F492253
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1255 | 817 | 816 | 405 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8019659431|8019665203 |
| Length | 443 |
| Sequence | RYRAARRSHPENHRDHAMTIAVFTLSLLGAMALGMPIAFALIVCGVALMSTIDMFDAQIVAQNVINGADSFPLMAIPFFMLAGEVMNKGGLAKRIVNVALVAVGHFRGGLGYVTILASCILASLSGSAAADAAALAALLVPMMVAAGHKKSYAAGLVAAGGIIAPVIPPSIGFVIFGVAAGVSISKLFLAGIVPGLLLGAGLCLAWAWVVRKENLTPPPRASLSEMVKAVVDGFWALMLPLIIVVGLRFGIFTPTEAAVVVAVYSLFVATCVYRELKLPQLYVIFVSSAVTTSIVMFLVAAALVSSWLITVSEISAQIVTLLKPFMGNNTLLMLAIMVVVVIVGTALDMTPTILILTPILMPIVKAAGIDPVYFGVLFIINNAIGLITPPVGIVLNVVCGVSRISMEDIVKGVWPFMIAQLIVLFAMVLFPGLVTIPAKWFGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 6 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 7 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 8 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 9 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 10 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 13 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 14 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 15 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 16 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 17 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 18 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 19 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 20 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 21 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 22 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 23 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 24 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 25 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 26 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 27 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 28 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 29 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 30 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 31 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 32 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 33 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 34 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 35 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 36 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 37 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 38 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 39 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 40 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 41 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 42 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 43 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 44 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 45 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 46 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 47 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 48 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 49 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 50 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 51 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 52 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 53 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 54 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 55 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 56 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 57 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 58 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 59 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 60 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 61 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 62 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 63 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 64 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 65 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 66 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 67 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 68 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 69 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 70 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 71 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 72 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 73 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 74 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 75 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 76 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 77 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 78 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 79 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 80 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 81 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 82 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 83 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 84 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 85 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 86 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 87 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 88 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 89 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 90 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 91 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 92 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 93 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 94 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 95 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 96 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 97 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 98 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 99 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 100 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 101 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 102 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 103 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 104 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 105 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 106 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 107 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 108 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 109 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 110 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 111 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 112 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 113 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 114 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 115 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 116 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 117 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 118 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 119 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 120 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 121 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 122 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 123 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 124 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 125 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 126 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 127 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 128 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 129 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 130 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 131 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 132 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 133 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 134 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 135 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 136 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 137 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 138 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 139 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 140 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 141 