F492253

General Info

Members Datasets Scaffolds Average Seq Length
1255 817 816 405

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8019659431|8019665203
Length 443
Sequence RYRAARRSHPENHRDHAMTIAVFTLSLLGAMALGMPIAFALIVCGVALMSTIDMFDAQIVAQNVINGADSFPLMAIPFFMLAGEVMNKGGLAKRIVNVALVAVGHFRGGLGYVTILASCILASLSGSAAADAAALAALLVPMMVAAGHKKSYAAGLVAAGGIIAPVIPPSIGFVIFGVAAGVSISKLFLAGIVPGLLLGAGLCLAWAWVVRKENLTPPPRASLSEMVKAVVDGFWALMLPLIIVVGLRFGIFTPTEAAVVVAVYSLFVATCVYRELKLPQLYVIFVSSAVTTSIVMFLVAAALVSSWLITVSEISAQIVTLLKPFMGNNTLLMLAIMVVVVIVGTALDMTPTILILTPILMPIVKAAGIDPVYFGVLFIINNAIGLITPPVGIVLNVVCGVSRISMEDIVKGVWPFMIAQLIVLFAMVLFPGLVTIPAKWFGG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501050 Microvirga lupini Lut6 Isolate Nodule
6 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
7 2509276019 Ensifer aridi TW10 Isolate Nodule
8 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
9 2511231008 Pseudomonas sp. GM21 Isolate Nodule
10 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
13 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
14 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
15 2516143018 Ensifer sp. BR816 Isolate Nodule
16 2519899620 Rhizobium sp. Pop5 Isolate Nodule
17 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
18 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
19 2547132374 Acidovorax radicis N35 Isolate Unclassified
20 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
21 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
22 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
23 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
24 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
25 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
26 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
27 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
28 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
29 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
30 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
31 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
32 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
33 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
34 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
35 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
36 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
37 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
38 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
39 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
40 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
41 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
42 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
43 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
44 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
45 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
46 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
47 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
48 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
49 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
50 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
51 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
52 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
53 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
54 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
55 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
56 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
57 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
58 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
59 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
60 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
61 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
62 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
63 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
64 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
65 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
66 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
67 2643221569 Achromobacter sp. Root565 Isolate Unclassified
68 2643221570 Acidovorax sp. Root568 Isolate Unclassified
69 2643221582 Rhizobium sp. Root651 Isolate Unclassified
70 2643221596 Acidovorax sp. Root70 Isolate Unclassified
71 2643221607 Rhizobium sp. Root73 Isolate Unclassified
72 2643221609 Acidovorax sp. Root217 Isolate Unclassified
73 2643221611 Acidovorax sp. Root219 Isolate Unclassified
74 2643221621 Achromobacter sp. Root83 Isolate Unclassified
75 2643221626 Ensifer sp. Root31 Isolate Unclassified
76 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
77 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
78 2643221652 Acidovorax sp. Root402 Isolate Unclassified
79 2643221658 Variovorax sp. Root411 Isolate Unclassified
80 2643221672 Variovorax sp. Root434 Isolate Unclassified
81 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
82 2643221693 Rhizobium sp. Root491 Isolate Unclassified
83 2643221717 Acidovorax sp. Root267 Isolate Unclassified
84 2643221736 Bosea sp. Root483D1 Isolate Unclassified
85 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
86 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
87 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
88 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
89 2718217882 Rhizobium sp. N741 Isolate Nodule
90 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
91 2718218009 Rhizobium sp. N561 Isolate Nodule
92 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
93 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
94 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
95 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
96 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
97 2718218363 Rhizobium sp. N113 Isolate Nodule
98 2718218365 Rhizobium sp. N731 Isolate Nodule
99 2718218366 Rhizobium sp. N621 Isolate Nodule
100 2721755514 Rhizobium sp. N6212 Isolate Nodule
101 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
102 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
103 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
104 2721755810 Rhizobium sp. N871 Isolate Nodule
105 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
106 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
107 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
108 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
109 2728369365 Rhizobium sp. N1341 Isolate Nodule
110 2728369397 Rhizobium sp. N1314 Isolate Nodule
111 2738541277 Variovorax sp. GV051 Isolate Unclassified
112 2738543012 Acidovorax sp. CF301 Isolate Unclassified
113 2738543019 Variovorax sp. GV040 Isolate Unclassified
114 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
115 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
116 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
117 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
118 2773857925 Microvirga vignae BR3299 Isolate Unclassified
119 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
120 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
121 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
122 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
123 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
124 2791355256 Rhizobium sp. M10 Isolate Nodule
125 2791355260 Rhizobium sp. L9 Isolate Nodule
126 2791355261 Rhizobium sp. J15 Isolate Nodule
127 2791355262 Rhizobium sp. M1 Isolate Nodule
128 2791355264 Rhizobium sp. S9 Isolate Nodule
129 2791355265 Rhizobium sp. H4 Isolate Nodule
130 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
131 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
132 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
133 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
134 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
135 2816332133 Acidovorax radicis 2721A Isolate Unclassified
136 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
137 2818991446 Variovorax sp. 1180 Isolate Unclassified
138 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
139 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
140 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
141 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
142 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
143 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
144 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
145 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
146 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
147 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
148 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
149 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
150 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
151 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
152 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
153 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
154 2838061910 Rhizobium phaseoli L15 Isolate Nodule
155 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
156 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
157 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
158 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
159 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
160 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
161 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
162 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
163 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
164 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
165 2841760612 Bosea sp. Tri-49 Isolate Nodule
166 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
167 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
168 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
169 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
170 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
171 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
172 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
173 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
174 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
175 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
176 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
177 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
178 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
179 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
180 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
181 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
182 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
183 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
184 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
185 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
186 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
187 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
188 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
189 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
190 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
191 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
192 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
193 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
194 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
195 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
196 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
197 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
198 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
199 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
200 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
201 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
202 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
203 2842677519 Variovorax sp. R-72495 Isolate Unclassified
204 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
205 2842733646 Variovorax sp. R-72446 Isolate Unclassified
206 2842747753 Variovorax sp. R-72060 Isolate Unclassified
207 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
208 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
209 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
210 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
211 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
212 2844104063 Bosea sp. Tri-39 Isolate Nodule
213 2844163670 Ensifer sp. 1H6 Isolate Unclassified
214 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
215 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
216 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
217 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
218 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
219 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
220 2851182111 Bosea sp. Tri-44 Isolate Nodule
221 2851246043 Bosea sp. Tri-54 Isolate Nodule
222 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
223 2854911287 Brucella lupini LUP21 Isolate Unclassified
224 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
225 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
226 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
227 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
228 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
229 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
230 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
231 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
232 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
233 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
234 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
235 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
236 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
237 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
238 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
239 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
240 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
241 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
242 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
243 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
244 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
245 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
246 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
247 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
248 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
249 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
250 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
251 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
252 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
253 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
254 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
255 2899924645 Variovorax sp. 369 Isolate Unclassified
256 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
257 2904456579 Variovorax sp. 2002 Isolate Unclassified
258 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
259 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
260 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
261 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
262 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
263 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
264 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
265 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
266 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
267 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
268 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
269 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
270 2922368715
271 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
272 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
273 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
274 2928037797 Variovorax sp. 1126 Isolate Unclassified
275 2928044640 Variovorax sp. 1128 Isolate Unclassified
276 2928051484 Variovorax sp. 1133 Isolate Unclassified
277 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
278 2928070936 Variovorax gossypii 1167 Isolate Unclassified
279 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
280 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
281 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
282 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
283 2929520902 Variovorax beijingensis 502 Isolate Unclassified
284 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
285 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
286 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
287 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
288 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
289 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
290 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
291 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
292 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
293 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
294 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
295 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
296 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
297 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
298 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
299 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
300 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
301 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
302 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
303 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
304 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
305 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
306 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
307 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
308 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
309 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
310 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
311 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
312 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
313 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
314 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
315 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
316 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
317 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
318 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
319 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
320 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
321 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
322 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
323 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
324 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
325 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
326 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
327 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
328 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
329 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
330 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
331 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
332 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
333 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
334 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
335 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
336 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
337 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
338 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
339 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
340 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
341 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
342 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
