616 Bacteria 584
210 Ga0068859_100010428 3300005617 Bacteria 9349
211 Ga0068859_100154256 3300005617 Bacteria 2373
212 Ga0068859_100175040 3300005617 Bacteria 2228
213 Ga0068859_100252906 3300005617 Bacteria 1852
214 Ga0068859_100338867 3300005617 Bacteria 1598
215 Ga0068859_100413590 3300005617 Bacteria 1445
216 Ga0068864_100011184 3300005618 Bacteria 7416
217 Ga0068864_100015192 3300005618 Bacteria 6403
218 Ga0068864_100735631 3300005618 Bacteria 966
219 Ga0068866_10019710 3300005718 Bacteria 3077
220 Ga0068866_10064676 3300005718 Bacteria 1910
221 Ga0068861_100006063 3300005719 Bacteria 8218
222 Ga0068861_100136966 3300005719 Bacteria 1993
223 Ga0068851_10040298 3300005834 Bacteria 2348
224 Ga0068851_10045449 3300005834 Bacteria 2219
225 Ga0068870_10032629 3300005840 Bacteria 2650
226 Ga0068870_10504622 3300005840 Bacteria 807
227 Ga0068863_100001567 3300005841 Bacteria 22604
228 Ga0068863_100001722 3300005841 Bacteria 21666
229 Ga0068863_100380730 3300005841 Bacteria 1378
230 Ga0068858_100000628 3300005842 Bacteria 36756
231 Ga0068858_100058676 3300005842 Bacteria 3559
232 Ga0068858_100323282 3300005842 Bacteria 1475
233 Ga0068858_100488267 3300005842 Bacteria 1189
234 Ga0068858_100852913 3300005842 Bacteria 890
235 Ga0068858_101001619 3300005842 Bacteria 819
236 Ga0068860_100002622 3300005843 Bacteria 18697
237 Ga0068860_100008901 3300005843 Bacteria 10002
238 Ga0068860_100184807 3300005843 Bacteria 2015
239 Ga0068860_100474576 3300005843 Bacteria 1246
240 Ga0068860_101064532 3300005843 Bacteria 828
241 Ga0068862_100049227 3300005844 Bacteria 3599
242 Ga0068862_100071248 3300005844 Bacteria 3001
243 Ga0068862_100087624 3300005844 Bacteria 2707
244 Ga0068862_100223968 3300005844 Bacteria 1704
245 Ga0068862_100483613 3300005844 Bacteria 1172
246 Ga0068862_101026749 3300005844 Bacteria 816
247 Ga0081455_10732466 3300005937 Bacteria 627
248 Ga0075365_10000402 3300006038 Bacteria 15892
249 Ga0075365_10188804 3300006038 Bacteria 1442
250 Ga0075368_10072401 3300006042 Bacteria 1394
251 Ga0075363_100006788 3300006048 Bacteria 5228
252 Ga0075364_10006947 3300006051 Bacteria 6686
253 Ga0075432_10028523 3300006058 Bacteria 1926
254 Ga0075362_10018359 3300006177 Bacteria 2892
255 Ga0075362_10026331 3300006177 Bacteria 2483
256 Ga0075362_10075241 3300006177 Bacteria 1548
257 Ga0075362_10079367 3300006177 Bacteria 1511
258 Ga0075362_10123620 3300006177 Bacteria 1226
259 Ga0075367_10052723 3300006178 Bacteria 2408
260 Ga0075367_10106928 3300006178 Bacteria 1715
261 Ga0075367_10173445 3300006178 Bacteria 1343
262 Ga0075367_10355351 3300006178 Bacteria 925
263 Ga0075367_10371852 3300006178 Bacteria 903
264 Ga0075369_10162193 3300006186 Bacteria 1025
265 Ga0075366_10006489 3300006195 Bacteria 6413
266 Ga0075366_10015968 3300006195 Bacteria 4311
267 Ga0075366_10018726 3300006195 Bacteria 4000
268 Ga0075366_10021592 3300006195 Bacteria 3742
269 Ga0075366_10038020 3300006195 Bacteria 2842
270 Ga0075366_10053152 3300006195 Bacteria 2406
271 Ga0075366_10064372 3300006195 Bacteria 2181
272 Ga0075366_10073073 3300006195 Bacteria 2044
273 Ga0075366_10077864 3300006195 Bacteria 1979
274 Ga0075366_10095547 3300006195 Bacteria 1782
275 Ga0075366_10153377 3300006195 Bacteria 1395
276 Ga0075366_10212788 3300006195 Bacteria 1177
277 Ga0075366_10774203 3300006195 Bacteria 597
278 Ga0097621_100007488 3300006237 Bacteria 7815
279 Ga0097621_100019592 3300006237 Bacteria 5197
280 Ga0097621_100186892 3300006237 Bacteria 1793
281 Ga0097621_100763867 3300006237 Bacteria 893
282 Ga0097621_100779391 3300006237 Bacteria 885
283 Ga0075370_10023306 3300006353 Bacteria 3407
284 Ga0075370_10024490 3300006353 Bacteria 3335
285 Ga0075370_10031608 3300006353 Bacteria 2955
286 Ga0075370_10053353 3300006353 Bacteria 2294
287 Ga0075370_10070417 3300006353 Bacteria 2000
288 Ga0075370_10177611 3300006353 Bacteria 1252
289 Ga0075370_10361938 3300006353 Bacteria 867
290 Ga0075370_10416635 3300006353 Bacteria 807
291 Ga0068871_100003128 3300006358 Bacteria 11356
292 Ga0068871_100012228 3300006358 Bacteria 6320
293 Ga0068871_100066423 3300006358 Bacteria 2956
294 Ga0075428_100002991 3300006844 Bacteria 18429
295 Ga0075428_100004497 3300006844 Bacteria 15397
296 Ga0075428_100600102 3300006844 Bacteria 1176
297 Ga0075428_102160969 3300006844 Bacteria 575
298 Ga0075430_100019067 3300006846 Bacteria 5836
299 Ga0075430_100053854 3300006846 Bacteria 3387
300 Ga0075431_100308981 3300006847 Bacteria 1596
301 Ga0075431_100604847 3300006847 Bacteria 1080
302 Ga0075433_10174388 3300006852 Bacteria 1913
303 Ga0075429_100022565 3300006880 Bacteria 5457
304 Ga0075429_100264976 3300006880 Bacteria 1505
305 Ga0068865_100003193 3300006881 Bacteria 9812
306 Ga0068865_100003621 3300006881 Bacteria 9279
307 Ga0068865_100005535 3300006881 Bacteria 7663
308 Ga0068865_100037561 3300006881 Bacteria 3271
309 Ga0068865_100199681 3300006881 Bacteria 1552
310 Ga0068865_100204342 3300006881 Bacteria 1535
311 Ga0068865_100703363 3300006881 Bacteria 864
312 Ga0097620_100010429 3300006931 Bacteria 9349
313 Ga0097620_100154273 3300006931 Bacteria 2373
314 Ga0097620_100175044 3300006931 Bacteria 2228
315 Ga0097620_100252899 3300006931 Bacteria 1852
316 Ga0097620_100338915 3300006931 Bacteria 1598
317 Ga0097620_100413575 3300006931 Bacteria 1445
318 Ga0099826_10065661 3300006948 Bacteria 2332
319 Ga0105244_10017711 3300009036 Bacteria 4018
320 Ga0105244_10140250 3300009036 Bacteria 1163
321 Ga0105240_10000470 3300009093 Bacteria 74442
322 Ga0105240_10002416 3300009093 Bacteria 30014
323 Ga0105240_10173426 3300009093 Bacteria 2552
324 Ga0105240_10876762 3300009093 Bacteria 967
325 Ga0111539_10007916 3300009094 Bacteria 13552
326 Ga0111539_10012627 3300009094 Bacteria 10584
327 Ga0105245_10012561 3300009098 Bacteria 7370
328 Ga0105245_10018645 3300009098 Bacteria 6069
329 Ga0105245_10038455 3300009098 Bacteria 4257
330 Ga0105245_10406613 3300009098 Bacteria 1362
331 Ga0105245_10436021 3300009098 Bacteria 1316
332 Ga0105245_10987911 3300009098 Bacteria 886
333 Ga0114129_10008968 3300009147 Bacteria 14262
334 Ga0105243_10000437 3300009148 Bacteria 43696
335 Ga0105243_10002267 3300009148 Bacteria 16166
336 Ga0105243_10016045 3300009148 Bacteria 5667
337 Ga0105243_10035573 3300009148 Bacteria 3861
338 Ga0105243_10149101 3300009148 Bacteria 2004
339 Ga0105243_10214642 3300009148 Bacteria 1696
340 Ga0105241_10024541 3300009174 Bacteria 4476
341 Ga0105241_10076022 3300009174 Bacteria 2618
342 Ga0105241_10198017 3300009174 Bacteria 1676
343 Ga0105241_10228970 3300009174 Unclassified 1566
344 Ga0105242_10005571 3300009176 Bacteria 9715
345 Ga0105242_10025391 3300009176 Bacteria 4689
346 Ga0105242_10172499 3300009176 Bacteria 1902
347 Ga0105242_10295810 3300009176 Bacteria 1476
348 Ga0105242_10356237 3300009176 Bacteria 1353
349 Ga0105242_10640995 3300009176 Bacteria 1032
350 Ga0105248_10002934 3300009177 Bacteria 18928
351 Ga0105248_10110965 3300009177 Bacteria 3093
352 Ga0105248_10315388 3300009177 Bacteria 1761
353 Ga0105237_10001223 3300009545 Bacteria 34228
354 Ga0105237_10004017 3300009545 Bacteria 17192
355 Ga0105237_10010476 3300009545 Bacteria 9854
356 Ga0105237_10066362 3300009545 Bacteria 3603
357 Ga0105237_10102414 3300009545 Bacteria 2855
358 Ga0105237_10189785 3300009545 Bacteria 2055
359 Ga0105238_10000294 3300009551 Bacteria 55283
360 Ga0105238_10006384 3300009551 Bacteria 11730
361 Ga0105238_10017161 3300009551 Bacteria 7350
362 Ga0105238_10071647 3300009551 Bacteria 3463
363 Ga0105238_10122079 3300009551 Bacteria 2585
364 Ga0105238_10158793 3300009551 Bacteria 2237
365 Ga0105238_10500661 3300009551 Bacteria 1216
366 Ga0105238_10848515 3300009551 Unclassified 930
367 Ga0105249_10007568 3300009553 Bacteria 9475
368 Ga0105249_10010948 3300009553 Bacteria 7972
369 Ga0105249_10432539 3300009553 Bacteria 1352
370 Ga0105239_10002071 3300010375 Bacteria 25990
371 Ga0105239_10016024 3300010375 Bacteria 8296
372 Ga0105239_10031117 3300010375 Bacteria 5871
373 Ga0105239_10043988 3300010375 Bacteria 4896
374 Ga0105239_10317522 3300010375 Bacteria 1756
375 Ga0105239_10420815 3300010375 Bacteria 1513
376 Ga0105239_10683668 3300010375 Bacteria 1173
377 Ga0105246_10069868 3300011119 Bacteria 2468
378 Ga0105246_10204120 3300011119 Bacteria 1539
379 Ga0105246_10286655 3300011119 Bacteria 1323
380 Ga0105246_10594420 3300011119 Bacteria 955
381 Ga0105246_10833173 3300011119 Bacteria 821
382 Ga0157322_1011987 3300012490 Bacteria 724
383 Ga0157345_1008467 3300012498 Bacteria 860
384 Ga0157339_1003029 3300012505 Bacteria 1183
385 Ga0157373_10079134 3300013100 Bacteria 2318
386 Ga0157371_10216837 3300013102 Bacteria 1374
387 Ga0157370_10003332 3300013104 Bacteria 18929
388 Ga0157370_10036164 3300013104 Bacteria 4794
389 Ga0157369_10054666 3300013105 Bacteria 4311
390 Ga0157369_10345339 3300013105 Unclassified 1546
391 Ga0157374_10018835 3300013296 Bacteria 6102
392 Ga0157374_10190956 3300013296 Bacteria 2004
393 Ga0157374_10223789 3300013296 Bacteria 1847
394 Ga0157374_10390070 3300013296 Bacteria 1388
395 Ga0157374_10438862 3300013296 Bacteria 1306
396 Ga0157378_10012717 3300013297 Bacteria 7364
397 Ga0157378_10025572 3300013297 Bacteria 5198
398 Ga0157378_10068930 3300013297 Bacteria 3172
399 Ga0157378_10181822 3300013297 Bacteria 1979
400 Ga0157378_10217874 3300013297 Bacteria 1813
401 Ga0157378_10629129 3300013297 Bacteria 1087
402 Ga0163162_10000954 3300013306 Bacteria 26824
403 Ga0163162_10049343 3300013306 Bacteria 4218
404 Ga0163162_10084244 3300013306 Bacteria 3254
405 Ga0163162_10093337 3300013306 Bacteria 3094
406 Ga0163162_10261827 3300013306 Bacteria 1861
407 Ga0163162_10271330 3300013306 Bacteria 1828
408 Ga0163162_11109334 3300013306 Unclassified 896
409 Ga0163162_11322846 3300013306 Bacteria 819
410 Ga0157372_10036787 3300013307 Bacteria 5398
411 Ga0157372_10239142 3300013307 Unclassified 2107
412 Ga0157372_10921368 3300013307 Unclassified 1013
413 Ga0157375_10000550 3300013308 Bacteria 33739
414 Ga0157375_10018289 3300013308 Bacteria 6353
415 Ga0157375_10033787 3300013308 Bacteria 4864
416 Ga0157375_10111508 3300013308 Bacteria 2834
417 Ga0157375_11135788 3300013308 Bacteria 915
418 Ga0163163_10018301 3300014325 Bacteria 6554
419 Ga0163163_10146821 3300014325 Bacteria 2403
420 Ga0157380_10000489 3300014326 Bacteria 24116
421 Ga0157380_10009763 3300014326 Bacteria 6888
422 Ga0157380_10012837 3300014326 Bacteria 6087
423 Ga0157380_10117607 3300014326 Bacteria 2245
424 Ga0157380_10124752 3300014326 Bacteria 2187
425 Ga0182008_10007679 3300014497 Bacteria 5941
426 Ga0182008_10050118 3300014497 Bacteria 2072
427 Ga0157377_10324933 3300014745 Bacteria 1023
428 Ga0157377_11084443 3300014745 Unclassified 612
429 Ga0157379_10000439 3300014968 Bacteria 33735
430 Ga0157379_10047612 3300014968 Bacteria 3825
431 Ga0157379_10094579 3300014968 Bacteria 2681
432 Ga0157379_10160691 3300014968 Bacteria 2028
433 Ga0157379_10294445 3300014968 Bacteria 1478
434 Ga0157379_10305253 3300014968 Bacteria 1451
435 Ga0157376_10029133 3300014969 Bacteria 4397
436 Ga0157376_10203034 3300014969 Bacteria 1825
437 Ga0157376_10266833 3300014969 Bacteria 1606
438 Ga0157376_10585657 3300014969 Bacteria 1108
439 Ga0157376_10940849 3300014969 Bacteria 884
440 Ga0182006_1001748 3300015261 Bacteria 12603
441 Ga0182006_1003709 3300015261 Bacteria 7719
442 Ga0182006_1127927 3300015261 Bacteria 876
443 Ga0182007_10004346 3300015262 Bacteria 6440
444 Ga0182005_1031429 3300015265 Bacteria 1446
445 Ga0182005_1059851 3300015265 Bacteria 1040
446 Ga0183362_10005 3300015683 Bacteria 437616
447 Ga0163161_10006931 3300017792 Bacteria 7836
448 Ga0163161_10052953 3300017792 Bacteria 2942
449 Ga0163161_10120687 3300017792 Bacteria 1970
450 Ga0163161_10121160 3300017792 Bacteria 1966
451 Ga0163161_10127999 3300017792 Bacteria 1913
452 Ga0213872_10023309 3300021361 Bacteria 2848
453 Ga0213876_10181594 3300021384 Bacteria 1119
454 Ga0209436_115256 3300025208 Bacteria 1194
455 Ga0209672_101328 3300025228 Bacteria 9426
456 Ga0209147_101428 3300025229 Bacteria 8692
457 Ga0209258_100176 3300025242 Bacteria 141261
458 Ga0207425_1000133 3300025245 Bacteria 67802
459 Ga0207425_1011401 3300025245 Bacteria 2123
460 Ga0207425_1044847 3300025245 Bacteria 829
461 Ga0209148_1000033 3300025254 Bacteria 555508
462 Ga0209129_1000186 3300025258 Bacteria 85793
463 Ga0209129_1007298 3300025258 Bacteria 3328
464 Ga0209129_1009268 3300025258 Bacteria 2619
465 Ga0209565_1000190 3300025263 Bacteria 75207
466 Ga0209565_1004293 3300025263 Bacteria 4388
467 Ga0209673_1000209 3300025273 Bacteria 117670
468 Ga0209673_1000393 3300025273 Bacteria 78531
469 Ga0209673_1001625 3300025273 Bacteria 19511
470 Ga0209673_1008405 3300025273 Bacteria 4598
471 Ga0209673_1051779 3300025273 Bacteria 1081
472 Ga0209130_1000372 3300025284 Bacteria 50940
473 Ga0209130_1010030 3300025284 Bacteria 2640
474 Ga0209130_1015881 3300025284 Bacteria 1840
475 Ga0209675_1000902 3300025291 Bacteria 19011
476 Ga0209675_1001575 3300025291 Bacteria 12922
477 Ga0209675_1006482 3300025291 Bacteria 4679
478 Ga0209675_1017081 3300025291 Bacteria 2085
479 Ga0209675_1037045 3300025291 Bacteria 1099
480 Ga0209676_1000048 3300025292 Bacteria 403716
481 Ga0209676_1000368 3300025292 Bacteria 83764
482 Ga0209676_1000433 3300025292 Bacteria 72480
483 Ga0209676_1000937 3300025292 Bacteria 35920
484 Ga0209025_1000324 3300025294 Bacteria 106257
485 Ga0209025_1001380 3300025294 Bacteria 32437
486 Ga0209025_1001614 3300025294 Bacteria 28196
487 Ga0209025_1019492 3300025294 Bacteria 3770
488 Ga0209025_1079347 3300025294 Bacteria 1123
489 Ga0209025_1096798 3300025294 Bacteria 947
490 Ga0209564_1000417 3300025295 Bacteria 74808
491 Ga0209564_1000423 3300025295 Bacteria 74528
492 Ga0209758_1000092 3300025297 Bacteria 241910
493 Ga0209758_1010418 3300025297 Bacteria 5566
494 Ga0209050_1000012 3300025298 Bacteria 813717
495 Ga0209050_1000912 3300025298 Bacteria 39073
496 Ga0209050_1004084 3300025298 Bacteria 10213
497 Ga0209050_1051799 3300025298 Bacteria 1032
498 Ga0209256_1000094 3300025299 Bacteria 208177
499 Ga0209256_1000095 3300025299 Bacteria 206120
500 Ga0207426_1000084 3300025302 Bacteria 298123
501 Ga0207426_1000161 3300025302 Bacteria 172765
502 Ga0209051_1000178 3300025303 Bacteria 115109
503 Ga0209051_1000207 3300025303 Bacteria 103683
504 Ga0209051_1000931 3300025303 Bacteria 28957
505 Ga0209051_1004369 3300025303 Bacteria 8755
506 Ga0209051_1016148 3300025303 Bacteria 3400
507 Ga0209051_1021299 3300025303 Bacteria 2764
508 Ga0209051_1026224 3300025303 Bacteria 2354
509 Ga0209257_1000024 3300025304 Bacteria 726068
510 Ga0209257_1000249 3300025304 Bacteria 124522
511 Ga0209257_1004734 3300025304 Bacteria 10176
512 Ga0209257_1019883 3300025304 Bacteria 2508
513 Ga0207697_10018594 3300025315 Bacteria 2849
514 Ga0207656_10005089 3300025321 Bacteria 4623
515 Ga0207656_10018338 3300025321 Bacteria 2754
516 Ga0207655_1004770 3300025728 Bacteria 9456
517 Ga0207655_1067730 3300025728 Bacteria 1342
518 Ga0207655_1125068 3300025728 Bacteria 846
519 Ga0207682_10019861 3300025893 Bacteria 2634
520 Ga0207682_10366174 3300025893 Bacteria 680
521 Ga0207642_10005581 3300025899 Bacteria 4117
522 Ga0207642_10375526 3300025899 Bacteria 845
523 Ga0207680_10086167 3300025903 Bacteria 1986
524 Ga0207680_10152926 3300025903 Bacteria 1540
525 Ga0207680_10320938 3300025903 Bacteria 1083
526 Ga0207680_10338048 3300025903 Bacteria 1056
527 Ga0207680_10509501 3300025903 Bacteria 857
528 Ga0207680_10993635 3300025903 Bacteria 601
529 Ga0207699_10035483 3300025906 Bacteria 2838
530 Ga0207645_10002573 3300025907 Bacteria 14148
531 Ga0207645_10008080 3300025907 Bacteria 7380
532 Ga0207645_10017297 3300025907 Bacteria 4763
533 Ga0207643_10014794 3300025908 Bacteria 4243
534 Ga0207643_10087791 3300025908 Bacteria 1809
535 Ga0207684_10007194 3300025910 Bacteria 10057
536 Ga0207684_10536269 3300025910 Bacteria 1002
537 Ga0207654_10125138 3300025911 Unclassified 1620