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 142 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 143 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 144 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 145 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 146 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 147 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 148 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 149 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 150 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 151 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 152 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 153 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 154 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 155 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 156 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 157 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 158 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 159 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 160 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 161 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 162 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 163 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 164 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 165 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 166 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 167 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 168 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 169 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 170 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 171 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 172 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 173 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 174 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 175 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 176 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 177 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 178 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 179 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 180 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 181 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 182 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 183 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 184 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 185 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 186 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 187 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 188 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 189 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 190 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 191 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 192 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 193 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 194 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 195 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 196 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 197 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 198 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 199 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 200 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 201 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 202 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 203 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 204 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 205 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 206 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 207 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 208 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 209 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 210 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 211 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 212 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 213 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 214 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 215 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 216 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 217 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 218 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 219 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 220 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 221 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 222 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 223 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 224 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 225 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 226 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 227 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 228 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 229 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 230 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 231 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 232 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 233 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 234 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 235 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 236 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 237 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 238 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 239 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 240 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 241 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 242 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 243 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 244 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 245 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 246 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 247 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 248 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 249 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 250 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 251 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 252 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 253 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 254 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 255 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 256 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 257 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 258 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 259 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 260 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 261 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 262 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 263 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 264 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 265 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 266 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 267 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 268 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 269 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 270 | 2922368715 | |||