343 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
344 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
345 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
346 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
347 2941479691
348 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
349 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
350 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
351 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
352 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
353 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
354 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
355 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
356 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
357 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
358 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
359 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
360 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
361 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
362 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
363 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
364 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
365 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
366 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
367 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
368 2996893221 Rhizobium sp. R635 Isolate Nodule
369 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
370 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
371 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
372 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
373 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
374 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
375 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
376 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
377 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
378 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
379 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
380 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
381 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
382 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
383 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
384 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
385 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
386 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
387 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
388 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
389 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
390 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
391 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
392 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
393 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
394 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
395 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
396 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
397 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
398 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
399 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
400 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
401 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
402 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
403 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
404 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
405 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
406 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
407 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
408 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
409 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
410 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
411 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
412 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
413 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
414 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
415 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
416 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
417 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
418 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
419 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
420 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
421 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
422 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
423 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
424 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
425 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
426 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
427 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
428 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
429 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
430 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
431 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
432 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
433 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
434 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
435 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
436 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
437 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
438 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
439 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
440 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
441 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
442 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
443 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
444 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
445 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
446 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
447 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
448 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
449 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
450 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
451 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
452 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
453 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
454 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
455 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
456 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
457 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
458 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
459 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
460 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
461 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
462 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
463 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
464 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
465 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
466 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
467 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
468 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
469 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
470 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
471 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
472 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
473 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
474 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
475 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
476 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
477 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
478 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
479 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
480 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
481 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
482 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
483 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
484 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
485 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
486 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
487 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
488 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
489 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
490 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
491 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
492 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
493 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
494 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
495 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
496 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
497 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
498 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
499 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
500 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
501 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
502 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
503 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
504 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
505 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
506 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
507 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
508 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
509 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
510 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
511 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
512 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
513 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
514 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
515 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
516 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
517 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
518 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
519 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
520 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
522 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
523 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
525 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
526 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
528 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
530 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
531 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
532 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
533 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
534 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
535 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
539 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
541 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
542 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
543 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
545 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
546 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
547 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
548 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
549 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
550 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
551 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
552 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
553 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
554 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
555 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
556 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
557 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
558 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
559 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
560 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
561 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
562 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
563 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
564 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
565 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
566 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
567 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
568 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
569 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
570 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
571 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
572 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
573 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
574 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
575 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
576 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
577 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
578 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
579 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
580 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
581 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
582 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
583 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
584 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
585 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
586 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
587 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
588 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
589 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
590 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
591 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
592 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
593 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
594 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
595 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
596 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
597 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
598 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
599 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
600 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
601 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
602 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
603 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
604 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
605 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
606 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
607 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
608 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
609 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
610 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
611 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
612 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
613 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
614 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
615 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
616 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
617 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
618 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
619 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
620 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
621 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
622 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
623 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
624 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
625 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
626 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
627 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
628 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
629 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
630 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
631 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
632 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
633 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
634 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
635 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
636 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
637 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
638 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
639 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
640 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
641 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
642 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
643 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
644 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
645 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
646 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
647 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
648 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
649 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
650 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
651 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
652 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
653 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
654 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
655 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
656 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
657 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
658 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
659 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
660 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
661 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
662 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
663 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
664 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
665 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
666 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
667 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
668 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
669 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
670 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
671 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
672 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
673 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
674 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
675 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
676 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
677 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
678 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
679 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
680 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
681 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
682 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
683 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
684 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
685 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
686 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
687 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
688 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
689 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
690 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
691 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
692 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
693 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
694 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