538 Ga0207654_10299021 3300025911 Unclassified 1094
539 Ga0207707_10006936 3300025912 Bacteria 9879
540 Ga0207695_10005377 3300025913 Bacteria 17023
541 Ga0207695_10007940 3300025913 Bacteria 13392
542 Ga0207695_10138130 3300025913 Bacteria 2389
543 Ga0207695_10376627 3300025913 Bacteria 1305
544 Ga0207695_10665193 3300025913 Bacteria 922
545 Ga0207671_10007085 3300025914 Bacteria 9808
546 Ga0207671_10056053 3300025914 Bacteria 2920
547 Ga0207671_10070997 3300025914 Bacteria 2597
548 Ga0207671_10294875 3300025914 Bacteria 1281
549 Ga0207671_10995659 3300025914 Unclassified 661
550 Ga0207660_10068643 3300025917 Bacteria 2571
551 Ga0207660_10532301 3300025917 Bacteria 955
552 Ga0207662_10130324 3300025918 Bacteria 1585
553 Ga0207657_10627702 3300025919 Bacteria 837
554 Ga0207649_10266254 3300025920 Bacteria 1240
555 Ga0207652_10145045 3300025921 Unclassified 2124
556 Ga0207646_10101910 3300025922 Bacteria 2574
557 Ga0207681_10000644 3300025923 Bacteria 23228
558 Ga0207681_10185542 3300025923 Bacteria 1588
559 Ga0207681_10238766 3300025923 Bacteria 1414
560 Ga0207681_10245131 3300025923 Bacteria 1396
561 Ga0207681_10904756 3300025923 Bacteria 739
562 Ga0207694_10000601 3300025924 Bacteria 32556
563 Ga0207694_10000920 3300025924 Bacteria 26083
564 Ga0207694_10024601 3300025924 Bacteria 4574
565 Ga0207694_10155247 3300025924 Bacteria 1845
566 Ga0207650_10006427 3300025925 Bacteria 8009
567 Ga0207650_10657425 3300025925 Bacteria 884
568 Ga0207650_10704442 3300025925 Bacteria 853
569 Ga0207659_10000751 3300025926 Bacteria 19207
570 Ga0207659_10006069 3300025926 Bacteria 7376
571 Ga0207659_10753015 3300025926 Bacteria 836
572 Ga0207687_10011986 3300025927 Bacteria 5669
573 Ga0207687_10038600 3300025927 Bacteria 3264
574 Ga0207687_10071514 3300025927 Bacteria 2479
575 Ga0207687_10547425 3300025927 Bacteria 971
576 Ga0207687_10563588 3300025927 Bacteria 957
577 Ga0207644_10010084 3300025931 Bacteria 6222
578 Ga0207644_10020786 3300025931 Bacteria 4465
579 Ga0207644_10031885 3300025931 Bacteria 3675
580 Ga0207644_10039620 3300025931 Bacteria 3326
581 Ga0207644_10248176 3300025931 Bacteria 1419
582 Ga0207690_10147513 3300025932 Bacteria 1741
583 Ga0207706_10006980 3300025933 Bacteria 10440
584 Ga0207706_10017696 3300025933 Bacteria 6421
585 Ga0207686_10080424 3300025934 Bacteria 2124
586 Ga0207686_10104914 3300025934 Bacteria 1894
587 Ga0207686_10167181 3300025934 Bacteria 1547
588 Ga0207686_10402841 3300025934 Bacteria 1043
589 Ga0207686_10627384 3300025934 Bacteria 848
590 Ga0207709_10001937 3300025935 Bacteria 13608
591 Ga0207709_10002102 3300025935 Bacteria 12830
592 Ga0207709_10025447 3300025935 Bacteria 3389
593 Ga0207709_10047583 3300025935 Bacteria 2608
594 Ga0207709_10053433 3300025935 Bacteria 2486
595 Ga0207709_10343225 3300025935 Bacteria 1125
596 Ga0207709_10587663 3300025935 Bacteria 880
597 Ga0207670_10008093 3300025936 Bacteria 5915
598 Ga0207670_10197679 3300025936 Bacteria 1525
599 Ga0207669_10001517 3300025937 Bacteria 9895
600 Ga0207669_10013519 3300025937 Bacteria 4056
601 Ga0207669_10074307 3300025937 Bacteria 2149
602 Ga0207669_10138672 3300025937 Bacteria 1684
603 Ga0207704_10001175 3300025938 Bacteria 11675
604 Ga0207704_10055018 3300025938 Bacteria 2429
605 Ga0207704_10056013 3300025938 Bacteria 2413
606 Ga0207704_10207072 3300025938 Bacteria 1440
607 Ga0207704_10225534 3300025938 Bacteria 1390
608 Ga0207691_10000347 3300025940 Bacteria 46651
609 Ga0207691_10003219 3300025940 Bacteria 15925
610 Ga0207691_10061540 3300025940 Bacteria 3409
611 Ga0207691_10093373 3300025940 Bacteria 2694
612 Ga0207691_10170221 3300025940 Bacteria 1908
613 Ga0207691_10175507 3300025940 Bacteria 1874
614 Ga0207691_10564074 3300025940 Bacteria 965
615 Ga0207711_10004936 3300025941 Bacteria 11328
616 Ga0207711_10096742 3300025941 Bacteria 2606
617 Ga0207689_10002269 3300025942 Bacteria 18022
618 Ga0207689_10010698 3300025942 Bacteria 7893
619 Ga0207689_10293180 3300025942 Bacteria 1348
620 Ga0207661_10142452 3300025944 Bacteria 2064
621 Ga0207661_10895452 3300025944 Bacteria 817
622 Ga0207661_11124060 3300025944 Unclassified 723
623 Ga0207679_10013107 3300025945 Bacteria 5428
624 Ga0207679_10013127 3300025945 Bacteria 5425
625 Ga0207679_10271542 3300025945 Bacteria 1450
626 Ga0207667_10000078 3300025949 Bacteria 165061
627 Ga0207667_10185710 3300025949 Unclassified 2134
628 Ga0207667_10539441 3300025949 Bacteria 1180
629 Ga0207651_10000398 3300025960 Bacteria 18449
630 Ga0207651_10012112 3300025960 Bacteria 4862
631 Ga0207651_10022279 3300025960 Bacteria 3870
632 Ga0207712_10009709 3300025961 Bacteria 6099
633 Ga0207712_10015478 3300025961 Bacteria 4922
634 Ga0207668_10000809 3300025972 Bacteria 19171
635 Ga0207668_10042364 3300025972 Bacteria 3083
636 Ga0207668_10230808 3300025972 Bacteria 1492
637 Ga0207668_10287476 3300025972 Bacteria 1351
638 Ga0207668_10653087 3300025972 Bacteria 921
639 Ga0207640_10057156 3300025981 Bacteria 2565
640 Ga0207658_10002681 3300025986 Bacteria 12869
641 Ga0207658_10010019 3300025986 Bacteria 6439
642 Ga0207658_10035740 3300025986 Bacteria 3559
643 Ga0207658_10074759 3300025986 Bacteria 2575
644 Ga0207658_10380315 3300025986 Bacteria 1236
645 Ga0207677_10004451 3300026023 Bacteria 7523
646 Ga0207677_10008191 3300026023 Bacteria 5822
647 Ga0207677_10011928 3300026023 Bacteria 4974
648 Ga0207677_10031948 3300026023 Bacteria 3378
649 Ga0207677_10138338 3300026023 Bacteria 1860
650 Ga0207703_10002510 3300026035 Bacteria 15864
651 Ga0207703_10013182 3300026035 Bacteria 6439
652 Ga0207703_10800538 3300026035 Bacteria 900
653 Ga0207639_10053359 3300026041 Bacteria 3084
654 Ga0207639_10801366 3300026041 Bacteria 878
655 Ga0207678_10013862 3300026067 Bacteria 7082
656 Ga0207678_10083066 3300026067 Bacteria 2740
657 Ga0207678_10247629 3300026067 Bacteria 1526
658 Ga0207678_10786432 3300026067 Bacteria 840
659 Ga0207708_10013570 3300026075 Bacteria 6091
660 Ga0207708_10022713 3300026075 Bacteria 4737
661 Ga0207708_10083169 3300026075 Bacteria 2461
662 Ga0207708_10144528 3300026075 Bacteria 1868
663 Ga0207702_10311891 3300026078 Bacteria 1496
664 Ga0207702_10352657 3300026078 Bacteria 1408
665 Ga0207702_10760449 3300026078 Unclassified 957
666 Ga0207641_10017015 3300026088 Bacteria 5951
667 Ga0207641_10055684 3300026088 Bacteria 3358
668 Ga0207648_10001863 3300026089 Bacteria 23045
669 Ga0207648_10002881 3300026089 Bacteria 18214
670 Ga0207648_10007895 3300026089 Bacteria 10381
671 Ga0207648_10021442 3300026089 Bacteria 5807
672 Ga0207648_10047745 3300026089 Bacteria 3751
673 Ga0207648_10078374 3300026089 Bacteria 2882
674 Ga0207648_10179559 3300026089 Bacteria 1873
675 Ga0207676_10000082 3300026095 Bacteria 92500
676 Ga0207676_10050076 3300026095 Bacteria 3254
677 Ga0207676_11089170 3300026095 Bacteria 790
678 Ga0207674_10018126 3300026116 Bacteria 7660
679 Ga0207674_10048359 3300026116 Bacteria 4354
680 Ga0207674_10063779 3300026116 Bacteria 3718
681 Ga0207674_10144755 3300026116 Bacteria 2335
682 Ga0207674_10352299 3300026116 Bacteria 1423
683 Ga0207675_100000927 3300026118 Bacteria 29280
684 Ga0207675_100001409 3300026118 Bacteria 24039
685 Ga0207675_100309568 3300026118 Bacteria 1540
686 Ga0207675_100866912 3300026118 Bacteria 918
687 Ga0207675_100940636 3300026118 Bacteria 881
688 Ga0207683_10210587 3300026121 Bacteria 1769
689 Ga0207683_10214579 3300026121 Bacteria 1752
690 Ga0207683_10216547 3300026121 Bacteria 1744
691 Ga0207683_10242335 3300026121 Bacteria 1645
692 Ga0207683_10624846 3300026121 Bacteria 998
693 Ga0207683_10951444 3300026121 Bacteria 798
694 Ga0207698_10100486 3300026142 Bacteria 2396
695 Ga0207698_10255540 3300026142 Bacteria 1606
696 Ga0207698_10292253 3300026142 Bacteria 1513
697 Ga0207698_10353948 3300026142 Bacteria 1388
698 Ga0207698_10661934 3300026142 Bacteria 1035
699 Ga0207698_10688782 3300026142 Bacteria 1016
700 Ga0209282_1105991 3300027666 Bacteria 1437
701 Ga0209813_10122536 3300027866 Bacteria 906
702 Ga0207428_10041116 3300027907 Bacteria 3745
703 Ga0268266_10066894 3300028379 Bacteria 3109
704 Ga0268266_10244025 3300028379 Bacteria 1659
705 Ga0268266_10368331 3300028379 Bacteria 1353
706 Ga0268265_10093044 3300028380 Bacteria 2414
707 Ga0268265_10110441 3300028380 Bacteria 2243
708 Ga0268264_10002202 3300028381 Bacteria 17310
709 Ga0268264_10012690 3300028381 Bacteria 6936
710 Ga0268264_10041350 3300028381 Bacteria 3813
711 Ga0268264_10377324 3300028381 Bacteria 1357
712 Ga0268264_10762697 3300028381 Bacteria 964
713 Ga0307517_10004553 3300028786 Bacteria 21271
714 Ga0307517_10179854 3300028786 Bacteria 1368
715 Ga0307517_10413969 3300028786 Bacteria 709
716 Ga0307515_10000419 3300028794 Bacteria 102271
717 Ga0307515_10000425 3300028794 Bacteria 101790
718 Ga0307515_10000672 3300028794 Bacteria 78835
719 Ga0307515_10011668 3300028794 Bacteria 16643
720 Ga0307515_10023797 3300028794 Bacteria 10710
721 Ga0307515_10050319 3300028794 Bacteria 6244
722 Ga0307515_10083885 3300028794 Bacteria 4101
723 Ga0307515_10102188 3300028794 Bacteria 3451
724 Ga0307515_10126323 3300028794 Bacteria 2854
725 Ga0307515_10470527 3300028794 Bacteria 870
726 Ga0307512_10022817 3300030522 Bacteria 5609
727 Ga0307512_10023039 3300030522 Bacteria 5573
728 Ga0307512_10063478 3300030522 Bacteria 2823
729 Ga0307512_10124236 3300030522 Bacteria 1645
730 Ga0307512_10285754 3300030522 Bacteria 783
731 Ga0265316_10316812 3300031344 Unclassified 1134
732 Ga0307513_10001868 3300031456 Bacteria 29930
733 Ga0307513_10008367 3300031456 Bacteria 13248
734 Ga0307513_10077369 3300031456 Bacteria 3446
735 Ga0307513_10086955 3300031456 Bacteria 3202
736 Ga0307513_10090348 3300031456 Bacteria 3124
737 Ga0307513_10203853 3300031456 Bacteria 1815
738 Ga0307513_10323141 3300031456 Bacteria 1300
739 Ga0307513_10550424 3300031456 Bacteria 866
740 Ga0307509_10003708 3300031507 Bacteria 22858
741 Ga0307509_10004745 3300031507 Bacteria 19393
742 Ga0307509_10007851 3300031507 Bacteria 13797
743 Ga0307509_10038154 3300031507 Bacteria 5244
744 Ga0307509_10236325 3300031507 Bacteria 1625
745 Ga0307509_10332143 3300031507 Bacteria 1251
746 Ga0307509_10603647 3300031507 Bacteria 770
747 Ga0307408_100564043 3300031548 Bacteria 1006
748 Ga0307408_100947544 3300031548 Bacteria 790
749 Ga0307408_101100691 3300031548 Bacteria 737
750 Ga0307508_10000278 3300031616 Bacteria 62985
751 Ga0307508_10008282 3300031616 Bacteria 9624
752 Ga0307508_10016618 3300031616 Bacteria 6696
753 Ga0307508_10072891 3300031616 Bacteria 3009
754 Ga0307514_10001174 3300031649 Bacteria 35389
755 Ga0307514_10009496 3300031649 Bacteria 8170
756 Ga0307514_10096609 3300031649 Bacteria 2134
757 Ga0307514_10237904 3300031649 Bacteria 1095
758 Ga0265314_10178784 3300031711 Bacteria 1273
759 Ga0265314_10231927 3300031711 Bacteria 1070
760 Ga0307516_10000237 3300031730 Bacteria 70929
761 Ga0307516_10099481 3300031730 Bacteria 2725
762 Ga0307516_10344365 3300031730 Bacteria 1157
763 Ga0307405_10164268 3300031731 Bacteria 1576
764 Ga0307405_10254616 3300031731 Bacteria 1308
765 Ga0307413_10201349 3300031824 Bacteria 1438
766 Ga0307410_10087844 3300031852 Bacteria 2200
767 Ga0307406_10033320 3300031901 Bacteria 3153
768 Ga0307406_10123962 3300031901 Bacteria 1801
769 Ga0307406_10365334 3300031901 Bacteria 1133
770 Ga0307406_10442887 3300031901 Bacteria 1040
771 Ga0307406_10472442 3300031901 Bacteria 1011
772 Ga0307412_10034281 3300031911 Bacteria 3234
773 Ga0307412_10431217 3300031911 Bacteria 1081
774 Ga0307412_10692821 3300031911 Bacteria 874
775 Ga0307412_10714539 3300031911 Bacteria 861
776 Ga0307412_11382326 3300031911 Bacteria 636
777 Ga0307409_100028240 3300031995 Bacteria 3993
778 Ga0307409_100030037 3300031995 Bacteria 3899
779 Ga0307409_100566255 3300031995 Bacteria 1118
780 Ga0307416_100033297 3300032002 Bacteria 3905
781 Ga0307416_100106923 3300032002 Bacteria 2454
782 Ga0307416_100287504 3300032002 Unclassified 1625
783 Ga0307416_101019003 3300032002 Unclassified 931
784 Ga0307416_101020974 3300032002 Bacteria 930
785 Ga0307411_10057995 3300032005 Bacteria 2560
786 Ga0307411_11475033 3300032005 Bacteria 624
787 Ga0307415_100151750 3300032126 Bacteria 1784
788 Ga0307415_101284880 3300032126 Bacteria 693
789 Ga0307507_10104119 3300033179 Bacteria 2357
790 Ga0307510_10022805 3300033180 Bacteria 7262
791 Ga0307510_10173630 3300033180 Bacteria 1730
792 Ga0307510_10276625 3300033180 Bacteria 1151
793 Ga0373944_0067142 3300035089 Bacteria 1161
794 Ga0373944_0115874 3300035089 Bacteria 919
795 Ga0373939_0195590 3300035114 Bacteria 762
796 Ga0373945_0182128 3300035116 Bacteria 865
797 Ga0373943_0005469 3300035170 Bacteria 5718
798 Ga0373946_0021686 3300035171 Bacteria 2493
799 Ga0373946_0095441 3300035171 Bacteria 1325
800 Ga0373931_0495605 3300035691 Bacteria 787
801 Ga0373935_0115537 3300035692 Bacteria 1786
802 Ga0373935_0669197 3300035692 Bacteria 762
803 Ga0373927_0031372 3300035695 Bacteria 3464
804 Ga0373927_0040785 3300035695 Bacteria 3011
805 Ga0373947_0008740 3300035725 Bacteria 5824
806 Ga0373937_0047465 3300036401 Bacteria 3929
807 Ga0373937_0125469 3300036401 Bacteria 2394
808 Ga0373925_0004060 3300037068 Bacteria 11121
809 Ga0373925_0122348 3300037068 Bacteria 2021
810 Ga0373925_0193640 3300037068 Bacteria 1614
811 Ga0395898_0237105 3300037466 Bacteria 1740
812 Ga0395905_0005642 3300037471 Bacteria 12729
813 Ga0395905_0006264 3300037471 Bacteria 12008
814 Ga0395905_0115347 3300037471 Bacteria 2524
815 Ga0395905_0285411 3300037471 Bacteria 1537
816 Ga0395905_0489662 3300037471 Bacteria 1129
817 Ga0395901_0518233 3300038443 Bacteria 1212
818 Ga0436365_1402919 3300039437 Bacteria 1910
819 Ga0436361_0221167 3300039447 Bacteria 2159
820 Ga0436361_0644663 3300039447 Bacteria 3077
821 Ga0436363_1469836 3300039450 Bacteria 2615
822 Ga0439436_0000134 3300041404 Bacteria 16918
823 Ga0439436_0000962 3300041404 Bacteria 7953
824 Ga0439438_125193 3300041405 Bacteria 617
825 Ga0439439_0004760 3300041406 Bacteria 3073
826 Ga0439439_0038287 3300041406 Bacteria 1238
827 Ga0439447_031631 3300041407 Bacteria 1327
828 Ga0439461_0004034 3300041410 Bacteria 2437
829 Ga0439461_0024933 3300041410 Bacteria 1212
830 Ga0439466_0006068 3300041411 Bacteria 4600
831 Ga0439465_0000339 3300041413 Bacteria 13362
832 Ga0451791_0210227 3300041451 Bacteria 865
833 Ga0451793_0124799 3300041452 Bacteria 983
834 Ga0451800_0939557 3300041459 Bacteria 628
835 Ga0451853_1321958 3300041512 Bacteria 925
836 Ga0439431_0009901 3300041997 Bacteria 2157
837 Ga0439433_0000087 3300041999 Bacteria 12676
838 Ga0439441_021416 3300042001 Unclassified 1193
839 Ga0439442_001006 3300042002 Bacteria 5694
840 Ga0439445_0009738 3300042004 Bacteria 2267
841 Ga0439445_0018295 3300042004 Bacteria 1738
842 Ga0439432_000527 3300042006 Bacteria 14248
843 Ga0439432_036027 3300042006 Bacteria 1584
844 Ga0439449_0000385 3300042007 Bacteria 16338
845 Ga0439449_0004263 3300042007 Bacteria 5531
846 Ga0439449_0011605 3300042007 Bacteria 3313
847 Ga0439450_052174 3300042008 Bacteria 974
848 Ga0439452_002869 3300042010 Bacteria 6196
849 Ga0439455_0018540 3300042012 Bacteria 1632
850 Ga0439455_0089309 3300042012 Bacteria 844
851 Ga0439457_021681 3300042014 Bacteria 1424
852 Ga0439462_0001243 3300042015 Bacteria 5579
853 Ga0439462_0005291 3300042015 Bacteria 3178
854 Ga0450911_000225 3300042115 Bacteria 21810
855 Ga0450923_002780 3300042125 Bacteria 2560
856 Ga0450894_015107 3300042131 Bacteria 1021
857 Ga0450896_024752 3300042133 Bacteria 890
858 Ga0450898_015921 3300042134 Bacteria 1279
859 Ga0450898_025829 3300042134 Bacteria 1056
860 Ga0450898_028365 3300042134 Bacteria 1017
861 Ga0450905_009627 3300042142 Bacteria 1331
862 Ga0439446_0035330 3300042156 Bacteria 1457
863 Ga0439434_0003391 3300042435 Bacteria 4665
864 Ga0439434_0116530 3300042435 Bacteria 868
865 Ga0450918_040166 3300042531 Bacteria 838
866 Ga0451577_0068194 3300042876 Bacteria 3173
867 Ga0466960_0143879 3300044901 Bacteria 1268