| 271 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 272 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 273 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 274 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 275 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 276 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 277 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 278 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 279 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 280 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 281 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 282 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 283 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 284 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 285 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 286 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 287 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 288 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 289 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 290 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 291 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 292 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 293 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 294 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 295 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 296 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 297 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 298 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 299 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 300 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 301 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 302 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 303 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 304 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 305 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 306 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 307 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 308 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 309 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 310 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 311 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 312 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 313 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 314 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 315 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 316 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 317 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 318 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 319 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 320 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 321 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 322 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 323 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 324 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 325 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 326 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 327 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 328 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 329 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 330 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 331 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 332 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 333 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 334 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 335 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 336 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 337 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 338 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 339 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 340 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 341 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 342 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 343 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 344 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 345 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 346 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 347 | 2941479691 | |||
| 348 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 349 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 350 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 351 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 352 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 353 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 354 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 355 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 356 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 357 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 358 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 359 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 360 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 361 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 362 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 363 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 364 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 365 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 366 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 367 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 368 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 369 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 370 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 371 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 372 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 373 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 374 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 375 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 376 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 377 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 378 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 379 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 380 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 381 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 382 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 383 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 384 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 385 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 386 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 387 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 388 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 389 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 390 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 391 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 392 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 393 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 394 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 395 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 396 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 397 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 398 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 399 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 400 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 401 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 402 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 403 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 404 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 405 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 406 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 407 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 408 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 409 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 410 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 411 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 412 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 413 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 414 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 415 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 416 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 417 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 418 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 419 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 420 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 421 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 422 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 423 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 424 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 425 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 426 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 427 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 428 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 429 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 