695 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
696 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
697 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
698 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
699 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
700 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
701 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
702 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
703 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
704 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
705 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
706 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
707 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
708 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
709 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
710 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
711 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
712 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
713 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
714 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
715 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
716 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
717 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
718 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
719 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
720 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
721 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
722 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
723 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
724 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
725 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
726 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
727 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
728 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
729 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
730 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
731 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
732 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
733 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
734 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
735 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
736 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
737 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
738 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
739 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
740 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
741 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
742 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
743 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
744 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
745 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
746 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
747 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
748 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
749 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
750 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
751 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
752 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
753 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
754 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
755 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
756 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
757 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
758 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
759 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
760 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
761 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
762 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
763 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
764 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
765 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
766 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
767 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
768 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
769 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
770 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
771 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
772 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
773 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
774 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
775 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
776 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
777 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
778 8005382845 Rhizobium sp. R634 Isolate Nodule
779 8005395548 Rhizobium sp. R339 Isolate Nodule
780 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
781 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
782 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
783 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
784 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
785 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
786 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
787 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
788 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
789 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
790 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
791 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
792 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
793 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
794 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
795 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
796 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
797 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
798 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
799 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
800 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
801 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
802 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
803 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
804 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
805 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
806 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
807 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
808 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
809 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
810 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
811 8024501048 Rhizobium sp. H4 Isolate Nodule
812 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
813 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
814 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
815 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
816 8056382006 Rhizobium croatiense 13T Isolate Nodule
817 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.83
Metatranscriptomes 0.24
Isolates 34.93

Biome Distribution

Category Percentage (%)
Aerial Root 0.24
Bulb 0
Endosphere 16.33
Nodule 17.93
Rhizoplane 6.69
Rhizosphere 43.59
Stem 0
Stem Tuber 0
Unclassified 15.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2555482 2162886007 Bacteria 18248
2 JGI24740J21852_10002160 3300001979 Bacteria 8985
3 JGI24739J22299_10007080 3300001989 Bacteria 4222
4 JGI25155J39150_1000024 3300002704 Bacteria 133561
5 JGI25156J39149_1000005 3300002705 Bacteria 263980
6 JGI25154J39366_1000017 3300002738 Bacteria 252448
7 JGI25157J39369_1000003 3300002741 Bacteria 274935
8 JGI25157J39369_1000054 3300002741 Bacteria 108825
9 JGI25159J45721_1000273 3300002987 Bacteria 24188
10 JGI25151J46595_10000162 3300003187 Bacteria 86356
11 JGI25151J46595_10000323 3300003187 Bacteria 51894
12 JGI25151J46595_10000616 3300003187 Bacteria 31174
13 JGI25151J46595_10001493 3300003187 Bacteria 15731
14 JGI25151J46595_10002779 3300003187 Bacteria 10145
15 JGI25151J46595_10037173 3300003187 Bacteria 1828
16 JGI25406J46586_10000127 3300003203 Bacteria 33062
17 JGI25153J46596_10000454 3300003215 Bacteria 26254
18 JGI25153J46596_10000458 3300003215 Bacteria 26109
19 JGI25153J46596_10005476 3300003215 Bacteria 6648
20 JGI25160J50197_1000483 3300003354 Bacteria 24188
21 JGI25160J50197_1000885 3300003354 Bacteria 15764
22 JGI25160J50197_1001425 3300003354 Bacteria 11968
23 JGI25160J50197_1003106 3300003354 Bacteria 7577
24 JGI25161J50226_1000352 3300003374 Bacteria 24188
25 Ga0006562J51391_1036730 3300003578 Bacteria 3188
26 Ga0055536_1000791 3300003781 Bacteria 21013
27 Ga0055536_1003436 3300003781 Bacteria 8500
28 Ga0055534_1004223 3300003784 Bacteria 4234
29 Ga0055530_10000022 3300003791 Bacteria 136894
30 Ga0055530_10000438 3300003791 Bacteria 36992
31 Ga0055540_1000382 3300003792 Bacteria 36992
32 Ga0055540_1000395 3300003792 Bacteria 35841
33 Ga0055531_10000392 3300003794 Bacteria 42357
34 Ga0058692_1005471 3300003856 Bacteria 3617
35 Ga0058692_1007863 3300003856 Bacteria 2787
36 Ga0055543_1003801 3300004625 Bacteria 4295
37 Ga0055543_1006051 3300004625 Bacteria 2989
38 Ga0055543_1011419 3300004625 Bacteria 1818
39 Ga0065165_1000393 3300005262 Bacteria 71081
40 Ga0065165_1000435 3300005262 Bacteria 65756
41 Ga0065165_1002316 3300005262 Bacteria 16664
42 Ga0065165_1005208 3300005262 Bacteria 7478
43 Ga0065165_1021088 3300005262 Bacteria 2272
44 Ga0065714_10002256 3300005288 Bacteria 34427
45 Ga0065714_10004812 3300005288 Bacteria 5270
46 Ga0065704_10070552 3300005289 Bacteria 20811
47 Ga0065712_10067809 3300005290 Bacteria 30647
48 Ga0070676_10000423 3300005328 Bacteria 20014
49 Ga0070690_100011894 3300005330 Bacteria 5108
50 Ga0070670_100000540 3300005331 Bacteria 30079
51 Ga0070670_100009738 3300005331 Bacteria 8206
52 Ga0070670_100019756 3300005331 Bacteria 5785
53 Ga0070670_100124977 3300005331 Bacteria 2220
54 Ga0070677_10001412 3300005333 Bacteria 7647
55 Ga0070677_10020404 3300005333 Bacteria 2414
56 Ga0070666_10010604 3300005335 Bacteria 5766
57 Ga0070680_100046239 3300005336 Bacteria 3540
58 Ga0068868_100002392 3300005338 Bacteria 12985
59 Ga0068868_100008937 3300005338 Bacteria 7188
60 Ga0070660_100001543 3300005339 Bacteria 15811
61 Ga0070691_10102534 3300005341 Bacteria 1423
62 Ga0070668_100130297 3300005347 Bacteria 2018
63 Ga0070669_100046205 3300005353 Bacteria 3175
64 Ga0070675_100000613 3300005354 Bacteria 24612
65 Ga0070675_100006144 3300005354 Bacteria 9206
66 Ga0070675_100019963 3300005354 Bacteria 5346
67 Ga0070671_100020945 3300005355 Bacteria 5335
68 Ga0070671_100035174 3300005355 Bacteria 4150
69 Ga0070671_100058651 3300005355 Bacteria 3204
70 Ga0070671_100071366 3300005355 Bacteria 2898
71 Ga0070674_100004301 3300005356 Bacteria 8104
72 Ga0070674_100004334 3300005356 Bacteria 8087
73 Ga0070674_100215607 3300005356 Bacteria 1490
74 Ga0070673_100004590 3300005364 Bacteria 8754
75 Ga0070673_100010305 3300005364 Bacteria 6321
76 Ga0070673_100060505 3300005364 Bacteria 3001
77 Ga0070688_100011113 3300005365 Bacteria 4998
78 Ga0070659_100004414 3300005366 Bacteria 10045
79 Ga0070667_100010275 3300005367 Bacteria 7735
80 Ga0070710_10006325 3300005437 Bacteria 5682
81 Ga0070663_100153489 3300005455 Bacteria 1767
82 Ga0070663_100164293 3300005455 Bacteria 1711
83 Ga0070678_100004507 3300005456 Bacteria 7907
84 Ga0070678_100055870 3300005456 Bacteria 2884
85 Ga0070662_100000314 3300005457 Bacteria 28884
86 Ga0070662_100019907 3300005457 Bacteria 4565
87 Ga0070662_100100221 3300005457 Bacteria 2191
88 Ga0070681_10001122 3300005458 Bacteria 22959
89 Ga0070681_10051971 3300005458 Bacteria 4086
90 Ga0068867_100011295 3300005459 Bacteria 6299
91 Ga0068867_100164844 3300005459 Bacteria 1750
92 Ga0070685_10030732 3300005466 Bacteria 2995
93 Ga0070706_100000680 3300005467 Bacteria 38488
94 Ga0070706_100069273 3300005467 Bacteria 3263
95 Ga0070707_100072123 3300005468 Bacteria 3328
96 Ga0070698_100177318 3300005471 Bacteria 2070
97 Ga0068853_100001041 3300005539 Bacteria 19601
98 Ga0068853_100042417 3300005539 Bacteria 3890
99 Ga0068853_100046332 3300005539 Bacteria 3728
100 Ga0070672_100004415 3300005543 Bacteria 9204
101 Ga0070672_100034386 3300005543 Bacteria 3846
102 Ga0070672_100120954 3300005543 Bacteria 2143
103 Ga0070672_100137273 3300005543 Bacteria 2014
104 Ga0070672_100232820 3300005543 Bacteria 1548
105 Ga0070686_100074033 3300005544 Bacteria 2237
106 Ga0070665_100056683 3300005548 Bacteria 3929
107 Ga0070665_100060634 3300005548 Bacteria 3792
108 Ga0070665_100115556 3300005548 Bacteria 2686
109 Ga0070704_100113072 3300005549 Bacteria 2070
110 Ga0068855_100006143 3300005563 Bacteria 14641
111 Ga0068855_100032864 3300005563 Bacteria 6193
112 Ga0068855_100073215 3300005563 Bacteria 3981
113 Ga0068855_100129838 3300005563 Bacteria 2879
114 Ga0070664_100023799 3300005564 Bacteria 5060
115 Ga0070664_100058106 3300005564 Bacteria 3289
116 Ga0070664_100128212 3300005564 Bacteria 2227
117 Ga0068857_100285160 3300005577 Bacteria 1520
118 Ga0068856_100044734 3300005614 Bacteria 4357
119 Ga0068852_100098566 3300005616 Bacteria 2632
120 Ga0068852_100290300 3300005616 Bacteria 1580
121 Ga0068859_100001476 3300005617 Bacteria 23924
122 Ga0068859_100209286 3300005617 Bacteria 2036
123 Ga0068864_100000212 3300005618 Bacteria 52395
124 Ga0068864_100014385 3300005618 Bacteria 6571
125 Ga0068861_100084356 3300005719 Bacteria 2494
126 Ga0068870_10002691 3300005840 Bacteria 7449
127 Ga0068863_100001367 3300005841 Bacteria 24264
128 Ga0068863_100010812 3300005841 Bacteria 8850
129 Ga0068863_100055965 3300005841 Bacteria 3734
130 Ga0068863_100075563 3300005841 Bacteria 3187
131 Ga0068858_100002088 3300005842 Bacteria 20307
132 Ga0068858_100150134 3300005842 Bacteria 2191
133 Ga0068860_100270278 3300005843 Bacteria 1659
134 Ga0068860_100270757 3300005843 Bacteria 1657
135 Ga0068862_100146573 3300005844 Bacteria 2098
136 Ga0081455_10028320 3300005937 Bacteria 5120
137 Ga0081455_10046638 3300005937 Bacteria 3758
138 Ga0081540_1005412 3300005983 Bacteria 9530
139 Ga0081540_1006083 3300005983 Bacteria 8872
140 Ga0081540_1016256 3300005983 Bacteria 4666
141 Ga0081540_1016775 3300005983 Bacteria 4565
142 Ga0081539_10000129 3300005985 Bacteria 178675
143 Ga0081539_10005493 3300005985 Bacteria 12877
144 Ga0081539_10017043 3300005985 Bacteria 5132
145 Ga0075365_10003264 3300006038 Bacteria 8312
146 Ga0075365_10020188 3300006038 Bacteria 4126
147 Ga0075365_10037179 3300006038 Bacteria 3159
148 Ga0075365_10048159 3300006038 Bacteria 2804
149 Ga0075365_10105278 3300006038 Bacteria 1935
150 Ga0075365_10135837 3300006038 Bacteria 1704
151 Ga0075368_10002604 3300006042 Bacteria 5915
152 Ga0075368_10032229 3300006042 Bacteria 2034
153 Ga0075363_100026100 3300006048 Bacteria 2986
154 Ga0075363_100044611 3300006048 Bacteria 2349
155 Ga0075363_100072228 3300006048 Bacteria 1876
156 Ga0075364_10007198 3300006051 Bacteria 6589
157 Ga0075364_10039004 3300006051 Bacteria 3078
158 Ga0075364_10069203 3300006051 Bacteria 2322
159 Ga0075364_10083930 3300006051 Bacteria 2109
160 Ga0070716_100056515 3300006173 Bacteria 2251
161 Ga0070712_100025017 3300006175 Bacteria 3963
162 Ga0070712_100040680 3300006175 Bacteria 3188
163 Ga0075362_10007237 3300006177 Bacteria 4189
164 Ga0075362_10026692 3300006177 Bacteria 2469
165 Ga0075367_10001552 3300006178 Bacteria 9927
166 Ga0075367_10006457 3300006178 Bacteria 5928
167 Ga0075367_10010157 3300006178 Bacteria 4938
168 Ga0075367_10020931 3300006178 Bacteria 3649
169 Ga0075367_10054273 3300006178 Bacteria 2376
170 Ga0075367_10118393 3300006178 Bacteria 1631
171 Ga0075369_10006145 3300006186 Bacteria 4530
172 Ga0075369_10007612 3300006186 Bacteria 4137
173 Ga0075369_10022344 3300006186 Bacteria 2608
174 Ga0075369_10040790 3300006186 Bacteria 1985
175 Ga0075366_10001115 3300006195 Bacteria 13221
176 Ga0075366_10006288 3300006195 Bacteria 6496
177 Ga0075366_10008595 3300006195 Bacteria 5685
178 Ga0075366_10056681 3300006195 Bacteria 2327
179 Ga0075366_10071680 3300006195 Bacteria 2064
180 Ga0097621_100040078 3300006237 Bacteria 3764
181 Ga0075370_10002782 3300006353 Bacteria 8198
182 Ga0075370_10023143 3300006353 Bacteria 3419
183 Ga0075370_10045805 3300006353 Bacteria 2474
184 Ga0075428_100001618 3300006844 Bacteria 24075
185 Ga0075428_100056566 3300006844 Bacteria 4297
186 Ga0075428_100381278 3300006844 Bacteria 1511
187 Ga0075430_100024745 3300006846 Bacteria 5107
188 Ga0075430_100150711 3300006846 Bacteria 1937
189 Ga0075431_100007036 3300006847 Bacteria 11174
190 Ga0075434_100148420 3300006871 Bacteria 2365
191 Ga0075429_100006885 3300006880 Bacteria 9869
192 Ga0075429_100022227 3300006880 Bacteria 5502
193 Ga0075429_100149349 3300006880 Bacteria 2046
194 Ga0068865_100055813 3300006881 Bacteria 2750
195 Ga0068865_100061310 3300006881 Bacteria 2636
196 Ga0097620_100001476 3300006931 Bacteria 23924
197 Ga0097620_100209282 3300006931 Bacteria 2036
198 Ga0079104_1009489 3300006946 Bacteria 3289
199 Ga0099826_10000013 3300006948 Bacteria 265459
200 Ga0099826_10069819 3300006948 Bacteria 2237
201 Ga0105244_10013800 3300009036 Bacteria 4702
202 Ga0105240_10002091 3300009093 Bacteria 32664
203 Ga0111539_10000418 3300009094 Bacteria 53186
204 Ga0105245_10015214 3300009098 Bacteria 6704
205 Ga0105245_10208600 3300009098 Bacteria 1879
206 Ga0105247_10014154 3300009101 Bacteria 4785
207 Ga0105247_10015117 3300009101 Bacteria 4630
208 Ga0105247_10053536 3300009101 Bacteria 2490
209 Ga0114129_10000336 3300009147 Bacteria 55036
210 Ga0114129_10466851 3300009147 Bacteria 1653
211 Ga0105243_10005737 3300009148 Bacteria 9639
212 Ga0105243_10006368 3300009148 Bacteria 9121
213 Ga0105243_10191857 3300009148 Bacteria 1785
214 Ga0105241_10017947 3300009174 Bacteria 5202
215 Ga0105241_10021271 3300009174 Bacteria 4794
216 Ga0105241_10258695 3300009174 Bacteria 1479
217 Ga0105248_10015734 3300009177 Bacteria 8338
218 Ga0105248_10030563 3300009177 Bacteria 6015
219 Ga0105248_10075042 3300009177 Bacteria 3800
220 Ga0105237_10001252 3300009545 Bacteria 33910
221 Ga0105237_10064955 3300009545 Bacteria 3646
222 Ga0105238_10006513 3300009551 Bacteria 11620
223 Ga0105238_10088911 3300009551 Bacteria 3076
224 Ga0105238_10216545 3300009551 Bacteria 1891
225 Ga0105249_10025877 3300009553 Bacteria 5286
226 Ga0105249_10064073 3300009553 Bacteria 3378
227 Ga0105249_10112151 3300009553 Bacteria 2579
228 Ga0105239_10012384 3300010375 Bacteria 9497
229 Ga0105239_10017719 3300010375 Bacteria 7879
230 Ga0105239_10031204 3300010375 Bacteria 5862
231 Ga0105239_10079779 3300010375 Bacteria 3601
232 Ga0105239_10229993 3300010375 Bacteria 2080
233 Ga0105246_10011263 3300011119 Bacteria 5547
234 Ga0105246_10029661 3300011119 Bacteria 3604
235 Ga0105246_10043205 3300011119 Bacteria 3057
236 Ga0105246_10066598 3300011119 Bacteria 2522
237 Ga0105246_10072651 3300011119 Bacteria 2426
238 Ga0105246_10095463 3300011119 Bacteria 2153
239 Ga0157373_10005155 3300013100 Bacteria 9824
240 Ga0157373_10006975 3300013100 Bacteria 8415
241 Ga0157373_10028318 3300013100 Bacteria 4041
242 Ga0157371_10000071 3300013102 Bacteria 164088
243 Ga0157371_10005016 3300013102 Bacteria 11345
244 Ga0157370_10000324 3300013104 Bacteria 59791
245 Ga0157370_10001357 3300013104 Bacteria 30329
246 Ga0157370_10081310 3300013104 Bacteria 3049
247 Ga0157370_10100354 3300013104 Bacteria 2712
248 Ga0157374_10022494 3300013296 Bacteria 5623
249 Ga0157374_10116736 3300013296 Bacteria 2572
250 Ga0163162_10078424 3300013306 Bacteria 3369
251 Ga0163162_10212367 3300013306 Bacteria 2065
252 Ga0157372_10000840 3300013307 Bacteria 33302
253 Ga0157375_10034947 3300013308 Bacteria 4793
254 Ga0157375_10376172 3300013308 Bacteria 1587
255 Ga0163163_10004624 3300014325 Bacteria 11756
256 Ga0163163_10008095 3300014325 Bacteria 9314
257 Ga0163163_10243246 3300014325 Bacteria 1849