868 Ga0495617_001251 3300046452 Bacteria 11401
869 Ga0495592_0000211 3300046454 Bacteria 49780
870 Ga0495603_0362366 3300046455 Bacteria 832
871 Ga0495590_0000092 3300046457 Bacteria 55212
872 Ga0495590_0001972 3300046457 Bacteria 8648
873 Ga0495590_0013034 3300046457 Bacteria 3065
874 Ga0495629_0032522 3300046459 Bacteria 3692
875 Ga0495629_0042748 3300046459 Bacteria 3184
876 Ga0495638_0015754 3300046460 Bacteria 5066
877 Ga0495638_0022034 3300046460 Bacteria 4187
878 Ga0495638_0074021 3300046460 Bacteria 2078
879 Ga0495638_0090658 3300046460 Bacteria 1842
880 Ga0495653_0380860 3300046463 Bacteria 901
881 Ga0495650_0008406 3300046471 Bacteria 6028
882 Ga0495650_0136472 3300046471 Bacteria 891
883 Ga0495580_0074019 3300046472 Bacteria 2378
884 Ga0495582_0085048 3300046473 Bacteria 1759
885 Ga0495582_0185706 3300046473 Bacteria 1185
886 Ga0495605_0039596 3300046474 Bacteria 2360
887 Ga0495605_0045936 3300046474 Bacteria 2149
888 Ga0495605_0133015 3300046474 Bacteria 1120
889 Ga0495605_0309183 3300046474 Bacteria 667
890 Ga0495639_0071706 3300046475 Bacteria 1600
891 Ga0495639_0106342 3300046475 Bacteria 1328
892 Ga0495639_0235238 3300046475 Bacteria 903
893 Ga0495584_0000300 3300046491 Bacteria 34910
894 Ga0495584_0296713 3300046491 Bacteria 821
895 Ga0495584_0489128 3300046491 Unclassified 627
896 Ga0495585_0018990 3300046492 Bacteria 3966
897 Ga0495585_0022023 3300046492 Bacteria 3658
898 Ga0495585_0053439 3300046492 Bacteria 2235
899 Ga0495594_0164175 3300046499 Bacteria 1263
900 Ga0495594_0472226 3300046499 Unclassified 713
901 Ga0495596_0006345 3300046500 Bacteria 5452
902 Ga0495596_0023058 3300046500 Bacteria 2528
903 Ga0495607_0000359 3300046501 Bacteria 47053
904 Ga0495607_0041673 3300046501 Bacteria 2725
905 Ga0495607_0071949 3300046501 Bacteria 1926
906 Ga0495607_0293988 3300046501 Bacteria 766
907 Ga0495583_0000067 3300046506 Bacteria 189381
908 Ga0495583_0000563 3300046506 Bacteria 51367
909 Ga0495583_0067301 3300046506 Bacteria 1583
910 Ga0495583_0167731 3300046506 Bacteria 903
911 Ga0495583_0168690 3300046506 Bacteria 900
912 Ga0495583_0375639 3300046506 Bacteria 559
913 Ga0495606_0002420 3300046507 Bacteria 21749
914 Ga0495606_0256544 3300046507 Bacteria 967
915 Ga0495606_0262079 3300046507 Bacteria 954
916 Ga0495610_0089206 3300046512 Bacteria 1400
917 Ga0495610_0298873 3300046512 Bacteria 621
918 Ga0495616_0000933 3300046513 Bacteria 21041
919 Ga0495616_0006364 3300046513 Bacteria 7157
920 Ga0495616_0040782 3300046513 Bacteria 2370
921 Ga0495618_0318948 3300046514 Bacteria 963
922 Ga0495620_0010656 3300046515 Bacteria 4840
923 Ga0495628_0124485 3300046516 Bacteria 1976
924 Ga0495628_0404365 3300046516 Bacteria 997
925 Ga0495631_0000176 3300046518 Bacteria 43388
926 Ga0495631_0050645 3300046518 Bacteria 1816
927 Ga0495632_0023431 3300046519 Bacteria 3297
928 Ga0495637_0003577 3300046520 Bacteria 8236
929 Ga0495637_0026699 3300046520 Bacteria 2589
930 Ga0495637_0232339 3300046520 Bacteria 668
931 Ga0495643_0009326 3300046522 Bacteria 6109
932 Ga0495643_0048890 3300046522 Bacteria 2283
933 Ga0495643_0121266 3300046522 Bacteria 1321
934 Ga0495644_0000501 3300046523 Bacteria 16743
935 Ga0495648_0000831 3300046524 Bacteria 32651
936 Ga0495648_0012948 3300046524 Bacteria 6194
937 Ga0495648_0026694 3300046524 Bacteria 3884
938 Ga0495648_0139802 3300046524 Bacteria 1276
939 Ga0495663_0065291 3300046525 Bacteria 1150
940 Ga0495642_0001270 3300046528 Bacteria 11421
941 Ga0495642_0092321 3300046528 Bacteria 1282
942 Ga0495642_0359572 3300046528 Bacteria 640
943 Ga0495654_0003149 3300046530 Bacteria 10235
944 Ga0495654_0003294 3300046530 Bacteria 9952
945 Ga0495654_0115443 3300046530 Bacteria 1221
946 Ga0495654_0211074 3300046530 Bacteria 826
947 Ga0495665_0103479 3300046531 Bacteria 1494
948 Ga0495640_0123366 3300046533 Bacteria 1682
949 Ga0495640_0240409 3300046533 Bacteria 1137
950 Ga0495609_0001479 3300046538 Bacteria 15589
951 Ga0495609_0036063 3300046538 Bacteria 2235
952 Ga0495609_0212485 3300046538 Bacteria 805
953 Ga0495621_0003592 3300046539 Bacteria 4282
954 Ga0495597_0005431 3300046542 Bacteria 6745
955 Ga0495597_0020388 3300046542 Bacteria 3089
956 Ga0495597_0039235 3300046542 Bacteria 2121
957 Ga0495597_0082577 3300046542 Bacteria 1372
958 Ga0495622_0000011 3300046557 Bacteria 201507
959 Ga0495622_0017968 3300046557 Bacteria 3294
960 Ga0495622_0062685 3300046557 Bacteria 1721
961 Ga0495633_0013261 3300046558 Bacteria 4350
962 Ga0495633_0015014 3300046558 Bacteria 4026
963 Ga0495656_0000055 3300046615 Bacteria 53908
964 Ga0495656_0001368 3300046615 Bacteria 7975
965 Ga0495656_0014289 3300046615 Bacteria 2974
966 Ga0495656_0029376 3300046615 Bacteria 2213
967 Ga0495656_0306741 3300046615 Bacteria 815
968 Ga0495668_0009680 3300046616 Bacteria 5893
969 Ga0495668_0014680 3300046616 Bacteria 4587
970 Ga0495668_0032416 3300046616 Bacteria 2940
971 Ga0495668_0049884 3300046616 Bacteria 2321
972 Ga0495668_0211190 3300046616 Bacteria 1063
973 Ga0495634_0268308 3300046642 Bacteria 1039
974 Ga0495611_0008860 3300046648 Bacteria 4254
975 Ga0495625_0000708 3300046660 Bacteria 47135
976 Ga0495625_0019127 3300046660 Bacteria 5326
977 Ga0495625_0019215 3300046660 Bacteria 5307
978 Ga0495625_0020257 3300046660 Bacteria 5139
979 Ga0495625_0056406 3300046660 Bacteria 2796
980 Ga0495625_0069863 3300046660 Bacteria 2467
981 Ga0495635_0102477 3300046663 Bacteria 1956
982 Ga0495635_0171602 3300046663 Bacteria 1475
983 Ga0495635_0320566 3300046663 Bacteria 1037
984 Ga0495659_0000193 3300046664 Bacteria 26723
985 Ga0495659_0048214 3300046664 Bacteria 1543
986 Ga0495661_0000755 3300046665 Bacteria 31313
987 Ga0495661_0000987 3300046665 Bacteria 25699
988 Ga0495661_0004847 3300046665 Bacteria 9638
989 Ga0495661_0185973 3300046665 Bacteria 1097
990 Ga0495661_0261924 3300046665 Bacteria 878
991 Ga0495661_0266886 3300046665 Bacteria 867
992 Ga0495661_0315951 3300046665 Bacteria 777
993 Ga0495588_0097954 3300046674 Bacteria 1539
994 Ga0495588_0368698 3300046674 Bacteria 754
995 Ga0495599_0297918 3300046678 Bacteria 974
996 Ga0495646_0259762 3300046680 Bacteria 928
997 Ga0495647_0037297 3300046681 Bacteria 1833
998 Ga0495647_0053062 3300046681 Bacteria 1580
999 Ga0495647_0159299 3300046681 Bacteria 972
1000 Ga0495647_0176505 3300046681 Bacteria 928
1001 Ga0495658_0015016 3300046683 Bacteria 3968
1002 Ga0495658_0070109 3300046683 Bacteria 2033
1003 Ga0495658_0081857 3300046683 Bacteria 1896
1004 Ga0495658_0354995 3300046683 Bacteria 932
1005 Ga0495613_0669775 3300046689 Bacteria 685
1006 Ga0495624_0073836 3300046690 Bacteria 2120
1007 Ga0495624_0084705 3300046690 Bacteria 1959
1008 Ga0495670_0005694 3300046691 Bacteria 6109
1009 Ga0495670_0005878 3300046691 Bacteria 6015
1010 Ga0495670_0105166 3300046691 Bacteria 1457
1011 Ga0495670_0401552 3300046691 Bacteria 740
1012 Ga0495671_0001321 3300046692 Bacteria 16827
1013 Ga0495671_0005250 3300046692 Bacteria 7605
1014 Ga0495671_0125520 3300046692 Bacteria 1251
1015 Ga0495671_0135871 3300046692 Bacteria 1199
1016 Ga0495671_0441055 3300046692 Bacteria 622
1017 Ga0495649_0001209 3300046694 Bacteria 19919
1018 Ga0495589_0020773 3300046794 Bacteria 3357
1019 Ga0495589_0069801 3300046794 Bacteria 1718
1020 Ga0495600_0032003 3300046809 Bacteria 3411
1021 Ga0495600_0425893 3300046809 Bacteria 823
1022 Ga0495600_0564390 3300046809 Bacteria 694
1023 Ga0495660_0004413 3300046810 Bacteria 8519
1024 Ga0495660_0015585 3300046810 Bacteria 4391
1025 Ga0495660_0046913 3300046810 Bacteria 2368
1026 Ga0495660_0057750 3300046810 Bacteria 2093
1027 Ga0495581_0205380 3300047315 Bacteria 1152
1028 Ga0495636_0000302 3300047318 Bacteria 19376
1029 Ga0495674_0152238 3300047319 Bacteria 1939
1030 Ga0495674_0466405 3300047319 Bacteria 1013
1031 Ga0495672_0003302 3300047320 Bacteria 13939
1032 Ga0495672_0150664 3300047320 Bacteria 1206
1033 Ga0495676_0061675 3300047321 Bacteria 2932
1034 Ga0495676_0109107 3300047321 Bacteria 2035
1035 Ga0495676_0236496 3300047321 Bacteria 1252
1036 Ga0495683_0068546 3300047323 Bacteria 1744
1037 Ga0495683_0181697 3300047323 Bacteria 960
1038 Ga0495687_000153 3300047443 Bacteria 105215
1039 Ga0495687_003793 3300047443 Bacteria 10667
1040 Ga0495687_008489 3300047443 Bacteria 5875
1041 Ga0495687_012212 3300047443 Bacteria 4556
1042 Ga0495677_0001414 3300047445 Bacteria 9642
1043 Ga0495677_0184931 3300047445 Bacteria 808
1044 Ga0495679_001633 3300047446 Bacteria 12492
1045 Ga0495685_000011 3300047447 Bacteria 83484
1046 Ga0495685_086382 3300047447 Bacteria 1042
1047 Ga0495685_176602 3300047447 Bacteria 689
1048 Ga0495673_0004503 3300047469 Bacteria 8702
1049 Ga0495681_0055933 3300047470 Bacteria 1838
1050 Ga0495684_0115155 3300047471 Bacteria 2027
1051 Ga0495684_0666773 3300047471 Bacteria 694
1052 Ga0495686_0001736 3300047472 Bacteria 22399
1053 Ga0495593_0017494 3300047673 Bacteria 4035
1054 Ga0495593_0090851 3300047673 Bacteria 1572
1055 Ga0495614_0081431 3300048089 Bacteria 1402
1056 Ga0495614_0082709 3300048089 Bacteria 1392
1057 Ga0495614_0452816 3300048089 Bacteria 607
1058 Ga0495615_0068733 3300048090 Bacteria 950
1059 Ga0495626_0000657 3300048091 Bacteria 33248
1060 Ga0495626_0000701 3300048091 Bacteria 31837
1061 Ga0495626_0009276 3300048091 Bacteria 5323
1062 Ga0495626_0022010 3300048091 Bacteria 3153
1063 Ga0495626_0198048 3300048091 Bacteria 825
1064 Ga0496100_0101842 3300048903 Bacteria 1980
1065 Ga0496101_0010546 3300048904 Bacteria 6103
1066 Ga0496102_0014578 3300048905 Bacteria 6831
1067 Ga0496102_0125873 3300048905 Bacteria 2395
1068 Ga0496103_0010336 3300048906 Bacteria 5523
1069 Ga0496104_0015327 3300048907 Bacteria 6941
1070 Ga0496104_1466667 3300048907 Bacteria 585
1071 Ga0496105_0002074 3300048908 Bacteria 14503
1072 Ga0496106_0024302 3300048909 Bacteria 4504
1073 Ga0496106_0894476 3300048909 Bacteria 701
1074 Ga0496107_0036652 3300048910 Bacteria 3518
1075 Ga0496108_0022182 3300048911 Bacteria 5220
1076 Ga0496110_0029223 3300048913 Bacteria 4741
1077 Ga0496111_0124593 3300048914 Bacteria 1904
1078 Ga0496113_0350757 3300048916 Bacteria 1184
1079 Ga0496113_0780584 3300048916 Unclassified 760
1080 Ga0496114_0069772 3300048917 Bacteria 2951
1081 Ga0496114_0485770 3300048917 Bacteria 1093
1082 Ga0496114_1502968 3300048917 Bacteria 561
1083 Ga0496116_0057954 3300048919 Bacteria 2528
1084 Ga0496116_0089477 3300048919 Bacteria 1877
1085 Ga0496117_0013969 3300048920 Bacteria 6958
1086 Ga0496117_0016300 3300048920 Bacteria 6278
1087 Ga0496117_0076287 3300048920 Bacteria 2223
1088 Ga0496118_0027766 3300048921 Bacteria 4781
1089 Ga0496118_0028081 3300048921 Bacteria 4747
1090 Ga0496121_0199642 3300048924 Bacteria 1426
1091 Ga0496121_0453743 3300048924 Bacteria 825
1092 Ga0496123_0103082 3300048926 Bacteria 1654
1093 Ga0496123_0127159 3300048926 Bacteria 1420
1094 Ga0496124_0300654 3300048927 Bacteria 1159
1095 Ga0496125_0027812 3300048928 Bacteria 5118
1096 Ga0496125_0438466 3300048928 Bacteria 752
1097 Ga0496126_0081296 3300048929 Bacteria 2865
1098 Ga0496126_0639021 3300048929 Bacteria 834
1099 Ga0495678_000367 3300049459 Bacteria 46226
1100 Ga0495678_008149 3300049459 Bacteria 5331
1101 Ga0495682_0000199 3300049460 Bacteria 48422
1102 Ga0495682_0001987 3300049460 Bacteria 10110
1103 Ga0495682_0109679 3300049460 Bacteria 989
1104 Ga0495682_0271472 3300049460 Bacteria 599
1105 Ga0501292_009487 3300049515 Bacteria 1445
1106 Ga0501292_022134 3300049515 Unclassified 1033
1107 Ga0501294_008077 3300049517 Bacteria 1022
1108 Ga0501298_002185 3300049521 Bacteria 2946
1109 Ga0501299_032863 3300049522 Bacteria 1009
1110 Ga0501032_0110228 3300049569 Bacteria 1822
1111 Ga0501041_0406562 3300049577 Bacteria 863
1112 Ga0501043_0000004 3300049579 Bacteria 291085
1113 Ga0501046_0000016 3300049580 Bacteria 234374
1114 Ga0501047_0000012 3300049581 Bacteria 368824
1115 Ga0501048_0000926 3300049582 Bacteria 21609
1116 Ga0501048_0791366 3300049582 Bacteria 681
1117 Ga0501071_0041686 3300049587 Plasmid 3288
1118 Ga0501071_0114982 3300049587 Bacteria 1991
1119 Ga0501071_1111199 3300049587 Archaea 611
1120 Ga0501199_013270 3300049650 Bacteria 906
1121 Ga0501206_002813 3300049653 Bacteria 2190
1122 Ga0501257_037872 3300049686 Bacteria 1177
1123 Ga0501259_058687 3300049688 Bacteria 799
1124 Ga0501081_0455501 3300049743 Bacteria 951
1125 Ga0501262_009881 3300049759 Bacteria 1186
1126 Ga0501273_006673 3300049770 Bacteria 1341
1127 Ga0501281_03099 3300049777 Bacteria 1191
1128 Ga0501045_0002191 3300049824 Bacteria 13251
1129 Ga0501045_0704258 3300049824 Unclassified 745
1130 nmdc:mga03683_107284_c1 3300050489 Bacteria 1232
1131 nmdc:mga03683_12530_c1 3300050489 Bacteria 3100
1132 nmdc:mga03683_37272_c1 3300050489 Bacteria 1981
1133 nmdc:mga03n38_19665_c1 3300050490 Bacteria 2687
1134 nmdc:mga03n38_62210_c1 3300050490 Bacteria 1702
1135 nmdc:mga00v17_152623_c1 3300050491 Bacteria 1484
1136 nmdc:mga00v17_2771_c1 3300050491 Bacteria 8996
1137 nmdc:mga00v17_344318_c1 3300050491 Bacteria 969
1138 nmdc:mga0yw44_119897_c1 3300050492 Bacteria 1693
1139 nmdc:mga0yw44_5627_c1 3300050492 Bacteria 5959
1140 nmdc:mga0k408_19767_c1 3300050493 Bacteria 3768
1141 nmdc:mga0k408_251645_c1 3300050493 Bacteria 1055
1142 nmdc:mga0k408_31050_c1 3300050493 Bacteria 3049
1143 nmdc:mga0k408_33051_c1 3300050493 Bacteria 2957
1144 nmdc:mga0k408_33349_c1 3300050493 Bacteria 2945
1145 nmdc:mga0k408_33984_c1 3300050493 Bacteria 2918
1146 nmdc:mga0k408_36165_c1 3300050493 Bacteria 2834
1147 nmdc:mga0k408_44858_c1 3300050493 Bacteria 2550
1148 nmdc:mga0k408_55074_c1 3300050493 Bacteria 2306
1149 nmdc:mga0k408_5871_c1 3300050493 Bacteria 6542
1150 nmdc:mga0k408_60655_c1 3300050493 Bacteria 2198
1151 nmdc:mga0k408_73875_c1 3300050493 Bacteria 1992
1152 nmdc:mga0k408_80835_c1 3300050493 Bacteria 1903
1153 nmdc:mga0k408_92205_c1 3300050493 Bacteria 1475
1154 nmdc:mga06z11_707678_c1 3300050494 Bacteria 614
1155 nmdc:mga04h51_150436_c1 3300050495 Bacteria 889
1156 nmdc:mga07m45_103848_c1 3300050496 Bacteria 1634
1157 nmdc:mga07m45_1144_c1 3300050496 Bacteria 11893
1158 nmdc:mga07m45_2026_c2 3300050496 Bacteria 4488
1159 nmdc:mga07m45_245524_c1 3300050496 Bacteria 1042
1160 nmdc:mga07m45_2594_c1 3300050496 Bacteria 8516
1161 nmdc:mga07m45_397680_c1 3300050496 Bacteria 800
1162 nmdc:mga07m45_607872_c1 3300050496 Bacteria 631
1163 nmdc:mga07m45_83596_c1 3300050496 Bacteria 1825
1164 nmdc:mga05p37_286583_c1 3300050507 Bacteria 1962
1165 nmdc:mga05p37_922713_c1 3300050507 Bacteria 938
1166 nmdc:mga09592_288559_c1 3300050508 Bacteria 1423
1167 nmdc:mga0qj67_520062_c1 3300050509 Unclassified 956
1168 nmdc:mga06r32_186776_c1 3300050510 Bacteria 2060
1169 nmdc:mga08y16_183385_c1 3300050511 Bacteria 2172
1170 nmdc:mga08y16_62434_c1 3300050511 Bacteria 3891
1171 nmdc:mga08y16_755306_c1 3300050511 Bacteria 968
1172 nmdc:mga0a205_191393_c1 3300050515 Bacteria 1938
1173 nmdc:mga0sz30_110451_c1 3300050516 Bacteria 1205
1174 nmdc:mga0sz30_230223_c1 3300050516 Bacteria 825
1175 nmdc:mga0sz30_34397_c1 3300050516 Bacteria 2109
1176 Ga0495601_0018255 3300053077 Bacteria 4267
1177 Ga0495612_0084174 3300053078 Bacteria 1339
1178 Ga0495612_0123928 3300053078 Bacteria 1113
1179 Ga0500610_0003534 3300053079 Bacteria 6027
1180 Ga0500610_0032538 3300053079 Bacteria 2655
1181 Ga0495619_0048380 3300053085 Bacteria 2802
1182 Ga0500643_008391 3300053087 Bacteria 4062
1183 Ga0500644_0007132 3300053088 Bacteria 2898
1184 Ga0500583_0049976 3300053092 Bacteria 1937
1185 Ga0500651_0000289 3300053093 Bacteria 29197
1186 Ga0500651_0135524 3300053093 Bacteria 1487
1187 Ga0500566_0078985 3300053094 Bacteria 1835
1188 Ga0500562_004272 3300053108 Bacteria 3615
1189 Ga0500562_020605 3300053108 Bacteria 1712
1190 Ga0500571_000089 3300053110 Bacteria 29120
1191 Ga0500572_076012 3300053111 Bacteria 1045
1192 Ga0500592_004261 3300053116 Bacteria 2284
1193 Ga0500594_0010549 3300053118 Bacteria 2147
1194 Ga0500607_000942 3300053121 Bacteria 27845