430 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 431 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 432 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 433 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 434 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 435 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 436 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 437 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 438 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 439 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 440 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 441 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 442 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 443 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 444 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 445 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 446 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 447 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 448 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 449 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 450 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 451 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 452 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 453 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 454 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 455 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 456 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 458 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 459 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 460 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 461 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 462 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 463 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 464 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 466 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 467 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 468 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 469 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 471 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 472 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 474 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 475 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 476 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 477 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 478 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 479 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 480 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 481 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 482 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 483 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 484 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 485 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 486 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 487 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 488 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 489 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 490 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 491 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 492 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 493 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 494 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 495 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 496 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 497 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 498 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 499 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 500 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 501 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 502 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 503 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 504 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 505 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 506 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 507 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 508 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 509 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 510 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 511 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 512 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 513 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 514 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 515 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 516 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 517 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 518 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 519 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 520 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 522 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 524 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 525 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 527 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 529 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 530 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 531 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 532 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 533 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 534 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 535 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 536 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 537 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 538 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 539 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 540 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 543 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 544 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 545 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 546 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 547 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 548 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 549 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 550 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 551 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 552 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 553 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 554 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 555 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 556 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 557 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 558 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 559 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 560 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 561 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 562 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 563 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 564 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 565 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 566 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 567 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 568 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 569 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 570 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 571 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 572 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 573 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 574 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 575 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 576 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 578 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 579 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 580 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 581 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 582 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 583 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 584 