258 Ga0157380_10003991 3300014326 Bacteria 10184
259 Ga0182008_10000325 3300014497 Bacteria 37641
260 Ga0182008_10001424 3300014497 Bacteria 16035
261 Ga0157379_10025267 3300014968 Bacteria 5275
262 Ga0157379_10215329 3300014968 Bacteria 1740
263 Ga0157376_10039160 3300014969 Bacteria 3863
264 Ga0157376_10041642 3300014969 Bacteria 3762
265 Ga0157376_10199753 3300014969 Bacteria 1839
266 Ga0182006_1002542 3300015261 Bacteria 9896
267 Ga0182006_1038795 3300015261 Bacteria 1882
268 Ga0182007_10000588 3300015262 Bacteria 21348
269 Ga0182007_10008452 3300015262 Bacteria 4229
270 Ga0163161_10109587 3300017792 Bacteria 2063
271 Ga0213876_10008758 3300021384 Bacteria 5464
272 Ga0209435_100002 3300025206 Bacteria 794178
273 Ga0209436_100352 3300025208 Bacteria 20774
274 Ga0209436_110094 3300025208 Bacteria 1748
275 Ga0207425_1000243 3300025245 Bacteria 41823
276 Ga0209646_1000001 3300025246 Bacteria 3092932
277 Ga0209026_1000001 3300025250 Bacteria 1228671
278 Ga0209148_1000270 3300025254 Bacteria 81508
279 Ga0209759_1000001 3300025256 Bacteria 2799452
280 Ga0209129_1000030 3300025258 Bacteria 391958
281 Ga0209233_1002691 3300025261 Bacteria 6415
282 Ga0209565_1000019 3300025263 Bacteria 438920
283 Ga0209565_1000678 3300025263 Bacteria 21266
284 Ga0209455_1003700 3300025272 Bacteria 5293
285 Ga0209673_1000095 3300025273 Bacteria 197466
286 Ga0209673_1000121 3300025273 Bacteria 170539
287 Ga0209673_1002789 3300025273 Bacteria 11363
288 Ga0209130_1000011 3300025284 Bacteria 431723
289 Ga0209130_1000061 3300025284 Bacteria 200990
290 Ga0209130_1000395 3300025284 Bacteria 47652
291 Ga0209130_1000450 3300025284 Bacteria 43201
292 Ga0209130_1000903 3300025284 Bacteria 23947
293 Ga0209675_1000073 3300025291 Bacteria 163009
294 Ga0209675_1001531 3300025291 Bacteria 13204
295 Ga0209675_1002999 3300025291 Bacteria 8308
296 Ga0209675_1007816 3300025291 Bacteria 4029
297 Ga0209676_1000193 3300025292 Bacteria 136946
298 Ga0209676_1001123 3300025292 Bacteria 29456
299 Ga0209676_1001188 3300025292 Bacteria 28027
300 Ga0209676_1002784 3300025292 Bacteria 11629
301 Ga0209676_1005394 3300025292 Bacteria 6702
302 Ga0209025_1000029 3300025294 Bacteria 488571
303 Ga0209025_1000145 3300025294 Bacteria 181436
304 Ga0209025_1000146 3300025294 Bacteria 180022
305 Ga0209025_1000494 3300025294 Bacteria 75744
306 Ga0209025_1001416 3300025294 Bacteria 31774
307 Ga0209025_1010461 3300025294 Bacteria 6282
308 Ga0209025_1011968 3300025294 Bacteria 5632
309 Ga0209025_1018594 3300025294 Bacteria 3923
310 Ga0209564_1000056 3300025295 Bacteria 340873
311 Ga0209564_1002665 3300025295 Bacteria 13561
312 Ga0209564_1014814 3300025295 Bacteria 3214
313 Ga0209564_1016881 3300025295 Bacteria 2879
314 Ga0209758_1000021 3300025297 Bacteria 697691
315 Ga0209758_1000037 3300025297 Bacteria 439101
316 Ga0209758_1000458 3300025297 Bacteria 67627
317 Ga0209758_1002993 3300025297 Bacteria 16182
318 Ga0209758_1003945 3300025297 Bacteria 12887
319 Ga0209758_1013030 3300025297 Bacteria 4581
320 Ga0209758_1038791 3300025297 Bacteria 1822
321 Ga0209050_1000193 3300025298 Bacteria 136946
322 Ga0209050_1000704 3300025298 Bacteria 49577
323 Ga0209050_1000960 3300025298 Bacteria 37189
324 Ga0209050_1005033 3300025298 Bacteria 8570
325 Ga0209256_1000043 3300025299 Bacteria 340873
326 Ga0209256_1000171 3300025299 Bacteria 129711
327 Ga0209256_1001387 3300025299 Bacteria 25302
328 Ga0209256_1003447 3300025299 Bacteria 11078
329 Ga0207426_1000029 3300025302 Bacteria 473835
330 Ga0207426_1000068 3300025302 Bacteria 335134
331 Ga0207426_1000217 3300025302 Bacteria 136180
332 Ga0207426_1000428 3300025302 Bacteria 68777
333 Ga0207426_1001536 3300025302 Bacteria 18776
334 Ga0207426_1001558 3300025302 Bacteria 18597
335 Ga0207426_1012078 3300025302 Bacteria 3260
336 Ga0209051_1000147 3300025303 Bacteria 133931
337 Ga0209051_1000186 3300025303 Bacteria 109900
338 Ga0209051_1000692 3300025303 Bacteria 37189
339 Ga0209257_1000547 3300025304 Bacteria 64609
340 Ga0209257_1000663 3300025304 Bacteria 54142
341 Ga0209257_1000883 3300025304 Bacteria 42345
342 Ga0209257_1005919 3300025304 Bacteria 8230
343 Ga0207697_10031808 3300025315 Bacteria 2159
344 Ga0207682_10002668 3300025893 Bacteria 7948
345 Ga0207682_10032032 3300025893 Bacteria 2112
346 Ga0207692_10024369 3300025898 Bacteria 2812
347 Ga0207680_10004622 3300025903 Bacteria 6538
348 Ga0207647_10060902 3300025904 Bacteria 2305
349 Ga0207645_10001419 3300025907 Bacteria 19626
350 Ga0207645_10017773 3300025907 Bacteria 4688
351 Ga0207643_10029867 3300025908 Bacteria 3032
352 Ga0207643_10051425 3300025908 Bacteria 2339
353 Ga0207705_10032712 3300025909 Bacteria 3717
354 Ga0207684_10001213 3300025910 Bacteria 28693
355 Ga0207684_10096591 3300025910 Bacteria 2522
356 Ga0207654_10010619 3300025911 Bacteria 4689
357 Ga0207707_10062969 3300025912 Bacteria 3228
358 Ga0207695_10111593 3300025913 Bacteria 2713
359 Ga0207662_10057439 3300025918 Bacteria 2326
360 Ga0207657_10007528 3300025919 Bacteria 11158
361 Ga0207649_10165386 3300025920 Bacteria 1536
362 Ga0207694_10063111 3300025924 Bacteria 2885
363 Ga0207694_10079167 3300025924 Bacteria 2577
364 Ga0207650_10005540 3300025925 Bacteria 8616
365 Ga0207650_10044581 3300025925 Bacteria 3260
366 Ga0207659_10000631 3300025926 Bacteria 20882
367 Ga0207659_10045529 3300025926 Bacteria 3094
368 Ga0207687_10004016 3300025927 Bacteria 9859
369 Ga0207687_10010612 3300025927 Bacteria 6022
370 Ga0207700_10087806 3300025928 Bacteria 2446
371 Ga0207644_10037494 3300025931 Bacteria 3410
372 Ga0207644_10087926 3300025931 Bacteria 2310
373 Ga0207644_10099700 3300025931 Bacteria 2180
374 Ga0207690_10003207 3300025932 Bacteria 9815
375 Ga0207706_10007928 3300025933 Bacteria 9800
376 Ga0207706_10019241 3300025933 Bacteria 6140
377 Ga0207706_10128895 3300025933 Bacteria 2225
378 Ga0207686_10104944 3300025934 Bacteria 1894
379 Ga0207686_10116915 3300025934 Bacteria 1808
380 Ga0207709_10002938 3300025935 Bacteria 10410
381 Ga0207669_10006937 3300025937 Bacteria 5210
382 Ga0207669_10021254 3300025937 Bacteria 3422
383 Ga0207704_10036609 3300025938 Bacteria 2825
384 Ga0207665_10016041 3300025939 Bacteria 4920
385 Ga0207665_10072941 3300025939 Bacteria 2346
386 Ga0207691_10001646 3300025940 Bacteria 22158
387 Ga0207691_10005530 3300025940 Bacteria 12204
388 Ga0207691_10022504 3300025940 Bacteria 5943
389 Ga0207691_10102166 3300025940 Bacteria 2558
390 Ga0207691_10198172 3300025940 Bacteria 1749
391 Ga0207711_10040039 3300025941 Bacteria 3986
392 Ga0207711_10153710 3300025941 Bacteria 2078
393 Ga0207689_10019538 3300025942 Bacteria 5709
394 Ga0207689_10020740 3300025942 Bacteria 5526
395 Ga0207679_10008067 3300025945 Bacteria 6696
396 Ga0207667_10010163 3300025949 Bacteria 11024
397 Ga0207667_10042307 3300025949 Bacteria 4843
398 Ga0207667_10079186 3300025949 Bacteria 3406
399 Ga0207667_10081551 3300025949 Bacteria 3351
400 Ga0207651_10000756 3300025960 Bacteria 13879
401 Ga0207651_10206507 3300025960 Bacteria 1578
402 Ga0207712_10169429 3300025961 Bacteria 1705
403 Ga0207668_10214479 3300025972 Bacteria 1541
404 Ga0207658_10041751 3300025986 Bacteria 3323
405 Ga0207677_10013806 3300026023 Bacteria 4692
406 Ga0207677_10164866 3300026023 Bacteria 1726
407 Ga0207703_10001030 3300026035 Bacteria 26749
408 Ga0207639_10002239 3300026041 Bacteria 13005
409 Ga0207678_10002499 3300026067 Bacteria 16723
410 Ga0207678_10039178 3300026067 Bacteria 4113
411 Ga0207678_10095097 3300026067 Bacteria 2546
412 Ga0207678_10116849 3300026067 Bacteria 2276
413 Ga0207678_10145619 3300026067 Bacteria 2022
414 Ga0207678_10160490 3300026067 Bacteria 1920
415 Ga0207708_10146461 3300026075 Bacteria 1856
416 Ga0207708_10187781 3300026075 Bacteria 1643
417 Ga0207708_10233452 3300026075 Bacteria 1477
418 Ga0207702_10008112 3300026078 Bacteria 8886
419 Ga0207641_10034707 3300026088 Bacteria 4197
420 Ga0207648_10003035 3300026089 Bacteria 17739
421 Ga0207648_10006536 3300026089 Bacteria 11571
422 Ga0207648_10012621 3300026089 Bacteria 7903
423 Ga0207676_10000229 3300026095 Bacteria 48726
424 Ga0207674_10032206 3300026116 Bacteria 5501
425 Ga0207675_100206385 3300026118 Bacteria 1888
426 Ga0207683_10008851 3300026121 Bacteria 8588
427 Ga0207683_10009189 3300026121 Bacteria 8423
428 Ga0207683_10243082 3300026121 Bacteria 1642
429 Ga0207698_10038526 3300026142 Bacteria 3533
430 Ga0207698_10136737 3300026142 Bacteria 2104
431 Ga0209371_1000037 3300027312 Bacteria 367074
432 Ga0209371_1001369 3300027312 Bacteria 16809
433 Ga0209282_1000043 3300027666 Bacteria 119260
434 Ga0209282_1055043 3300027666 Bacteria 2253
435 Ga0209974_10001122 3300027876 Bacteria 9505
436 Ga0207428_10002714 3300027907 Bacteria 17645
437 Ga0268266_10005375 3300028379 Bacteria 11966
438 Ga0268266_10024020 3300028379 Bacteria 5187
439 Ga0268266_10142955 3300028379 Bacteria 2148
440 Ga0268266_10152146 3300028379 Bacteria 2086
441 Ga0268266_10159107 3300028379 Bacteria 2042
442 Ga0268266_10269284 3300028379 Bacteria 1581
443 Ga0268265_10112664 3300028380 Bacteria 2224
444 Ga0268265_10281762 3300028380 Bacteria 1488
445 Ga0268264_10210705 3300028381 Bacteria 1784
446 Ga0268264_10245057 3300028381 Bacteria 1662
447 Ga0307517_10000024 3300028786 Bacteria 185597
448 Ga0307515_10061534 3300028794 Bacteria 5323
449 Ga0268256_1000039 3300030500 Bacteria 354969
450 Ga0268256_1002578 3300030500 Bacteria 9061
451 Ga0307511_10000001 3300030521 Bacteria 206079
452 Ga0316181_1051064 3300030744 Bacteria 3279
453 Ga0265332_10044576 3300031238 Bacteria 1913
454 Ga0265331_10030832 3300031250 Bacteria 2667
455 Ga0307513_10000057 3300031456 Bacteria 146564
456 Ga0307513_10000206 3300031456 Bacteria 85338
457 Ga0307513_10005251 3300031456 Bacteria 17162
458 Ga0307513_10039329 3300031456 Bacteria 5244
459 Ga0307513_10067054 3300031456 Bacteria 3768
460 Ga0307513_10156503 3300031456 Bacteria 2178
461 Ga0307408_100000072 3300031548 Bacteria 115918
462 Ga0307408_100001768 3300031548 Bacteria 15769
463 Ga0307408_100005659 3300031548 Bacteria 8332
464 Ga0307408_100084788 3300031548 Bacteria 2377
465 Ga0307508_10000028 3300031616 Bacteria 168639
466 Ga0265314_10054139 3300031711 Bacteria 2778
467 Ga0265314_10160908 3300031711 Bacteria 1366
468 Ga0307516_10080305 3300031730 Bacteria 3105
469 Ga0307413_10055005 3300031824 Bacteria 2418
470 Ga0307406_10000278 3300031901 Bacteria 30154
471 Ga0307412_10000235 3300031911 Bacteria 36152
472 Ga0307412_10014920 3300031911 Bacteria 4593
473 Ga0307412_10038789 3300031911 Bacteria 3070
474 Ga0307412_10072561 3300031911 Bacteria 2353
475 Ga0307414_10051343 3300032004 Bacteria 2862
476 Ga0307414_10149333 3300032004 Bacteria 1841
477 Ga0307411_10038395 3300032005 Bacteria 3020
478 Ga0307415_100065365 3300032126 Bacteria 2534
479 Ga0307510_10089416 3300033180 Bacteria 2932
480 Ga0373944_0002367 3300035089 Bacteria 4803
481 Ga0373944_0010804 3300035089 Bacteria 2495
482 Ga0373952_0032224 3300035092 Bacteria 1169
483 Ga0373923_0036767 3300035111 Bacteria 2000
484 Ga0373932_0034506 3300035112 Bacteria 1426
485 Ga0373936_0031832 3300035113 Bacteria 2084
486 Ga0373953_0004104 3300035117 Bacteria 4615
487 Ga0373954_0030188 3300035118 Bacteria 2499
488 Ga0373943_0000789 3300035170 Bacteria 13880
489 Ga0373946_0007208 3300035171 Bacteria 4059
490 Ga0373946_0007751 3300035171 Bacteria 3937
491 Ga0373955_0034161 3300035172 Bacteria 2683
492 Ga0373942_0025825 3300035207 Bacteria 1517
493 Ga0373935_0000272 3300035692 Bacteria 25407
494 Ga0373935_0003759 3300035692 Bacteria 8861
495 Ga0373927_0000980 3300035695 Bacteria 21707
496 Ga0373927_0004169 3300035695 Bacteria 10157
497 Ga0373927_0066002 3300035695 Bacteria 2340
498 Ga0373947_0001732 3300035725 Bacteria 13348
499 Ga0373947_0015139 3300035725 Bacteria 4427
500 Ga0373947_0070660 3300035725 Bacteria 2140
501 Ga0373937_0056762 3300036401 Bacteria 3596
502 Ga0373937_0067997 3300036401 Bacteria 3284
503 Ga0373925_0001601 3300037068 Bacteria 19118
504 Ga0373925_0035877 3300037068 Bacteria 3660
505 Ga0373925_0104562 3300037068 Bacteria 2180
506 Ga0395899_0009643 3300037312 Bacteria 7410
507 Ga0395900_0105087 3300037418 Bacteria 2901
508 Ga0395898_0075301 3300037466 Bacteria 3260
509 Ga0395905_0034718 3300037471 Bacteria 4736
510 Ga0395905_0036256 3300037471 Bacteria 4632
511 Ga0395905_0061025 3300037471 Bacteria 3526
512 Ga0395905_0094045 3300037471 Bacteria 2811
513 Ga0436364_0086959 3300037853 Bacteria 1627
514 Ga0395901_0044011 3300038443 Bacteria 4630
515 Ga0395901_0054747 3300038443 Bacteria 4147
516 Ga0395901_0241016 3300038443 Bacteria 1886
517 Ga0439438_000572 3300041405 Bacteria 16757
518 Ga0439438_001328 3300041405 Bacteria 10954
519 Ga0439447_004656 3300041407 Bacteria 4674
520 Ga0439466_0008780 3300041411 Bacteria 3803
521 Ga0439465_0032538 3300041413 Bacteria 1665
522 Ga0439431_0003797 3300041997 Bacteria 3337
523 Ga0439431_0005486 3300041997 Bacteria 2801
524 Ga0439445_0007942 3300042004 Bacteria 2474
525 Ga0439432_001391 3300042006 Bacteria 9132
526 Ga0439432_007368 3300042006 Bacteria 3899
527 Ga0439462_0002207 3300042015 Bacteria 4492
528 Ga0439463_010067 3300042016 Bacteria 2323
529 Ga0450890_010734 3300042127 Bacteria 1180
530 Ga0466965_0006790 3300044683 Bacteria 5225
531 Ga0466968_0004998 3300044735 Bacteria 4965
532 Ga0466960_0005850 3300044901 Bacteria 4901
533 Ga0451576_0044807 3300045051 Bacteria 4660
534 Ga0495627_000054 3300046453 Bacteria 151899
535 Ga0495592_0015807 3300046454 Bacteria 5726
536 Ga0495592_0018339 3300046454 Bacteria 5321
537 Ga0495603_0001822 3300046455 Bacteria 12583
538 Ga0495603_0009552 3300046455 Bacteria 5861
539 Ga0495629_0000499 3300046459 Bacteria 32883
540 Ga0495629_0096420 3300046459 Bacteria 2063
541 Ga0495638_0075628 3300046460 Bacteria 2052
542 Ga0495638_0075776 3300046460 Bacteria 2049
543 Ga0495641_0003876 3300046461 Bacteria 10902
544 Ga0495651_0005001 3300046462 Bacteria 10126
545 Ga0495651_0019040 3300046462 Bacteria 5319
546 Ga0495651_0134730 3300046462 Bacteria 1799
547 Ga0495653_0164598 3300046463 Bacteria 1536
548 Ga0495580_0001242 3300046472 Bacteria 22494
549 Ga0495580_0018432 3300046472 Bacteria 5196
550 Ga0495582_0000969 3300046473 Bacteria 16048
551 Ga0495582_0051943 3300046473 Bacteria 2261
552 Ga0495605_0001215 3300046474 Bacteria 17172
553 Ga0495605_0013343 3300046474 Bacteria 4531
554 Ga0495639_0000003 3300046475 Bacteria 118479
555 Ga0495639_0058950 3300046475 Bacteria 1757
556 Ga0495639_0064242 3300046475 Bacteria 1686
557 Ga0495662_0000185 3300046476 Bacteria 25164
558 Ga0495662_0018852 3300046476 Bacteria 3339
559 Ga0495584_0039085 3300046491 Bacteria 2398
560 Ga0495594_0000865 3300046499 Bacteria 15562
561 Ga0495596_0000058 3300046500 Bacteria 80763
562 Ga0495607_0000021 3300046501 Bacteria 164571
563 Ga0495607_0000509 3300046501 Bacteria 38503
564 Ga0495607_0006603 3300046501 Bacteria 8142
565 Ga0495606_0000177 3300046507 Bacteria 112843
566 Ga0495606_0000234 3300046507 Bacteria 98166
567 Ga0495608_0056094 3300046511 Bacteria 2603
568 Ga0495610_0001463 3300046512 Bacteria 20832
569 Ga0495616_0001432 3300046513 Bacteria 16598
570 Ga0495618_0120523 3300046514 Bacteria 1680
571 Ga0495620_0045919 3300046515 Bacteria 1889
572 Ga0495630_0000566 3300046517 Bacteria 26945
573 Ga0495631_0060576 3300046518 Bacteria 1642
574 Ga0495632_0011702 3300046519 Bacteria 5107
575 Ga0495637_0043181 3300046520 Bacteria 1926
576 Ga0495643_0013677 3300046522 Bacteria 4849
577 Ga0495648_0032067 3300046524 Bacteria 3453
578 Ga0495648_0043977 3300046524 Bacteria 2792
579 Ga0495663_0033271 3300046525 Bacteria 1539
580 Ga0495663_0058780 3300046525 Bacteria 1205
581 Ga0495654_0002515 3300046530 Bacteria 11781
582 Ga0495654_0016304 3300046530 Bacteria 3931
583 Ga0495665_0000138 3300046531 Bacteria 35409
584 Ga0495665_0043657 3300046531 Bacteria 2384
585 Ga0495640_0040832 3300046533 Bacteria 3246
586 Ga0495586_0103683 3300046535 Bacteria 1580
587 Ga0495587_0036029 3300046536 Bacteria 2978
588 Ga0495598_0009887 3300046537 Bacteria 2268
589 Ga0495598_0024321 3300046537 Bacteria 1641
590 Ga0495609_0000566 3300046538 Bacteria 29042
591 Ga0495597_0000329 3300046542 Bacteria 42746
592 Ga0495622_0007663 3300046557 Bacteria 5015
593 Ga0495622_0007851 3300046557 Bacteria 4953
594 Ga0495622_0018272 3300046557 Bacteria 3266
595 Ga0495633_0048406 3300046558 Bacteria 2007
596 Ga0495633_0050295 3300046558 Bacteria 1965
597 Ga0495667_0038472 3300046559 Bacteria 3185
598 Ga0495667_0083373 3300046559 Bacteria 2076
599 Ga0495656_0000047 3300046615 Bacteria 59690
600 Ga0495656_0062975 3300046615 Bacteria 1624
601 Ga0495634_0000360 3300046642 Bacteria 44196
602 Ga0495634_0031617 3300046642 Bacteria 3644
603 Ga0495634_0085115 3300046642 Bacteria 2061
604 Ga0495625_0043121 3300046660 Bacteria 3274
605 Ga0495635_0003164 3300046663 Bacteria 11340
606 Ga0495635_0004706 3300046663 Bacteria 9482
607 Ga0495661_0048361 3300046665 Bacteria 2584
608 Ga0495588_0000431 3300046674 Bacteria 22035
609 Ga0495588_0011695 3300046674 Bacteria 4125
610 Ga0495588_0011898 3300046674 Bacteria 4097
611 Ga0495588_0026021 3300046674 Bacteria 2919
612 Ga0495646_0005530 3300046680 Bacteria 7992
613 Ga0495658_0000136 3300046683 Bacteria 40715
614 Ga0495658_0074047 3300046683 Bacteria 1984
615 Ga0495669_0052395 3300046684 Bacteria 1833
616 Ga0495613_0006681 3300046689 Bacteria 8617
617 Ga0495624_0001994 3300046690 Bacteria 15576
618 Ga0495624_0023634 3300046690 Bacteria 4051
619 Ga0495670_0048730 3300046691 Bacteria 2119
620 Ga0495671_0000966 3300046692 Bacteria 20124
621 Ga0495671_0066028 3300046692 Bacteria 1781
622 Ga0495649_0001060 3300046694 Bacteria 21502
623 Ga0495649_0020791 3300046694 Bacteria 3678
624 Ga0495660_0005739 3300046810 Bacteria 7414
625 Ga0495581_0000614 3300047315 Bacteria 18660
626 Ga0495674_0007275 3300047319 Bacteria 10588
627 Ga0495674_0015008 3300047319 Bacteria 7249
628 Ga0495674_0075980 3300047319 Bacteria 2890
629 Ga0495672_0105675 3300047320 Bacteria 1519
630 Ga0495676_0051185 3300047321 Bacteria 3307
631 Ga0495676_0063557 3300047321 Bacteria 2876
632 Ga0495680_0011212 3300047322 Bacteria 7959
633 Ga0495673_0000210 3300047469 Bacteria 88390
634 Ga0495673_0078116 3300047469 Bacteria 1377
635 Ga0495684_0027601 3300047471 Bacteria 4358
636 Ga0495684_0080508 3300047471 Bacteria 2473
637 Ga0495684_0135889 3300047471 Bacteria 1845
638 Ga0495686_0079814 3300047472 Bacteria 2001
639 Ga0495593_0000819 3300047673 Bacteria 18024
640 Ga0495602_0028809 3300048088 Bacteria 5305
641 Ga0495602_0045740 3300048088 Bacteria 3959
642 Ga0495602_0112414 3300048088 Bacteria 2210
643 Ga0496100_0170719 3300048903 Bacteria 1566
644 Ga0496101_0006529 3300048904 Bacteria 7512
645 Ga0496102_0006975 3300048905 Bacteria 9639
646 Ga0496102_0008353 3300048905 Bacteria 8866
647 Ga0496102_0024053 3300048905 Bacteria 5414
648 Ga0496104_0015976 3300048907 Bacteria 6813
649 Ga0496104_0020930 3300048907 Bacteria 6000
650 Ga0496104_0043800 3300048907 Bacteria 4203
651 Ga0496104_0268571 3300048907 Bacteria 1618
652 Ga0496105_0006073 3300048908 Bacteria 9241
653 Ga0496105_0024500 3300048908 Bacteria 4903
654 Ga0496105_0039450 3300048908 Bacteria 3892
655 Ga0496106_0117893 3300048909 Bacteria 2072
656 Ga0496106_0140580 3300048909 Bacteria 1899
657 Ga0496107_0102142 3300048910 Bacteria 2102
658 Ga0496108_0030525 3300048911 Bacteria 4467
659 Ga0496108_0044563 3300048911 Bacteria 3702
660 Ga0496108_0092410 3300048911 Bacteria 2573
661 Ga0496108_0104267 3300048911 Bacteria 2420
662 Ga0496108_0185934 3300048911 Bacteria 1800
663 Ga0496109_0040860 3300048912 Bacteria 4201
664 Ga0496109_0052831 3300048912 Bacteria 3705
665 Ga0496109_0055922 3300048912 Bacteria 3600
666 Ga0496109_0082047 3300048912 Bacteria 2971
667 Ga0496109_0353873 3300048912 Bacteria 1387
668 Ga0496110_0009704 3300048913 Bacteria 7796
669 Ga0496110_0027915 3300048913 Bacteria 4842
670 Ga0496110_0097595 3300048913 Bacteria 2633
671 Ga0496112_0000545 3300048915 Bacteria 25805
672 Ga0496112_0072787 3300048915 Bacteria 3397