1195 Ga0500607_012041 3300053121 Bacteria 5094
1196 Ga0500608_011017 3300053122 Bacteria 3908
1197 Ga0500608_075230 3300053122 Bacteria 1601
1198 Ga0500618_027127 3300053125 Bacteria 1364
1199 Ga0500618_027711 3300053125 Bacteria 1346
1200 Ga0500628_060006 3300053129 Bacteria 927
1201 Ga0500658_0000137 3300053134 Bacteria 34691
1202 Ga0500658_0000140 3300053134 Bacteria 34349
1203 Ga0500658_0015270 3300053134 Bacteria 2849
1204 Ga0500559_0000166 3300053136 Bacteria 51944
1205 Ga0500564_057811 3300053138 Bacteria 1764
1206 Ga0500564_066507 3300053138 Bacteria 1630
1207 Ga0500568_0000735 3300053139 Bacteria 23510
1208 Ga0500568_0025308 3300053139 Bacteria 2505
1209 Ga0500574_019578 3300053141 Bacteria 1687
1210 Ga0500577_0079072 3300053142 Bacteria 1307
1211 Ga0500586_016719 3300053145 Bacteria 2232
1212 Ga0500589_010275 3300053147 Bacteria 3996
1213 Ga0500616_0079167 3300053153 Bacteria 1655
1214 Ga0500619_069489 3300053154 Bacteria 1169
1215 Ga0500627_0043809 3300053158 Bacteria 1931
1216 Ga0500634_0011590 3300053161 Bacteria 4557
1217 Ga0500634_0018046 3300053161 Bacteria 3784
1218 Ga0500638_046305 3300053162 Bacteria 2108
1219 Ga0500636_0044573 3300053177 Bacteria 2616
1220 Ga0500625_029427 3300053729 Bacteria 2608
1221 Ga0500587_002063 3300053739 Bacteria 2868
1222 Ga0501084_0280439 3300054114 Bacteria 1407
1223 Ga0590071_021025 3300059421 Bacteria 1537
1224 Ga0466962_0096217 3300061719 Bacteria 1420
1225 Ga0530510_0390804 3300061734 Unclassified 1048

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8047673197 8047673713 162
2 3300035691 Ga0373931_0495605 Ga0373931_0495605_263_754 163
3 3300046455 Ga0495603_0362366 Ga0495603_0362366_108_599 163
4 3300046499 Ga0495594_0472226 Ga0495594_0472226_106_597 163
5 3300046615 Ga0495656_0306741 Ga0495656_0306741_41_532 163
6 3300048916 Ga0496113_0780584 Ga0496113_0780584_236_727 163
7 3300048917 Ga0496114_1502968 Ga0496114_1502968_56_547 163
8 3300005327 Ga0070658_10682662 Ga0070658_106826622 164
9 3300005329 Ga0070683_100124461 Ga0070683_1001244613 164
10 3300005329 Ga0070683_100503711 Ga0070683_1005037112 164
11 3300005336 Ga0070680_100311391 Ga0070680_1003113912 164
12 3300005445 Ga0070708_100188876 Ga0070708_1001888762 164
13 3300005458 Ga0070681_10029856 Ga0070681_100298562 164
14 3300005458 Ga0070681_10631726 Ga0070681_106317261 164
15 3300005458 Ga0070681_10961264 Ga0070681_109612641 164
16 3300005530 Ga0070679_100183717 Ga0070679_1001837171 164
17 3300005535 Ga0070684_100026516 Ga0070684_1000265163 164
18 3300005539 Ga0068853_100009688 Ga0068853_1000096887 164
19 3300005545 Ga0070695_101196718 Ga0070695_1011967181 164
20 3300005563 Ga0068855_100164792 Ga0068855_1001647922 164
21 3300005577 Ga0068857_100006977 Ga0068857_1000069777 164
22 3300005614 Ga0068856_100123773 Ga0068856_1001237732 164
23 3300005614 Ga0068856_100198462 Ga0068856_1001984622 164
24 3300006237 Ga0097621_100007488 Ga0097621_1000074884 164
25 3300006358 Ga0068871_100003128 Ga0068871_10000312811 164
26 3300006881 Ga0068865_100003193 Ga0068865_10000319313 164
27 3300009093 Ga0105240_10876762 Ga0105240_108767622 164
28 3300009174 Ga0105241_10024541 Ga0105241_100245413 164
29 3300009174 Ga0105241_10076022 Ga0105241_100760223 164
30 3300009174 Ga0105241_10198017 Ga0105241_101980172 164
31 3300009176 Ga0105242_10005571 Ga0105242_100055716 164
32 3300009176 Ga0105242_10025391 Ga0105242_100253912 164
33 3300009177 Ga0105248_10315388 Ga0105248_103153882 164
34 3300009545 Ga0105237_10004017 Ga0105237_1000401714 164
35 3300009545 Ga0105237_10066362 Ga0105237_100663621 164
36 3300009551 Ga0105238_10017161 Ga0105238_100171616 164
37 3300009551 Ga0105238_10500661 Ga0105238_105006612 164
38 3300010375 Ga0105239_10016024 Ga0105239_100160243 164
39 3300010375 Ga0105239_10043988 Ga0105239_100439882 164
40 3300011119 Ga0105246_10069868 Ga0105246_100698683 164
41 3300013104 Ga0157370_10036164 Ga0157370_100361643 164
42 3300013105 Ga0157369_10345339 Ga0157369_103453392 164
43 3300013296 Ga0157374_10018835 Ga0157374_100188351 164
44 3300013297 Ga0157378_10012717 Ga0157378_100127176 164
45 3300013306 Ga0163162_11109334 Ga0163162_111093342 164
46 3300013307 Ga0157372_10239142 Ga0157372_102391422 164
47 3300013307 Ga0157372_10921368 Ga0157372_109213681 164
48 3300014325 Ga0163163_10018301 Ga0163163_100183014 164
49 3300014745 Ga0157377_11084443 Ga0157377_110844431 164
50 3300014969 Ga0157376_10029133 Ga0157376_100291333 164
51 3300025911 Ga0207654_10125138 Ga0207654_101251381 164
52 3300025911 Ga0207654_10299021 Ga0207654_102990212 164
53 3300025912 Ga0207707_10006936 Ga0207707_100069362 164
54 3300025913 Ga0207695_10665193 Ga0207695_106651931 164
55 3300025914 Ga0207671_10007085 Ga0207671_100070856 164
56 3300025914 Ga0207671_10995659 Ga0207671_109956591 164
57 3300025917 Ga0207660_10532301 Ga0207660_105323012 164
58 3300025920 Ga0207649_10266254 Ga0207649_102662542 164
59 3300025921 Ga0207652_10145045 Ga0207652_101450452 164
60 3300025924 Ga0207694_10000601 Ga0207694_100006019 164
61 3300025934 Ga0207686_10104914 Ga0207686_101049142 164
62 3300025938 Ga0207704_10055018 Ga0207704_100550183 164
63 3300025941 Ga0207711_10096742 Ga0207711_100967423 164
64 3300025944 Ga0207661_10895452 Ga0207661_108954521 164
65 3300025944 Ga0207661_11124060 Ga0207661_111240601 164
66 3300025945 Ga0207679_10013107 Ga0207679_100131073 164
67 3300025949 Ga0207667_10185710 Ga0207667_101857103 164
68 3300026023 Ga0207677_10004451 Ga0207677_1000445110 164
69 3300026078 Ga0207702_10311891 Ga0207702_103118912 164
70 3300026078 Ga0207702_10760449 Ga0207702_107604491 164
71 3300026089 Ga0207648_10047745 Ga0207648_100477452 164
72 3300026116 Ga0207674_10063779 Ga0207674_100637794 164
73 3300028379 Ga0268266_10066894 Ga0268266_100668943 164
74 3300031344 Ga0265316_10316812 Ga0265316_103168122 164
75 3300031711 Ga0265314_10178784 Ga0265314_101787842 164
76 3300003322 rootL2_10113471 rootL2_101134711 165
77 3300005434 Ga0070709_10041462 Ga0070709_100414621 165
78 3300005844 Ga0068862_100483613 Ga0068862_1004836132 165
79 3300013296 Ga0157374_10438862 Ga0157374_104388622 165
80 3300025906 Ga0207699_10035483 Ga0207699_100354832 165
81 3300035170 Ga0373943_0005469 Ga0373943_0005469_2480_2980 165
82 3300035171 Ga0373946_0021686 Ga0373946_0021686_157_657 165
83 3300035692 Ga0373935_0669197 Ga0373935_0669197_146_646 165
84 3300035695 Ga0373927_0040785 Ga0373927_0040785_661_1161 165
85 3300035725 Ga0373947_0008740 Ga0373947_0008740_1443_1943 165
86 3300037068 Ga0373925_0004060 Ga0373925_0004060_7025_7525 165
87 3300042001 Ga0439441_021416 Ga0439441_021416_577_1089 165
88 3300046472 Ga0495580_0074019 Ga0495580_0074019_846_1346 165
89 3300046473 Ga0495582_0085048 Ga0495582_0085048_391_891 165
90 3300046499 Ga0495594_0164175 Ga0495594_0164175_141_641 165
91 3300046514 Ga0495618_0318948 Ga0495618_0318948_127_627 165
92 3300046531 Ga0495665_0103479 Ga0495665_0103479_10_510 165
93 3300046663 Ga0495635_0320566 Ga0495635_0320566_227_727 165
94 3300046683 Ga0495658_0015016 Ga0495658_0015016_2755_3255 165
95 3300047319 Ga0495674_0152238 Ga0495674_0152238_94_594 165
96 3300048089 Ga0495614_0082709 Ga0495614_0082709_717_1217 165
97 3300053078 Ga0495612_0084174 Ga0495612_0084174_11_511 165
98 iso_pu_bacteria 2643221660 2644338858 165
99 iso_pu_bacteria 2643221683 2644465032 165
100 iso_pu_bacteria 2904449895 2904456480 165
101 iso_pu_bacteria 2904456579 2904461462 165
102 iso_pu_bacteria 2929520902 2929522996 165
103 3300003373 JGI25407J50210_10071250 JGI25407J50210_100712502 166
104 3300005327 Ga0070658_10057194 Ga0070658_100571944 166
105 3300005353 Ga0070669_101122731 Ga0070669_1011227311 166
106 3300005440 Ga0070705_100187047 Ga0070705_1001870472 166
107 3300005445 Ga0070708_100033241 Ga0070708_1000332414 166
108 3300005445 Ga0070708_100197772 Ga0070708_1001977722 166
109 3300005445 Ga0070708_100373113 Ga0070708_1003731131 166
110 3300005445 Ga0070708_100551649 Ga0070708_1005516492 166
111 3300005536 Ga0070697_100010956 Ga0070697_1000109566 166
112 3300005563 Ga0068855_100000166 Ga0068855_10000016638 166
113 3300006844 Ga0075428_100004497 Ga0075428_1000044977 166
114 3300006846 Ga0075430_100019067 Ga0075430_1000190676 166
115 3300006847 Ga0075431_100308981 Ga0075431_1003089812 166
116 3300006847 Ga0075431_100604847 Ga0075431_1006048472 166
117 3300006880 Ga0075429_100264976 Ga0075429_1002649762 166
118 3300009093 Ga0105240_10000470 Ga0105240_1000047020 166
119 3300009147 Ga0114129_10008968 Ga0114129_100089685 166
120 3300009551 Ga0105238_10000294 Ga0105238_100002949 166
121 3300010375 Ga0105239_10420815 Ga0105239_104208151 166
122 3300014326 Ga0157380_10117607 Ga0157380_101176073 166
123 3300025910 Ga0207684_10536269 Ga0207684_105362692 166
124 3300025913 Ga0207695_10005377 Ga0207695_1000537710 166
125 3300025923 Ga0207681_10185542 Ga0207681_101855423 166
126 3300025924 Ga0207694_10000920 Ga0207694_1000092019 166
127 3300025949 Ga0207667_10000078 Ga0207667_1000007894 166
128 3300031731 Ga0307405_10254616 Ga0307405_102546161 166
129 3300031901 Ga0307406_10033320 Ga0307406_100333202 166
130 3300031911 Ga0307412_10692821 Ga0307412_106928212 166
131 3300031995 Ga0307409_100028240 Ga0307409_1000282401 166
132 3300031995 Ga0307409_100030037 Ga0307409_1000300372 166
133 3300032002 Ga0307416_100106923 Ga0307416_1001069232 166
134 3300032002 Ga0307416_100287504 Ga0307416_1002875041 166
135 3300032126 Ga0307415_100151750 Ga0307415_1001517502 166
136 3300038443 Ga0395901_0518233 Ga0395901_0518233_396_896 166
137 3300042008 Ga0439450_052174 Ga0439450_052174_161_721 166
138 3300046457 Ga0495590_0000092 Ga0495590_0000092_18663_19163 166
139 3300046457 Ga0495590_0001972 Ga0495590_0001972_3959_4459 166
140 3300046460 Ga0495638_0015754 Ga0495638_0015754_3190_3690 166
141 3300046474 Ga0495605_0133015 Ga0495605_0133015_156_656 166
142 3300046474 Ga0495605_0309183 Ga0495605_0309183_156_656 166
143 3300046491 Ga0495584_0296713 Ga0495584_0296713_138_638 166
144 3300046491 Ga0495584_0489128 Ga0495584_0489128_45_590 166
145 3300046500 Ga0495596_0006345 Ga0495596_0006345_489_989 166
146 3300046500 Ga0495596_0023058 Ga0495596_0023058_1575_2075 166
147 3300046501 Ga0495607_0000359 Ga0495607_0000359_33173_33673 166
148 3300046501 Ga0495607_0071949 Ga0495607_0071949_1298_1798 166
149 3300046501 Ga0495607_0293988 Ga0495607_0293988_137_637 166
150 3300046506 Ga0495583_0167731 Ga0495583_0167731_391_891 166
151 3300046507 Ga0495606_0256544 Ga0495606_0256544_404_904 166
152 3300046513 Ga0495616_0040782 Ga0495616_0040782_1498_1998 166
153 3300046518 Ga0495631_0050645 Ga0495631_0050645_93_593 166
154 3300046520 Ga0495637_0232339 Ga0495637_0232339_155_655 166
155 3300046522 Ga0495643_0009326 Ga0495643_0009326_155_655 166
156 3300046522 Ga0495643_0048890 Ga0495643_0048890_1461_1961 166
157 3300046524 Ga0495648_0012948 Ga0495648_0012948_3186_3686 166
158 3300046524 Ga0495648_0026694 Ga0495648_0026694_568_1068 166
159 3300046528 Ga0495642_0001270 Ga0495642_0001270_7162_7662 166
160 3300046530 Ga0495654_0003149 Ga0495654_0003149_2349_2849 166
161 3300046538 Ga0495609_0036063 Ga0495609_0036063_1139_1639 166
162 3300046542 Ga0495597_0005431 Ga0495597_0005431_5859_6359 166
163 3300046542 Ga0495597_0020388 Ga0495597_0020388_2042_2542 166
164 3300046542 Ga0495597_0082577 Ga0495597_0082577_119_619 166
165 3300046557 Ga0495622_0000011 Ga0495622_0000011_39244_39744 166
166 3300046616 Ga0495668_0014680 Ga0495668_0014680_3504_4004 166
167 3300046616 Ga0495668_0032416 Ga0495668_0032416_167_667 166
168 3300046665 Ga0495661_0000987 Ga0495661_0000987_11323_11823 166
169 3300046665 Ga0495661_0004847 Ga0495661_0004847_6856_7356 166
170 3300046665 Ga0495661_0185973 Ga0495661_0185973_442_942 166
171 3300046665 Ga0495661_0266886 Ga0495661_0266886_108_608 166
172 3300046665 Ga0495661_0315951 Ga0495661_0315951_17_517 166
173 3300046692 Ga0495671_0005250 Ga0495671_0005250_5273_5773 166
174 3300046794 Ga0495589_0069801 Ga0495589_0069801_1025_1525 166
175 3300046810 Ga0495660_0015585 Ga0495660_0015585_3233_3733 166
176 3300046810 Ga0495660_0057750 Ga0495660_0057750_449_949 166
177 3300047443 Ga0495687_008489 Ga0495687_008489_2000_2500 166
178 3300047446 Ga0495679_001633 Ga0495679_001633_4391_4891 166
179 3300047447 Ga0495685_176602 Ga0495685_176602_60_560 166
180 3300048091 Ga0495626_0000657 Ga0495626_0000657_7857_8357 166
181 3300048091 Ga0495626_0000701 Ga0495626_0000701_10598_11098 166
182 3300048091 Ga0495626_0009276 Ga0495626_0009276_3702_4202 166
183 3300049459 Ga0495678_000367 Ga0495678_000367_37337_37837 166
184 3300049515 Ga0501292_022134 Ga0501292_022134_232_747 166
185 3300049587 Ga0501071_1111199 Ga0501071_1111199_57_590 166
186 3300050507 nmdc:mga05p37_286583_c1 nmdc:mga05p37_286583_c1_1445_1945 166
187 3300050508 nmdc:mga09592_288559_c1 nmdc:mga09592_288559_c1_675_1175 166
188 3300050510 nmdc:mga06r32_186776_c1 nmdc:mga06r32_186776_c1_409_909 166
189 3300059421 Ga0590071_021025 Ga0590071_021025_156_716 166
190 3300061719 Ga0466962_0096217 Ga0466962_0096217_93_593 166
191 iso_pu_bacteria 2513020051 2513230589 166
192 iso_pu_bacteria 2643221658 2644328564 166
193 iso_pu_bacteria 2643221672 2644399804 166
194 iso_pu_bacteria 2738541277 2738721379 166
195 iso_pu_bacteria 2738543013 2739249625 166
196 iso_pu_bacteria 2738543019 2739281048 166
197 iso_pu_bacteria 2885192300 2885195012 166
198 3300003322 rootL2_10020422 rootL2_100204225 167
199 3300005295 Ga0065707_10101401 Ga0065707_101014012 167
200 3300005338 Ga0068868_100964320 Ga0068868_1009643202 167
201 3300005338 Ga0068868_101602450 Ga0068868_1016024501 167
202 3300005354 Ga0070675_100488535 Ga0070675_1004885351 167
203 3300005355 Ga0070671_101205393 Ga0070671_1012053931 167
204 3300005356 Ga0070674_100388003 Ga0070674_1003880031 167
205 3300005441 Ga0070700_100766040 Ga0070700_1007660401 167
206 3300005455 Ga0070663_100185389 Ga0070663_1001853891 167
207 3300005455 Ga0070663_101674885 Ga0070663_1016748851 167
208 3300005456 Ga0070678_100178927 Ga0070678_1001789271 167
209 3300005456 Ga0070678_101275078 Ga0070678_1012750782 167
210 3300005466 Ga0070685_10514457 Ga0070685_105144571 167
211 3300005543 Ga0070672_100220183 Ga0070672_1002201832 167
212 3300005564 Ga0070664_100241622 Ga0070664_1002416222 167
213 3300005614 Ga0068856_100649653 Ga0068856_1006496531 167
214 3300005616 Ga0068852_102122197 Ga0068852_1021221971 167
215 3300005617 Ga0068859_100338867 Ga0068859_1003388672 167
216 3300005842 Ga0068858_100488267 Ga0068858_1004882672 167
217 3300006881 Ga0068865_100204342 Ga0068865_1002043422 167
218 3300006931 Ga0097620_100338915 Ga0097620_1003389152 167
219 3300009036 Ga0105244_10017711 Ga0105244_100177114 167
220 3300009098 Ga0105245_10012561 Ga0105245_100125618 167
221 3300009098 Ga0105245_10436021 Ga0105245_104360212 167
222 3300009098 Ga0105245_10987911 Ga0105245_109879111 167
223 3300009174 Ga0105241_10228970 Ga0105241_102289702 167
224 3300009176 Ga0105242_10295810 Ga0105242_102958102 167
225 3300009176 Ga0105242_10356237 Ga0105242_103562372 167
226 3300009545 Ga0105237_10189785 Ga0105237_101897852 167
227 3300009551 Ga0105238_10848515 Ga0105238_108485151 167
228 3300010375 Ga0105239_10317522 Ga0105239_103175221 167
229 3300013296 Ga0157374_10223789 Ga0157374_102237892 167
230 3300013306 Ga0163162_10261827 Ga0163162_102618272 167
231 3300013306 Ga0163162_11322846 Ga0163162_113228461 167
232 3300013308 Ga0157375_11135788 Ga0157375_111357882 167
233 3300014969 Ga0157376_10940849 Ga0157376_109408491 167
234 3300025728 Ga0207655_1067730 Ga0207655_10677302 167
235 3300025903 Ga0207680_10338048 Ga0207680_103380481 167
236 3300025914 Ga0207671_10294875 Ga0207671_102948752 167
237 3300025923 Ga0207681_10904756 Ga0207681_109047562 167
238 3300025926 Ga0207659_10753015 Ga0207659_107530151 167
239 3300025927 Ga0207687_10547425 Ga0207687_105474251 167
240 3300025937 Ga0207669_10074307 Ga0207669_100743072 167
241 3300025940 Ga0207691_10564074 Ga0207691_105640741 167