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 585 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 586 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 587 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 588 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 589 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 590 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 591 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 592 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 593 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 594 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 595 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 596 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 597 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 598 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 599 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 600 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 601 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 602 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 603 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 604 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 605 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 606 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 607 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 608 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 609 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 610 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 611 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 612 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 613 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 614 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 615 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 616 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 617 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 618 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 619 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 620 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 621 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 622 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 623 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 624 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 625 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 626 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 627 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 628 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 629 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 630 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 631 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 632 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 693 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 699 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 700 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 701 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 702 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 703 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 704 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 705 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 706 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 707 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 708 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 709 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 710 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 711 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 712 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 713 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 714 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 715 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 716 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 717 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 718 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 719 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 720 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 721 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 722 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 723 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 724 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 725 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 726 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 727 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 728 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 729 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 730 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 731 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 732 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 733 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 734 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 735 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 736 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 737 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 738 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 739 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 740 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 741 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 742 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 743 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 744 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 745 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 746 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 747 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 748 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 749 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 750 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 751 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 752 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 753 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 754 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 755 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 756 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 757 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 758 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 759 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 760 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 761 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 762 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 763 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 764 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 765 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 766 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 767 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 768 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 769 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 770 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 771 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 772 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 773 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 774 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 775 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 776 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 777 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 778 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 779 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 780 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 781 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 782 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 783 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 784 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 785 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 786 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 787 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 788 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 789 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 790 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 791 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 792 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 