673 Ga0496112_0109196 3300048915 Bacteria 2737
674 Ga0496112_0120166 3300048915 Bacteria 2597
675 Ga0496113_0035720 3300048916 Bacteria 3636
676 Ga0496113_0048240 3300048916 Bacteria 3168
677 Ga0496113_0291071 3300048916 Bacteria 1307
678 Ga0496114_0049847 3300048917 Bacteria 3484
679 Ga0496114_0101901 3300048917 Bacteria 2452
680 Ga0496115_0004982 3300048918 Bacteria 9640
681 Ga0496115_0006020 3300048918 Bacteria 8856
682 Ga0496115_0011568 3300048918 Bacteria 6616
683 Ga0496115_0063427 3300048918 Bacteria 2981
684 Ga0496115_0072802 3300048918 Bacteria 2788
685 Ga0496116_0006171 3300048919 Bacteria 10957
686 Ga0496116_0026738 3300048919 Bacteria 4209
687 Ga0496117_0000031 3300048920 Bacteria 381048
688 Ga0496117_0023846 3300048920 Bacteria 4859
689 Ga0496117_0062647 3300048920 Bacteria 2547
690 Ga0496118_0001366 3300048921 Bacteria 36777
691 Ga0496118_0015432 3300048921 Bacteria 7069
692 Ga0496118_0030785 3300048921 Bacteria 4467
693 Ga0496118_0064217 3300048921 Bacteria 2695
694 Ga0496118_0067566 3300048921 Bacteria 2601
695 Ga0496119_0001100 3300048922 Bacteria 34059
696 Ga0496120_0000337 3300048923 Bacteria 78140
697 Ga0496120_0046768 3300048923 Bacteria 2499
698 Ga0496121_0000444 3300048924 Bacteria 81596
699 Ga0496121_0013412 3300048924 Bacteria 8809
700 Ga0496121_0032600 3300048924 Bacteria 4732
701 Ga0496121_0046058 3300048924 Bacteria 3738
702 Ga0496121_0057551 3300048924 Bacteria 3221
703 Ga0496121_0112481 3300048924 Bacteria 2074
704 Ga0496121_0175225 3300048924 Bacteria 1553
705 Ga0496122_0000023 3300048925 Bacteria 381035
706 Ga0496122_0000214 3300048925 Bacteria 129132
707 Ga0496122_0000908 3300048925 Bacteria 54441
708 Ga0496122_0001245 3300048925 Bacteria 42799
709 Ga0496122_0001281 3300048925 Bacteria 41818
710 Ga0496122_0008833 3300048925 Bacteria 10758
711 Ga0496123_0000027 3300048926 Bacteria 306773
712 Ga0496123_0000289 3300048926 Bacteria 98253
713 Ga0496123_0000412 3300048926 Bacteria 78170
714 Ga0496123_0000524 3300048926 Bacteria 66159
715 Ga0496123_0001497 3300048926 Bacteria 32439
716 Ga0496123_0009986 3300048926 Bacteria 8458
717 Ga0496123_0011434 3300048926 Bacteria 7691
718 Ga0496123_0022278 3300048926 Bacteria 4889
719 Ga0496124_0000174 3300048927 Bacteria 129228
720 Ga0496124_0001510 3300048927 Bacteria 33896
721 Ga0496124_0078611 3300048927 Bacteria 2718
722 Ga0496125_0017989 3300048928 Bacteria 6718
723 Ga0496125_0020013 3300048928 Bacteria 6291
724 Ga0496125_0025329 3300048928 Bacteria 5435
725 Ga0496125_0049442 3300048928 Bacteria 3494
726 Ga0496125_0151148 3300048928 Bacteria 1594
727 Ga0496126_0028624 3300048929 Bacteria 5306
728 Ga0496126_0118755 3300048929 Bacteria 2295
729 nmdc:mga03683_26852_c1 3300050489 Bacteria 2275
730 nmdc:mga03683_5459_c1 3300050489 Bacteria 4293
731 nmdc:mga03n38_45165_c1 3300050490 Bacteria 1939
732 nmdc:mga03n38_55088_c1 3300050490 Bacteria 1790
733 nmdc:mga00v17_183_c1 3300050491 Bacteria 37432
734 nmdc:mga00v17_5231_c1 3300050491 Bacteria 6832
735 nmdc:mga00v17_66735_c1 3300050491 Bacteria 2222
736 nmdc:mga0yw44_123535_c1 3300050492 Bacteria 1669
737 nmdc:mga0yw44_27381_c1 3300050492 Bacteria 3264
738 nmdc:mga0yw44_751_c1 3300050492 Bacteria 12016
739 nmdc:mga0yw44_824_c1 3300050492 Bacteria 11578
740 nmdc:mga0k408_113591_c1 3300050493 Bacteria 1602
741 nmdc:mga0k408_254_c1 3300050493 Bacteria 29029
742 nmdc:mga06z11_30692_c1 3300050494 Bacteria 2603
743 nmdc:mga06z11_73871_c1 3300050494 Bacteria 1812
744 nmdc:mga06z11_97997_c1 3300050494 Bacteria 1604
745 nmdc:mga07m45_2648_c1 3300050496 Bacteria 8434
746 nmdc:mga07m45_6292_c1 3300050496 Bacteria 5995
747 nmdc:mga05p37_22_c2 3300050507 Bacteria 58856
748 nmdc:mga05p37_261893_c1 3300050507 Bacteria 2069
749 nmdc:mga09592_20673_c1 3300050508 Bacteria 5417
750 nmdc:mga09592_32610_c1 3300050508 Bacteria 4343
751 nmdc:mga0qj67_20482_c1 3300050509 Bacteria 5064
752 nmdc:mga06r32_244188_c1 3300050510 Bacteria 1783
753 nmdc:mga06r32_3586_c1 3300050510 Bacteria 13851
754 nmdc:mga08y16_177_c1 3300050511 Bacteria 56157
755 nmdc:mga08y16_73407_c1 3300050511 Bacteria 3565
756 nmdc:mga0sz30_11825_c1 3300050516 Bacteria 3382
757 nmdc:mga0sz30_11989_c1 3300050516 Bacteria 3364
758 nmdc:mga0sz30_52931_c1 3300050516 Bacteria 1724
759 Ga0495601_0005831 3300053077 Bacteria 7183
760 Ga0495601_0012914 3300053077 Bacteria 5015
761 Ga0495619_0009243 3300053085 Bacteria 6228
762 Ga0495619_0010489 3300053085 Bacteria 5828
763 Ga0495619_0050326 3300053085 Bacteria 2750
764 Ga0495619_0094159 3300053085 Bacteria 2032
765 Ga0500643_000085 3300053087 Bacteria 98026
766 Ga0500643_000111 3300053087 Bacteria 85038
767 Ga0500644_0000670 3300053088 Bacteria 12478
768 Ga0500646_0001150 3300053090 Bacteria 7153
769 Ga0500646_0031108 3300053090 Bacteria 1468
770 Ga0500566_0001138 3300053094 Bacteria 15446
771 Ga0500566_0012902 3300053094 Bacteria 4922
772 Ga0500641_0002711 3300053096 Bacteria 6258
773 Ga0500641_0006974 3300053096 Bacteria 4021
774 Ga0500641_0010572 3300053096 Bacteria 3337
775 Ga0500555_002436 3300053103 Bacteria 5389
776 Ga0500555_017007 3300053103 Bacteria 2096
777 Ga0500556_0000004 3300053104 Bacteria 666287
778 Ga0500556_0000022 3300053104 Bacteria 174894
779 Ga0500560_000185 3300053107 Bacteria 7338
780 Ga0500593_000258 3300053117 Bacteria 21754
781 Ga0500594_0021154 3300053118 Bacteria 1629
782 Ga0500594_0024845 3300053118 Bacteria 1530
783 Ga0500595_000521 3300053119 Bacteria 23203
784 Ga0500595_007107 3300053119 Bacteria 4680
785 Ga0500608_001717 3300053122 Bacteria 7828
786 Ga0500618_011643 3300053125 Bacteria 2327
787 Ga0500642_0000036 3300053130 Bacteria 104249
788 Ga0500642_0019327 3300053130 Bacteria 2655
789 Ga0500652_000986 3300053131 Bacteria 9364
790 Ga0500652_001282 3300053131 Bacteria 7967
791 Ga0500652_051048 3300053131 Bacteria 1689
792 Ga0500658_0029998 3300053134 Bacteria 2119
793 Ga0500559_0000835 3300053136 Bacteria 19960
794 Ga0500559_0010835 3300053136 Bacteria 3908
795 Ga0500561_0001498 3300053137 Bacteria 3791
796 Ga0500568_0000881 3300053139 Bacteria 21071
797 Ga0500568_0008498 3300053139 Bacteria 4940
798 Ga0500573_0040919 3300053140 Bacteria 2676
799 Ga0500577_0022870 3300053142 Bacteria 2080
800 Ga0500590_026161 3300053148 Bacteria 3027
801 Ga0500603_000186 3300053150 Bacteria 16102
802 Ga0500616_0000014 3300053153 Bacteria 637918
803 Ga0500616_0011831 3300053153 Bacteria 5132
804 Ga0500622_0001597 3300053156 Bacteria 17813
805 Ga0500624_000900 3300053157 Bacteria 6326
806 Ga0500627_0005113 3300053158 Bacteria 4312
807 Ga0500634_0107248 3300053161 Bacteria 1386
808 Ga0500638_107645 3300053162 Bacteria 1291
809 Ga0500636_0000103 3300053177 Bacteria 43319
810 Ga0500636_0002134 3300053177 Bacteria 10915
811 Ga0500637_0000029 3300053178 Bacteria 52437
812 Ga0500637_0002040 3300053178 Bacteria 8818
813 Ga0500645_000978 3300053730 Bacteria 16206
814 Ga0500661_000060 3300055283 Bacteria 17314
815 Ga0587090_001792 3300059510 Bacteria 2242
816 Ga0587072_001998 3300059643 Bacteria 2661

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035092 Ga0373952_0032224 Ga0373952_0032224_81_1157 286
2 3300048928 Ga0496125_0151148 Ga0496125_0151148_510_1583 292
3 3300050510 nmdc:mga06r32_244188_c1 nmdc:mga06r32_244188_c1_17_1111 295
4 3300048918 Ga0496115_0063427 Ga0496115_0063427_1857_2969 298
5 3300048916 Ga0496113_0291071 Ga0496113_0291071_134_1291 301
6 3300046525 Ga0495663_0058780 Ga0495663_0058780_152_1192 306
7 3300053131 Ga0500652_051048 Ga0500652_051048_554_1666 307
8 3300042127 Ga0450890_010734 Ga0450890_010734_69_1160 321
9 3300053118 Ga0500594_0024845 Ga0500594_0024845_400_1512 322
10 iso_pu_bacteria 8019547302 8019548604 322
11 3300053162 Ga0500638_107645 Ga0500638_107645_10_1239 327
12 iso_pu_bacteria 8019678201 8019681357 331
13 3300025941 Ga0207711_10153710 Ga0207711_101537102 337
14 3300005288 Ga0065714_10004812 Ga0065714_100048123 339
15 3300050516 nmdc:mga0sz30_52931_c1 nmdc:mga0sz30_52931_c1_463_1701 339
16 3300031456 Ga0307513_10156503 Ga0307513_101565032 340
17 3300009174 Ga0105241_10258695 Ga0105241_102586952 341
18 3300047471 Ga0495684_0080508 Ga0495684_0080508_1217_2458 341
19 3300005336 Ga0070680_100046239 Ga0070680_1000462393 342
20 3300005458 Ga0070681_10051971 Ga0070681_100519713 342
21 3300005563 Ga0068855_100032864 Ga0068855_1000328643 342
22 3300009545 Ga0105237_10064955 Ga0105237_100649555 342
23 3300013104 Ga0157370_10081310 Ga0157370_100813102 342
24 3300025909 Ga0207705_10032712 Ga0207705_100327123 342
25 3300025912 Ga0207707_10062969 Ga0207707_100629692 342
26 3300025913 Ga0207695_10111593 Ga0207695_101115932 342
27 3300025949 Ga0207667_10042307 Ga0207667_100423073 342
28 3300033180 Ga0307510_10089416 Ga0307510_100894163 342
29 3300048928 Ga0496125_0017989 Ga0496125_0017989_1784_3064 342
30 3300053150 Ga0500603_000186 Ga0500603_000186_8340_9620 342
31 3300053178 Ga0500637_0002040 Ga0500637_0002040_3411_4691 342
32 3300031711 Ga0265314_10160908 Ga0265314_101609081 343
33 3300048915 Ga0496112_0000545 Ga0496112_0000545_2026_3306 343
34 3300003354 JGI25160J50197_1000885 JGI25160J50197_100088521 344
35 3300005262 Ga0065165_1021088 Ga0065165_10210881 344
36 3300025284 Ga0209130_1000395 Ga0209130_100039521 344
37 3300025302 Ga0207426_1001536 Ga0207426_10015363 344
38 3300025960 Ga0207651_10206507 Ga0207651_102065071 344
39 3300048912 Ga0496109_0353873 Ga0496109_0353873_75_1355 344
40 3300053094 Ga0500566_0012902 Ga0500566_0012902_909_2189 344
41 3300053119 Ga0500595_000521 Ga0500595_000521_16033_17313 344
42 3300053178 Ga0500637_0000029 Ga0500637_0000029_43261_44541 344
43 3300055283 Ga0500661_000060 Ga0500661_000060_7787_9067 344
44 3300037471 Ga0395905_0036256 Ga0395905_0036256_1494_2774 345
45 3300025254 Ga0209148_1000270 Ga0209148_100027043 346
46 3300025272 Ga0209455_1003700 Ga0209455_10037003 346
47 3300053140 Ga0500573_0040919 Ga0500573_0040919_493_1773 346
48 3300048907 Ga0496104_0268571 Ga0496104_0268571_28_1266 347
49 3300048924 Ga0496121_0046058 Ga0496121_0046058_2239_3519 347
50 3300005937 Ga0081455_10028320 Ga0081455_1002832010 349
51 3300005983 Ga0081540_1005412 Ga0081540_10054125 350
52 3300046557 Ga0495622_0018272 Ga0495622_0018272_969_2249 350
53 3300053094 Ga0500566_0001138 Ga0500566_0001138_5170_6450 350
54 3300053122 Ga0500608_001717 Ga0500608_001717_6136_7416 350
55 3300053125 Ga0500618_011643 Ga0500618_011643_191_1471 350
56 3300053136 Ga0500559_0000835 Ga0500559_0000835_8776_10056 350
57 3300053177 Ga0500636_0002134 Ga0500636_0002134_3809_5089 350
58 3300053136 Ga0500559_0010835 Ga0500559_0010835_950_2230 351
59 3300053148 Ga0500590_026161 Ga0500590_026161_903_2183 351
60 3300053177 Ga0500636_0000103 Ga0500636_0000103_13861_15141 351
61 3300003354 JGI25160J50197_1003106 JGI25160J50197_10031064 352
62 3300003578 Ga0006562J51391_1036730 Ga0006562J51391_10367303 352
63 3300003856 Ga0058692_1005471 Ga0058692_10054712 352
64 3300003856 Ga0058692_1007863 Ga0058692_10078633 352
65 3300005616 Ga0068852_100098566 Ga0068852_1000985663 352
66 3300005985 Ga0081539_10017043 Ga0081539_100170433 352
67 3300006178 Ga0075367_10020931 Ga0075367_100209313 352
68 3300009093 Ga0105240_10002091 Ga0105240_1000209124 352
69 3300009545 Ga0105237_10001252 Ga0105237_1000125214 352
70 3300010375 Ga0105239_10031204 Ga0105239_100312045 352
71 3300025294 Ga0209025_1001416 Ga0209025_100141619 352
72 3300025302 Ga0207426_1012078 Ga0207426_10120783 352
73 3300027312 Ga0209371_1000037 Ga0209371_1000037184 352
74 3300027312 Ga0209371_1001369 Ga0209371_10013695 352
75 3300030500 Ga0268256_1000039 Ga0268256_1000039124 352
76 3300030500 Ga0268256_1002578 Ga0268256_10025784 352
77 3300030744 Ga0316181_1051064 Ga0316181_10510643 352
78 3300050494 nmdc:mga06z11_30692_c1 nmdc:mga06z11_30692_c1_784_2061 352
79 3300053107 Ga0500560_000185 Ga0500560_000185_1628_2905 352
80 3300004625 Ga0055543_1003801 Ga0055543_10038013 353
81 3300005262 Ga0065165_1000435 Ga0065165_10004358 353
82 3300005290 Ga0065712_10067809 Ga0065712_1006780912 353
83 3300006186 Ga0075369_10022344 Ga0075369_100223443 353
84 3300025261 Ga0209233_1002691 Ga0209233_10026916 353
85 3300031548 Ga0307408_100001768 Ga0307408_1000017688 353
86 3300003215 JGI25153J46596_10000458 JGI25153J46596_1000045821 354
87 3300005262 Ga0065165_1005208 Ga0065165_10052088 354
88 3300006048 Ga0075363_100072228 Ga0075363_1000722282 354
89 3300009174 Ga0105241_10017947 Ga0105241_100179475 354
90 3300009177 Ga0105248_10030563 Ga0105248_100305636 354
91 3300010375 Ga0105239_10012384 Ga0105239_100123848 354
92 3300010375 Ga0105239_10017719 Ga0105239_100177196 354
93 3300025295 Ga0209564_1016881 Ga0209564_10168813 354
94 3300025297 Ga0209758_1000021 Ga0209758_1000021370 354
95 3300025299 Ga0209256_1003447 Ga0209256_100344710 354
96 3300025304 Ga0209257_1000883 Ga0209257_100088316 354
97 3300025911 Ga0207654_10010619 Ga0207654_100106195 354
98 3300025934 Ga0207686_10104944 Ga0207686_101049442 354
99 3300035112 Ga0373932_0034506 Ga0373932_0034506_125_1405 354
100 3300035207 Ga0373942_0025825 Ga0373942_0025825_170_1450 354
101 3300046454 Ga0495592_0018339 Ga0495592_0018339_3111_4391 354
102 3300046462 Ga0495651_0005001 Ga0495651_0005001_3403_4683 354
103 3300046536 Ga0495587_0036029 Ga0495587_0036029_1642_2922 354
104 3300046559 Ga0495667_0038472 Ga0495667_0038472_1472_2752 354
105 3300047322 Ga0495680_0011212 Ga0495680_0011212_3207_4487 354
106 3300048088 Ga0495602_0045740 Ga0495602_0045740_36_1316 354
107 3300048905 Ga0496102_0008353 Ga0496102_0008353_2539_3819 354
108 3300048908 Ga0496105_0006073 Ga0496105_0006073_6327_7607 354
109 3300048911 Ga0496108_0104267 Ga0496108_0104267_924_2204 354
110 3300048912 Ga0496109_0055922 Ga0496109_0055922_1635_2915 354
111 3300048913 Ga0496110_0009704 Ga0496110_0009704_3897_5177 354
112 3300048915 Ga0496112_0072787 Ga0496112_0072787_1101_2381 354
113 3300048916 Ga0496113_0035720 Ga0496113_0035720_1431_2711 354
114 3300050490 nmdc:mga03n38_55088_c1 nmdc:mga03n38_55088_c1_481_1761 354
115 3300031548 Ga0307408_100000072 Ga0307408_10000007223 355
116 3300031901 Ga0307406_10000278 Ga0307406_1000027823 355
117 3300005548 Ga0070665_100060634 Ga0070665_1000606344 356
118 3300009551 Ga0105238_10088911 Ga0105238_100889112 356
119 3300013308 Ga0157375_10376172 Ga0157375_103761722 356
120 3300014968 Ga0157379_10215329 Ga0157379_102153292 356
121 3300025908 Ga0207643_10051425 Ga0207643_100514253 356
122 3300026121 Ga0207683_10243082 Ga0207683_102430821 356
123 3300028379 Ga0268266_10152146 Ga0268266_101521462 356
124 3300031238 Ga0265332_10044576 Ga0265332_100445762 356
125 3300031250 Ga0265331_10030832 Ga0265331_100308322 356
126 3300041413 Ga0439465_0032538 Ga0439465_0032538_468_1652 356
127 3300046453 Ga0495627_000054 Ga0495627_000054_64389_65669 356
128 3300046475 Ga0495639_0058950 Ga0495639_0058950_459_1739 356
129 3300046507 Ga0495606_0000234 Ga0495606_0000234_72248_73528 356
130 3300053087 Ga0500643_000085 Ga0500643_000085_38967_40247 356
131 3300053096 Ga0500641_0002711 Ga0500641_0002711_4494_5774 356
132 3300053103 Ga0500555_002436 Ga0500555_002436_647_1927 356
133 3300053118 Ga0500594_0021154 Ga0500594_0021154_300_1580 356
134 3300053134 Ga0500658_0029998 Ga0500658_0029998_68_1348 356
135 3300053139 Ga0500568_0008498 Ga0500568_0008498_3100_4380 356
136 3300005347 Ga0070668_100130297 Ga0070668_1001302971 357
137 3300005356 Ga0070674_100215607 Ga0070674_1002156071 357
138 3300006038 Ga0075365_10105278 Ga0075365_101052782 357
139 3300031456 Ga0307513_10039329 Ga0307513_100393295 357
140 3300035118 Ga0373954_0030188 Ga0373954_0030188_1019_2299 357
141 3300046511 Ga0495608_0056094 Ga0495608_0056094_547_1827 357
142 3300046518 Ga0495631_0060576 Ga0495631_0060576_308_1588 357
143 3300046525 Ga0495663_0033271 Ga0495663_0033271_84_1364 357
144 3300046559 Ga0495667_0083373 Ga0495667_0083373_315_1595 357
145 3300046674 Ga0495588_0011898 Ga0495588_0011898_1967_3247 357
146 3300047321 Ga0495676_0051185 Ga0495676_0051185_472_1752 357
147 3300048929 Ga0496126_0028624 Ga0496126_0028624_1473_2753 357
148 3300003215 JGI25153J46596_10005476 JGI25153J46596_100054765 358
149 3300003354 JGI25160J50197_1001425 JGI25160J50197_10014258 358
150 3300005543 Ga0070672_100034386 Ga0070672_1000343863 358
151 3300005544 Ga0070686_100074033 Ga0070686_1000740331 358
152 3300006038 Ga0075365_10003264 Ga0075365_100032646 358
153 3300006051 Ga0075364_10007198 Ga0075364_100071982 358
154 3300006177 Ga0075362_10026692 Ga0075362_100266922 358
155 3300006178 Ga0075367_10006457 Ga0075367_100064576 358
156 3300006186 Ga0075369_10040790 Ga0075369_100407902 358
157 3300006844 Ga0075428_100056566 Ga0075428_1000565663 358
158 3300006844 Ga0075428_100381278 Ga0075428_1003812781 358
159 3300006880 Ga0075429_100149349 Ga0075429_1001493491 358
160 3300009553 Ga0105249_10112151 Ga0105249_101121513 358
161 3300013308 Ga0157375_10034947 Ga0157375_100349472 358
162 3300014969 Ga0157376_10039160 Ga0157376_100391604 358
163 3300025295 Ga0209564_1002665 Ga0209564_10026653 358
164 3300025297 Ga0209758_1000458 Ga0209758_100045835 358
165 3300025302 Ga0207426_1000217 Ga0207426_1000217119 358
166 3300025940 Ga0207691_10198172 Ga0207691_101981721 358
167 3300025961 Ga0207712_10169429 Ga0207712_101694292 358
168 3300026067 Ga0207678_10039178 Ga0207678_100391783 358
169 3300026075 Ga0207708_10146461 Ga0207708_101464612 358
170 3300035089 Ga0373944_0010804 Ga0373944_0010804_249_1535 358
171 3300035111 Ga0373923_0036767 Ga0373923_0036767_211_1491 358
172 3300035170 Ga0373943_0000789 Ga0373943_0000789_10070_11350 358
173 3300035171 Ga0373946_0007208 Ga0373946_0007208_1416_2696 358
174 3300035692 Ga0373935_0000272 Ga0373935_0000272_17663_18943 358
175 3300035695 Ga0373927_0000980 Ga0373927_0000980_2181_3461 358
176 3300035695 Ga0373927_0066002 Ga0373927_0066002_234_1520 358
177 3300035725 Ga0373947_0001732 Ga0373947_0001732_9681_10961 358
178 3300036401 Ga0373937_0056762 Ga0373937_0056762_848_2128 358
179 3300037068 Ga0373925_0001601 Ga0373925_0001601_11054_12334 358
180 3300046454 Ga0495592_0015807 Ga0495592_0015807_603_1883 358
181 3300046455 Ga0495603_0001822 Ga0495603_0001822_4966_6246 358
182 3300046459 Ga0495629_0000499 Ga0495629_0000499_9667_10947 358
183 3300046459 Ga0495629_0096420 Ga0495629_0096420_148_1434 358
184 3300046460 Ga0495638_0075628 Ga0495638_0075628_647_1927 358
185 3300046461 Ga0495641_0003876 Ga0495641_0003876_2049_3329 358
186 3300046472 Ga0495580_0001242 Ga0495580_0001242_11516_12796 358
187 3300046473 Ga0495582_0000969 Ga0495582_0000969_9675_10955 358
188 3300046473 Ga0495582_0051943 Ga0495582_0051943_433_1719 358
189 3300046475 Ga0495639_0000003 Ga0495639_0000003_9690_10970 358
190 3300046476 Ga0495662_0000185 Ga0495662_0000185_6454_7734 358
191 3300046499 Ga0495594_0000865 Ga0495594_0000865_4619_5899 358
192 3300046514 Ga0495618_0120523 Ga0495618_0120523_50_1330 358
193 3300046517 Ga0495630_0000566 Ga0495630_0000566_6332_7612 358
194 3300046531 Ga0495665_0000138 Ga0495665_0000138_23181_24461 358
195 3300046531 Ga0495665_0043657 Ga0495665_0043657_389_1675 358
196 3300046533 Ga0495640_0040832 Ga0495640_0040832_681_1967 358
197 3300046535 Ga0495586_0103683 Ga0495586_0103683_205_1485 358
198 3300046557 Ga0495622_0007663 Ga0495622_0007663_261_1541 358
199 3300046642 Ga0495634_0000360 Ga0495634_0000360_33819_35099 358
200 3300046642 Ga0495634_0031617 Ga0495634_0031617_660_1946 358
201 3300046663 Ga0495635_0003164 Ga0495635_0003164_9664_10944 358
202 3300046674 Ga0495588_0011695 Ga0495588_0011695_2175_3455 358
203 3300046674 Ga0495588_0026021 Ga0495588_0026021_859_2139 358
204 3300046680 Ga0495646_0005530 Ga0495646_0005530_6282_7562 358
205 3300046683 Ga0495658_0000136 Ga0495658_0000136_33668_34948 358
206 3300046684 Ga0495669_0052395 Ga0495669_0052395_174_1454 358
207 3300046689 Ga0495613_0006681 Ga0495613_0006681_1206_2486 358
208 3300046690 Ga0495624_0001994 Ga0495624_0001994_8040_9320 358
209 3300046692 Ga0495671_0066028 Ga0495671_0066028_328_1608 358