242 3300026041 Ga0207639_10801366 Ga0207639_108013661 167
243 3300026067 Ga0207678_10247629 Ga0207678_102476291 167
244 3300026075 Ga0207708_10083169 Ga0207708_100831693 167
245 3300026078 Ga0207702_10352657 Ga0207702_103526572 167
246 3300026118 Ga0207675_100940636 Ga0207675_1009406361 167
247 3300026121 Ga0207683_10242335 Ga0207683_102423351 167
248 3300028794 Ga0307515_10011668 Ga0307515_1001166816 167
249 3300030522 Ga0307512_10022817 Ga0307512_100228176 167
250 3300030522 Ga0307512_10023039 Ga0307512_100230392 167
251 3300031507 Ga0307509_10236325 Ga0307509_102363252 167
252 3300031616 Ga0307508_10000278 Ga0307508_1000027862 167
253 3300031649 Ga0307514_10009496 Ga0307514_100094963 167
254 3300031901 Ga0307406_10365334 Ga0307406_103653342 167
255 3300033179 Ga0307507_10104119 Ga0307507_101041192 167
256 3300035089 Ga0373944_0067142 Ga0373944_0067142_136_639 167
257 3300035116 Ga0373945_0182128 Ga0373945_0182128_176_679 167
258 3300035695 Ga0373927_0031372 Ga0373927_0031372_1551_2054 167
259 3300037471 Ga0395905_0005642 Ga0395905_0005642_3841_4344 167
260 3300046475 Ga0495639_0106342 Ga0495639_0106342_371_874 167
261 3300046665 Ga0495661_0000755 Ga0495661_0000755_10422_10925 167
262 3300046681 Ga0495647_0053062 Ga0495647_0053062_727_1230 167
263 3300050511 nmdc:mga08y16_183385_c1 nmdc:mga08y16_183385_c1_1516_2112 167
264 iso_pu_bacteria 2904541872 2904545375 167
265 3300005328 Ga0070676_10048770 Ga0070676_100487703 168
266 3300005329 Ga0070683_100179924 Ga0070683_1001799242 168
267 3300005330 Ga0070690_100300565 Ga0070690_1003005652 168
268 3300005334 Ga0068869_100066156 Ga0068869_1000661563 168
269 3300005347 Ga0070668_100122730 Ga0070668_1001227301 168
270 3300005353 Ga0070669_100250334 Ga0070669_1002503341 168
271 3300005355 Ga0070671_100073564 Ga0070671_1000735642 168
272 3300005356 Ga0070674_100104587 Ga0070674_1001045871 168
273 3300005356 Ga0070674_100775468 Ga0070674_1007754681 168
274 3300005436 Ga0070713_100079415 Ga0070713_1000794153 168
275 3300005437 Ga0070710_11181176 Ga0070710_111811761 168
276 3300005441 Ga0070700_100046369 Ga0070700_1000463691 168
277 3300005456 Ga0070678_100282242 Ga0070678_1002822422 168
278 3300005459 Ga0068867_100032411 Ga0068867_1000324113 168
279 3300005459 Ga0068867_100843491 Ga0068867_1008434912 168
280 3300005539 Ga0068853_100509540 Ga0068853_1005095402 168
281 3300005543 Ga0070672_100383809 Ga0070672_1003838091 168
282 3300005615 Ga0070702_101158956 Ga0070702_1011589561 168
283 3300005616 Ga0068852_101004876 Ga0068852_1010048761 168
284 3300005617 Ga0068859_100252906 Ga0068859_1002529062 168
285 3300005618 Ga0068864_100735631 Ga0068864_1007356312 168
286 3300005718 Ga0068866_10064676 Ga0068866_100646762 168
287 3300005719 Ga0068861_100006063 Ga0068861_1000060631 168
288 3300005842 Ga0068858_100058676 Ga0068858_1000586762 168
289 3300005843 Ga0068860_100008901 Ga0068860_1000089012 168
290 3300005843 Ga0068860_100184807 Ga0068860_1001848072 168
291 3300005844 Ga0068862_100087624 Ga0068862_1000876243 168
292 3300005844 Ga0068862_101026749 Ga0068862_1010267492 168
293 3300006177 Ga0075362_10026331 Ga0075362_100263313 168
294 3300006178 Ga0075367_10173445 Ga0075367_101734452 168
295 3300006178 Ga0075367_10371852 Ga0075367_103718521 168
296 3300006195 Ga0075366_10015968 Ga0075366_100159683 168
297 3300006195 Ga0075366_10153377 Ga0075366_101533771 168
298 3300006881 Ga0068865_100005535 Ga0068865_1000055354 168
299 3300006931 Ga0097620_100252899 Ga0097620_1002528992 168
300 3300009148 Ga0105243_10214642 Ga0105243_102146422 168
301 3300009553 Ga0105249_10010948 Ga0105249_100109487 168
302 3300013297 Ga0157378_10025572 Ga0157378_100255724 168
303 3300013306 Ga0163162_10049343 Ga0163162_100493433 168
304 3300013308 Ga0157375_10111508 Ga0157375_101115082 168
305 3300014326 Ga0157380_10009763 Ga0157380_100097634 168
306 3300014968 Ga0157379_10047612 Ga0157379_100476123 168
307 3300014968 Ga0157379_10160691 Ga0157379_101606912 168
308 3300014969 Ga0157376_10266833 Ga0157376_102668332 168
309 3300017792 Ga0163161_10121160 Ga0163161_101211602 168
310 3300025899 Ga0207642_10375526 Ga0207642_103755262 168
311 3300025934 Ga0207686_10402841 Ga0207686_104028411 168
312 3300025935 Ga0207709_10053433 Ga0207709_100534334 168
313 3300025935 Ga0207709_10343225 Ga0207709_103432252 168
314 3300025937 Ga0207669_10138672 Ga0207669_101386722 168
315 3300025940 Ga0207691_10061540 Ga0207691_100615402 168
316 3300025942 Ga0207689_10293180 Ga0207689_102931802 168
317 3300025944 Ga0207661_10142452 Ga0207661_101424522 168
318 3300025961 Ga0207712_10015478 Ga0207712_100154783 168
319 3300025972 Ga0207668_10230808 Ga0207668_102308081 168
320 3300026035 Ga0207703_10800538 Ga0207703_108005382 168
321 3300026075 Ga0207708_10022713 Ga0207708_100227132 168
322 3300026089 Ga0207648_10001863 Ga0207648_1000186322 168
323 3300026118 Ga0207675_100001409 Ga0207675_10000140924 168
324 3300026118 Ga0207675_100309568 Ga0207675_1003095682 168
325 3300026121 Ga0207683_10951444 Ga0207683_109514441 168
326 3300026142 Ga0207698_10353948 Ga0207698_103539482 168
327 3300028381 Ga0268264_10012690 Ga0268264_100126907 168
328 3300028381 Ga0268264_10762697 Ga0268264_107626972 168
329 3300031901 Ga0307406_10472442 Ga0307406_104724422 168
330 3300032005 Ga0307411_11475033 Ga0307411_114750331 168
331 3300032126 Ga0307415_101284880 Ga0307415_1012848801 168
332 3300042133 Ga0450896_024752 Ga0450896_024752_118_624 168
333 3300042134 Ga0450898_028365 Ga0450898_028365_457_963 168
334 3300046452 Ga0495617_001251 Ga0495617_001251_10744_11250 168
335 3300046460 Ga0495638_0090658 Ga0495638_0090658_20_526 168
336 3300046471 Ga0495650_0136472 Ga0495650_0136472_133_639 168
337 3300046474 Ga0495605_0045936 Ga0495605_0045936_147_653 168
338 3300046491 Ga0495584_0000300 Ga0495584_0000300_25039_25545 168
339 3300046492 Ga0495585_0018990 Ga0495585_0018990_412_918 168
340 3300046492 Ga0495585_0022023 Ga0495585_0022023_3017_3523 168
341 3300046492 Ga0495585_0053439 Ga0495585_0053439_732_1238 168
342 3300046501 Ga0495607_0041673 Ga0495607_0041673_1902_2408 168
343 3300046506 Ga0495583_0000067 Ga0495583_0000067_14864_15370 168
344 3300046506 Ga0495583_0000563 Ga0495583_0000563_2779_3285 168
345 3300046506 Ga0495583_0375639 Ga0495583_0375639_28_534 168
346 3300046513 Ga0495616_0006364 Ga0495616_0006364_5407_5913 168
347 3300046522 Ga0495643_0121266 Ga0495643_0121266_132_644 168
348 3300046523 Ga0495644_0000501 Ga0495644_0000501_10777_11283 168
349 3300046524 Ga0495648_0000831 Ga0495648_0000831_14734_15240 168
350 3300046530 Ga0495654_0115443 Ga0495654_0115443_192_698 168
351 3300046538 Ga0495609_0001479 Ga0495609_0001479_220_726 168
352 3300046538 Ga0495609_0212485 Ga0495609_0212485_80_586 168
353 3300046542 Ga0495597_0039235 Ga0495597_0039235_1155_1667 168
354 3300046557 Ga0495622_0062685 Ga0495622_0062685_519_1025 168
355 3300046558 Ga0495633_0013261 Ga0495633_0013261_3264_3770 168
356 3300046558 Ga0495633_0015014 Ga0495633_0015014_1545_2051 168
357 3300046615 Ga0495656_0001368 Ga0495656_0001368_162_668 168
358 3300046615 Ga0495656_0014289 Ga0495656_0014289_1433_1939 168
359 3300046648 Ga0495611_0008860 Ga0495611_0008860_2836_3342 168
360 3300046660 Ga0495625_0019127 Ga0495625_0019127_3386_3892 168
361 3300046664 Ga0495659_0000193 Ga0495659_0000193_9773_10279 168
362 3300046691 Ga0495670_0005694 Ga0495670_0005694_722_1228 168
363 3300046691 Ga0495670_0005878 Ga0495670_0005878_5472_5978 168
364 3300046692 Ga0495671_0125520 Ga0495671_0125520_60_566 168
365 3300046692 Ga0495671_0441055 Ga0495671_0441055_89_595 168
366 3300047318 Ga0495636_0000302 Ga0495636_0000302_17555_18061 168
367 3300047320 Ga0495672_0003302 Ga0495672_0003302_849_1355 168
368 3300047320 Ga0495672_0150664 Ga0495672_0150664_255_761 168
369 3300047323 Ga0495683_0068546 Ga0495683_0068546_48_554 168
370 3300047443 Ga0495687_000153 Ga0495687_000153_49939_50451 168
371 3300047443 Ga0495687_003793 Ga0495687_003793_6732_7238 168
372 3300047445 Ga0495677_0001414 Ga0495677_0001414_8576_9082 168
373 3300047447 Ga0495685_000011 Ga0495685_000011_51089_51595 168
374 3300047469 Ga0495673_0004503 Ga0495673_0004503_6937_7443 168
375 3300048091 Ga0495626_0198048 Ga0495626_0198048_156_668 168
376 3300049459 Ga0495678_008149 Ga0495678_008149_4806_5312 168
377 3300049460 Ga0495682_0000199 Ga0495682_0000199_22491_22997 168
378 3300049460 Ga0495682_0001987 Ga0495682_0001987_86_592 168
379 3300050493 nmdc:mga0k408_5871_c1 nmdc:mga0k408_5871_c1_3362_3868 168
380 3300050494 nmdc:mga06z11_707678_c1 nmdc:mga06z11_707678_c1_59_598 168
381 3300050507 nmdc:mga05p37_922713_c1 nmdc:mga05p37_922713_c1_403_912 168
382 iso_pu_bacteria 2929160207 2929165565 168
383 3300003781 Ga0055536_1013599 Ga0055536_10135992 169
384 3300003792 Ga0055540_1002229 Ga0055540_100222913 169
385 3300003792 Ga0055540_1005977 Ga0055540_10059772 169
386 3300003792 Ga0055540_1007891 Ga0055540_10078913 169
387 3300005288 Ga0065714_10104460 Ga0065714_101044602 169
388 3300005288 Ga0065714_10204003 Ga0065714_102040031 169
389 3300005289 Ga0065704_10081990 Ga0065704_100819904 169
390 3300005290 Ga0065712_10316088 Ga0065712_103160881 169
391 3300005327 Ga0070658_10382387 Ga0070658_103823872 169
392 3300005328 Ga0070676_10002959 Ga0070676_100029594 169
393 3300005328 Ga0070676_10003006 Ga0070676_100030066 169
394 3300005328 Ga0070676_10009607 Ga0070676_100096074 169
395 3300005328 Ga0070676_10115300 Ga0070676_101153002 169
396 3300005330 Ga0070690_100176086 Ga0070690_1001760862 169
397 3300005331 Ga0070670_100011371 Ga0070670_1000113715 169
398 3300005331 Ga0070670_100158075 Ga0070670_1001580752 169
399 3300005331 Ga0070670_100166921 Ga0070670_1001669212 169
400 3300005331 Ga0070670_100254958 Ga0070670_1002549582 169
401 3300005333 Ga0070677_10265891 Ga0070677_102658911 169
402 3300005334 Ga0068869_100004690 Ga0068869_1000046901 169
403 3300005334 Ga0068869_100014419 Ga0068869_1000144194 169
404 3300005334 Ga0068869_101290440 Ga0068869_1012904401 169
405 3300005335 Ga0070666_10002130 Ga0070666_100021303 169
406 3300005335 Ga0070666_10242878 Ga0070666_102428781 169
407 3300005335 Ga0070666_10582288 Ga0070666_105822881 169
408 3300005338 Ga0068868_100051509 Ga0068868_1000515094 169
409 3300005338 Ga0068868_100054986 Ga0068868_1000549864 169
410 3300005338 Ga0068868_100155069 Ga0068868_1001550691 169
411 3300005340 Ga0070689_100014421 Ga0070689_1000144212 169
412 3300005343 Ga0070687_100118412 Ga0070687_1001184122 169
413 3300005347 Ga0070668_100010950 Ga0070668_1000109502 169
414 3300005347 Ga0070668_100256205 Ga0070668_1002562052 169
415 3300005347 Ga0070668_100574926 Ga0070668_1005749262 169
416 3300005353 Ga0070669_100568517 Ga0070669_1005685171 169
417 3300005353 Ga0070669_100947023 Ga0070669_1009470231 169
418 3300005354 Ga0070675_100008998 Ga0070675_1000089984 169
419 3300005354 Ga0070675_100278711 Ga0070675_1002787112 169
420 3300005355 Ga0070671_100001982 Ga0070671_1000019827 169
421 3300005355 Ga0070671_100049526 Ga0070671_1000495262 169
422 3300005355 Ga0070671_100199979 Ga0070671_1001999791 169
423 3300005355 Ga0070671_100283273 Ga0070671_1002832732 169
424 3300005356 Ga0070674_100031734 Ga0070674_1000317342 169
425 3300005364 Ga0070673_100000636 Ga0070673_10000063613 169
426 3300005364 Ga0070673_100017149 Ga0070673_1000171495 169
427 3300005364 Ga0070673_100068716 Ga0070673_1000687162 169
428 3300005364 Ga0070673_100582773 Ga0070673_1005827731 169
429 3300005364 Ga0070673_100772804 Ga0070673_1007728041 169
430 3300005365 Ga0070688_100206154 Ga0070688_1002061542 169
431 3300005365 Ga0070688_100241403 Ga0070688_1002414031 169
432 3300005366 Ga0070659_100368624 Ga0070659_1003686242 169
433 3300005367 Ga0070667_100000916 Ga0070667_1000009166 169
434 3300005367 Ga0070667_100108331 Ga0070667_1001083312 169
435 3300005367 Ga0070667_100254517 Ga0070667_1002545172 169
436 3300005367 Ga0070667_100276685 Ga0070667_1002766851 169
437 3300005438 Ga0070701_10236218 Ga0070701_102362182 169
438 3300005441 Ga0070700_100021338 Ga0070700_1000213382 169
439 3300005456 Ga0070678_100005995 Ga0070678_1000059952 169
440 3300005456 Ga0070678_100296129 Ga0070678_1002961292 169
441 3300005457 Ga0070662_100002338 Ga0070662_1000023383 169
442 3300005457 Ga0070662_100189153 Ga0070662_1001891532 169
443 3300005459 Ga0068867_100000664 Ga0068867_10000066417 169
444 3300005459 Ga0068867_100013814 Ga0068867_1000138142 169
445 3300005459 Ga0068867_100029743 Ga0068867_1000297433 169
446 3300005459 Ga0068867_100154895 Ga0068867_1001548952 169
447 3300005459 Ga0068867_100212789 Ga0068867_1002127891 169
448 3300005466 Ga0070685_10633233 Ga0070685_106332331 169
449 3300005466 Ga0070685_10678964 Ga0070685_106789641 169
450 3300005539 Ga0068853_101150454 Ga0068853_1011504541 169
451 3300005543 Ga0070672_100000215 Ga0070672_10000021521 169
452 3300005543 Ga0070672_100007533 Ga0070672_1000075333 169
453 3300005543 Ga0070672_100375068 Ga0070672_1003750682 169
454 3300005543 Ga0070672_100529513 Ga0070672_1005295132 169
455 3300005543 Ga0070672_101011538 Ga0070672_1010115381 169
456 3300005544 Ga0070686_100058846 Ga0070686_1000588461 169
457 3300005548 Ga0070665_100025474 Ga0070665_1000254746 169
458 3300005548 Ga0070665_100055275 Ga0070665_1000552755 169
459 3300005577 Ga0068857_100012327 Ga0068857_1000123276 169
460 3300005616 Ga0068852_100180934 Ga0068852_1001809342 169
461 3300005617 Ga0068859_100010428 Ga0068859_1000104288 169
462 3300005617 Ga0068859_100175040 Ga0068859_1001750402 169
463 3300005617 Ga0068859_100413590 Ga0068859_1004135902 169
464 3300005618 Ga0068864_100011184 Ga0068864_1000111844 169
465 3300005618 Ga0068864_100015192 Ga0068864_1000151922 169
466 3300005718 Ga0068866_10019710 Ga0068866_100197102 169
467 3300005719 Ga0068861_100136966 Ga0068861_1001369662 169
468 3300005834 Ga0068851_10040298 Ga0068851_100402983 169
469 3300005840 Ga0068870_10032629 Ga0068870_100326292 169
470 3300005840 Ga0068870_10504622 Ga0068870_105046222 169
471 3300005841 Ga0068863_100001567 Ga0068863_1000015672 169
472 3300005841 Ga0068863_100001722 Ga0068863_10000172224 169
473 3300005841 Ga0068863_100380730 Ga0068863_1003807302 169
474 3300005842 Ga0068858_100000628 Ga0068858_10000062833 169
475 3300005842 Ga0068858_100323282 Ga0068858_1003232822 169
476 3300005842 Ga0068858_100852913 Ga0068858_1008529132 169
477 3300005842 Ga0068858_101001619 Ga0068858_1010016191 169
478 3300005843 Ga0068860_100002622 Ga0068860_1000026222 169
479 3300005843 Ga0068860_100474576 Ga0068860_1004745762 169
480 3300005844 Ga0068862_100049227 Ga0068862_1000492273 169
481 3300005937 Ga0081455_10732466 Ga0081455_107324661 169
482 3300006038 Ga0075365_10188804 Ga0075365_101888042 169
483 3300006195 Ga0075366_10006489 Ga0075366_100064893 169
484 3300006195 Ga0075366_10064372 Ga0075366_100643722 169
485 3300006195 Ga0075366_10077864 Ga0075366_100778642 169
486 3300006195 Ga0075366_10095547 Ga0075366_100955472 169
487 3300006195 Ga0075366_10212788 Ga0075366_102127882 169
488 3300006237 Ga0097621_100019592 Ga0097621_1000195922 169
489 3300006237 Ga0097621_100779391 Ga0097621_1007793912 169
490 3300006358 Ga0068871_100012228 Ga0068871_1000122281 169
491 3300006844 Ga0075428_102160969 Ga0075428_1021609691 169
492 3300006881 Ga0068865_100003621 Ga0068865_1000036212 169
493 3300006881 Ga0068865_100037561 Ga0068865_1000375613 169
494 3300006881 Ga0068865_100703363 Ga0068865_1007033632 169
495 3300006931 Ga0097620_100010429 Ga0097620_1000104298 169
496 3300006931 Ga0097620_100175044 Ga0097620_1001750442 169
497 3300006931 Ga0097620_100413575 Ga0097620_1004135752 169
498 3300009098 Ga0105245_10018645 Ga0105245_100186454 169
499 3300009098 Ga0105245_10038455 Ga0105245_100384555 169
500 3300009098 Ga0105245_10406613 Ga0105245_104066131 169
501 3300009148 Ga0105243_10000437 Ga0105243_1000043722 169
502 3300009148 Ga0105243_10002267 Ga0105243_100022674 169
503 3300009176 Ga0105242_10172499 Ga0105242_101724992 169