793 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 794 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 795 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 796 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 797 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 798 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 799 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 800 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 801 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 802 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 803 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 804 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 805 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 806 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 807 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 808 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 809 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 810 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 811 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 812 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 813 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 814 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 815 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 816 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 817 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 64.83 |
| Metatranscriptomes | 0.24 |
| Isolates | 34.93 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.24 |
| Bulb | 0 |
| Endosphere | 16.33 |
| Nodule | 17.93 |
| Rhizoplane | 6.69 |
| Rhizosphere | 43.59 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2555482 | 2162886007 | Bacteria | 18248 |
| 2 | JGI24740J21852_10002160 | 3300001979 | Bacteria | 8985 |
| 3 | JGI24739J22299_10007080 | 3300001989 | Bacteria | 4222 |
| 4 | JGI25155J39150_1000024 | 3300002704 | Bacteria | 133561 |
| 5 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 6 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 7 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 8 | JGI25157J39369_1000054 | 3300002741 | Bacteria | 108825 |
| 9 | JGI25159J45721_1000273 | 3300002987 | Bacteria | 24188 |
| 10 | JGI25151J46595_10000162 | 3300003187 | Bacteria | 86356 |
| 11 | JGI25151J46595_10000323 | 3300003187 | Bacteria | 51894 |
| 12 | JGI25151J46595_10000616 | 3300003187 | Bacteria | 31174 |
| 13 | JGI25151J46595_10001493 | 3300003187 | Bacteria | 15731 |
| 14 | JGI25151J46595_10002779 | 3300003187 | Bacteria | 10145 |
| 15 | JGI25151J46595_10037173 | 3300003187 | Bacteria | 1828 |
| 16 | JGI25406J46586_10000127 | 3300003203 | Bacteria | 33062 |
| 17 | JGI25153J46596_10000454 | 3300003215 | Bacteria | 26254 |
| 18 | JGI25153J46596_10000458 | 3300003215 | Bacteria | 26109 |
| 19 | JGI25153J46596_10005476 | 3300003215 | Bacteria | 6648 |
| 20 | JGI25160J50197_1000483 | 3300003354 | Bacteria | 24188 |
| 21 | JGI25160J50197_1000885 | 3300003354 | Bacteria | 15764 |
| 22 | JGI25160J50197_1001425 | 3300003354 | Bacteria | 11968 |
| 23 | JGI25160J50197_1003106 | 3300003354 | Bacteria | 7577 |
| 24 | JGI25161J50226_1000352 | 3300003374 | Bacteria | 24188 |
| 25 | Ga0006562J51391_1036730 | 3300003578 | Bacteria | 3188 |
| 26 | Ga0055536_1000791 | 3300003781 | Bacteria | 21013 |
| 27 | Ga0055536_1003436 | 3300003781 | Bacteria | 8500 |
| 28 | Ga0055534_1004223 | 3300003784 | Bacteria | 4234 |
| 29 | Ga0055530_10000022 | 3300003791 | Bacteria | 136894 |
| 30 | Ga0055530_10000438 | 3300003791 | Bacteria | 36992 |
| 31 | Ga0055540_1000382 | 3300003792 | Bacteria | 36992 |
| 32 | Ga0055540_1000395 | 3300003792 | Bacteria | 35841 |
| 33 | Ga0055531_10000392 | 3300003794 | Bacteria | 42357 |
| 34 | Ga0058692_1005471 | 3300003856 | Bacteria | 3617 |
| 35 | Ga0058692_1007863 | 3300003856 | Bacteria | 2787 |
| 36 | Ga0055543_1003801 | 3300004625 | Bacteria | 4295 |
| 37 | Ga0055543_1006051 | 3300004625 | Bacteria | 2989 |
| 38 | Ga0055543_1011419 | 3300004625 | Bacteria | 1818 |
| 39 | Ga0065165_1000393 | 3300005262 | Bacteria | 71081 |
| 40 | Ga0065165_1000435 | 3300005262 | Bacteria | 65756 |
| 41 | Ga0065165_1002316 | 3300005262 | Bacteria | 16664 |
| 42 | Ga0065165_1005208 | 3300005262 | Bacteria | 7478 |
| 43 | Ga0065165_1021088 | 3300005262 | Bacteria | 2272 |
| 44 | Ga0065714_10002256 | 3300005288 | Bacteria | 34427 |
| 45 | Ga0065714_10004812 | 3300005288 | Bacteria | 5270 |
| 46 | Ga0065704_10070552 | 3300005289 | Bacteria | 20811 |
| 47 | Ga0065712_10067809 | 3300005290 | Bacteria | 30647 |
| 48 | Ga0070676_10000423 | 3300005328 | Bacteria | 20014 |
| 49 | Ga0070690_100011894 | 3300005330 | Bacteria | 5108 |
| 50 | Ga0070670_100000540 | 3300005331 | Bacteria | 30079 |
| 51 | Ga0070670_100009738 | 3300005331 | Bacteria | 8206 |
| 52 | Ga0070670_100019756 | 3300005331 | Bacteria | 5785 |
| 53 | Ga0070670_100124977 | 3300005331 | Bacteria | 2220 |
| 54 | Ga0070677_10001412 | 3300005333 | Bacteria | 7647 |
| 55 | Ga0070677_10020404 | 3300005333 | Bacteria | 2414 |
| 56 | Ga0070666_10010604 | 3300005335 | Bacteria | 5766 |
| 57 | Ga0070680_100046239 | 3300005336 | Bacteria | 3540 |
| 58 | Ga0068868_100002392 | 3300005338 | Bacteria | 12985 |
| 59 | Ga0068868_100008937 | 3300005338 | Bacteria | 7188 |
| 60 | Ga0070660_100001543 | 3300005339 | Bacteria | 15811 |
| 61 | Ga0070691_10102534 | 3300005341 | Bacteria | 1423 |
| 62 | Ga0070668_100130297 | 3300005347 | Bacteria | 2018 |
| 63 | Ga0070669_100046205 | 3300005353 | Bacteria | 3175 |
| 64 | Ga0070675_100000613 | 3300005354 | Bacteria | 24612 |
| 65 | Ga0070675_100006144 | 3300005354 | Bacteria | 9206 |
| 66 | Ga0070675_100019963 | 3300005354 | Bacteria | 5346 |
| 67 | Ga0070671_100020945 | 3300005355 | Bacteria | 5335 |
| 68 | Ga0070671_100035174 | 3300005355 | Bacteria | 4150 |
| 69 | Ga0070671_100058651 | 3300005355 | Bacteria | 3204 |
| 70 | Ga0070671_100071366 | 3300005355 | Bacteria | 2898 |
| 71 | Ga0070674_100004301 | 3300005356 | Bacteria | 8104 |
| 72 | Ga0070674_100004334 | 3300005356 | Bacteria | 8087 |
| 73 | Ga0070674_100215607 | 3300005356 | Bacteria | 1490 |
| 74 | Ga0070673_100004590 | 3300005364 | Bacteria | 8754 |
| 75 | Ga0070673_100010305 | 3300005364 | Bacteria | 6321 |
| 76 | Ga0070673_100060505 | 3300005364 | Bacteria | 3001 |
| 77 | Ga0070688_100011113 | 3300005365 | Bacteria | 4998 |
| 78 | Ga0070659_100004414 | 3300005366 | Bacteria | 10045 |
| 79 | Ga0070667_100010275 | 3300005367 | Bacteria | 7735 |
| 80 | Ga0070710_10006325 | 3300005437 | Bacteria | 5682 |
| 81 | Ga0070663_100153489 | 3300005455 | Bacteria | 1767 |
| 82 | Ga0070663_100164293 | 3300005455 | Bacteria | 1711 |
| 83 | Ga0070678_100004507 | 3300005456 | Bacteria | 7907 |
| 84 | Ga0070678_100055870 | 3300005456 | Bacteria | 2884 |
| 85 | Ga0070662_100000314 | 3300005457 | Bacteria | 28884 |
| 86 | Ga0070662_100019907 | 3300005457 | Bacteria | 4565 |
| 87 | Ga0070662_100100221 | 3300005457 | Bacteria | 2191 |
| 88 | Ga0070681_10001122 | 3300005458 | Bacteria | 22959 |
| 89 | Ga0070681_10051971 | 3300005458 | Bacteria | 4086 |
| 90 | Ga0068867_100011295 | 3300005459 | Bacteria | 6299 |
| 91 | Ga0068867_100164844 | 3300005459 | Bacteria | 1750 |
| 92 | Ga0070685_10030732 | 3300005466 | Bacteria | 2995 |
| 93 | Ga0070706_100000680 | 3300005467 | Bacteria | 38488 |
| 94 | Ga0070706_100069273 | 3300005467 | Bacteria | 3263 |
| 95 | Ga0070707_100072123 | 3300005468 | Bacteria | 3328 |
| 96 | Ga0070698_100177318 | 3300005471 | Bacteria | 2070 |
| 97 | Ga0068853_100001041 | 3300005539 | Bacteria | 19601 |
| 98 | Ga0068853_100042417 | 3300005539 | Bacteria | 3890 |
| 99 | Ga0068853_100046332 | 3300005539 | Bacteria | 3728 |
| 100 | Ga0070672_100004415 | 3300005543 | Bacteria | 9204 |
| 101 | Ga0070672_100034386 | 3300005543 | Bacteria | 3846 |
| 102 | Ga0070672_100120954 | 3300005543 | Bacteria | 2143 |
| 103 | Ga0070672_100137273 | 3300005543 | Bacteria | 2014 |
| 104 | Ga0070672_100232820 | 3300005543 | Bacteria | 1548 |
| 105 | Ga0070686_100074033 | 3300005544 | Bacteria | 2237 |
| 106 | Ga0070665_100056683 | 3300005548 | Bacteria | 3929 |
| 107 | Ga0070665_100060634 | 3300005548 | Bacteria | 3792 |
| 108 | Ga0070665_100115556 | 3300005548 | Bacteria | 2686 |
| 109 | Ga0070704_100113072 | 3300005549 | Bacteria | 2070 |