210 3300047315 Ga0495581_0000614 Ga0495581_0000614_7701_8981 358
211 3300047319 Ga0495674_0007275 Ga0495674_0007275_8704_9990 358
212 3300047319 Ga0495674_0015008 Ga0495674_0015008_1425_2705 358
213 3300047321 Ga0495676_0063557 Ga0495676_0063557_280_1566 358
214 3300047469 Ga0495673_0078116 Ga0495673_0078116_68_1348 358
215 3300047471 Ga0495684_0027601 Ga0495684_0027601_2329_3609 358
216 3300047673 Ga0495593_0000819 Ga0495593_0000819_9413_10693 358
217 3300048907 Ga0496104_0020930 Ga0496104_0020930_1915_3195 358
218 3300048909 Ga0496106_0140580 Ga0496106_0140580_265_1545 358
219 3300048913 Ga0496110_0097595 Ga0496110_0097595_1120_2400 358
220 3300048924 Ga0496121_0175225 Ga0496121_0175225_102_1382 358
221 3300048927 Ga0496124_0078611 Ga0496124_0078611_642_1922 358
222 3300048928 Ga0496125_0049442 Ga0496125_0049442_1896_3176 358
223 3300048929 Ga0496126_0118755 Ga0496126_0118755_787_2067 358
224 3300050489 nmdc:mga03683_26852_c1 nmdc:mga03683_26852_c1_475_1755 358
225 3300050491 nmdc:mga00v17_5231_c1 nmdc:mga00v17_5231_c1_2660_3940 358
226 3300050492 nmdc:mga0yw44_824_c1 nmdc:mga0yw44_824_c1_7318_8598 358
227 3300050511 nmdc:mga08y16_73407_c1 nmdc:mga08y16_73407_c1_1196_2476 358
228 3300050516 nmdc:mga0sz30_11989_c1 nmdc:mga0sz30_11989_c1_1636_2916 358
229 3300053077 Ga0495601_0005831 Ga0495601_0005831_3934_5220 358
230 3300053085 Ga0495619_0010489 Ga0495619_0010489_3946_5232 358
231 3300053085 Ga0495619_0050326 Ga0495619_0050326_174_1454 358
232 3300005338 Ga0068868_100008937 Ga0068868_1000089377 359
233 3300005341 Ga0070691_10102534 Ga0070691_101025341 359
234 3300005355 Ga0070671_100058651 Ga0070671_1000586511 359
235 3300005437 Ga0070710_10006325 Ga0070710_100063256 359
236 3300005458 Ga0070681_10001122 Ga0070681_100011226 359
237 3300005539 Ga0068853_100042417 Ga0068853_1000424173 359
238 3300005549 Ga0070704_100113072 Ga0070704_1001130722 359
239 3300005564 Ga0070664_100058106 Ga0070664_1000581063 359
240 3300005983 Ga0081540_1016775 Ga0081540_10167753 359
241 3300005985 Ga0081539_10005493 Ga0081539_100054939 359
242 3300006175 Ga0070712_100040680 Ga0070712_1000406804 359
243 3300009098 Ga0105245_10015214 Ga0105245_100152145 359
244 3300009098 Ga0105245_10208600 Ga0105245_102086002 359
245 3300009101 Ga0105247_10014154 Ga0105247_100141542 359
246 3300009174 Ga0105241_10021271 Ga0105241_100212715 359
247 3300009177 Ga0105248_10075042 Ga0105248_100750422 359
248 3300010375 Ga0105239_10079779 Ga0105239_100797793 359
249 3300011119 Ga0105246_10029661 Ga0105246_100296614 359
250 3300011119 Ga0105246_10072651 Ga0105246_100726511 359
251 3300013296 Ga0157374_10116736 Ga0157374_101167363 359
252 3300013306 Ga0163162_10212367 Ga0163162_102123672 359
253 3300014968 Ga0157379_10025267 Ga0157379_100252673 359
254 3300014969 Ga0157376_10041642 Ga0157376_100416424 359
255 3300015262 Ga0182007_10008452 Ga0182007_100084522 359
256 3300025898 Ga0207692_10024369 Ga0207692_100243692 359
257 3300025927 Ga0207687_10004016 Ga0207687_100040167 359
258 3300025928 Ga0207700_10087806 Ga0207700_100878062 359
259 3300025931 Ga0207644_10099700 Ga0207644_100997001 359
260 3300025933 Ga0207706_10128895 Ga0207706_101288952 359
261 3300025939 Ga0207665_10016041 Ga0207665_100160415 359
262 3300026023 Ga0207677_10164866 Ga0207677_101648662 359
263 3300026067 Ga0207678_10002499 Ga0207678_100024994 359
264 3300026067 Ga0207678_10095097 Ga0207678_100950972 359
265 3300026118 Ga0207675_100206385 Ga0207675_1002063852 359
266 3300028379 Ga0268266_10159107 Ga0268266_101591071 359
267 3300035117 Ga0373953_0004104 Ga0373953_0004104_3238_4518 359
268 3300035725 Ga0373947_0015139 Ga0373947_0015139_719_1999 359
269 3300037068 Ga0373925_0104562 Ga0373925_0104562_806_2086 359
270 3300042016 Ga0439463_010067 Ga0439463_010067_194_1474 359
271 3300046462 Ga0495651_0019040 Ga0495651_0019040_3673_4953 359
272 3300046463 Ga0495653_0164598 Ga0495653_0164598_87_1367 359
273 3300046642 Ga0495634_0085115 Ga0495634_0085115_140_1420 359
274 3300046663 Ga0495635_0004706 Ga0495635_0004706_6029_7309 359
275 3300046683 Ga0495658_0074047 Ga0495658_0074047_676_1956 359
276 3300047471 Ga0495684_0135889 Ga0495684_0135889_376_1656 359
277 3300048088 Ga0495602_0028809 Ga0495602_0028809_1948_3228 359
278 3300048904 Ga0496101_0006529 Ga0496101_0006529_683_1963 359
279 3300048905 Ga0496102_0006975 Ga0496102_0006975_2210_3490 359
280 3300048905 Ga0496102_0024053 Ga0496102_0024053_3441_4721 359
281 3300048907 Ga0496104_0043800 Ga0496104_0043800_1103_2383 359
282 3300048908 Ga0496105_0024500 Ga0496105_0024500_2833_4113 359
283 3300048908 Ga0496105_0039450 Ga0496105_0039450_449_1729 359
284 3300048910 Ga0496107_0102142 Ga0496107_0102142_742_2022 359
285 3300048911 Ga0496108_0030525 Ga0496108_0030525_1989_3269 359
286 3300048912 Ga0496109_0040860 Ga0496109_0040860_2485_3765 359
287 3300048913 Ga0496110_0027915 Ga0496110_0027915_3198_4478 359
288 3300048915 Ga0496112_0120166 Ga0496112_0120166_841_2121 359
289 3300048917 Ga0496114_0049847 Ga0496114_0049847_1926_3206 359
290 3300048918 Ga0496115_0004982 Ga0496115_0004982_695_1975 359
291 3300048918 Ga0496115_0006020 Ga0496115_0006020_28_1308 359
292 3300048918 Ga0496115_0072802 Ga0496115_0072802_1070_2350 359
293 3300053085 Ga0495619_0009243 Ga0495619_0009243_4853_6133 359
294 3300053085 Ga0495619_0094159 Ga0495619_0094159_338_1618 359
295 3300005548 Ga0070665_100056683 Ga0070665_1000566833 360
296 3300006048 Ga0075363_100026100 Ga0075363_1000261003 360
297 3300006846 Ga0075430_100150711 Ga0075430_1001507112 360
298 3300006948 Ga0099826_10069819 Ga0099826_100698192 360
299 3300009147 Ga0114129_10466851 Ga0114129_104668512 360
300 3300009148 Ga0105243_10191857 Ga0105243_101918572 360
301 3300013100 Ga0157373_10028318 Ga0157373_100283182 360
302 3300013102 Ga0157371_10000071 Ga0157371_100000716 360
303 3300013104 Ga0157370_10000324 Ga0157370_1000032447 360
304 3300027666 Ga0209282_1055043 Ga0209282_10550432 360
305 3300027876 Ga0209974_10001122 Ga0209974_100011229 360
306 3300028379 Ga0268266_10005375 Ga0268266_100053753 360
307 3300046474 Ga0495605_0013343 Ga0495605_0013343_337_1617 360
308 3300046558 Ga0495633_0048406 Ga0495633_0048406_210_1487 360
309 3300046674 Ga0495588_0000431 Ga0495588_0000431_1796_3073 360
310 3300046810 Ga0495660_0005739 Ga0495660_0005739_1281_2561 360
311 3300047320 Ga0495672_0105675 Ga0495672_0105675_98_1378 360
312 3300048916 Ga0496113_0048240 Ga0496113_0048240_711_1988 360
313 3300048920 Ga0496117_0000031 Ga0496117_0000031_222430_223707 360
314 3300048921 Ga0496118_0015432 Ga0496118_0015432_2381_3658 360
315 3300048923 Ga0496120_0000337 Ga0496120_0000337_71631_72908 360
316 3300048924 Ga0496121_0112481 Ga0496121_0112481_677_1954 360
317 3300048925 Ga0496122_0000023 Ga0496122_0000023_222418_223695 360
318 3300048926 Ga0496123_0000027 Ga0496123_0000027_157341_158618 360
319 3300048926 Ga0496123_0011434 Ga0496123_0011434_1435_2715 360
320 3300048927 Ga0496124_0001510 Ga0496124_0001510_27607_28884 360
321 3300050491 nmdc:mga00v17_183_c1 nmdc:mga00v17_183_c1_7409_8686 360
322 3300050492 nmdc:mga0yw44_751_c1 nmdc:mga0yw44_751_c1_2067_3344 360
323 3300050494 nmdc:mga06z11_73871_c1 nmdc:mga06z11_73871_c1_358_1635 360
324 3300053137 Ga0500561_0001498 Ga0500561_0001498_306_1583 360
325 3300053157 Ga0500624_000900 Ga0500624_000900_2296_3573 360
326 3300059510 Ga0587090_001792 Ga0587090_001792_803_2080 360
327 3300059643 Ga0587072_001998 Ga0587072_001998_330_1607 360
328 3300003791 Ga0055530_10000438 Ga0055530_100004389 361
329 3300003792 Ga0055540_1000382 Ga0055540_10003829 361
330 3300006038 Ga0075365_10037179 Ga0075365_100371793 361
331 3300009148 Ga0105243_10005737 Ga0105243_100057377 361
332 3300011119 Ga0105246_10043205 Ga0105246_100432051 361
333 3300014326 Ga0157380_10003991 Ga0157380_100039917 361
334 3300015261 Ga0182006_1038795 Ga0182006_10387952 361
335 3300025292 Ga0209676_1001123 Ga0209676_100112318 361
336 3300025295 Ga0209564_1014814 Ga0209564_10148142 361
337 3300025298 Ga0209050_1000960 Ga0209050_100096027 361
338 3300025303 Ga0209051_1000692 Ga0209051_100069227 361
339 3300025304 Ga0209257_1005919 Ga0209257_10059195 361
340 3300031548 Ga0307408_100084788 Ga0307408_1000847883 361
341 3300037471 Ga0395905_0061025 Ga0395905_0061025_1190_2473 361
342 3300046615 Ga0495656_0062975 Ga0495656_0062975_59_1342 361
343 3300048920 Ga0496117_0062647 Ga0496117_0062647_421_1701 361
344 3300048921 Ga0496118_0067566 Ga0496118_0067566_530_1810 361
345 3300050516 nmdc:mga0sz30_11825_c1 nmdc:mga0sz30_11825_c1_1215_2495 361
346 3300005548 Ga0070665_100115556 Ga0070665_1001155561 362
347 3300031911 Ga0307412_10072561 Ga0307412_100725612 362
348 3300032126 Ga0307415_100065365 Ga0307415_1000653652 362
349 3300041405 Ga0439438_001328 Ga0439438_001328_6358_7638 362
350 3300042006 Ga0439432_007368 Ga0439432_007368_1268_2548 362
351 3300048927 Ga0496124_0000174 Ga0496124_0000174_71008_72285 362
352 3300050490 nmdc:mga03n38_45165_c1 nmdc:mga03n38_45165_c1_299_1579 362
353 3300050492 nmdc:mga0yw44_123535_c1 nmdc:mga0yw44_123535_c1_88_1368 362
354 3300048922 Ga0496119_0001100 Ga0496119_0001100_32055_33335 363
355 3300048925 Ga0496122_0001245 Ga0496122_0001245_18901_20181 363
356 3300048926 Ga0496123_0000524 Ga0496123_0000524_725_2005 363
357 3300053104 Ga0500556_0000022 Ga0500556_0000022_93549_94829 363
358 3300005262 Ga0065165_1002316 Ga0065165_10023165 364
359 3300025302 Ga0207426_1001558 Ga0207426_100155817 364
360 3300031548 Ga0307408_100005659 Ga0307408_1000056596 364
361 3300031824 Ga0307413_10055005 Ga0307413_100550052 364
362 3300031911 Ga0307412_10014920 Ga0307412_100149203 364
363 3300032004 Ga0307414_10051343 Ga0307414_100513432 364
364 3300032005 Ga0307411_10038395 Ga0307411_100383953 364
365 3300053087 Ga0500643_000111 Ga0500643_000111_13310_14590 364
366 3300053103 Ga0500555_017007 Ga0500555_017007_785_2065 364
367 3300053130 Ga0500642_0019327 Ga0500642_0019327_1170_2450 364
368 3300053142 Ga0500577_0022870 Ga0500577_0022870_480_1760 364
369 3300005339 Ga0070660_100001543 Ga0070660_10000154314 365
370 3300005353 Ga0070669_100046205 Ga0070669_1000462052 365
371 3300005354 Ga0070675_100019963 Ga0070675_1000199632 365
372 3300005366 Ga0070659_100004414 Ga0070659_10000441410 365
373 3300005455 Ga0070663_100164293 Ga0070663_1001642932 365
374 3300005457 Ga0070662_100000314 Ga0070662_10000031422 365
375 3300005539 Ga0068853_100046332 Ga0068853_1000463324 365
376 3300005543 Ga0070672_100232820 Ga0070672_1002328201 365
377 3300005563 Ga0068855_100006143 Ga0068855_10000614317 365
378 3300005564 Ga0070664_100023799 Ga0070664_1000237995 365
379 3300005614 Ga0068856_100044734 Ga0068856_1000447344 365
380 3300013100 Ga0157373_10005155 Ga0157373_100051552 365
381 3300013102 Ga0157371_10005016 Ga0157371_1000501612 365
382 3300013307 Ga0157372_10000840 Ga0157372_1000084043 365
383 3300025919 Ga0207657_10007528 Ga0207657_100075281 365
384 3300025932 Ga0207690_10003207 Ga0207690_1000320710 365
385 3300025933 Ga0207706_10007928 Ga0207706_1000792810 365
386 3300025945 Ga0207679_10008067 Ga0207679_100080675 365
387 3300025949 Ga0207667_10010163 Ga0207667_1001016311 365
388 3300026067 Ga0207678_10160490 Ga0207678_101604902 365
389 3300026078 Ga0207702_10008112 Ga0207702_100081122 365
390 3300021384 Ga0213876_10008758 Ga0213876_100087586 366
391 3300044683 Ga0466965_0006790 Ga0466965_0006790_2919_4199 366
392 3300044735 Ga0466968_0004998 Ga0466968_0004998_1185_2465 366
393 3300044901 Ga0466960_0005850 Ga0466960_0005850_893_2173 366
394 3300053131 Ga0500652_000986 Ga0500652_000986_10_1290 366
395 3300006178 Ga0075367_10118393 Ga0075367_101183932 367
396 3300048919 Ga0496116_0026738 Ga0496116_0026738_2621_3901 367
397 3300048925 Ga0496122_0000214 Ga0496122_0000214_86806_88086 367
398 3300048926 Ga0496123_0000289 Ga0496123_0000289_10168_11448 367
399 3300053161 Ga0500634_0107248 Ga0500634_0107248_55_1335 367
400 3300031911 Ga0307412_10038789 Ga0307412_100387892 368
401 3300032004 Ga0307414_10149333 Ga0307414_101493331 368
402 3300035725 Ga0373947_0070660 Ga0373947_0070660_196_1476 368
403 3300005843 Ga0068860_100270278 Ga0068860_1002702782 369
404 3300028381 Ga0268264_10245057 Ga0268264_102450571 369
405 3300031730 Ga0307516_10080305 Ga0307516_100803053 369
406 3300046501 Ga0495607_0000509 Ga0495607_0000509_11356_12636 369
407 3300048917 Ga0496114_0101901 Ga0496114_0101901_283_1563 369
408 3300041405 Ga0439438_000572 Ga0439438_000572_10309_11589 370
409 3300041407 Ga0439447_004656 Ga0439447_004656_1694_2974 370
410 3300041411 Ga0439466_0008780 Ga0439466_0008780_696_1976 370
411 3300041997 Ga0439431_0003797 Ga0439431_0003797_1773_3053 370
412 3300041997 Ga0439431_0005486 Ga0439431_0005486_1434_2711 370
413 3300042004 Ga0439445_0007942 Ga0439445_0007942_171_1451 370
414 3300042006 Ga0439432_001391 Ga0439432_001391_5269_6549 370
415 3300003203 JGI25406J46586_10000127 JGI25406J46586_1000012711 371
416 3300005985 Ga0081539_10000129 Ga0081539_1000012925 371
417 3300053119 Ga0500595_007107 Ga0500595_007107_2524_3804 371
418 3300005331 Ga0070670_100124977 Ga0070670_1001249771 372
419 3300005455 Ga0070663_100153489 Ga0070663_1001534891 372
420 3300005467 Ga0070706_100069273 Ga0070706_1000692733 372
421 3300005564 Ga0070664_100128212 Ga0070664_1001282123 372
422 3300005937 Ga0081455_10046638 Ga0081455_100466383 372
423 3300006871 Ga0075434_100148420 Ga0075434_1001484201 372
424 3300009551 Ga0105238_10216545 Ga0105238_102165452 372
425 3300010375 Ga0105239_10229993 Ga0105239_102299932 372
426 3300011119 Ga0105246_10095463 Ga0105246_100954632 372
427 3300014325 Ga0163163_10243246 Ga0163163_102432462 372
428 3300025297 Ga0209758_1038791 Ga0209758_10387912 372
429 3300025904 Ga0207647_10060902 Ga0207647_100609022 372
430 3300025910 Ga0207684_10096591 Ga0207684_100965912 372
431 3300025920 Ga0207649_10165386 Ga0207649_101653862 372
432 3300025924 Ga0207694_10079167 Ga0207694_100791673 372
433 3300025927 Ga0207687_10010612 Ga0207687_100106127 372
434 3300025934 Ga0207686_10116915 Ga0207686_101169152 372
435 3300025940 Ga0207691_10102166 Ga0207691_101021663 372
436 3300025942 Ga0207689_10020740 Ga0207689_100207403 372
437 3300025949 Ga0207667_10079186 Ga0207667_100791863 372
438 3300026067 Ga0207678_10116849 Ga0207678_101168492 372
439 3300026067 Ga0207678_10145619 Ga0207678_101456192 372
440 3300026116 Ga0207674_10032206 Ga0207674_100322066 372
441 3300028379 Ga0268266_10024020 Ga0268266_100240204 372
442 3300028379 Ga0268266_10142955 Ga0268266_101429551 372
443 3300028794 Ga0307515_10061534 Ga0307515_100615344 372
444 3300031711 Ga0265314_10054139 Ga0265314_100541392 372
445 3300046460 Ga0495638_0075776 Ga0495638_0075776_756_2036 372
446 3300046507 Ga0495606_0000177 Ga0495606_0000177_31743_33023 372
447 3300046520 Ga0495637_0043181 Ga0495637_0043181_620_1900 372
448 3300046660 Ga0495625_0043121 Ga0495625_0043121_700_1980 372
449 3300046694 Ga0495649_0001060 Ga0495649_0001060_3574_4854 372
450 3300048911 Ga0496108_0185934 Ga0496108_0185934_40_1320 372
451 3300048919 Ga0496116_0006171 Ga0496116_0006171_3761_5041 372
452 3300048923 Ga0496120_0046768 Ga0496120_0046768_677_1957 372
453 3300048924 Ga0496121_0013412 Ga0496121_0013412_499_1779 372
454 3300048925 Ga0496122_0008833 Ga0496122_0008833_9337_10617 372
455 3300048926 Ga0496123_0009986 Ga0496123_0009986_499_1779 372
456 3300048928 Ga0496125_0020013 Ga0496125_0020013_1246_2526 372
457 3300053088 Ga0500644_0000670 Ga0500644_0000670_8038_9318 372
458 3300053090 Ga0500646_0001150 Ga0500646_0001150_1964_3244 372
459 3300053096 Ga0500641_0006974 Ga0500641_0006974_904_2184 372
460 3300053096 Ga0500641_0010572 Ga0500641_0010572_1868_3148 372
461 3300053104 Ga0500556_0000004 Ga0500556_0000004_357383_358663 372
462 3300053131 Ga0500652_001282 Ga0500652_001282_3376_4656 372
463 3300053139 Ga0500568_0000881 Ga0500568_0000881_15106_16386 372
464 3300053153 Ga0500616_0000014 Ga0500616_0000014_384678_385958 372
465 3300053156 Ga0500622_0001597 Ga0500622_0001597_3076_4356 372
466 3300053158 Ga0500627_0005113 Ga0500627_0005113_1597_2877 372
467 3300003215 JGI25153J46596_10000454 JGI25153J46596_1000045423 373
468 3300005328 Ga0070676_10000423 Ga0070676_100004233 373
469 3300005331 Ga0070670_100019756 Ga0070670_1000197563 373
470 3300005333 Ga0070677_10020404 Ga0070677_100204042 373
471 3300005338 Ga0068868_100002392 Ga0068868_1000023922 373
472 3300005354 Ga0070675_100006144 Ga0070675_1000061441 373
473 3300005355 Ga0070671_100020945 Ga0070671_1000209454 373
474 3300005364 Ga0070673_100004590 Ga0070673_1000045904 373
475 3300005459 Ga0068867_100011295 Ga0068867_1000112955 373
476 3300005543 Ga0070672_100004415 Ga0070672_1000044155 373
477 3300005840 Ga0068870_10002691 Ga0068870_100026912 373
478 3300005844 Ga0068862_100146573 Ga0068862_1001465731 373
479 3300005983 Ga0081540_1016256 Ga0081540_10162565 373
480 3300006038 Ga0075365_10135837 Ga0075365_101358372 373
481 3300006051 Ga0075364_10083930 Ga0075364_100839302 373
482 3300006177 Ga0075362_10007237 Ga0075362_100072374 373
483 3300006195 Ga0075366_10071680 Ga0075366_100716802 373
484 3300006881 Ga0068865_100055813 Ga0068865_1000558131 373
485 3300025297 Ga0209758_1013030 Ga0209758_10130303 373
486 3300025893 Ga0207682_10032032 Ga0207682_100320322 373
487 3300025907 Ga0207645_10001419 Ga0207645_1000141910 373
488 3300025925 Ga0207650_10005540 Ga0207650_100055401 373
489 3300025926 Ga0207659_10045529 Ga0207659_100455291 373
490 3300025931 Ga0207644_10087926 Ga0207644_100879263 373
491 3300025938 Ga0207704_10036609 Ga0207704_100366093 373
492 3300025940 Ga0207691_10005530 Ga0207691_100055309 373
493 3300025942 Ga0207689_10019538 Ga0207689_100195385 373
494 3300025960 Ga0207651_10000756 Ga0207651_100007569 373
495 3300025972 Ga0207668_10214479 Ga0207668_102144792 373
496 3300026023 Ga0207677_10013806 Ga0207677_100138066 373
497 3300026075 Ga0207708_10233452 Ga0207708_102334521 373
498 3300026089 Ga0207648_10006536 Ga0207648_100065363 373
499 3300028786 Ga0307517_10000024 Ga0307517_1000002489 373
500 3300031456 Ga0307513_10067054 Ga0307513_100670543 373
501 3300031616 Ga0307508_10000028 Ga0307508_1000002828 373
502 3300046501 Ga0495607_0000021 Ga0495607_0000021_145729_147009 373
503 3300046519 Ga0495632_0011702 Ga0495632_0011702_702_1979 373
504 3300048924 Ga0496121_0057551 Ga0496121_0057551_1330_2610 373
505 3300050489 nmdc:mga03683_5459_c1 nmdc:mga03683_5459_c1_680_1960 373
506 3300005331 Ga0070670_100000540 Ga0070670_10000054021 374
507 3300005983 Ga0081540_1006083 Ga0081540_10060837 374
508 3300009101 Ga0105247_10053536 Ga0105247_100535362 374
509 3300048925 Ga0496122_0001281 Ga0496122_0001281_22813_24051 374
510 3300048926 Ga0496123_0001497 Ga0496123_0001497_23533_24771 374
511 3300005563 Ga0068855_100129838 Ga0068855_1001298383 375
512 3300006195 Ga0075366_10001115 Ga0075366_100011158 375
513 3300025949 Ga0207667_10081551 Ga0207667_100815513 375
514 3300038443 Ga0395901_0054747 Ga0395901_0054747_1102_2382 375
515 3300038443 Ga0395901_0241016 Ga0395901_0241016_128_1405 375
516 3300046558 Ga0495633_0050295 Ga0495633_0050295_444_1724 375
517 3300048903 Ga0496100_0170719 Ga0496100_0170719_37_1278 375
518 3300048928 Ga0496125_0025329 Ga0496125_0025329_14_1255 375
519 3300050493 nmdc:mga0k408_254_c1 nmdc:mga0k408_254_c1_26783_28063 375
520 3300006175 Ga0070712_100025017 Ga0070712_1000250173 376
521 3300030521 Ga0307511_10000001 Ga0307511_1000000126 376
522 3300037312 Ga0395899_0009643 Ga0395899_0009643_1139_2419 376
523 3300037418 Ga0395900_0105087 Ga0395900_0105087_65_1345 376
524 3300037466 Ga0395898_0075301 Ga0395898_0075301_1633_2913 376
525 3300037471 Ga0395905_0094045 Ga0395905_0094045_281_1561 376
526 3300038443 Ga0395901_0044011 Ga0395901_0044011_3070_4350 376
527 3300006173 Ga0070716_100056515 Ga0070716_1000565153 377
528 3300013100 Ga0157373_10006975 Ga0157373_100069756 377
529 3300025939 Ga0207665_10072941 Ga0207665_100729413 377
530 3300037471 Ga0395905_0034718 Ga0395905_0034718_1063_2343 377