504 3300009176 Ga0105242_10640995 Ga0105242_106409952 169
505 3300009177 Ga0105248_10002934 Ga0105248_1000293419 169
506 3300009177 Ga0105248_10110965 Ga0105248_101109652 169
507 3300009551 Ga0105238_10158793 Ga0105238_101587932 169
508 3300009553 Ga0105249_10007568 Ga0105249_100075687 169
509 3300009553 Ga0105249_10432539 Ga0105249_104325392 169
510 3300011119 Ga0105246_10204120 Ga0105246_102041201 169
511 3300011119 Ga0105246_10594420 Ga0105246_105944202 169
512 3300011119 Ga0105246_10833173 Ga0105246_108331732 169
513 3300013100 Ga0157373_10079134 Ga0157373_100791343 169
514 3300013296 Ga0157374_10190956 Ga0157374_101909562 169
515 3300013296 Ga0157374_10390070 Ga0157374_103900702 169
516 3300013297 Ga0157378_10068930 Ga0157378_100689303 169
517 3300013297 Ga0157378_10181822 Ga0157378_101818222 169
518 3300013297 Ga0157378_10217874 Ga0157378_102178742 169
519 3300013306 Ga0163162_10000954 Ga0163162_1000095420 169
520 3300013306 Ga0163162_10093337 Ga0163162_100933372 169
521 3300013306 Ga0163162_10271330 Ga0163162_102713302 169
522 3300013308 Ga0157375_10000550 Ga0157375_100005507 169
523 3300013308 Ga0157375_10018289 Ga0157375_100182893 169
524 3300013308 Ga0157375_10033787 Ga0157375_100337875 169
525 3300014325 Ga0163163_10146821 Ga0163163_101468214 169
526 3300014326 Ga0157380_10000489 Ga0157380_100004892 169
527 3300014497 Ga0182008_10050118 Ga0182008_100501182 169
528 3300014745 Ga0157377_10324933 Ga0157377_103249331 169
529 3300014968 Ga0157379_10000439 Ga0157379_1000043926 169
530 3300014968 Ga0157379_10094579 Ga0157379_100945792 169
531 3300014968 Ga0157379_10294445 Ga0157379_102944452 169
532 3300014968 Ga0157379_10305253 Ga0157379_103052532 169
533 3300014969 Ga0157376_10203034 Ga0157376_102030342 169
534 3300014969 Ga0157376_10585657 Ga0157376_105856572 169
535 3300015261 Ga0182006_1001748 Ga0182006_100174818 169
536 3300015261 Ga0182006_1127927 Ga0182006_11279271 169
537 3300015262 Ga0182007_10004346 Ga0182007_100043469 169
538 3300015265 Ga0182005_1031429 Ga0182005_10314292 169
539 3300015683 Ga0183362_10005 Ga0183362_10005228 169
540 3300017792 Ga0163161_10006931 Ga0163161_100069317 169
541 3300017792 Ga0163161_10052953 Ga0163161_100529534 169
542 3300017792 Ga0163161_10120687 Ga0163161_101206872 169
543 3300021384 Ga0213876_10181594 Ga0213876_101815941 169
544 3300025292 Ga0209676_1000368 Ga0209676_100036883 169
545 3300025298 Ga0209050_1051799 Ga0209050_10517991 169
546 3300025303 Ga0209051_1000178 Ga0209051_10001782 169
547 3300025303 Ga0209051_1000931 Ga0209051_100093129 169
548 3300025303 Ga0209051_1016148 Ga0209051_10161483 169
549 3300025315 Ga0207697_10018594 Ga0207697_100185942 169
550 3300025321 Ga0207656_10005089 Ga0207656_100050893 169
551 3300025893 Ga0207682_10019861 Ga0207682_100198614 169
552 3300025893 Ga0207682_10366174 Ga0207682_103661741 169
553 3300025899 Ga0207642_10005581 Ga0207642_100055812 169
554 3300025903 Ga0207680_10086167 Ga0207680_100861672 169
555 3300025903 Ga0207680_10152926 Ga0207680_101529262 169
556 3300025903 Ga0207680_10320938 Ga0207680_103209382 169
557 3300025903 Ga0207680_10509501 Ga0207680_105095012 169
558 3300025903 Ga0207680_10993635 Ga0207680_109936351 169
559 3300025907 Ga0207645_10002573 Ga0207645_100025737 169
560 3300025907 Ga0207645_10008080 Ga0207645_100080807 169
561 3300025907 Ga0207645_10017297 Ga0207645_100172973 169
562 3300025908 Ga0207643_10014794 Ga0207643_100147943 169
563 3300025908 Ga0207643_10087791 Ga0207643_100877911 169
564 3300025918 Ga0207662_10130324 Ga0207662_101303242 169
565 3300025919 Ga0207657_10627702 Ga0207657_106277021 169
566 3300025923 Ga0207681_10000644 Ga0207681_1000064412 169
567 3300025923 Ga0207681_10238766 Ga0207681_102387662 169
568 3300025923 Ga0207681_10245131 Ga0207681_102451311 169
569 3300025925 Ga0207650_10006427 Ga0207650_100064274 169
570 3300025925 Ga0207650_10657425 Ga0207650_106574252 169
571 3300025926 Ga0207659_10000751 Ga0207659_1000075112 169
572 3300025926 Ga0207659_10006069 Ga0207659_100060694 169
573 3300025927 Ga0207687_10011986 Ga0207687_100119865 169
574 3300025927 Ga0207687_10038600 Ga0207687_100386002 169
575 3300025927 Ga0207687_10563588 Ga0207687_105635882 169
576 3300025931 Ga0207644_10010084 Ga0207644_100100842 169
577 3300025931 Ga0207644_10031885 Ga0207644_100318852 169
578 3300025931 Ga0207644_10039620 Ga0207644_100396205 169
579 3300025931 Ga0207644_10248176 Ga0207644_102481761 169
580 3300025933 Ga0207706_10006980 Ga0207706_100069801 169
581 3300025934 Ga0207686_10167181 Ga0207686_101671812 169
582 3300025934 Ga0207686_10627384 Ga0207686_106273841 169
583 3300025935 Ga0207709_10002102 Ga0207709_100021025 169
584 3300025935 Ga0207709_10025447 Ga0207709_100254471 169
585 3300025936 Ga0207670_10008093 Ga0207670_100080932 169
586 3300025936 Ga0207670_10197679 Ga0207670_101976791 169
587 3300025937 Ga0207669_10001517 Ga0207669_100015175 169
588 3300025937 Ga0207669_10013519 Ga0207669_100135192 169
589 3300025938 Ga0207704_10001175 Ga0207704_100011757 169
590 3300025938 Ga0207704_10056013 Ga0207704_100560133 169
591 3300025938 Ga0207704_10207072 Ga0207704_102070722 169
592 3300025940 Ga0207691_10000347 Ga0207691_100003472 169
593 3300025940 Ga0207691_10003219 Ga0207691_100032199 169
594 3300025940 Ga0207691_10093373 Ga0207691_100933732 169
595 3300025940 Ga0207691_10170221 Ga0207691_101702212 169
596 3300025940 Ga0207691_10175507 Ga0207691_101755072 169
597 3300025941 Ga0207711_10004936 Ga0207711_100049367 169
598 3300025942 Ga0207689_10002269 Ga0207689_100022694 169
599 3300025942 Ga0207689_10010698 Ga0207689_100106984 169
600 3300025945 Ga0207679_10271542 Ga0207679_102715422 169
601 3300025960 Ga0207651_10000398 Ga0207651_1000039814 169
602 3300025960 Ga0207651_10012112 Ga0207651_100121122 169
603 3300025960 Ga0207651_10022279 Ga0207651_100222793 169
604 3300025961 Ga0207712_10009709 Ga0207712_100097095 169
605 3300025972 Ga0207668_10000809 Ga0207668_1000080911 169
606 3300025972 Ga0207668_10042364 Ga0207668_100423642 169
607 3300025972 Ga0207668_10287476 Ga0207668_102874762 169
608 3300025972 Ga0207668_10653087 Ga0207668_106530871 169
609 3300025986 Ga0207658_10002681 Ga0207658_100026811 169
610 3300025986 Ga0207658_10010019 Ga0207658_100100192 169
611 3300025986 Ga0207658_10074759 Ga0207658_100747591 169
612 3300025986 Ga0207658_10380315 Ga0207658_103803151 169
613 3300026023 Ga0207677_10008191 Ga0207677_100081915 169
614 3300026023 Ga0207677_10011928 Ga0207677_100119282 169
615 3300026023 Ga0207677_10031948 Ga0207677_100319482 169
616 3300026023 Ga0207677_10138338 Ga0207677_101383382 169
617 3300026035 Ga0207703_10002510 Ga0207703_100025107 169
618 3300026035 Ga0207703_10013182 Ga0207703_100131822 169
619 3300026067 Ga0207678_10013862 Ga0207678_100138626 169
620 3300026067 Ga0207678_10786432 Ga0207678_107864322 169
621 3300026075 Ga0207708_10013570 Ga0207708_100135703 169
622 3300026075 Ga0207708_10144528 Ga0207708_101445282 169
623 3300026088 Ga0207641_10017015 Ga0207641_100170152 169
624 3300026088 Ga0207641_10055684 Ga0207641_100556842 169
625 3300026089 Ga0207648_10002881 Ga0207648_100028812 169
626 3300026089 Ga0207648_10007895 Ga0207648_100078956 169
627 3300026089 Ga0207648_10021442 Ga0207648_100214422 169
628 3300026089 Ga0207648_10078374 Ga0207648_100783742 169
629 3300026095 Ga0207676_10000082 Ga0207676_1000008238 169
630 3300026095 Ga0207676_10050076 Ga0207676_100500765 169
631 3300026095 Ga0207676_11089170 Ga0207676_110891701 169
632 3300026116 Ga0207674_10018126 Ga0207674_100181265 169
633 3300026118 Ga0207675_100000927 Ga0207675_10000092727 169
634 3300026121 Ga0207683_10210587 Ga0207683_102105872 169
635 3300026121 Ga0207683_10214579 Ga0207683_102145792 169
636 3300026121 Ga0207683_10216547 Ga0207683_102165472 169
637 3300026142 Ga0207698_10292253 Ga0207698_102922532 169
638 3300026142 Ga0207698_10661934 Ga0207698_106619341 169
639 3300026142 Ga0207698_10688782 Ga0207698_106887821 169
640 3300028380 Ga0268265_10110441 Ga0268265_101104412 169
641 3300028381 Ga0268264_10002202 Ga0268264_100022029 169
642 3300028381 Ga0268264_10041350 Ga0268264_100413505 169
643 3300028786 Ga0307517_10004553 Ga0307517_1000455322 169
644 3300028786 Ga0307517_10179854 Ga0307517_101798542 169
645 3300028794 Ga0307515_10023797 Ga0307515_100237979 169
646 3300028794 Ga0307515_10102188 Ga0307515_101021883 169
647 3300028794 Ga0307515_10126323 Ga0307515_101263232 169
648 3300031456 Ga0307513_10001868 Ga0307513_1000186823 169
649 3300031456 Ga0307513_10086955 Ga0307513_100869552 169
650 3300031507 Ga0307509_10007851 Ga0307509_100078516 169
651 3300031507 Ga0307509_10038154 Ga0307509_100381544 169
652 3300031507 Ga0307509_10603647 Ga0307509_106036471 169
653 3300031548 Ga0307408_100947544 Ga0307408_1009475441 169
654 3300031548 Ga0307408_101100691 Ga0307408_1011006911 169
655 3300031616 Ga0307508_10008282 Ga0307508_100082825 169
656 3300031649 Ga0307514_10096609 Ga0307514_100966093 169
657 3300031649 Ga0307514_10237904 Ga0307514_102379042 169
658 3300031711 Ga0265314_10231927 Ga0265314_102319271 169
659 3300031730 Ga0307516_10000237 Ga0307516_1000023727 169
660 3300031852 Ga0307410_10087844 Ga0307410_100878442 169
661 3300031901 Ga0307406_10123962 Ga0307406_101239622 169
662 3300031995 Ga0307409_100566255 Ga0307409_1005662552 169
663 3300032002 Ga0307416_101020974 Ga0307416_1010209742 169
664 3300035114 Ga0373939_0195590 Ga0373939_0195590_226_735 169
665 3300035171 Ga0373946_0095441 Ga0373946_0095441_284_793 169
666 3300035692 Ga0373935_0115537 Ga0373935_0115537_470_979 169
667 3300036401 Ga0373937_0047465 Ga0373937_0047465_2478_2987 169
668 3300036401 Ga0373937_0125469 Ga0373937_0125469_1726_2235 169
669 3300037068 Ga0373925_0122348 Ga0373925_0122348_1003_1512 169
670 3300037466 Ga0395898_0237105 Ga0395898_0237105_1040_1549 169
671 3300037471 Ga0395905_0006264 Ga0395905_0006264_896_1405 169
672 3300037471 Ga0395905_0115347 Ga0395905_0115347_401_910 169
673 3300037471 Ga0395905_0285411 Ga0395905_0285411_613_1122 169
674 3300037471 Ga0395905_0489662 Ga0395905_0489662_212_721 169
675 3300039437 Ga0436365_1402919 Ga0436365_1402919_1263_1772 169
676 3300039450 Ga0436363_1469836 Ga0436363_1469836_607_1116 169
677 3300041451 Ga0451791_0210227 Ga0451791_0210227_163_678 169
678 3300041452 Ga0451793_0124799 Ga0451793_0124799_83_598 169
679 3300041459 Ga0451800_0939557 Ga0451800_0939557_49_558 169
680 3300041512 Ga0451853_1321958 Ga0451853_1321958_216_731 169
681 3300042012 Ga0439455_0018540 Ga0439455_0018540_223_732 169
682 3300042134 Ga0450898_015921 Ga0450898_015921_160_669 169
683 3300042876 Ga0451577_0068194 Ga0451577_0068194_1864_2373 169
684 3300046454 Ga0495592_0000211 Ga0495592_0000211_13287_13796 169
685 3300046457 Ga0495590_0013034 Ga0495590_0013034_1234_1743 169
686 3300046459 Ga0495629_0032522 Ga0495629_0032522_2325_2834 169
687 3300046459 Ga0495629_0042748 Ga0495629_0042748_1669_2178 169
688 3300046460 Ga0495638_0074021 Ga0495638_0074021_1237_1746 169
689 3300046463 Ga0495653_0380860 Ga0495653_0380860_187_696 169
690 3300046473 Ga0495582_0185706 Ga0495582_0185706_159_668 169
691 3300046475 Ga0495639_0071706 Ga0495639_0071706_575_1084 169
692 3300046475 Ga0495639_0235238 Ga0495639_0235238_286_795 169
693 3300046506 Ga0495583_0067301 Ga0495583_0067301_17_526 169
694 3300046507 Ga0495606_0262079 Ga0495606_0262079_158_673 169
695 3300046516 Ga0495628_0124485 Ga0495628_0124485_160_669 169
696 3300046516 Ga0495628_0404365 Ga0495628_0404365_73_621 169
697 3300046528 Ga0495642_0092321 Ga0495642_0092321_464_973 169
698 3300046533 Ga0495640_0123366 Ga0495640_0123366_569_1078 169
699 3300046533 Ga0495640_0240409 Ga0495640_0240409_162_671 169
700 3300046539 Ga0495621_0003592 Ga0495621_0003592_833_1342 169
701 3300046615 Ga0495656_0000055 Ga0495656_0000055_29662_30171 169
702 3300046615 Ga0495656_0029376 Ga0495656_0029376_34_543 169
703 3300046616 Ga0495668_0049884 Ga0495668_0049884_744_1253 169
704 3300046616 Ga0495668_0211190 Ga0495668_0211190_274_783 169
705 3300046642 Ga0495634_0268308 Ga0495634_0268308_502_1011 169
706 3300046660 Ga0495625_0069863 Ga0495625_0069863_469_978 169
707 3300046663 Ga0495635_0102477 Ga0495635_0102477_404_913 169
708 3300046663 Ga0495635_0171602 Ga0495635_0171602_254_763 169
709 3300046674 Ga0495588_0097954 Ga0495588_0097954_520_1029 169
710 3300046678 Ga0495599_0297918 Ga0495599_0297918_342_851 169
711 3300046680 Ga0495646_0259762 Ga0495646_0259762_57_566 169
712 3300046681 Ga0495647_0037297 Ga0495647_0037297_147_656 169
713 3300046681 Ga0495647_0159299 Ga0495647_0159299_203_712 169
714 3300046681 Ga0495647_0176505 Ga0495647_0176505_345_854 169
715 3300046683 Ga0495658_0070109 Ga0495658_0070109_1371_1880 169
716 3300046683 Ga0495658_0354995 Ga0495658_0354995_241_789 169
717 3300046689 Ga0495613_0669775 Ga0495613_0669775_151_660 169
718 3300046691 Ga0495670_0105166 Ga0495670_0105166_371_880 169
719 3300046809 Ga0495600_0032003 Ga0495600_0032003_2290_2799 169
720 3300046809 Ga0495600_0564390 Ga0495600_0564390_138_647 169
721 3300046810 Ga0495660_0046913 Ga0495660_0046913_937_1446 169
722 3300047315 Ga0495581_0205380 Ga0495581_0205380_215_724 169
723 3300047319 Ga0495674_0466405 Ga0495674_0466405_261_770 169
724 3300047321 Ga0495676_0109107 Ga0495676_0109107_1126_1635 169
725 3300047445 Ga0495677_0184931 Ga0495677_0184931_75_584 169
726 3300047447 Ga0495685_086382 Ga0495685_086382_393_902 169
727 3300047470 Ga0495681_0055933 Ga0495681_0055933_887_1396 169
728 3300047471 Ga0495684_0115155 Ga0495684_0115155_866_1375 169
729 3300047471 Ga0495684_0666773 Ga0495684_0666773_16_525 169
730 3300048089 Ga0495614_0452816 Ga0495614_0452816_58_567 169
731 3300048090 Ga0495615_0068733 Ga0495615_0068733_367_876 169
732 3300048903 Ga0496100_0101842 Ga0496100_0101842_540_1049 169
733 3300048904 Ga0496101_0010546 Ga0496101_0010546_2841_3350 169
734 3300048905 Ga0496102_0014578 Ga0496102_0014578_3117_3626 169
735 3300048906 Ga0496103_0010336 Ga0496103_0010336_2635_3144 169
736 3300048907 Ga0496104_0015327 Ga0496104_0015327_1317_1826 169
737 3300048907 Ga0496104_1466667 Ga0496104_1466667_51_560 169
738 3300048908 Ga0496105_0002074 Ga0496105_0002074_1284_1793 169
739 3300048909 Ga0496106_0024302 Ga0496106_0024302_1100_1609 169
740 3300048910 Ga0496107_0036652 Ga0496107_0036652_215_724 169
741 3300048911 Ga0496108_0022182 Ga0496108_0022182_376_885 169
742 3300048913 Ga0496110_0029223 Ga0496110_0029223_4001_4510 169
743 3300048914 Ga0496111_0124593 Ga0496111_0124593_328_837 169
744 3300048916 Ga0496113_0350757 Ga0496113_0350757_132_641 169
745 3300048917 Ga0496114_0069772 Ga0496114_0069772_1471_1980 169
746 3300048928 Ga0496125_0438466 Ga0496125_0438466_54_563 169
747 3300049515 Ga0501292_009487 Ga0501292_009487_663_1172 169
748 3300049517 Ga0501294_008077 Ga0501294_008077_235_744 169
749 3300049521 Ga0501298_002185 Ga0501298_002185_1396_1905 169
750 3300049522 Ga0501299_032863 Ga0501299_032863_373_882 169
751 3300049650 Ga0501199_013270 Ga0501199_013270_21_530 169
752 3300049653 Ga0501206_002813 Ga0501206_002813_490_999 169
753 3300049686 Ga0501257_037872 Ga0501257_037872_117_626 169
754 3300049688 Ga0501259_058687 Ga0501259_058687_83_592 169
755 3300049759 Ga0501262_009881 Ga0501262_009881_380_889 169
756 3300049770 Ga0501273_006673 Ga0501273_006673_362_871 169
757 3300049777 Ga0501281_03099 Ga0501281_03099_439_948 169
758 3300050489 nmdc:mga03683_107284_c1 nmdc:mga03683_107284_c1_682_1191 169
759 3300050493 nmdc:mga0k408_251645_c1 nmdc:mga0k408_251645_c1_23_532 169
760 3300050493 nmdc:mga0k408_36165_c1 nmdc:mga0k408_36165_c1_1013_1522 169
761 3300050493 nmdc:mga0k408_73875_c1 nmdc:mga0k408_73875_c1_737_1246 169
762 3300050493 nmdc:mga0k408_92205_c1 nmdc:mga0k408_92205_c1_931_1440 169
763 3300050496 nmdc:mga07m45_397680_c1 nmdc:mga07m45_397680_c1_268_777 169
764 3300050496 nmdc:mga07m45_607872_c1 nmdc:mga07m45_607872_c1_97_606 169
765 3300050516 nmdc:mga0sz30_34397_c1 nmdc:mga0sz30_34397_c1_427_936 169