| 110 | Ga0068855_100006143 | 3300005563 | Bacteria | 14641 |
| 111 | Ga0068855_100032864 | 3300005563 | Bacteria | 6193 |
| 112 | Ga0068855_100073215 | 3300005563 | Bacteria | 3981 |
| 113 | Ga0068855_100129838 | 3300005563 | Bacteria | 2879 |
| 114 | Ga0070664_100023799 | 3300005564 | Bacteria | 5060 |
| 115 | Ga0070664_100058106 | 3300005564 | Bacteria | 3289 |
| 116 | Ga0070664_100128212 | 3300005564 | Bacteria | 2227 |
| 117 | Ga0068857_100285160 | 3300005577 | Bacteria | 1520 |
| 118 | Ga0068856_100044734 | 3300005614 | Bacteria | 4357 |
| 119 | Ga0068852_100098566 | 3300005616 | Bacteria | 2632 |
| 120 | Ga0068852_100290300 | 3300005616 | Bacteria | 1580 |
| 121 | Ga0068859_100001476 | 3300005617 | Bacteria | 23924 |
| 122 | Ga0068859_100209286 | 3300005617 | Bacteria | 2036 |
| 123 | Ga0068864_100000212 | 3300005618 | Bacteria | 52395 |
| 124 | Ga0068864_100014385 | 3300005618 | Bacteria | 6571 |
| 125 | Ga0068861_100084356 | 3300005719 | Bacteria | 2494 |
| 126 | Ga0068870_10002691 | 3300005840 | Bacteria | 7449 |
| 127 | Ga0068863_100001367 | 3300005841 | Bacteria | 24264 |
| 128 | Ga0068863_100010812 | 3300005841 | Bacteria | 8850 |
| 129 | Ga0068863_100055965 | 3300005841 | Bacteria | 3734 |
| 130 | Ga0068863_100075563 | 3300005841 | Bacteria | 3187 |
| 131 | Ga0068858_100002088 | 3300005842 | Bacteria | 20307 |
| 132 | Ga0068858_100150134 | 3300005842 | Bacteria | 2191 |
| 133 | Ga0068860_100270278 | 3300005843 | Bacteria | 1659 |
| 134 | Ga0068860_100270757 | 3300005843 | Bacteria | 1657 |
| 135 | Ga0068862_100146573 | 3300005844 | Bacteria | 2098 |
| 136 | Ga0081455_10028320 | 3300005937 | Bacteria | 5120 |
| 137 | Ga0081455_10046638 | 3300005937 | Bacteria | 3758 |
| 138 | Ga0081540_1005412 | 3300005983 | Bacteria | 9530 |
| 139 | Ga0081540_1006083 | 3300005983 | Bacteria | 8872 |
| 140 | Ga0081540_1016256 | 3300005983 | Bacteria | 4666 |
| 141 | Ga0081540_1016775 | 3300005983 | Bacteria | 4565 |
| 142 | Ga0081539_10000129 | 3300005985 | Bacteria | 178675 |
| 143 | Ga0081539_10005493 | 3300005985 | Bacteria | 12877 |
| 144 | Ga0081539_10017043 | 3300005985 | Bacteria | 5132 |
| 145 | Ga0075365_10003264 | 3300006038 | Bacteria | 8312 |
| 146 | Ga0075365_10020188 | 3300006038 | Bacteria | 4126 |
| 147 | Ga0075365_10037179 | 3300006038 | Bacteria | 3159 |
| 148 | Ga0075365_10048159 | 3300006038 | Bacteria | 2804 |
| 149 | Ga0075365_10105278 | 3300006038 | Bacteria | 1935 |
| 150 | Ga0075365_10135837 | 3300006038 | Bacteria | 1704 |
| 151 | Ga0075368_10002604 | 3300006042 | Bacteria | 5915 |
| 152 | Ga0075368_10032229 | 3300006042 | Bacteria | 2034 |
| 153 | Ga0075363_100026100 | 3300006048 | Bacteria | 2986 |
| 154 | Ga0075363_100044611 | 3300006048 | Bacteria | 2349 |
| 155 | Ga0075363_100072228 | 3300006048 | Bacteria | 1876 |
| 156 | Ga0075364_10007198 | 3300006051 | Bacteria | 6589 |
| 157 | Ga0075364_10039004 | 3300006051 | Bacteria | 3078 |
| 158 | Ga0075364_10069203 | 3300006051 | Bacteria | 2322 |
| 159 | Ga0075364_10083930 | 3300006051 | Bacteria | 2109 |
| 160 | Ga0070716_100056515 | 3300006173 | Bacteria | 2251 |
| 161 | Ga0070712_100025017 | 3300006175 | Bacteria | 3963 |
| 162 | Ga0070712_100040680 | 3300006175 | Bacteria | 3188 |
| 163 | Ga0075362_10007237 | 3300006177 | Bacteria | 4189 |
| 164 | Ga0075362_10026692 | 3300006177 | Bacteria | 2469 |
| 165 | Ga0075367_10001552 | 3300006178 | Bacteria | 9927 |
| 166 | Ga0075367_10006457 | 3300006178 | Bacteria | 5928 |
| 167 | Ga0075367_10010157 | 3300006178 | Bacteria | 4938 |
| 168 | Ga0075367_10020931 | 3300006178 | Bacteria | 3649 |
| 169 | Ga0075367_10054273 | 3300006178 | Bacteria | 2376 |
| 170 | Ga0075367_10118393 | 3300006178 | Bacteria | 1631 |
| 171 | Ga0075369_10006145 | 3300006186 | Bacteria | 4530 |
| 172 | Ga0075369_10007612 | 3300006186 | Bacteria | 4137 |
| 173 | Ga0075369_10022344 | 3300006186 | Bacteria | 2608 |
| 174 | Ga0075369_10040790 | 3300006186 | Bacteria | 1985 |
| 175 | Ga0075366_10001115 | 3300006195 | Bacteria | 13221 |
| 176 | Ga0075366_10006288 | 3300006195 | Bacteria | 6496 |
| 177 | Ga0075366_10008595 | 3300006195 | Bacteria | 5685 |
| 178 | Ga0075366_10056681 | 3300006195 | Bacteria | 2327 |
| 179 | Ga0075366_10071680 | 3300006195 | Bacteria | 2064 |
| 180 | Ga0097621_100040078 | 3300006237 | Bacteria | 3764 |
| 181 | Ga0075370_10002782 | 3300006353 | Bacteria | 8198 |
| 182 | Ga0075370_10023143 | 3300006353 | Bacteria | 3419 |
| 183 | Ga0075370_10045805 | 3300006353 | Bacteria | 2474 |
| 184 | Ga0075428_100001618 | 3300006844 | Bacteria | 24075 |
| 185 | Ga0075428_100056566 | 3300006844 | Bacteria | 4297 |
| 186 | Ga0075428_100381278 | 3300006844 | Bacteria | 1511 |
| 187 | Ga0075430_100024745 | 3300006846 | Bacteria | 5107 |
| 188 | Ga0075430_100150711 | 3300006846 | Bacteria | 1937 |
| 189 | Ga0075431_100007036 | 3300006847 | Bacteria | 11174 |
| 190 | Ga0075434_100148420 | 3300006871 | Bacteria | 2365 |
| 191 | Ga0075429_100006885 | 3300006880 | Bacteria | 9869 |
| 192 | Ga0075429_100022227 | 3300006880 | Bacteria | 5502 |
| 193 | Ga0075429_100149349 | 3300006880 | Bacteria | 2046 |
| 194 | Ga0068865_100055813 | 3300006881 | Bacteria | 2750 |
| 195 | Ga0068865_100061310 | 3300006881 | Bacteria | 2636 |
| 196 | Ga0097620_100001476 | 3300006931 | Bacteria | 23924 |
| 197 | Ga0097620_100209282 | 3300006931 | Bacteria | 2036 |
| 198 | Ga0079104_1009489 | 3300006946 | Bacteria | 3289 |
| 199 | Ga0099826_10000013 | 3300006948 | Bacteria | 265459 |
| 200 | Ga0099826_10069819 | 3300006948 | Bacteria | 2237 |
| 201 | Ga0105244_10013800 | 3300009036 | Bacteria | 4702 |
| 202 | Ga0105240_10002091 | 3300009093 | Bacteria | 32664 |
| 203 | Ga0111539_10000418 | 3300009094 | Bacteria | 53186 |
| 204 | Ga0105245_10015214 | 3300009098 | Bacteria | 6704 |
| 205 | Ga0105245_10208600 | 3300009098 | Bacteria | 1879 |
| 206 | Ga0105247_10014154 | 3300009101 | Bacteria | 4785 |
| 207 | Ga0105247_10015117 | 3300009101 | Bacteria | 4630 |
| 208 | Ga0105247_10053536 | 3300009101 | Bacteria | 2490 |
| 209 | Ga0114129_10000336 | 3300009147 | Bacteria | 55036 |
| 210 | Ga0114129_10466851 | 3300009147 | Bacteria | 1653 |
| 211 | Ga0105243_10005737 | 3300009148 | Bacteria | 9639 |
| 212 | Ga0105243_10006368 | 3300009148 | Bacteria | 9121 |
| 213 | Ga0105243_10191857 | 3300009148 | Bacteria | 1785 |
| 214 | Ga0105241_10017947 | 3300009174 | Bacteria | 5202 |
| 215 | Ga0105241_10021271 | 3300009174 | Bacteria | 4794 |
| 216 | Ga0105241_10258695 | 3300009174 | Bacteria | 1479 |
| 217 | Ga0105248_10015734 | 3300009177 | Bacteria | 8338 |
| 218 | Ga0105248_10030563 | 3300009177 | Bacteria | 6015 |
| 219 | Ga0105248_10075042 | 3300009177 | Bacteria | 3800 |
| 220 | Ga0105237_10001252 | 3300009545 | Bacteria | 33910 |
| 221 | Ga0105237_10064955 | 3300009545 | Bacteria | 3646 |
| 222 | Ga0105238_10006513 | 3300009551 | Bacteria | 11620 |
| 223 | Ga0105238_10088911 | 3300009551 | Bacteria | 3076 |
| 224 | Ga0105238_10216545 | 3300009551 | Bacteria | 1891 |
| 225 | Ga0105249_10025877 | 3300009553 | Bacteria | 5286 |
| 226 | Ga0105249_10064073 | 3300009553 | Bacteria | 3378 |
| 227 | Ga0105249_10112151 | 3300009553 | Bacteria | 2579 |
| 228 | Ga0105239_10012384 | 3300010375 | Bacteria | 9497 |
| 229 | Ga0105239_10017719 | 3300010375 | Bacteria | 7879 |
| 230 | Ga0105239_10031204 | 3300010375 | Bacteria | 5862 |
| 231 | Ga0105239_10079779 | 3300010375 | Bacteria | 3601 |
| 232 | Ga0105239_10229993 | 3300010375 | Bacteria | 2080 |
| 233 | Ga0105246_10011263 | 3300011119 | Bacteria | 5547 |
| 234 | Ga0105246_10029661 | 3300011119 | Bacteria | 3604 |
| 235 | Ga0105246_10043205 | 3300011119 | Bacteria | 3057 |
| 236 | Ga0105246_10066598 | 3300011119 | Bacteria | 2522 |
| 237 | Ga0105246_10072651 | 3300011119 | Bacteria | 2426 |
| 238 | Ga0105246_10095463 | 3300011119 | Bacteria | 2153 |
| 239 | Ga0157373_10005155 | 3300013100 | Bacteria | 9824 |
| 240 | Ga0157373_10006975 | 3300013100 | Bacteria | 8415 |
| 241 | Ga0157373_10028318 | 3300013100 | Bacteria | 4041 |
| 242 | Ga0157371_10000071 | 3300013102 | Bacteria | 164088 |
| 243 | Ga0157371_10005016 | 3300013102 | Bacteria | 11345 |
| 244 | Ga0157370_10000324 | 3300013104 | Bacteria | 59791 |
| 245 | Ga0157370_10001357 | 3300013104 | Bacteria | 30329 |
| 246 | Ga0157370_10081310 | 3300013104 | Bacteria | 3049 |
| 247 | Ga0157370_10100354 | 3300013104 | Bacteria | 2712 |