531 3300037853 Ga0436364_0086959 Ga0436364_0086959_141_1421 377
532 3300048921 Ga0496118_0030785 Ga0496118_0030785_1536_2816 377
533 3300035172 Ga0373955_0034161 Ga0373955_0034161_380_1660 378
534 3300036401 Ga0373937_0067997 Ga0373937_0067997_1652_2932 378
535 3300046462 Ga0495651_0134730 Ga0495651_0134730_482_1762 378
536 3300046524 Ga0495648_0032067 Ga0495648_0032067_1517_2797 378
537 3300046530 Ga0495654_0002515 Ga0495654_0002515_4693_5970 378
538 3300046530 Ga0495654_0016304 Ga0495654_0016304_1231_2511 378
539 3300048088 Ga0495602_0112414 Ga0495602_0112414_875_2155 378
540 3300053077 Ga0495601_0012914 Ga0495601_0012914_3001_4281 378
541 3300053090 Ga0500646_0031108 Ga0500646_0031108_107_1384 378
542 3300053130 Ga0500642_0000036 Ga0500642_0000036_32696_33976 378
543 3300003187 JGI25151J46595_10000616 JGI25151J46595_100006167 379
544 3300005356 Ga0070674_100004301 Ga0070674_1000043017 379
545 3300005543 Ga0070672_100120954 Ga0070672_1001209542 379
546 3300013306 Ga0163162_10078424 Ga0163162_100784244 379
547 3300025294 Ga0209025_1000029 Ga0209025_1000029428 379
548 3300025937 Ga0207669_10021254 Ga0207669_100212542 379
549 3300025291 Ga0209675_1007816 Ga0209675_10078164 381
550 iso_pu_bacteria 2643221736 2644746889 381
551 iso_pu_bacteria 2841760612 2841762368 381
552 iso_pu_bacteria 2841911363 2841915917 381
553 iso_pu_bacteria 2841917233 2841921703 381
554 iso_pu_bacteria 2844104063 2844109906 381
555 iso_pu_bacteria 2851182111 2851186935 381
556 iso_pu_bacteria 2851246043 2851248381 381
557 iso_pu_bacteria 3003665799 3003669311 381
558 iso_pu_bacteria 8057529695 8057535479 381
559 3300005466 Ga0070685_10030732 Ga0070685_100307322 382
560 3300005577 Ga0068857_100285160 Ga0068857_1002851601 382
561 3300005617 Ga0068859_100209286 Ga0068859_1002092862 382
562 3300005841 Ga0068863_100055965 Ga0068863_1000559654 382
563 3300005842 Ga0068858_100150134 Ga0068858_1001501343 382
564 3300006931 Ga0097620_100209282 Ga0097620_1002092822 382
565 3300009101 Ga0105247_10015117 Ga0105247_100151173 382
566 3300011119 Ga0105246_10066598 Ga0105246_100665983 382
567 3300025907 Ga0207645_10017773 Ga0207645_100177733 382
568 3300025918 Ga0207662_10057439 Ga0207662_100574393 382
569 3300005333 Ga0070677_10001412 Ga0070677_100014127 383
570 3300005355 Ga0070671_100071366 Ga0070671_1000713664 383
571 3300005356 Ga0070674_100004334 Ga0070674_1000043349 383
572 3300005364 Ga0070673_100060505 Ga0070673_1000605052 383
573 3300005456 Ga0070678_100055870 Ga0070678_1000558703 383
574 3300005457 Ga0070662_100100221 Ga0070662_1001002212 383
575 3300005719 Ga0068861_100084356 Ga0068861_1000843562 383
576 3300006038 Ga0075365_10048159 Ga0075365_100481592 383
577 3300006042 Ga0075368_10032229 Ga0075368_100322293 383
578 3300006880 Ga0075429_100006885 Ga0075429_1000068855 383
579 3300014969 Ga0157376_10199753 Ga0157376_101997532 383
580 3300025893 Ga0207682_10002668 Ga0207682_100026687 383
581 3300025908 Ga0207643_10029867 Ga0207643_100298673 383
582 3300025937 Ga0207669_10006937 Ga0207669_100069374 383
583 3300025940 Ga0207691_10001646 Ga0207691_100016467 383
584 3300026075 Ga0207708_10187781 Ga0207708_101877812 383
585 3300026089 Ga0207648_10003035 Ga0207648_100030358 383
586 3300026121 Ga0207683_10009189 Ga0207683_100091897 383
587 3300028380 Ga0268265_10281762 Ga0268265_102817621 383
588 3300046537 Ga0495598_0024321 Ga0495598_0024321_288_1568 383
589 3300050508 nmdc:mga09592_32610_c1 nmdc:mga09592_32610_c1_793_2070 383
590 iso_pu_bacteria 2537561587 2537873636 383
591 iso_pu_bacteria 2554235003 2554248905 383
592 iso_pu_bacteria 2558860242 2559295993 383
593 iso_pu_bacteria 2599185210 2599603214 383
594 iso_pu_bacteria 2600255279 2601610881 383
595 iso_pu_bacteria 2600255308 2601747655 383
596 iso_pu_bacteria 2643221582 2643921517 383
597 iso_pu_bacteria 2643221693 2644521571 383
598 iso_pu_bacteria 2808606387 2808988181 383
599 iso_pu_bacteria 2818991439 2819561003 383
600 iso_pu_bacteria 2838675328 2838678629 383
601 iso_pu_bacteria 2838714209 2838718283 383
602 iso_pu_bacteria 2838719591 2838722925 383
603 iso_pu_bacteria 2838724970 2838728349 383
604 iso_pu_bacteria 2841846520 2841850481 383
605 iso_pu_bacteria 2841859092 2841863267 383
606 iso_pu_bacteria 2842124991 2842129009 383
607 iso_pu_bacteria 2842130223 2842133521 383
608 iso_pu_bacteria 2842152218 2842155567 383
609 iso_pu_bacteria 2842170452 2842174475 383
610 iso_pu_bacteria 2842175837 2842179135 383
611 iso_pu_bacteria 2842187318 2842190707 383
612 iso_pu_bacteria 2842211629 2842214969 383
613 iso_pu_bacteria 2842224351 2842227690 383
614 iso_pu_bacteria 2842515876 2842519996 383
615 iso_pu_bacteria 2842733646 2842738022 383
616 iso_pu_bacteria 2854911287 2854915740 383
617 iso_pu_bacteria 2899792073 2899795364 383
618 iso_pu_bacteria 2899845264 2899849343 383
619 iso_pu_bacteria 2904541872 2904542729 383
620 iso_pu_bacteria 2915650412 2915654495 383
621 iso_pu_bacteria 2919114240 2919118459 383
622 iso_pu_bacteria 2919462493 2919467408 383
623 iso_pu_bacteria 2926754445 2926754989 383
624 iso_pu_bacteria 2926760298 2926762152 383
625 iso_pu_bacteria 2933006813 2933010584 383
626 iso_pu_bacteria 2933011516 2933015744 383
627 iso_pu_bacteria 2933594066 2933597518 383
628 iso_pu_bacteria 2979089926 2979092578 383
629 iso_pu_bacteria 2979095461 2979100031 383
630 iso_pu_bacteria 2979100975 2979104550 383
631 iso_pu_bacteria 2981284811 2981285140 383
632 iso_pu_bacteria 2981289755 2981290085 383
633 iso_pu_bacteria 2981980479 2981981281 383
634 iso_pu_bacteria 2981985349 2981986173 383
635 iso_pu_bacteria 2984518228 2984522765 383
636 iso_pu_bacteria 2984537506 2984542072 383
637 iso_pu_bacteria 2984601300 2984601502 383
638 iso_pu_bacteria 2996310559 2996312621 383
639 iso_pu_bacteria 8003570095 8003573730 383
640 iso_pu_bacteria 8055909800 8055912313 383
641 3300003187 JGI25151J46595_10000162 JGI25151J46595_100001622 384
642 3300003187 JGI25151J46595_10001493 JGI25151J46595_100014937 384
643 3300025294 Ga0209025_1000146 Ga0209025_100014681 384
644 3300025297 Ga0209758_1002993 Ga0209758_100299310 384
645 iso_pu_bacteria 2507262055 2507511326 384
646 iso_pu_bacteria 2508501009 2508545123 384
647 iso_pu_bacteria 2508501042 2508693877 384
648 iso_pu_bacteria 2508501050 2508729140 384
649 iso_pu_bacteria 2508501050 2508730765 384
650 iso_pu_bacteria 2508501114 2509078047 384
651 iso_pu_bacteria 2509276019 2509379848 384
652 iso_pu_bacteria 2510917026 2511174481 384
653 iso_pu_bacteria 2511231008 2511276904 384
654 iso_pu_bacteria 2511231156 2511824548 384
655 iso_pu_bacteria 2513237139 2513877515 384
656 iso_pu_bacteria 2513237144 2513914792 384
657 iso_pu_bacteria 2513237146 2513923966 384
658 iso_pu_bacteria 2515154112 2515625101 384
659 iso_pu_bacteria 2516143018 2516208125 384
660 iso_pu_bacteria 2519899620 2520376849 384
661 iso_pu_bacteria 2524023207 2524452662 384
662 iso_pu_bacteria 2547132374 2548500439 384
663 iso_pu_bacteria 2582581283 2585169112 384
664 iso_pu_bacteria 2582581865 2585390433 384
665 iso_pu_bacteria 2585427633 2585996314 384
666 iso_pu_bacteria 2599185156 2599334133 384
667 iso_pu_bacteria 2599185170 2599416008 384
668 iso_pu_bacteria 2599185188 2599502329 384
669 iso_pu_bacteria 2599185212 2599616536 384
670 iso_pu_bacteria 2599185214 2599627681 384
671 iso_pu_bacteria 2599185226 2599677250 384
672 iso_pu_bacteria 2599185227 2599684695 384
673 iso_pu_bacteria 2599185229 2599696638 384
674 iso_pu_bacteria 2599185248 2599769123 384
675 iso_pu_bacteria 2599185289 2599888367 384
676 iso_pu_bacteria 2599185291 2599895905 384
677 iso_pu_bacteria 2599185292 2599905848 384
678 iso_pu_bacteria 2599185300 2599932609 384
679 iso_pu_bacteria 2599185302 2599941193 384
680 iso_pu_bacteria 2599185304 2599953287 384
681 iso_pu_bacteria 2599185305 2599957789 384
682 iso_pu_bacteria 2599185306 2599968884 384
683 iso_pu_bacteria 2599185308 2599980404 384
684 iso_pu_bacteria 2599185309 2599986390 384
685 iso_pu_bacteria 2599185310 2599992079 384
686 iso_pu_bacteria 2599185311 2599992396 384
687 iso_pu_bacteria 2599185312 2599998835 384
688 iso_pu_bacteria 2599185313 2600004128 384
689 iso_pu_bacteria 2599185314 2600014215 384
690 iso_pu_bacteria 2599185315 2600015513 384
691 iso_pu_bacteria 2599185316 2600026951 384
692 iso_pu_bacteria 2599185317 2600030852 384
693 iso_pu_bacteria 2599185318 2600038362 384
694 iso_pu_bacteria 2599185319 2600044417 384
695 iso_pu_bacteria 2599185320 2600047514 384
696 iso_pu_bacteria 2599185321 2600050721 384
697 iso_pu_bacteria 2599185322 2600062635 384
698 iso_pu_bacteria 2599185323 2600067983 384
699 iso_pu_bacteria 2599185324 2600072758 384
700 iso_pu_bacteria 2599185325 2600077056 384
701 iso_pu_bacteria 2600254930 2600360656 384
702 iso_pu_bacteria 2602042107 2603859411 384
703 iso_pu_bacteria 2615840624 2616294264 384
704 iso_pu_bacteria 2617270735 2617351880 384
705 iso_pu_bacteria 2643221569 2643860746 384
706 iso_pu_bacteria 2643221570 2643864545 384
707 iso_pu_bacteria 2643221596 2643992843 384
708 iso_pu_bacteria 2643221607 2644048509 384
709 iso_pu_bacteria 2643221609 2644058237 384
710 iso_pu_bacteria 2643221609 2644062716 384
711 iso_pu_bacteria 2643221611 2644073290 384
712 iso_pu_bacteria 2643221611 2644076270 384
713 iso_pu_bacteria 2643221621 2644120908 384
714 iso_pu_bacteria 2643221626 2644149493 384
715 iso_pu_bacteria 2643221628 2644162897 384
716 iso_pu_bacteria 2643221636 2644201870 384
717 iso_pu_bacteria 2643221652 2644291766 384
718 iso_pu_bacteria 2643221658 2644325656 384
719 iso_pu_bacteria 2643221672 2644400955 384
720 iso_pu_bacteria 2643221686 2644481311 384
721 iso_pu_bacteria 2643221717 2644647014 384
722 iso_pu_bacteria 2667528170 2671088597 384
723 iso_pu_bacteria 2667528176 2671125178 384
724 iso_pu_bacteria 2675903515 2678263738 384
725 iso_pu_bacteria 2690316117 2692317764 384
726 iso_pu_bacteria 2718217882 2719184256 384
727 iso_pu_bacteria 2718217997 2719669598 384
728 iso_pu_bacteria 2718218009 2719729829 384
729 iso_pu_bacteria 2718218199 2720494614 384
730 iso_pu_bacteria 2718218232 2720610949 384
731 iso_pu_bacteria 2718218233 2720616830 384
732 iso_pu_bacteria 2718218235 2720628188 384
733 iso_pu_bacteria 2718218269 2720771766 384
734 iso_pu_bacteria 2718218363 2721144079 384
735 iso_pu_bacteria 2718218365 2721156768 384
736 iso_pu_bacteria 2718218366 2721161454 384
737 iso_pu_bacteria 2721755514 2722837407 384
738 iso_pu_bacteria 2721755556 2723031020 384
739 iso_pu_bacteria 2721755684 2723563526 384
740 iso_pu_bacteria 2721755685 2723571520 384
741 iso_pu_bacteria 2721755810 2724040983 384
742 iso_pu_bacteria 2721755819 2724087315 384
743 iso_pu_bacteria 2721755822 2724101026 384
744 iso_pu_bacteria 2721755823 2724108268 384
745 iso_pu_bacteria 2728369352 2730105486 384
746 iso_pu_bacteria 2728369365 2730162396 384
747 iso_pu_bacteria 2728369397 2730295529 384
748 iso_pu_bacteria 2738541277 2738721055 384
749 iso_pu_bacteria 2738543012 2739244604 384
750 iso_pu_bacteria 2738543019 2739280254 384
751 iso_pu_bacteria 2744054620 2745010069 384
752 iso_pu_bacteria 2751185821 2753459682 384
753 iso_pu_bacteria 2765235802 2765464534 384
754 iso_pu_bacteria 2767802442 2770199405 384
755 iso_pu_bacteria 2773857925 2774871342 384
756 iso_pu_bacteria 2775506901 2776258894 384
757 iso_pu_bacteria 2775506901 2776259389 384
758 iso_pu_bacteria 2775506901 2776266356 384
759 iso_pu_bacteria 2775506902 2776266980 384
760 iso_pu_bacteria 2775506904 2776283052 384
761 iso_pu_bacteria 2791355091 2792623385 384
762 iso_pu_bacteria 2791355092 2792629299 384
763 iso_pu_bacteria 2791355256 2793295913 384
764 iso_pu_bacteria 2791355260 2793321852 384
765 iso_pu_bacteria 2791355261 2793326905 384
766 iso_pu_bacteria 2791355262 2793336299 384
767 iso_pu_bacteria 2791355264 2793348551 384
768 iso_pu_bacteria 2791355265 2793354176 384
769 iso_pu_bacteria 2791355520 2794594890 384
770 iso_pu_bacteria 2802429603 2805918835 384
771 iso_pu_bacteria 2802429605 2805929825 384
772 iso_pu_bacteria 2802429606 2805933169 384
773 iso_pu_bacteria 2816332133 2816475192 384
774 iso_pu_bacteria 2818991446 2819598616 384
775 iso_pu_bacteria 2824600985 2824606460 384
776 iso_pu_bacteria 2824609381 2824614578 384
777 iso_pu_bacteria 2824653114 2824656223 384
778 iso_pu_bacteria 2824661429 2824662004 384
779 iso_pu_bacteria 2824661429 2824667669 384
780 iso_pu_bacteria 2824696289 2824698801 384
781 iso_pu_bacteria 2824704595 2824708782 384
782 iso_pu_bacteria 2824753945 2824757161 384
783 iso_pu_bacteria 2824763712 2824766759 384
784 iso_pu_bacteria 2825651385 2825651879 384
785 iso_pu_bacteria 2826581358 2826581552 384
786 iso_pu_bacteria 2828305725 2828310008 384
787 iso_pu_bacteria 2835312727 2835312801 384
788 iso_pu_bacteria 2838016132 2838019662 384
789 iso_pu_bacteria 2838022645 2838027135 384
790 iso_pu_bacteria 2838035591 2838036128 384
791 iso_pu_bacteria 2838054893 2838061253 384
792 iso_pu_bacteria 2838061910 2838066441 384
793 iso_pu_bacteria 2838068647 2838072533 384
794 iso_pu_bacteria 2838074704 2838077770 384
795 iso_pu_bacteria 2838661181 2838668475 384
796 iso_pu_bacteria 2838668709 2838669105 384
797 iso_pu_bacteria 2838701080 2838701234 384
798 iso_pu_bacteria 2840764183 2840766012 384
799 iso_pu_bacteria 2841957949 2841963386 384
800 iso_pu_bacteria 2842038055 2842039045 384
801 iso_pu_bacteria 2842045827 2842048008 384
802 iso_pu_bacteria 2842146304 2842146701 384
803 iso_pu_bacteria 2842192696 2842193910 384
804 iso_pu_bacteria 2842198810 2842200609 384
805 iso_pu_bacteria 2842205361 2842208484 384
806 iso_pu_bacteria 2842250916 2842251069 384
807 iso_pu_bacteria 2842278818 2842282170 384
808 iso_pu_bacteria 2842285085 2842289207 384
809 iso_pu_bacteria 2842311132 2842313255 384
810 iso_pu_bacteria 2842317721 2842319323 384
811 iso_pu_bacteria 2842333319 2842338094 384
812 iso_pu_bacteria 2842402390 2842407413 384
813 iso_pu_bacteria 2842409023 2842413338 384
814 iso_pu_bacteria 2842415677 2842419981 384
815 iso_pu_bacteria 2842422224 2842426019 384
816 iso_pu_bacteria 2842428310 2842430166 384
817 iso_pu_bacteria 2842441272 2842442882 384
818 iso_pu_bacteria 2842447887 2842452440 384
819 iso_pu_bacteria 2842462802 2842464470 384
820 iso_pu_bacteria 2842469257 2842471163 384
821 iso_pu_bacteria 2842489311 2842490657 384
822 iso_pu_bacteria 2842495871 2842498925 384
823 iso_pu_bacteria 2842677519 2842680168 384
824 iso_pu_bacteria 2842718218 2842719394 384
825 iso_pu_bacteria 2842733646 2842735509 384
826 iso_pu_bacteria 2842747753 2842751397 384
827 iso_pu_bacteria 2842805378 2842809792 384
828 iso_pu_bacteria 2842815866 2842821091 384
829 iso_pu_bacteria 2842849001 2842854220 384
830 iso_pu_bacteria 2842854478 2842858503 384
831 iso_pu_bacteria 2842922631 2842925586 384
832 iso_pu_bacteria 2844163670 2844170833 384
833 iso_pu_bacteria 2844533157 2844539143 384
834 iso_pu_bacteria 2847417321 2847423735 384
835 iso_pu_bacteria 2847939898 2847940087 384
836 iso_pu_bacteria 2848858292 2848863494 384
837 iso_pu_bacteria 2848992105 2848998821 384
838 iso_pu_bacteria 2850079185 2850085625 384
839 iso_pu_bacteria 2854896431 2854901124 384
840 iso_pu_bacteria 2854916844 2854918515 384
841 iso_pu_bacteria 2855872281 2855873067 384
842 iso_pu_bacteria 2857509624 2857513966 384
843 iso_pu_bacteria 2857524615 2857529176 384
844 iso_pu_bacteria 2857537821 2857540351 384
845 iso_pu_bacteria 2874590934 2874591065 384
846 iso_pu_bacteria 2874628541 2874629807 384
847 iso_pu_bacteria 2874645413 2874645449 384
848 iso_pu_bacteria 2876761206 2876770272 384
849 iso_pu_bacteria 2876771140 2876771201 384
850 iso_pu_bacteria 2876808645 2876817099 384
851 iso_pu_bacteria 2876818435 2876818513 384
852 iso_pu_bacteria 2879074833 2879074930 384
853 iso_pu_bacteria 2879099564 2879105437 384
854 iso_pu_bacteria 2879110137 2879117517 384
855 iso_pu_bacteria 2879127579 2879135682 384
856 iso_pu_bacteria 2879142872 2879150870 384
857 iso_pu_bacteria 2881927736 2881928447 384
858 iso_pu_bacteria 2882456835 2882460271 384
859 iso_pu_bacteria 2882456835 2882462698 384
860 iso_pu_bacteria 2885192300 2885196781 384
861 iso_pu_bacteria 2885383462 2885386185 384
862 iso_pu_bacteria 2885409591 2885411956 384
863 iso_pu_bacteria 2888388044 2888394139 384
864 iso_pu_bacteria 2888419890 2888424168 384
865 iso_pu_bacteria 2889295896 2889297549 384
866 iso_pu_bacteria 2889295896 2889298325 384
867 iso_pu_bacteria 2893066018 2893071290 384
868 iso_pu_bacteria 2894232714 2894237160 384
869 iso_pu_bacteria 2896384573 2896391884 384
870 iso_pu_bacteria 2897803580 2897807369 384
871 iso_pu_bacteria 2899924645 2899926771 384
872 iso_pu_bacteria 2904449895 2904454736 384
873 iso_pu_bacteria 2904456579 2904460341 384
874 iso_pu_bacteria 2904479285 2904482573 384
875 iso_pu_bacteria 2904541872 2904546485 384
876 iso_pu_bacteria 2904541872 2904547465 384
877 iso_pu_bacteria 2904711408 2904720878 384
878 iso_pu_bacteria 2906626472 2906629832 384
879 iso_pu_bacteria 2913036834 2913039610 384
880 iso_pu_bacteria 2919073203 2919076685 384
881 iso_pu_bacteria 2919462493 2919464136 384
882 iso_pu_bacteria 2919481497 2919487428 384
883 iso_pu_bacteria 2920760137 2920764946 384
884 iso_pu_bacteria 2920822456 2920827957 384
885 iso_pu_bacteria 2922368715 2922377645 384
886 iso_pu_bacteria 2923586266 2923586274 384
887 iso_pu_bacteria 2928037797 2928043779 384
888 iso_pu_bacteria 2928044640 2928050636 384
889 iso_pu_bacteria 2928051484 2928056988 384
890 iso_pu_bacteria 2928064002 2928070676 384
891 iso_pu_bacteria 2928070936 2928078234 384
892 iso_pu_bacteria 2928084124 2928086119 384
893 iso_pu_bacteria 2928115317 2928116798 384
894 iso_pu_bacteria 2928115317 2928119777 384
895 iso_pu_bacteria 2929144301 2929147198 384
896 iso_pu_bacteria 2929160207 2929165033 384
897 iso_pu_bacteria 2929160207 2929165931 384
898 iso_pu_bacteria 2929520902 2929524537 384
899 iso_pu_bacteria 2929615660 2929623383 384
900 iso_pu_bacteria 2929624759 2929632525 384
901 iso_pu_bacteria 2931369376 2931369460 384
902 iso_pu_bacteria 2932784394 2932788144 384
903 iso_pu_bacteria 2932794094 2932798564 384
904 iso_pu_bacteria 2932801729 2932803127 384
905 iso_pu_bacteria 2932809354 2932813518 384
906 iso_pu_bacteria 2932818245 2932820215 384
907 iso_pu_bacteria 2933016740 2933022687 384
908 iso_pu_bacteria 2933577622 2933585288 384
909 iso_pu_bacteria 2935608549 2935612439 384
910 iso_pu_bacteria 2935616580 2935620211 384
911 iso_pu_bacteria 2935638405 2935640530 384
912 iso_pu_bacteria 2935648319 2935650341 384
913 iso_pu_bacteria 2935656913 2935658488 384
914 iso_pu_bacteria 2935665750 2935668723 384
915 iso_pu_bacteria 2935675223 2935682022 384
916 iso_pu_bacteria 2935684952 2935687029 384
917 iso_pu_bacteria 2935694250 2935696999 384
918 iso_pu_bacteria 2935703347 2935709767 384
919 iso_pu_bacteria 2935713505 2935716717 384
920 iso_pu_bacteria 2935722832 2935723158 384
921 iso_pu_bacteria 2935732158 2935734715 384
922 iso_pu_bacteria 2935741537 2935744494 384
923 iso_pu_bacteria 2935750917 2935752995 384
924 iso_pu_bacteria 2935760218 2935766892 384
925 iso_pu_bacteria 2935769743 2935774551 384
926 iso_pu_bacteria 2935777560 2935781842 384
927 iso_pu_bacteria 2935785616 2935789434 384
928 iso_pu_bacteria 2935793552 2935797523 384
929 iso_pu_bacteria 2935801545 2935804643 384
930 iso_pu_bacteria 2935810662 2935815794 384
931 iso_pu_bacteria 2935819856 2935823928 384
932 iso_pu_bacteria 2935827899 2935832036 384
933 iso_pu_bacteria 2935837841 2935841133 384
934 iso_pu_bacteria 2935847175 2935852925 384
935 iso_pu_bacteria 2935855204 2935859097 384
936 iso_pu_bacteria 2935864058 2935864278 384
937 iso_pu_bacteria 2935873716 2935875370 384
938 iso_pu_bacteria 2935883170 2935885466 384
939 iso_pu_bacteria 2935908558 2935913383 384
940 iso_pu_bacteria 2935916978 2935922132 384
941 iso_pu_bacteria 2935926038 2935931300 384
942 iso_pu_bacteria 2935934488 2935935582 384
943 iso_pu_bacteria 2935942939 2935947148 384
944 iso_pu_bacteria 2935951376 2935953757 384