766 3300053077 Ga0495601_0018255 Ga0495601_0018255_11_520 169
767 3300053078 Ga0495612_0123928 Ga0495612_0123928_486_995 169
768 3300053085 Ga0495619_0048380 Ga0495619_0048380_1489_1998 169
769 3300053088 Ga0500644_0007132 Ga0500644_0007132_649_1158 169
770 3300053092 Ga0500583_0049976 Ga0500583_0049976_732_1244 169
771 3300053108 Ga0500562_020605 Ga0500562_020605_1160_1669 169
772 3300053118 Ga0500594_0010549 Ga0500594_0010549_871_1380 169
773 3300053136 Ga0500559_0000166 Ga0500559_0000166_15727_16236 169
774 3300053138 Ga0500564_057811 Ga0500564_057811_633_1142 169
775 3300053154 Ga0500619_069489 Ga0500619_069489_76_585 169
776 3300053739 Ga0500587_002063 Ga0500587_002063_1123_1632 169
777 iso_pu_bacteria 2928084124 2928088461 169
778 iso_pu_bacteria 2945909444 2945909761 169
779 3300003187 JGI25151J46595_10000966 JGI25151J46595_100009661 170
780 3300003781 Ga0055536_1000980 Ga0055536_10009801 170
781 3300003784 Ga0055534_1018300 Ga0055534_10183002 170
782 3300003791 Ga0055530_10011577 Ga0055530_100115773 170
783 3300003794 Ga0055531_10000809 Ga0055531_100008092 170
784 3300005344 Ga0070661_100143938 Ga0070661_1001439382 170
785 3300005367 Ga0070667_101108948 Ga0070667_1011089481 170
786 3300005456 Ga0070678_100581387 Ga0070678_1005813871 170
787 3300005457 Ga0070662_100074970 Ga0070662_1000749702 170
788 3300005548 Ga0070665_100409201 Ga0070665_1004092011 170
789 3300005564 Ga0070664_100022201 Ga0070664_1000222017 170
790 3300005577 Ga0068857_100209974 Ga0068857_1002099742 170
791 3300005844 Ga0068862_100223968 Ga0068862_1002239682 170
792 3300006038 Ga0075365_10000402 Ga0075365_100004023 170
793 3300006048 Ga0075363_100006788 Ga0075363_1000067887 170
794 3300006051 Ga0075364_10006947 Ga0075364_100069475 170
795 3300006058 Ga0075432_10028523 Ga0075432_100285233 170
796 3300006177 Ga0075362_10018359 Ga0075362_100183593 170
797 3300006177 Ga0075362_10075241 Ga0075362_100752411 170
798 3300006178 Ga0075367_10106928 Ga0075367_101069282 170
799 3300006195 Ga0075366_10021592 Ga0075366_100215923 170
800 3300006195 Ga0075366_10038020 Ga0075366_100380202 170
801 3300006195 Ga0075366_10774203 Ga0075366_107742031 170
802 3300006237 Ga0097621_100763867 Ga0097621_1007638672 170
803 3300006353 Ga0075370_10024490 Ga0075370_100244902 170
804 3300006353 Ga0075370_10053353 Ga0075370_100533532 170
805 3300006353 Ga0075370_10177611 Ga0075370_101776112 170
806 3300006353 Ga0075370_10416635 Ga0075370_104166351 170
807 3300006948 Ga0099826_10065661 Ga0099826_100656612 170
808 3300009093 Ga0105240_10002416 Ga0105240_1000241625 170
809 3300009148 Ga0105243_10016045 Ga0105243_100160457 170
810 3300009148 Ga0105243_10149101 Ga0105243_101491012 170
811 3300009545 Ga0105237_10001223 Ga0105237_100012238 170
812 3300009551 Ga0105238_10006384 Ga0105238_100063847 170
813 3300009551 Ga0105238_10071647 Ga0105238_100716474 170
814 3300010375 Ga0105239_10002071 Ga0105239_100020718 170
815 3300012498 Ga0157345_1008467 Ga0157345_10084672 170
816 3300014497 Ga0182008_10007679 Ga0182008_100076794 170
817 3300015261 Ga0182006_1003709 Ga0182006_10037095 170
818 3300021361 Ga0213872_10023309 Ga0213872_100233092 170
819 3300025258 Ga0209129_1007298 Ga0209129_10072982 170
820 3300025273 Ga0209673_1001625 Ga0209673_100162513 170
821 3300025291 Ga0209675_1017081 Ga0209675_10170812 170
822 3300025291 Ga0209675_1037045 Ga0209675_10370452 170
823 3300025292 Ga0209676_1000433 Ga0209676_100043311 170
824 3300025294 Ga0209025_1001614 Ga0209025_100161425 170
825 3300025294 Ga0209025_1096798 Ga0209025_10967982 170
826 3300025298 Ga0209050_1000912 Ga0209050_100091225 170
827 3300025298 Ga0209050_1004084 Ga0209050_10040842 170
828 3300025303 Ga0209051_1000207 Ga0209051_100020731 170
829 3300025304 Ga0209257_1000249 Ga0209257_100024989 170
830 3300025728 Ga0207655_1004770 Ga0207655_10047708 170
831 3300025913 Ga0207695_10007940 Ga0207695_1000794013 170
832 3300025914 Ga0207671_10070997 Ga0207671_100709971 170
833 3300025924 Ga0207694_10024601 Ga0207694_100246013 170
834 3300025924 Ga0207694_10155247 Ga0207694_101552472 170
835 3300025925 Ga0207650_10704442 Ga0207650_107044421 170
836 3300025932 Ga0207690_10147513 Ga0207690_101475132 170
837 3300025934 Ga0207686_10080424 Ga0207686_100804243 170
838 3300025935 Ga0207709_10001937 Ga0207709_1000193713 170
839 3300025935 Ga0207709_10047583 Ga0207709_100475832 170
840 3300025945 Ga0207679_10013127 Ga0207679_100131277 170
841 3300026116 Ga0207674_10144755 Ga0207674_101447552 170
842 3300026116 Ga0207674_10352299 Ga0207674_103522991 170
843 3300027666 Ga0209282_1105991 Ga0209282_11059912 170
844 3300028379 Ga0268266_10244025 Ga0268266_102440252 170
845 3300028379 Ga0268266_10368331 Ga0268266_103683312 170
846 3300028380 Ga0268265_10093044 Ga0268265_100930442 170
847 3300028794 Ga0307515_10000419 Ga0307515_10000419100 170
848 3300028794 Ga0307515_10000425 Ga0307515_1000042590 170
849 3300028794 Ga0307515_10000672 Ga0307515_100006729 170
850 3300028794 Ga0307515_10050319 Ga0307515_100503196 170
851 3300030522 Ga0307512_10285754 Ga0307512_102857542 170
852 3300031456 Ga0307513_10077369 Ga0307513_100773693 170
853 3300031456 Ga0307513_10203853 Ga0307513_102038532 170
854 3300031548 Ga0307408_100564043 Ga0307408_1005640432 170
855 3300031649 Ga0307514_10001174 Ga0307514_1000117419 170
856 3300031731 Ga0307405_10164268 Ga0307405_101642682 170
857 3300031901 Ga0307406_10442887 Ga0307406_104428872 170
858 3300031911 Ga0307412_10034281 Ga0307412_100342811 170
859 3300031911 Ga0307412_10714539 Ga0307412_107145391 170
860 3300031911 Ga0307412_11382326 Ga0307412_113823261 170
861 3300032005 Ga0307411_10057995 Ga0307411_100579952 170
862 3300039447 Ga0436361_0221167 Ga0436361_0221167_369_881 170
863 3300039447 Ga0436361_0644663 Ga0436361_0644663_738_1250 170
864 3300041404 Ga0439436_0000134 Ga0439436_0000134_15773_16285 170
865 3300041404 Ga0439436_0000962 Ga0439436_0000962_4844_5356 170
866 3300041405 Ga0439438_125193 Ga0439438_125193_61_573 170
867 3300041406 Ga0439439_0004760 Ga0439439_0004760_2079_2591 170
868 3300041406 Ga0439439_0038287 Ga0439439_0038287_527_1039 170
869 3300041410 Ga0439461_0004034 Ga0439461_0004034_1824_2336 170
870 3300041410 Ga0439461_0024933 Ga0439461_0024933_583_1095 170
871 3300041411 Ga0439466_0006068 Ga0439466_0006068_2192_2704 170
872 3300041413 Ga0439465_0000339 Ga0439465_0000339_4149_4661 170
873 3300041997 Ga0439431_0009901 Ga0439431_0009901_754_1266 170
874 3300041999 Ga0439433_0000087 Ga0439433_0000087_11970_12482 170
875 3300042002 Ga0439442_001006 Ga0439442_001006_2886_3398 170
876 3300042004 Ga0439445_0009738 Ga0439445_0009738_1411_1923 170
877 3300042004 Ga0439445_0018295 Ga0439445_0018295_929_1441 170
878 3300042006 Ga0439432_000527 Ga0439432_000527_13_525 170
879 3300042006 Ga0439432_036027 Ga0439432_036027_743_1255 170
880 3300042007 Ga0439449_0000385 Ga0439449_0000385_10013_10525 170
881 3300042007 Ga0439449_0004263 Ga0439449_0004263_2380_2892 170
882 3300042007 Ga0439449_0011605 Ga0439449_0011605_2329_2841 170
883 3300042010 Ga0439452_002869 Ga0439452_002869_5045_5557 170
884 3300042014 Ga0439457_021681 Ga0439457_021681_588_1100 170
885 3300042015 Ga0439462_0001243 Ga0439462_0001243_4766_5278 170
886 3300042015 Ga0439462_0005291 Ga0439462_0005291_465_977 170
887 3300042115 Ga0450911_000225 Ga0450911_000225_18018_18530 170
888 3300042125 Ga0450923_002780 Ga0450923_002780_797_1309 170
889 3300042131 Ga0450894_015107 Ga0450894_015107_329_841 170
890 3300042134 Ga0450898_025829 Ga0450898_025829_308_820 170
891 3300042142 Ga0450905_009627 Ga0450905_009627_210_722 170
892 3300042156 Ga0439446_0035330 Ga0439446_0035330_467_979 170
893 3300042435 Ga0439434_0003391 Ga0439434_0003391_1106_1618 170
894 3300042435 Ga0439434_0116530 Ga0439434_0116530_342_854 170
895 3300044901 Ga0466960_0143879 Ga0466960_0143879_22_534 170
896 3300046660 Ga0495625_0000708 Ga0495625_0000708_17596_18108 170
897 3300046664 Ga0495659_0048214 Ga0495659_0048214_869_1381 170
898 3300048905 Ga0496102_0125873 Ga0496102_0125873_1032_1544 170
899 3300048917 Ga0496114_0485770 Ga0496114_0485770_347_859 170
900 3300048919 Ga0496116_0057954 Ga0496116_0057954_896_1408 170
901 3300048919 Ga0496116_0089477 Ga0496116_0089477_779_1291 170
902 3300048920 Ga0496117_0016300 Ga0496117_0016300_3019_3531 170
903 3300048920 Ga0496117_0076287 Ga0496117_0076287_773_1285 170
904 3300048921 Ga0496118_0027766 Ga0496118_0027766_442_954 170
905 3300048924 Ga0496121_0453743 Ga0496121_0453743_35_547 170
906 3300048926 Ga0496123_0103082 Ga0496123_0103082_97_609 170
907 3300050489 nmdc:mga03683_12530_c1 nmdc:mga03683_12530_c1_2528_3040 170
908 3300050490 nmdc:mga03n38_19665_c1 nmdc:mga03n38_19665_c1_1311_1823 170
909 3300050490 nmdc:mga03n38_62210_c1 nmdc:mga03n38_62210_c1_454_966 170
910 3300050491 nmdc:mga00v17_2771_c1 nmdc:mga00v17_2771_c1_6192_6704 170
911 3300050492 nmdc:mga0yw44_5627_c1 nmdc:mga0yw44_5627_c1_3635_4147 170
912 3300050493 nmdc:mga0k408_33051_c1 nmdc:mga0k408_33051_c1_830_1342 170
913 3300050493 nmdc:mga0k408_33984_c1 nmdc:mga0k408_33984_c1_1541_2053 170
914 3300050493 nmdc:mga0k408_60655_c1 nmdc:mga0k408_60655_c1_77_589 170
915 3300050496 nmdc:mga07m45_2026_c2 nmdc:mga07m45_2026_c2_1494_2006 170
916 3300050516 nmdc:mga0sz30_110451_c1 nmdc:mga0sz30_110451_c1_671_1183 170
917 3300053108 Ga0500562_004272 Ga0500562_004272_784_1392 170
918 3300053121 Ga0500607_012041 Ga0500607_012041_1892_2404 170
919 3300053125 Ga0500618_027711 Ga0500618_027711_585_1124 170
920 3300053142 Ga0500577_0079072 Ga0500577_0079072_193_705 170
921 3300053145 Ga0500586_016719 Ga0500586_016719_391_903 170
922 3300053729 Ga0500625_029427 Ga0500625_029427_591_1103 170
923 iso_pu_bacteria 2818991446 2819601682 170
924 iso_pu_bacteria 2831265667 2831272118 170
925 iso_pu_bacteria 2838054893 2838059281 170
926 iso_pu_bacteria 2885198086 2885202982 170
927 iso_pu_bacteria 2885211737 2885216621 170
928 iso_pu_bacteria 2899924645 2899930749 170
929 iso_pu_bacteria 2928037797 2928040930 170
930 iso_pu_bacteria 2928044640 2928047772 170
931 iso_pu_bacteria 2928051484 2928055663 170
932 iso_pu_bacteria 2928064002 2928069761 170
933 3300002987 JGI25159J45721_1008171 JGI25159J45721_10081713 171
934 3300003784 Ga0055534_1006770 Ga0055534_10067703 171
935 3300025273 Ga0209673_1051779 Ga0209673_10517791 171
936 3300025284 Ga0209130_1010030 Ga0209130_10100303 171
937 3300025291 Ga0209675_1001575 Ga0209675_10015759 171
938 3300025292 Ga0209676_1000937 Ga0209676_100093722 171
939 3300025294 Ga0209025_1079347 Ga0209025_10793472 171
940 3300025303 Ga0209051_1026224 Ga0209051_10262242 171
941 3300025304 Ga0209257_1019883 Ga0209257_10198833 171
942 3300026121 Ga0207683_10624846 Ga0207683_106248462 171
943 3300028794 Ga0307515_10083885 Ga0307515_100838853 171
944 3300031456 Ga0307513_10323141 Ga0307513_103231412 171
945 3300035089 Ga0373944_0115874 Ga0373944_0115874_298_813 171
946 3300037068 Ga0373925_0193640 Ga0373925_0193640_90_605 171
947 3300041407 Ga0439447_031631 Ga0439447_031631_670_1188 171
948 3300046690 Ga0495624_0073836 Ga0495624_0073836_919_1434 171
949 3300047321 Ga0495676_0061675 Ga0495676_0061675_1580_2095 171
950 3300047673 Ga0495593_0017494 Ga0495593_0017494_161_676 171
951 3300048929 Ga0496126_0639021 Ga0496126_0639021_49_564 171
952 3300049460 Ga0495682_0271472 Ga0495682_0271472_48_566 171
953 3300003187 JGI25151J46595_10049812 JGI25151J46595_100498121 172
954 3300005367 Ga0070667_100001639 Ga0070667_10000163912 172
955 3300005466 Ga0070685_10681485 Ga0070685_106814852 172
956 3300005468 Ga0070707_100010736 Ga0070707_10001073610 172
957 3300005471 Ga0070698_100833995 Ga0070698_1008339952 172
958 3300005843 Ga0068860_101064532 Ga0068860_1010645321 172
959 3300006237 Ga0097621_100186892 Ga0097621_1001868922 172
960 3300006358 Ga0068871_100066423 Ga0068871_1000664233 172
961 3300013306 Ga0163162_10084244 Ga0163162_100842443 172
962 3300025245 Ga0207425_1044847 Ga0207425_10448471 172
963 3300025294 Ga0209025_1000324 Ga0209025_100032426 172
964 3300025922 Ga0207646_10101910 Ga0207646_101019103 172
965 3300025927 Ga0207687_10071514 Ga0207687_100715143 172
966 3300025986 Ga0207658_10035740 Ga0207658_100357403 172
967 3300028381 Ga0268264_10377324 Ga0268264_103773242 172
968 3300030522 Ga0307512_10063478 Ga0307512_100634782 172
969 3300031456 Ga0307513_10008367 Ga0307513_1000836710 172
970 3300031507 Ga0307509_10003708 Ga0307509_1000370823 172
971 3300031507 Ga0307509_10004745 Ga0307509_100047452 172
972 3300031507 Ga0307509_10332143 Ga0307509_103321432 172
973 3300031616 Ga0307508_10016618 Ga0307508_100166183 172
974 3300031616 Ga0307508_10072891 Ga0307508_100728912 172
975 3300033180 Ga0307510_10022805 Ga0307510_100228052 172
976 3300033180 Ga0307510_10276625 Ga0307510_102766252 172
977 3300046692 Ga0495671_0135871 Ga0495671_0135871_402_923 172
978 3300047472 Ga0495686_0001736 Ga0495686_0001736_5361_5879 172
979 3300053093 Ga0500651_0135524 Ga0500651_0135524_640_1161 172
980 iso_pu_bacteria 2599185214 2599626406 172
981 iso_pu_bacteria 2599185226 2599676270 172
982 iso_pu_bacteria 2599185227 2599682108 172
983 iso_pu_bacteria 2599185229 2599695758 172
984 iso_pu_bacteria 2738541307 2738880738 172
985 iso_pu_bacteria 2928070936 2928075381 172
986 3300005336 Ga0070680_100051495 Ga0070680_1000514953 173
987 3300005341 Ga0070691_10218433 Ga0070691_102184332 173
988 3300005341 Ga0070691_10281495 Ga0070691_102814951 173
989 3300005438 Ga0070701_10067484 Ga0070701_100674842 173
990 3300005441 Ga0070700_101235732 Ga0070700_1012357321 173
991 3300005457 Ga0070662_100009196 Ga0070662_1000091968 173
992 3300005459 Ga0068867_100142501 Ga0068867_1001425012 173
993 3300005471 Ga0070698_100423339 Ga0070698_1004233391 173
994 3300005548 Ga0070665_100446518 Ga0070665_1004465182 173
995 3300005563 Ga0068855_100242436 Ga0068855_1002424362 173
996 3300005577 Ga0068857_100069621 Ga0068857_1000696213 173
997 3300005578 Ga0068854_100039212 Ga0068854_1000392123 173
998 3300005578 Ga0068854_100169572 Ga0068854_1001695722 173
999 3300005616 Ga0068852_100291220 Ga0068852_1002912202 173
1000 3300005616 Ga0068852_100516312 Ga0068852_1005163122 173
1001 3300005617 Ga0068859_100154256 Ga0068859_1001542562 173
1002 3300005844 Ga0068862_100071248 Ga0068862_1000712482 173
1003 3300006042 Ga0075368_10072401 Ga0075368_100724012 173
1004 3300006177 Ga0075362_10079367 Ga0075362_100793672 173
1005 3300006177 Ga0075362_10123620 Ga0075362_101236202 173
1006 3300006178 Ga0075367_10052723 Ga0075367_100527232 173
1007 3300006178 Ga0075367_10355351 Ga0075367_103553511 173
1008 3300006186 Ga0075369_10162193 Ga0075369_101621932 173
1009 3300006195 Ga0075366_10018726 Ga0075366_100187262 173
1010 3300006195 Ga0075366_10053152 Ga0075366_100531522 173
1011 3300006195 Ga0075366_10073073 Ga0075366_100730732 173
1012 3300006353 Ga0075370_10023306 Ga0075370_100233062 173
1013 3300006353 Ga0075370_10031608 Ga0075370_100316082 173
1014 3300006353 Ga0075370_10070417 Ga0075370_100704172 173
1015 3300006353 Ga0075370_10361938 Ga0075370_103619381 173
1016 3300006844 Ga0075428_100002991 Ga0075428_1000029914 173
1017 3300006844 Ga0075428_100600102 Ga0075428_1006001021 173
1018 3300006846 Ga0075430_100053854 Ga0075430_1000538543 173
1019 3300006852 Ga0075433_10174388 Ga0075433_101743882 173
1020 3300006880 Ga0075429_100022565 Ga0075429_1000225654 173
1021 3300006881 Ga0068865_100199681 Ga0068865_1001996812 173
1022 3300006931 Ga0097620_100154273 Ga0097620_1001542732 173
1023 3300009036 Ga0105244_10140250 Ga0105244_101402502 173
1024 3300009093 Ga0105240_10173426 Ga0105240_101734262 173
1025 3300009094 Ga0111539_10007916 Ga0111539_100079168 173
1026 3300009094 Ga0111539_10012627 Ga0111539_100126274 173
1027 3300009148 Ga0105243_10035573 Ga0105243_100355734 173
1028 3300009545 Ga0105237_10010476 Ga0105237_100104764 173
1029 3300009545 Ga0105237_10102414 Ga0105237_101024143 173
1030 3300009551 Ga0105238_10122079 Ga0105238_101220793 173
1031 3300010375 Ga0105239_10031117 Ga0105239_100311178 173
1032 3300011119 Ga0105246_10286655 Ga0105246_102866552 173
1033 3300012490 Ga0157322_1011987 Ga0157322_10119871 173
1034 3300013104 Ga0157370_10003332 Ga0157370_1000333218 173
1035 3300013105 Ga0157369_10054666 Ga0157369_100546663 173
1036 3300013297 Ga0157378_10629129 Ga0157378_106291292 173
1037 3300014326 Ga0157380_10012837 Ga0157380_100128373 173
1038 3300014326 Ga0157380_10124752 Ga0157380_101247522 173
1039 3300015265 Ga0182005_1059851 Ga0182005_10598511 173
1040 3300017792 Ga0163161_10127999 Ga0163161_101279992 173
1041 3300025910 Ga0207684_10007194 Ga0207684_100071944 173
1042 3300025913 Ga0207695_10138130 Ga0207695_101381301 173
1043 3300025913 Ga0207695_10376627 Ga0207695_103766272 173
1044 3300025914 Ga0207671_10056053 Ga0207671_100560532 173
1045 3300025917 Ga0207660_10068643 Ga0207660_100686432 173
1046 3300025931 Ga0207644_10020786 Ga0207644_100207862 173
1047 3300025933 Ga0207706_10017696 Ga0207706_100176962 173
1048 3300025935 Ga0207709_10587663 Ga0207709_105876631 173
1049 3300025938 Ga0207704_10225534 Ga0207704_102255342 173
1050 3300025949 Ga0207667_10539441 Ga0207667_105394412 173
1051 3300025981 Ga0207640_10057156 Ga0207640_100571563 173
1052 3300026067 Ga0207678_10083066 Ga0207678_100830661 173
1053 3300026089 Ga0207648_10179559 Ga0207648_101795592 173
1054 3300026116 Ga0207674_10048359 Ga0207674_100483592 173
1055 3300026118 Ga0207675_100866912 Ga0207675_1008669122 173
1056 3300026142 Ga0207698_10100486 Ga0207698_101004862 173
1057 3300026142 Ga0207698_10255540 Ga0207698_102555402 173
1058 3300027866 Ga0209813_10122536 Ga0209813_101225361 173
1059 3300027907 Ga0207428_10041116 Ga0207428_100411162 173
1060 3300028786 Ga0307517_10413969 Ga0307517_104139691 173
1061 3300028794 Ga0307515_10470527 Ga0307515_104705272 173
1062 3300030522 Ga0307512_10124236 Ga0307512_101242362 173
1063 3300031456 Ga0307513_10090348 Ga0307513_100903483 173
1064 3300031456 Ga0307513_10550424 Ga0307513_105504241 173
1065 3300031730 Ga0307516_10099481 Ga0307516_100994812 173
1066 3300031730 Ga0307516_10344365 Ga0307516_103443652 173
1067 3300031824 Ga0307413_10201349 Ga0307413_102013492 173
1068 3300031911 Ga0307412_10431217 Ga0307412_104312172 173
1069 3300032002 Ga0307416_100033297 Ga0307416_1000332973 173
1070 3300032002 Ga0307416_101019003 Ga0307416_1010190031 173
1071 3300033180 Ga0307510_10173630 Ga0307510_101736302 173
1072 3300042531 Ga0450918_040166 Ga0450918_040166_59_583 173
1073 3300046460 Ga0495638_0022034 Ga0495638_0022034_2673_3194 173
1074 3300046471 Ga0495650_0008406 Ga0495650_0008406_1107_1628 173
1075 3300046474 Ga0495605_0039596 Ga0495605_0039596_1746_2267 173
1076 3300046506 Ga0495583_0168690 Ga0495583_0168690_53_574 173
1077 3300046507 Ga0495606_0002420 Ga0495606_0002420_14443_14964 173
1078 3300046512 Ga0495610_0089206 Ga0495610_0089206_624_1145 173
1079 3300046512 Ga0495610_0298873 Ga0495610_0298873_54_575 173
1080 3300046513 Ga0495616_0000933 Ga0495616_0000933_14300_14821 173
1081 3300046515 Ga0495620_0010656 Ga0495620_0010656_1416_1937 173
1082 3300046518 Ga0495631_0000176 Ga0495631_0000176_27663_28184 173
1083 3300046519 Ga0495632_0023431 Ga0495632_0023431_709_1230 173
1084 3300046520 Ga0495637_0003577 Ga0495637_0003577_6612_7133 173
1085 3300046520 Ga0495637_0026699 Ga0495637_0026699_1194_1715 173
1086 3300046524 Ga0495648_0139802 Ga0495648_0139802_320_841 173
1087 3300046525 Ga0495663_0065291 Ga0495663_0065291_317_838 173
1088 3300046528 Ga0495642_0359572 Ga0495642_0359572_84_605 173
1089 3300046530 Ga0495654_0003294 Ga0495654_0003294_2302_2823 173
1090 3300046530 Ga0495654_0211074 Ga0495654_0211074_260_781 173
1091 3300046557 Ga0495622_0017968 Ga0495622_0017968_2536_3057 173
1092 3300046616 Ga0495668_0009680 Ga0495668_0009680_4662_5183 173
1093 3300046660 Ga0495625_0019215 Ga0495625_0019215_3462_3983 173
1094 3300046660 Ga0495625_0020257 Ga0495625_0020257_3030_3551 173
1095 3300046660 Ga0495625_0056406 Ga0495625_0056406_1441_1962 173
1096 3300046665 Ga0495661_0261924 Ga0495661_0261924_224_745 173
1097 3300046674 Ga0495588_0368698 Ga0495588_0368698_168_689 173
1098 3300046683 Ga0495658_0081857 Ga0495658_0081857_106_627 173
1099 3300046690 Ga0495624_0084705 Ga0495624_0084705_486_1007 173
1100 3300046691 Ga0495670_0401552 Ga0495670_0401552_90_611 173
1101 3300046692 Ga0495671_0001321 Ga0495671_0001321_15674_16195 173
1102 3300046694 Ga0495649_0001209 Ga0495649_0001209_13059_13580 173
1103 3300046794 Ga0495589_0020773 Ga0495589_0020773_2551_3072 173
1104 3300046809 Ga0495600_0425893 Ga0495600_0425893_24_545 173
1105 3300046810 Ga0495660_0004413 Ga0495660_0004413_7213_7734 173
1106 3300047321 Ga0495676_0236496 Ga0495676_0236496_115_636 173
1107 3300047323 Ga0495683_0181697 Ga0495683_0181697_39_560 173
1108 3300047443 Ga0495687_012212 Ga0495687_012212_1689_2210 173
1109 3300047673 Ga0495593_0090851 Ga0495593_0090851_834_1355 173
1110 3300048089 Ga0495614_0081431 Ga0495614_0081431_86_607 173
1111 3300048091 Ga0495626_0022010 Ga0495626_0022010_1640_2161 173
1112 3300048909 Ga0496106_0894476 Ga0496106_0894476_55_576 173
1113 3300048924 Ga0496121_0199642 Ga0496121_0199642_557_1078 173
1114 3300048926 Ga0496123_0127159 Ga0496123_0127159_157_678 173
1115 3300048927 Ga0496124_0300654 Ga0496124_0300654_463_984 173
1116 3300048929 Ga0496126_0081296 Ga0496126_0081296_1558_2079 173
1117 3300049460 Ga0495682_0109679 Ga0495682_0109679_24_545 173
1118 3300049569 Ga0501032_0110228 Ga0501032_0110228_427_966 173
1119 3300049577 Ga0501041_0406562 Ga0501041_0406562_69_593 173
1120 3300049579 Ga0501043_0000004 Ga0501043_0000004_94611_95150 173
1121 3300049580 Ga0501046_0000016 Ga0501046_0000016_196686_197225 173
1122 3300049581 Ga0501047_0000012 Ga0501047_0000012_196366_196905 173
1123 3300049582 Ga0501048_0000926 Ga0501048_0000926_3821_4360 173
1124 3300049582 Ga0501048_0791366 Ga0501048_0791366_67_591 173
1125 3300049587 Ga0501071_0041686 Ga0501071_0041686_534_1058 173
1126 3300049587 Ga0501071_0114982 Ga0501071_0114982_1171_1695 173
1127 3300049743 Ga0501081_0455501 Ga0501081_0455501_79_603 173
1128 3300049824 Ga0501045_0002191 Ga0501045_0002191_11463_12002 173
1129 3300049824 Ga0501045_0704258 Ga0501045_0704258_105_629 173
1130 3300050489 nmdc:mga03683_37272_c1 nmdc:mga03683_37272_c1_1173_1778 173
1131 3300050491 nmdc:mga00v17_152623_c1 nmdc:mga00v17_152623_c1_834_1439 173
1132 3300050491 nmdc:mga00v17_344318_c1 nmdc:mga00v17_344318_c1_354_875 173
1133 3300050492 nmdc:mga0yw44_119897_c1 nmdc:mga0yw44_119897_c1_916_1437 173
1134 3300050493 nmdc:mga0k408_19767_c1 nmdc:mga0k408_19767_c1_104_625 173
1135 3300050493 nmdc:mga0k408_31050_c1 nmdc:mga0k408_31050_c1_1929_2534 173
1136 3300050493 nmdc:mga0k408_33349_c1 nmdc:mga0k408_33349_c1_568_1089 173
1137 3300050493 nmdc:mga0k408_44858_c1 nmdc:mga0k408_44858_c1_188_709 173
1138 3300050493 nmdc:mga0k408_55074_c1 nmdc:mga0k408_55074_c1_1747_2271 173
1139 3300050493 nmdc:mga0k408_80835_c1 nmdc:mga0k408_80835_c1_340_861 173
1140 3300050495 nmdc:mga04h51_150436_c1 nmdc:mga04h51_150436_c1_141_662 173
1141 3300050496 nmdc:mga07m45_103848_c1 nmdc:mga07m45_103848_c1_781_1305 173
1142 3300050496 nmdc:mga07m45_1144_c1 nmdc:mga07m45_1144_c1_438_959 173
1143 3300050496 nmdc:mga07m45_245524_c1 nmdc:mga07m45_245524_c1_273_803 173
1144 3300050496 nmdc:mga07m45_2594_c1 nmdc:mga07m45_2594_c1_2696_3217 173
1145 3300050496 nmdc:mga07m45_83596_c1 nmdc:mga07m45_83596_c1_573_1094 173
1146 3300050509 nmdc:mga0qj67_520062_c1 nmdc:mga0qj67_520062_c1_137_661 173
1147 3300050511 nmdc:mga08y16_62434_c1 nmdc:mga08y16_62434_c1_3329_3853 173
1148 3300050511 nmdc:mga08y16_755306_c1 nmdc:mga08y16_755306_c1_176_700 173
1149 3300050515 nmdc:mga0a205_191393_c1 nmdc:mga0a205_191393_c1_311_835 173
1150 3300050516 nmdc:mga0sz30_230223_c1 nmdc:mga0sz30_230223_c1_102_623 173
1151 3300053079 Ga0500610_0003534 Ga0500610_0003534_1595_2116 173
1152 3300053079 Ga0500610_0032538 Ga0500610_0032538_1064_1585 173
1153 3300053087 Ga0500643_008391 Ga0500643_008391_2770_3291 173
1154 3300053093 Ga0500651_0000289 Ga0500651_0000289_27589_28110 173
1155 3300053094 Ga0500566_0078985 Ga0500566_0078985_794_1315 173
1156 3300053110 Ga0500571_000089 Ga0500571_000089_1076_1597 173
1157 3300053111 Ga0500572_076012 Ga0500572_076012_195_716 173
1158 3300053116 Ga0500592_004261 Ga0500592_004261_102_623 173
1159 3300053121 Ga0500607_000942 Ga0500607_000942_26263_26784 173
1160 3300053122 Ga0500608_011017 Ga0500608_011017_1577_2098 173
1161 3300053122 Ga0500608_075230 Ga0500608_075230_387_908 173
1162 3300053125 Ga0500618_027127 Ga0500618_027127_827_1348 173
1163 3300053129 Ga0500628_060006 Ga0500628_060006_86_607 173
1164 3300053134 Ga0500658_0000137 Ga0500658_0000137_11871_12392 173
1165 3300053134 Ga0500658_0000140 Ga0500658_0000140_21161_21682 173
1166 3300053134 Ga0500658_0015270 Ga0500658_0015270_1640_2161 173
1167 3300053138 Ga0500564_066507 Ga0500564_066507_747_1268 173
1168 3300053139 Ga0500568_0000735 Ga0500568_0000735_5591_6112 173
1169 3300053139 Ga0500568_0025308 Ga0500568_0025308_1518_2039 173
1170 3300053141 Ga0500574_019578 Ga0500574_019578_474_995 173
1171 3300053147 Ga0500589_010275 Ga0500589_010275_951_1472 173
1172 3300053153 Ga0500616_0079167 Ga0500616_0079167_23_544 173
1173 3300053158 Ga0500627_0043809 Ga0500627_0043809_570_1091 173
1174 3300053161 Ga0500634_0011590 Ga0500634_0011590_804_1325 173
1175 3300053161 Ga0500634_0018046 Ga0500634_0018046_2212_2733 173
1176 3300053162 Ga0500638_046305 Ga0500638_046305_895_1416 173
1177 3300053177 Ga0500636_0044573 Ga0500636_0044573_1109_1630 173
1178 3300054114 Ga0501084_0280439 Ga0501084_0280439_13_537 173
1179 3300061734 Ga0530510_0390804 Ga0530510_0390804_114_638 173
1180 3300001979 JGI24740J21852_10010212 JGI24740J21852_100102123 174
1181 3300002773 JGI25152J39213_1014372 JGI25152J39213_10143721 174
1182 3300002774 JGI25150J39212_1000692 JGI25150J39212_10006922 174
1183 3300002987 JGI25159J45721_1024032 JGI25159J45721_10240321 174
1184 3300002987 JGI25159J45721_1034896 JGI25159J45721_10348961 174
1185 3300003187 JGI25151J46595_10032862 JGI25151J46595_100328621 174
1186 3300003187 JGI25151J46595_10033648 JGI25151J46595_100336482 174
1187 3300003215 JGI25153J46596_10015324 JGI25153J46596_100153243 174
1188 3300003215 JGI25153J46596_10038516 JGI25153J46596_100385162 174
1189 3300003320 rootH2_10009454 rootH2_100094542 174
1190 3300003354 JGI25160J50197_1051024 JGI25160J50197_10510241 174
1191 3300003354 JGI25160J50197_1058914 JGI25160J50197_10589141 174
1192 3300003374 JGI25161J50226_1006587 JGI25161J50226_10065871 174
1193 3300003374 JGI25161J50226_1019299 JGI25161J50226_10192991 174
1194 3300003758 Ga0055532_1015032 Ga0055532_10150321 174
1195 3300003760 Ga0055527_1008415 Ga0055527_10084152 174
1196 3300003761 Ga0055535_1001074 Ga0055535_100107411 174
1197 3300003762 Ga0055542_1000074 Ga0055542_100007426 174
1198 3300003771 Ga0055526_1042004 Ga0055526_10420041 174
1199 3300003771 Ga0055526_1063622 Ga0055526_10636221 174
1200 3300003773 Ga0055537_1013714 Ga0055537_10137142 174
1201 3300003773 Ga0055537_1014024 Ga0055537_10140241 174
1202 3300003775 Ga0055524_1061519 Ga0055524_10615191 174
1203 3300003784 Ga0055534_1011553 Ga0055534_10115533 174
1204 3300003784 Ga0055534_1018301 Ga0055534_10183012 174
1205 3300003790 Ga0055528_1015002 Ga0055528_10150021 174
1206 3300003790 Ga0055528_1029096 Ga0055528_10290962 174
1207 3300003791 Ga0055530_10000437 Ga0055530_1000043712 174
1208 3300003794 Ga0055531_10025336 Ga0055531_100253362 174
1209 3300003794 Ga0055531_10027333 Ga0055531_100273332 174
1210 3300004625 Ga0055543_1043910 Ga0055543_10439101 174
1211 3300005262 Ga0065165_1011798 Ga0065165_10117982 174
1212 3300005539 Ga0068853_100011188 Ga0068853_1000111882 174
1213 3300005834 Ga0068851_10045449 Ga0068851_100454492 174
1214 3300010375 Ga0105239_10683668 Ga0105239_106836682 174
1215 3300012505 Ga0157339_1003029 Ga0157339_10030292 174
1216 3300013102 Ga0157371_10216837 Ga0157371_102168372 174
1217 3300013307 Ga0157372_10036787 Ga0157372_100367873 174
1218 3300025208 Ga0209436_115256 Ga0209436_1152562 174
1219 3300025228 Ga0209672_101328 Ga0209672_1013286 174
1220 3300025229 Ga0209147_101428 Ga0209147_1014289 174
1221 3300025242 Ga0209258_100176 Ga0209258_100176114 174
1222 3300025245 Ga0207425_1000133 Ga0207425_100013350 174
1223 3300025245 Ga0207425_1011401 Ga0207425_10114012 174
1224 3300025254 Ga0209148_1000033 Ga0209148_1000033245 174
1225 3300025258 Ga0209129_1000186 Ga0209129_100018635 174
1226 3300025258 Ga0209129_1009268 Ga0209129_10092682 174
1227 3300025263 Ga0209565_1000190 Ga0209565_100019026 174
1228 3300025263 Ga0209565_1004293 Ga0209565_10042933 174
1229 3300025273 Ga0209673_1000209 Ga0209673_100020922 174
1230 3300025273 Ga0209673_1000393 Ga0209673_100039326 174
1231 3300025273 Ga0209673_1008405 Ga0209673_10084053 174
1232 3300025284 Ga0209130_1000372 Ga0209130_10003722 174
1233 3300025284 Ga0209130_1015881 Ga0209130_10158812 174
1234 3300025291 Ga0209675_1000902 Ga0209675_10009022 174
1235 3300025291 Ga0209675_1006482 Ga0209675_10064822 174
1236 3300025292 Ga0209676_1000048 Ga0209676_100004875 174
1237 3300025294 Ga0209025_1001380 Ga0209025_10013803 174
1238 3300025294 Ga0209025_1019492 Ga0209025_10194923 174
1239 3300025295 Ga0209564_1000417 Ga0209564_100041750 174
1240 3300025295 Ga0209564_1000423 Ga0209564_10004232 174
1241 3300025297 Ga0209758_1000092 Ga0209758_1000092183 174
1242 3300025297 Ga0209758_1010418 Ga0209758_10104183 174
1243 3300025298 Ga0209050_1000012 Ga0209050_100001275 174
1244 3300025299 Ga0209256_1000094 Ga0209256_1000094153 174
1245 3300025299 Ga0209256_1000095 Ga0209256_1000095213 174
1246 3300025302 Ga0207426_1000084 Ga0207426_100008450 174
1247 3300025302 Ga0207426_1000161 Ga0207426_100016198 174
1248 3300025303 Ga0209051_1004369 Ga0209051_10043692 174
1249 3300025303 Ga0209051_1021299 Ga0209051_10212992 174
1250 3300025304 Ga0209257_1000024 Ga0209257_100002421 174
1251 3300025304 Ga0209257_1004734 Ga0209257_100473410 174
1252 3300025321 Ga0207656_10018338 Ga0207656_100183381 174
1253 3300025728 Ga0207655_1125068 Ga0207655_11250681 174
1254 3300026041 Ga0207639_10053359 Ga0207639_100533592 174
1255 3300042012 Ga0439455_0089309 Ga0439455_0089309_166_690 174
1256 3300048920 Ga0496117_0013969 Ga0496117_0013969_5044_5568 174
1257 3300048921 Ga0496118_0028081 Ga0496118_0028081_3660_4184 174
1258 3300048928 Ga0496125_0027812 Ga0496125_0027812_2414_2938 174

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d40-assembly1.cif.gz_C crystal structure of z3393 from escherichia coli o157:h7 0.8775 60 157
5m21-assembly1.cif.gz_C crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound 0.8749 10 174
4zxa-assembly1.cif.gz_B crystal structure of hydroquinone 1,2-dioxygenase pnpcd in complex with cd2+ and 4-hydroxybenzonitrile 0.8706 6 173
3nl1-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with gentisate 0.8676 60 157
5m21-assembly1.cif.gz_D crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound 0.8658 41 156
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8399 56 157 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8338 56 159 2.60.120.10
1zx5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8312 56 159 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8306 52 158 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8269 54 159 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2G4J352-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9839 40 173 GO:0051213
AF-A0A2G4J352-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.955 40 173 GO:0051213
AF-A0A7C5EWE8-F1-model_v4 Cupin domain-containing protein 0.908 45 159
AF-A0A0F0HFM9-F1-model_v4 Cupin 0.9065 43 158
AF-A0A7Y8RJY2-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9046 10 174 GO:0051213

Feature Viewer

pLDDT pTM Quality
86.99 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map