945 iso_pu_bacteria 2935959822 2935964340 384
946 iso_pu_bacteria 2935967501 2935968783 384
947 iso_pu_bacteria 2935975950 2935976991 384
948 iso_pu_bacteria 2935984226 2935986050 384
949 iso_pu_bacteria 2935992306 2935995652 384
950 iso_pu_bacteria 2936002035 2936008071 384
951 iso_pu_bacteria 2936011229 2936013100 384
952 iso_pu_bacteria 2936019824 2936021813 384
953 iso_pu_bacteria 2936028420 2936030393 384
954 iso_pu_bacteria 2936037263 2936041696 384
955 iso_pu_bacteria 2936046547 2936048007 384
956 iso_pu_bacteria 2936055302 2936058007 384
957 iso_pu_bacteria 2939631187 2939632484 384
958 iso_pu_bacteria 2940556831 2940558908 384
959 iso_pu_bacteria 2941479691 2941482695 384
960 iso_pu_bacteria 2941499720 2941502460 384
961 iso_pu_bacteria 2941531003 2941537674 384
962 iso_pu_bacteria 2941538514 2941541605 384
963 iso_pu_bacteria 2945945610 2945946944 384
964 iso_pu_bacteria 2945972063 2945976643 384
965 iso_pu_bacteria 2960617483 2960619479 384
966 iso_pu_bacteria 2981284811 2981286024 384
967 iso_pu_bacteria 2981284811 2981289653 384
968 iso_pu_bacteria 2981289755 2981290975 384
969 iso_pu_bacteria 2981289755 2981294599 384
970 iso_pu_bacteria 2981980479 2981981674 384
971 iso_pu_bacteria 2981980479 2981985247 384
972 iso_pu_bacteria 2981985349 2981986570 384
973 iso_pu_bacteria 2981985349 2981990186 384
974 iso_pu_bacteria 2988728565 2988728708 384
975 iso_pu_bacteria 2989349275 2989352384 384
976 iso_pu_bacteria 2990710928 2990715124 384
977 iso_pu_bacteria 2996893221 2996894798 384
978 iso_pu_bacteria 3003930520 3003935804 384
979 iso_pu_bacteria 3005506211 3005510101 384
980 iso_pu_bacteria 3007866637 3007869638 384
981 iso_pu_bacteria 643692032 643821901 384
982 iso_pu_bacteria 8005282627 8005287357 384
983 iso_pu_bacteria 8005289223 8005289910 384
984 iso_pu_bacteria 8005301065 8005307403 384
985 iso_pu_bacteria 8005382845 8005389269 384
986 iso_pu_bacteria 8005395548 8005396867 384
987 iso_pu_bacteria 8005430974 8005435753 384
988 iso_pu_bacteria 8005497431 8005503497 384
989 iso_pu_bacteria 8005619151 8005625799 384
990 iso_pu_bacteria 8005626139 8005632056 384
991 iso_pu_bacteria 8005668836 8005675375 384
992 iso_pu_bacteria 8005688590 8005688692 384
993 iso_pu_bacteria 8006926726 8006931298 384
994 iso_pu_bacteria 8016511872 8016517507 384
995 iso_pu_bacteria 8016522445 8016524177 384
996 iso_pu_bacteria 8016530956 8016537723 384
997 iso_pu_bacteria 8016539877 8016542005 384
998 iso_pu_bacteria 8016548790 8016551280 384
999 iso_pu_bacteria 8016557553 8016559671 384
1000 iso_pu_bacteria 8016583857 8016587868 384
1001 iso_pu_bacteria 8016595262 8016597611 384
1002 iso_pu_bacteria 8016622563 8016629668 384
1003 iso_pu_bacteria 8016630954 8016637755 384
1004 iso_pu_bacteria 8017057580 8017059109 384
1005 iso_pu_bacteria 8018127388 8018134576 384
1006 iso_pu_bacteria 8019530166 8019537397 384
1007 iso_pu_bacteria 8019597564 8019607159 384
1008 iso_pu_bacteria 8019608314 8019611349 384
1009 iso_pu_bacteria 8019619141 8019624788 384
1010 iso_pu_bacteria 8019629233 8019637353 384
1011 iso_pu_bacteria 8019638758 8019642242 384
1012 iso_pu_bacteria 8019648815 8019656929 384
1013 iso_pu_bacteria 8019668869 8019674739 384
1014 iso_pu_bacteria 8019687851 8019694460 384
1015 iso_pu_bacteria 8024501048 8024506960 384
1016 iso_pu_bacteria 8054002106 8054008344 384
1017 iso_pu_bacteria 8054002106 8054008779 384
1018 iso_pu_bacteria 8055742211 8055743327 384
1019 iso_pu_bacteria 8056143049 8056145658 384
1020 iso_pu_bacteria 8056382006 8056385464 384
1021 3300004625 Ga0055543_1011419 Ga0055543_10114191 385
1022 3300005262 Ga0065165_1000393 Ga0065165_100039325 385
1023 3300005331 Ga0070670_100009738 Ga0070670_1000097387 385
1024 3300005618 Ga0068864_100014385 Ga0068864_1000143854 385
1025 3300005841 Ga0068863_100010812 Ga0068863_1000108124 385
1026 3300006844 Ga0075428_100001618 Ga0075428_1000016187 385
1027 3300006846 Ga0075430_100024745 Ga0075430_1000247455 385
1028 3300006847 Ga0075431_100007036 Ga0075431_10000703612 385
1029 3300006880 Ga0075429_100022227 Ga0075429_1000222276 385
1030 3300009094 Ga0111539_10000418 Ga0111539_1000041834 385
1031 3300009147 Ga0114129_10000336 Ga0114129_1000033622 385
1032 3300013104 Ga0157370_10001357 Ga0157370_1000135722 385
1033 3300014325 Ga0163163_10004624 Ga0163163_100046249 385
1034 3300025284 Ga0209130_1000061 Ga0209130_100006127 385
1035 3300025925 Ga0207650_10044581 Ga0207650_100445812 385
1036 3300027907 Ga0207428_10002714 Ga0207428_100027144 385
1037 3300046522 Ga0495643_0013677 Ga0495643_0013677_3334_4614 385
1038 3300050507 nmdc:mga05p37_22_c2 nmdc:mga05p37_22_c2_35404_36684 385
1039 3300050508 nmdc:mga09592_20673_c1 nmdc:mga09592_20673_c1_602_1882 385
1040 3300050509 nmdc:mga0qj67_20482_c1 nmdc:mga0qj67_20482_c1_2874_4154 385
1041 3300050510 nmdc:mga06r32_3586_c1 nmdc:mga06r32_3586_c1_1006_2286 385
1042 3300050511 nmdc:mga08y16_177_c1 nmdc:mga08y16_177_c1_9297_10577 385
1043 3300035089 Ga0373944_0002367 Ga0373944_0002367_71_1351 386
1044 3300035113 Ga0373936_0031832 Ga0373936_0031832_415_1695 386
1045 3300035171 Ga0373946_0007751 Ga0373946_0007751_2365_3645 386
1046 3300035692 Ga0373935_0003759 Ga0373935_0003759_6068_7348 386
1047 3300035695 Ga0373927_0004169 Ga0373927_0004169_7321_8601 386
1048 3300045051 Ga0451576_0044807 Ga0451576_0044807_2926_4203 386
1049 3300046455 Ga0495603_0009552 Ga0495603_0009552_3546_4826 386
1050 3300046472 Ga0495580_0018432 Ga0495580_0018432_1064_2344 386
1051 3300046476 Ga0495662_0018852 Ga0495662_0018852_619_1899 386
1052 3300046491 Ga0495584_0039085 Ga0495584_0039085_796_2076 386
1053 3300046515 Ga0495620_0045919 Ga0495620_0045919_598_1878 386
1054 3300046537 Ga0495598_0009887 Ga0495598_0009887_385_1665 386
1055 3300046557 Ga0495622_0007851 Ga0495622_0007851_2745_4025 386
1056 3300046690 Ga0495624_0023634 Ga0495624_0023634_2320_3600 386
1057 3300047319 Ga0495674_0075980 Ga0495674_0075980_1454_2734 386
1058 3300047472 Ga0495686_0079814 Ga0495686_0079814_162_1442 386
1059 3300002704 JGI25155J39150_1000024 JGI25155J39150_10000242 387
1060 3300002705 JGI25156J39149_1000005 JGI25156J39149_1000005252 387
1061 3300002738 JGI25154J39366_1000017 JGI25154J39366_1000017244 387
1062 3300002741 JGI25157J39369_1000003 JGI25157J39369_1000003260 387
1063 3300002741 JGI25157J39369_1000054 JGI25157J39369_100005495 387
1064 3300002987 JGI25159J45721_1000273 JGI25159J45721_100027316 387
1065 3300003187 JGI25151J46595_10037173 JGI25151J46595_100371732 387
1066 3300003354 JGI25160J50197_1000483 JGI25160J50197_10004832 387
1067 3300003374 JGI25161J50226_1000352 JGI25161J50226_10003522 387
1068 3300004625 Ga0055543_1006051 Ga0055543_10060512 387
1069 3300005330 Ga0070690_100011894 Ga0070690_1000118943 387
1070 3300005335 Ga0070666_10010604 Ga0070666_100106045 387
1071 3300005354 Ga0070675_100000613 Ga0070675_1000006134 387
1072 3300005355 Ga0070671_100035174 Ga0070671_1000351742 387
1073 3300005364 Ga0070673_100010305 Ga0070673_1000103052 387
1074 3300005365 Ga0070688_100011113 Ga0070688_1000111133 387
1075 3300005367 Ga0070667_100010275 Ga0070667_1000102756 387
1076 3300005456 Ga0070678_100004507 Ga0070678_1000045075 387
1077 3300005457 Ga0070662_100019907 Ga0070662_1000199073 387
1078 3300005543 Ga0070672_100137273 Ga0070672_1001372732 387
1079 3300005563 Ga0068855_100073215 Ga0068855_1000732153 387
1080 3300005616 Ga0068852_100290300 Ga0068852_1002903002 387
1081 3300005617 Ga0068859_100001476 Ga0068859_1000014764 387
1082 3300005618 Ga0068864_100000212 Ga0068864_10000021231 387
1083 3300005841 Ga0068863_100001367 Ga0068863_10000136725 387
1084 3300005841 Ga0068863_100075563 Ga0068863_1000755633 387
1085 3300005842 Ga0068858_100002088 Ga0068858_1000020885 387
1086 3300005843 Ga0068860_100270757 Ga0068860_1002707572 387
1087 3300006038 Ga0075365_10020188 Ga0075365_100201882 387
1088 3300006042 Ga0075368_10002604 Ga0075368_100026045 387
1089 3300006048 Ga0075363_100044611 Ga0075363_1000446113 387
1090 3300006051 Ga0075364_10039004 Ga0075364_100390043 387
1091 3300006178 Ga0075367_10010157 Ga0075367_100101572 387
1092 3300006178 Ga0075367_10054273 Ga0075367_100542733 387
1093 3300006186 Ga0075369_10006145 Ga0075369_100061451 387
1094 3300006195 Ga0075366_10008595 Ga0075366_100085952 387
1095 3300006237 Ga0097621_100040078 Ga0097621_1000400783 387
1096 3300006353 Ga0075370_10045805 Ga0075370_100458054 387
1097 3300006881 Ga0068865_100061310 Ga0068865_1000613103 387
1098 3300006931 Ga0097620_100001476 Ga0097620_1000014764 387
1099 3300006946 Ga0079104_1009489 Ga0079104_10094894 387
1100 3300009177 Ga0105248_10015734 Ga0105248_100157347 387
1101 3300009553 Ga0105249_10025877 Ga0105249_100258773 387
1102 3300013296 Ga0157374_10022494 Ga0157374_100224943 387
1103 3300014325 Ga0163163_10008095 Ga0163163_100080959 387
1104 3300025206 Ga0209435_100002 Ga0209435_100002367 387
1105 3300025208 Ga0209436_100352 Ga0209436_1003522 387
1106 3300025246 Ga0209646_1000001 Ga0209646_10000012510 387
1107 3300025250 Ga0209026_1000001 Ga0209026_10000011166 387
1108 3300025256 Ga0209759_1000001 Ga0209759_10000012141 387
1109 3300025263 Ga0209565_1000678 Ga0209565_10006789 387
1110 3300025284 Ga0209130_1000450 Ga0209130_100045032 387
1111 3300025291 Ga0209675_1001531 Ga0209675_10015313 387
1112 3300025291 Ga0209675_1002999 Ga0209675_10029992 387
1113 3300025292 Ga0209676_1005394 Ga0209676_10053943 387
1114 3300025294 Ga0209025_1011968 Ga0209025_10119685 387
1115 3300025294 Ga0209025_1018594 Ga0209025_10185943 387
1116 3300025297 Ga0209758_1003945 Ga0209758_10039453 387
1117 3300025299 Ga0209256_1001387 Ga0209256_100138726 387
1118 3300025302 Ga0207426_1000428 Ga0207426_100042843 387
1119 3300025315 Ga0207697_10031808 Ga0207697_100318083 387
1120 3300025903 Ga0207680_10004622 Ga0207680_100046225 387
1121 3300025926 Ga0207659_10000631 Ga0207659_100006312 387
1122 3300025931 Ga0207644_10037494 Ga0207644_100374943 387
1123 3300025933 Ga0207706_10019241 Ga0207706_100192415 387
1124 3300025940 Ga0207691_10022504 Ga0207691_100225045 387
1125 3300025941 Ga0207711_10040039 Ga0207711_100400394 387
1126 3300025986 Ga0207658_10041751 Ga0207658_100417514 387
1127 3300026035 Ga0207703_10001030 Ga0207703_1000103027 387
1128 3300026088 Ga0207641_10034707 Ga0207641_100347072 387
1129 3300026089 Ga0207648_10012621 Ga0207648_100126216 387
1130 3300026095 Ga0207676_10000229 Ga0207676_100002295 387
1131 3300026121 Ga0207683_10008851 Ga0207683_100088514 387
1132 3300026142 Ga0207698_10136737 Ga0207698_101367371 387
1133 3300028380 Ga0268265_10112664 Ga0268265_101126643 387
1134 3300028381 Ga0268264_10210705 Ga0268264_102107052 387
1135 3300031456 Ga0307513_10000057 Ga0307513_10000057109 387
1136 3300031456 Ga0307513_10000206 Ga0307513_100002066 387
1137 3300031456 Ga0307513_10005251 Ga0307513_1000525114 387
1138 3300048911 Ga0496108_0044563 Ga0496108_0044563_185_1462 387
1139 3300048912 Ga0496109_0082047 Ga0496109_0082047_846_2123 387
1140 3300050491 nmdc:mga00v17_66735_c1 nmdc:mga00v17_66735_c1_849_2129 387
1141 3300050492 nmdc:mga0yw44_27381_c1 nmdc:mga0yw44_27381_c1_1862_3142 387
1142 3300050494 nmdc:mga06z11_97997_c1 nmdc:mga06z11_97997_c1_194_1471 387
1143 3300050496 nmdc:mga07m45_6292_c1 nmdc:mga07m45_6292_c1_2967_4244 387
1144 3300050507 nmdc:mga05p37_261893_c1 nmdc:mga05p37_261893_c1_655_1932 387
1145 3300053117 Ga0500593_000258 Ga0500593_000258_17747_19024 387
1146 3300053730 Ga0500645_000978 Ga0500645_000978_12922_14199 387
1147 2162886007 SwRhRL2b_contig_2555482 SwRhRL2b_0988.00001450 388
1148 3300001979 JGI24740J21852_10002160 JGI24740J21852_100021609 388
1149 3300001989 JGI24739J22299_10007080 JGI24739J22299_100070803 388
1150 3300003187 JGI25151J46595_10000323 JGI25151J46595_1000032335 388
1151 3300003187 JGI25151J46595_10002779 JGI25151J46595_100027793 388
1152 3300003781 Ga0055536_1000791 Ga0055536_10007914 388
1153 3300003781 Ga0055536_1003436 Ga0055536_10034366 388
1154 3300003784 Ga0055534_1004223 Ga0055534_10042235 388
1155 3300003791 Ga0055530_10000022 Ga0055530_1000002259 388
1156 3300003792 Ga0055540_1000395 Ga0055540_100039538 388
1157 3300003794 Ga0055531_10000392 Ga0055531_100003924 388
1158 3300005288 Ga0065714_10002256 Ga0065714_1000225620 388
1159 3300005289 Ga0065704_10070552 Ga0065704_1007055210 388
1160 3300005459 Ga0068867_100164844 Ga0068867_1001648442 388
1161 3300005467 Ga0070706_100000680 Ga0070706_1000006805 388
1162 3300005468 Ga0070707_100072123 Ga0070707_1000721232 388
1163 3300005471 Ga0070698_100177318 Ga0070698_1001773182 388
1164 3300005539 Ga0068853_100001041 Ga0068853_10000104112 388
1165 3300006051 Ga0075364_10069203 Ga0075364_100692032 388
1166 3300006178 Ga0075367_10001552 Ga0075367_100015527 388
1167 3300006186 Ga0075369_10007612 Ga0075369_100076122 388
1168 3300006195 Ga0075366_10006288 Ga0075366_100062884 388
1169 3300006195 Ga0075366_10056681 Ga0075366_100566811 388
1170 3300006353 Ga0075370_10002782 Ga0075370_100027825 388
1171 3300006353 Ga0075370_10023143 Ga0075370_100231434 388
1172 3300006948 Ga0099826_10000013 Ga0099826_10000013174 388
1173 3300009036 Ga0105244_10013800 Ga0105244_100138003 388
1174 3300009148 Ga0105243_10006368 Ga0105243_100063686 388
1175 3300009551 Ga0105238_10006513 Ga0105238_100065132 388
1176 3300009553 Ga0105249_10064073 Ga0105249_100640732 388
1177 3300011119 Ga0105246_10011263 Ga0105246_100112631 388
1178 3300013104 Ga0157370_10100354 Ga0157370_101003543 388
1179 3300014497 Ga0182008_10000325 Ga0182008_100003254 388
1180 3300014497 Ga0182008_10001424 Ga0182008_1000142410 388
1181 3300015261 Ga0182006_1002542 Ga0182006_10025425 388
1182 3300015262 Ga0182007_10000588 Ga0182007_100005885 388
1183 3300017792 Ga0163161_10109587 Ga0163161_101095872 388
1184 3300025208 Ga0209436_110094 Ga0209436_1100942 388
1185 3300025245 Ga0207425_1000243 Ga0207425_100024338 388
1186 3300025258 Ga0209129_1000030 Ga0209129_100003042 388
1187 3300025263 Ga0209565_1000019 Ga0209565_1000019113 388
1188 3300025273 Ga0209673_1000095 Ga0209673_100009532 388
1189 3300025273 Ga0209673_1000121 Ga0209673_1000121152 388
1190 3300025273 Ga0209673_1002789 Ga0209673_10027899 388
1191 3300025284 Ga0209130_1000011 Ga0209130_1000011106 388
1192 3300025284 Ga0209130_1000903 Ga0209130_10009038 388
1193 3300025291 Ga0209675_1000073 Ga0209675_100007338 388
1194 3300025292 Ga0209676_1000193 Ga0209676_100019356 388
1195 3300025292 Ga0209676_1001188 Ga0209676_100118823 388
1196 3300025292 Ga0209676_1002784 Ga0209676_100278412 388
1197 3300025294 Ga0209025_1000145 Ga0209025_100014570 388
1198 3300025294 Ga0209025_1000494 Ga0209025_100049440 388
1199 3300025294 Ga0209025_1010461 Ga0209025_10104616 388
1200 3300025295 Ga0209564_1000056 Ga0209564_100005629 388
1201 3300025297 Ga0209758_1000037 Ga0209758_1000037298 388
1202 3300025298 Ga0209050_1000193 Ga0209050_100019356 388
1203 3300025298 Ga0209050_1000704 Ga0209050_10007044 388
1204 3300025298 Ga0209050_1005033 Ga0209050_10050337 388
1205 3300025299 Ga0209256_1000043 Ga0209256_100004329 388
1206 3300025299 Ga0209256_1000171 Ga0209256_1000171102 388
1207 3300025302 Ga0207426_1000029 Ga0207426_1000029297 388
1208 3300025302 Ga0207426_1000068 Ga0207426_100006824 388
1209 3300025303 Ga0209051_1000147 Ga0209051_100014756 388
1210 3300025303 Ga0209051_1000186 Ga0209051_100018650 388
1211 3300025304 Ga0209257_1000547 Ga0209257_10005479 388
1212 3300025304 Ga0209257_1000663 Ga0209257_10006637 388
1213 3300025910 Ga0207684_10001213 Ga0207684_100012133 388
1214 3300025924 Ga0207694_10063111 Ga0207694_100631111 388
1215 3300025935 Ga0207709_10002938 Ga0207709_100029385 388
1216 3300026041 Ga0207639_10002239 Ga0207639_100022395 388
1217 3300026142 Ga0207698_10038526 Ga0207698_100385262 388
1218 3300027666 Ga0209282_1000043 Ga0209282_100004382 388
1219 3300028379 Ga0268266_10269284 Ga0268266_102692842 388
1220 3300031911 Ga0307412_10000235 Ga0307412_1000023527 388
1221 3300037068 Ga0373925_0035877 Ga0373925_0035877_340_1620 388
1222 3300042015 Ga0439462_0002207 Ga0439462_0002207_2638_3921 388
1223 3300046474 Ga0495605_0001215 Ga0495605_0001215_10594_11874 388
1224 3300046475 Ga0495639_0064242 Ga0495639_0064242_252_1532 388
1225 3300046500 Ga0495596_0000058 Ga0495596_0000058_74556_75836 388
1226 3300046501 Ga0495607_0006603 Ga0495607_0006603_6795_8075 388
1227 3300046512 Ga0495610_0001463 Ga0495610_0001463_5821_7101 388
1228 3300046513 Ga0495616_0001432 Ga0495616_0001432_4396_5676 388
1229 3300046524 Ga0495648_0043977 Ga0495648_0043977_1224_2504 388
1230 3300046538 Ga0495609_0000566 Ga0495609_0000566_958_2238 388
1231 3300046542 Ga0495597_0000329 Ga0495597_0000329_40716_41996 388
1232 3300046615 Ga0495656_0000047 Ga0495656_0000047_31249_32529 388
1233 3300046665 Ga0495661_0048361 Ga0495661_0048361_966_2246 388
1234 3300046691 Ga0495670_0048730 Ga0495670_0048730_86_1366 388
1235 3300046692 Ga0495671_0000966 Ga0495671_0000966_12434_13714 388
1236 3300046694 Ga0495649_0020791 Ga0495649_0020791_684_1964 388
1237 3300047469 Ga0495673_0000210 Ga0495673_0000210_3023_4303 388
1238 3300048907 Ga0496104_0015976 Ga0496104_0015976_5156_6436 388
1239 3300048909 Ga0496106_0117893 Ga0496106_0117893_196_1476 388
1240 3300048911 Ga0496108_0092410 Ga0496108_0092410_749_2029 388
1241 3300048912 Ga0496109_0052831 Ga0496109_0052831_2287_3567 388
1242 3300048915 Ga0496112_0109196 Ga0496112_0109196_1358_2638 388
1243 3300048918 Ga0496115_0011568 Ga0496115_0011568_1153_2433 388
1244 3300048920 Ga0496117_0023846 Ga0496117_0023846_490_1770 388
1245 3300048921 Ga0496118_0001366 Ga0496118_0001366_8619_9899 388
1246 3300048921 Ga0496118_0064217 Ga0496118_0064217_1157_2437 388
1247 3300048924 Ga0496121_0000444 Ga0496121_0000444_39238_40518 388
1248 3300048924 Ga0496121_0032600 Ga0496121_0032600_482_1762 388
1249 3300048925 Ga0496122_0000908 Ga0496122_0000908_17619_18899 388
1250 3300048926 Ga0496123_0000412 Ga0496123_0000412_44457_45737 388
1251 3300048926 Ga0496123_0022278 Ga0496123_0022278_2234_3514 388
1252 3300050493 nmdc:mga0k408_113591_c1 nmdc:mga0k408_113591_c1_115_1395 388
1253 3300050496 nmdc:mga07m45_2648_c1 nmdc:mga07m45_2648_c1_5565_6845 388
1254 3300053153 Ga0500616_0011831 Ga0500616_0011831_1291_2571 388
1255 iso_pu_bacteria 8019659431 8019665203 388

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06808

DctM

Tripartite ATP-independent periplasmic transporter, DctM component

24

433

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.7967 19 386
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7746 3 388
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7689 3 388
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.756 19 386
4r0c-assembly1.cif.gz_D crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology 0.6441 37 383
ID Description Score Start End Superfamily
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6011 2 371 1.20.1530.20
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.5756 2 371 1.20.1530.20
af_A6NC51_4_206_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3168 55 251 1.20.1070.10
af_A6NC51_4_206_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3047 55 251 1.20.1070.10
af_Q1ZXE9_716_918_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.3034 48 227 1.20.1410.10
ID Description Score Start End GO Terms
AF-A0A527ZKM0-F1-model_v4 TRAP transporter large permease 0.9387 48 265 GO:0005886
GO:0022857
AF-X1CUY5-F1-model_v4 TRAP C4-dicarboxylate transport system permease DctM subunit domain-containing protein 0.934 47 257 GO:0005886
GO:0022857
AF-A0A7W8PJF4-F1-model_v4 TRAP transporter large permease protein 0.9166 69 385 GO:0005886
GO:0022857
AF-X1KG46-F1-model_v4 TRAP C4-dicarboxylate transport system permease DctM subunit domain-containing protein 0.9103 87 249 GO:0005886
GO:0022857
AF-X0TLF2-F1-model_v4 TRAP C4-dicarboxylate transport system permease DctM subunit domain-containing protein 0.8942 52 384 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
82.12 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map