| 248 | Ga0157374_10022494 | 3300013296 | Bacteria | 5623 |
| 249 | Ga0157374_10116736 | 3300013296 | Bacteria | 2572 |
| 250 | Ga0163162_10078424 | 3300013306 | Bacteria | 3369 |
| 251 | Ga0163162_10212367 | 3300013306 | Bacteria | 2065 |
| 252 | Ga0157372_10000840 | 3300013307 | Bacteria | 33302 |
| 253 | Ga0157375_10034947 | 3300013308 | Bacteria | 4793 |
| 254 | Ga0157375_10376172 | 3300013308 | Bacteria | 1587 |
| 255 | Ga0163163_10004624 | 3300014325 | Bacteria | 11756 |
| 256 | Ga0163163_10008095 | 3300014325 | Bacteria | 9314 |
| 257 | Ga0163163_10243246 | 3300014325 | Bacteria | 1849 |
| 258 | Ga0157380_10003991 | 3300014326 | Bacteria | 10184 |
| 259 | Ga0182008_10000325 | 3300014497 | Bacteria | 37641 |
| 260 | Ga0182008_10001424 | 3300014497 | Bacteria | 16035 |
| 261 | Ga0157379_10025267 | 3300014968 | Bacteria | 5275 |
| 262 | Ga0157379_10215329 | 3300014968 | Bacteria | 1740 |
| 263 | Ga0157376_10039160 | 3300014969 | Bacteria | 3863 |
| 264 | Ga0157376_10041642 | 3300014969 | Bacteria | 3762 |
| 265 | Ga0157376_10199753 | 3300014969 | Bacteria | 1839 |
| 266 | Ga0182006_1002542 | 3300015261 | Bacteria | 9896 |
| 267 | Ga0182006_1038795 | 3300015261 | Bacteria | 1882 |
| 268 | Ga0182007_10000588 | 3300015262 | Bacteria | 21348 |
| 269 | Ga0182007_10008452 | 3300015262 | Bacteria | 4229 |
| 270 | Ga0163161_10109587 | 3300017792 | Bacteria | 2063 |
| 271 | Ga0213876_10008758 | 3300021384 | Bacteria | 5464 |
| 272 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 273 | Ga0209436_100352 | 3300025208 | Bacteria | 20774 |
| 274 | Ga0209436_110094 | 3300025208 | Bacteria | 1748 |
| 275 | Ga0207425_1000243 | 3300025245 | Bacteria | 41823 |
| 276 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 277 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 278 | Ga0209148_1000270 | 3300025254 | Bacteria | 81508 |
| 279 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 280 | Ga0209129_1000030 | 3300025258 | Bacteria | 391958 |
| 281 | Ga0209233_1002691 | 3300025261 | Bacteria | 6415 |
| 282 | Ga0209565_1000019 | 3300025263 | Bacteria | 438920 |
| 283 | Ga0209565_1000678 | 3300025263 | Bacteria | 21266 |
| 284 | Ga0209455_1003700 | 3300025272 | Bacteria | 5293 |
| 285 | Ga0209673_1000095 | 3300025273 | Bacteria | 197466 |
| 286 | Ga0209673_1000121 | 3300025273 | Bacteria | 170539 |
| 287 | Ga0209673_1002789 | 3300025273 | Bacteria | 11363 |
| 288 | Ga0209130_1000011 | 3300025284 | Bacteria | 431723 |
| 289 | Ga0209130_1000061 | 3300025284 | Bacteria | 200990 |
| 290 | Ga0209130_1000395 | 3300025284 | Bacteria | 47652 |
| 291 | Ga0209130_1000450 | 3300025284 | Bacteria | 43201 |
| 292 | Ga0209130_1000903 | 3300025284 | Bacteria | 23947 |
| 293 | Ga0209675_1000073 | 3300025291 | Bacteria | 163009 |
| 294 | Ga0209675_1001531 | 3300025291 | Bacteria | 13204 |
| 295 | Ga0209675_1002999 | 3300025291 | Bacteria | 8308 |
| 296 | Ga0209675_1007816 | 3300025291 | Bacteria | 4029 |
| 297 | Ga0209676_1000193 | 3300025292 | Bacteria | 136946 |
| 298 | Ga0209676_1001123 | 3300025292 | Bacteria | 29456 |
| 299 | Ga0209676_1001188 | 3300025292 | Bacteria | 28027 |
| 300 | Ga0209676_1002784 | 3300025292 | Bacteria | 11629 |
| 301 | Ga0209676_1005394 | 3300025292 | Bacteria | 6702 |
| 302 | Ga0209025_1000029 | 3300025294 | Bacteria | 488571 |
| 303 | Ga0209025_1000145 | 3300025294 | Bacteria | 181436 |
| 304 | Ga0209025_1000146 | 3300025294 | Bacteria | 180022 |
| 305 | Ga0209025_1000494 | 3300025294 | Bacteria | 75744 |
| 306 | Ga0209025_1001416 | 3300025294 | Bacteria | 31774 |
| 307 | Ga0209025_1010461 | 3300025294 | Bacteria | 6282 |
| 308 | Ga0209025_1011968 | 3300025294 | Bacteria | 5632 |
| 309 | Ga0209025_1018594 | 3300025294 | Bacteria | 3923 |
| 310 | Ga0209564_1000056 | 3300025295 | Bacteria | 340873 |
| 311 | Ga0209564_1002665 | 3300025295 | Bacteria | 13561 |
| 312 | Ga0209564_1014814 | 3300025295 | Bacteria | 3214 |
| 313 | Ga0209564_1016881 | 3300025295 | Bacteria | 2879 |
| 314 | Ga0209758_1000021 | 3300025297 | Bacteria | 697691 |
| 315 | Ga0209758_1000037 | 3300025297 | Bacteria | 439101 |
| 316 | Ga0209758_1000458 | 3300025297 | Bacteria | 67627 |
| 317 | Ga0209758_1002993 | 3300025297 | Bacteria | 16182 |
| 318 | Ga0209758_1003945 | 3300025297 | Bacteria | 12887 |
| 319 | Ga0209758_1013030 | 3300025297 | Bacteria | 4581 |
| 320 | Ga0209758_1038791 | 3300025297 | Bacteria | 1822 |
| 321 | Ga0209050_1000193 | 3300025298 | Bacteria | 136946 |
| 322 | Ga0209050_1000704 | 3300025298 | Bacteria | 49577 |
| 323 | Ga0209050_1000960 | 3300025298 | Bacteria | 37189 |
| 324 | Ga0209050_1005033 | 3300025298 | Bacteria | 8570 |
| 325 | Ga0209256_1000043 | 3300025299 | Bacteria | 340873 |
| 326 | Ga0209256_1000171 | 3300025299 | Bacteria | 129711 |
| 327 | Ga0209256_1001387 | 3300025299 | Bacteria | 25302 |
| 328 | Ga0209256_1003447 | 3300025299 | Bacteria | 11078 |
| 329 | Ga0207426_1000029 | 3300025302 | Bacteria | 473835 |
| 330 | Ga0207426_1000068 | 3300025302 | Bacteria | 335134 |
| 331 | Ga0207426_1000217 | 3300025302 | Bacteria | 136180 |
| 332 | Ga0207426_1000428 | 3300025302 | Bacteria | 68777 |
| 333 | Ga0207426_1001536 | 3300025302 | Bacteria | 18776 |
| 334 | Ga0207426_1001558 | 3300025302 | Bacteria | 18597 |
| 335 | Ga0207426_1012078 | 3300025302 | Bacteria | 3260 |
| 336 | Ga0209051_1000147 | 3300025303 | Bacteria | 133931 |
| 337 | Ga0209051_1000186 | 3300025303 | Bacteria | 109900 |
| 338 | Ga0209051_1000692 | 3300025303 | Bacteria | 37189 |
| 339 | Ga0209257_1000547 | 3300025304 | Bacteria | 64609 |
| 340 | Ga0209257_1000663 | 3300025304 | Bacteria | 54142 |
| 341 | Ga0209257_1000883 | 3300025304 | Bacteria | 42345 |
| 342 | Ga0209257_1005919 | 3300025304 | Bacteria | 8230 |
| 343 | Ga0207697_10031808 | 3300025315 | Bacteria | 2159 |
| 344 | Ga0207682_10002668 | 3300025893 | Bacteria | 7948 |
| 345 | Ga0207682_10032032 | 3300025893 | Bacteria | 2112 |
| 346 | Ga0207692_10024369 | 3300025898 | Bacteria | 2812 |
| 347 | Ga0207680_10004622 | 3300025903 | Bacteria | 6538 |
| 348 | Ga0207647_10060902 | 3300025904 | Bacteria | 2305 |
| 349 | Ga0207645_10001419 | 3300025907 | Bacteria | 19626 |
| 350 | Ga0207645_10017773 | 3300025907 | Bacteria | 4688 |
| 351 | Ga0207643_10029867 | 3300025908 | Bacteria | 3032 |
| 352 | Ga0207643_10051425 | 3300025908 | Bacteria | 2339 |
| 353 | Ga0207705_10032712 | 3300025909 | Bacteria | 3717 |
| 354 | Ga0207684_10001213 | 3300025910 | Bacteria | 28693 |
| 355 | Ga0207684_10096591 | 3300025910 | Bacteria | 2522 |
| 356 | Ga0207654_10010619 | 3300025911 | Bacteria | 4689 |
| 357 | Ga0207707_10062969 | 3300025912 | Bacteria | 3228 |
| 358 | Ga0207695_10111593 | 3300025913 | Bacteria | 2713 |
| 359 | Ga0207662_10057439 | 3300025918 | Bacteria | 2326 |
| 360 | Ga0207657_10007528 | 3300025919 | Bacteria | 11158 |
| 361 | Ga0207649_10165386 | 3300025920 | Bacteria | 1536 |
| 362 | Ga0207694_10063111 | 3300025924 | Bacteria | 2885 |
| 363 | Ga0207694_10079167 | 3300025924 | Bacteria | 2577 |
| 364 | Ga0207650_10005540 | 3300025925 | Bacteria | 8616 |
| 365 | Ga0207650_10044581 | 3300025925 | Bacteria | 3260 |
| 366 | Ga0207659_10000631 | 3300025926 | Bacteria | 20882 |
| 367 | Ga0207659_10045529 | 3300025926 | Bacteria | 3094 |
| 368 | Ga0207687_10004016 | 3300025927 | Bacteria | 9859 |
| 369 | Ga0207687_10010612 | 3300025927 | Bacteria | 6022 |
| 370 | Ga0207700_10087806 | 3300025928 | Bacteria | 2446 |
| 371 | Ga0207644_10037494 | 3300025931 | Bacteria | 3410 |
| 372 | Ga0207644_10087926 | 3300025931 | Bacteria | 2310 |
| 373 | Ga0207644_10099700 | 3300025931 | Bacteria | 2180 |
| 374 | Ga0207690_10003207 | 3300025932 | Bacteria | 9815 |
| 375 | Ga0207706_10007928 | 3300025933 | Bacteria | 9800 |
| 376 | Ga0207706_10019241 | 3300025933 | Bacteria | 6140 |
| 377 | Ga0207706_10128895 | 3300025933 | Bacteria | 2225 |
| 378 | Ga0207686_10104944 | 3300025934 | Bacteria | 1894 |
| 379 | Ga0207686_10116915 | 3300025934 | Bacteria | 1808 |
| 380 | Ga0207709_10002938 | 3300025935 | Bacteria | 10410 |
| 381 | Ga0207669_10006937 | 3300025937 | Bacteria | 5210 |
| 382 | Ga0207669_10021254 | 3300025937 | Bacteria | 3422 |
| 383 | Ga0207704_10036609 | 3300025938 | Bacteria | 2825 |
| 384 | Ga0207665_10016041 | 3300025939 | Bacteria | 4920 |
| 385 | Ga0207665_10072941 | 3300025939 | Bacteria | 2346 |
| 386 | Ga0207691_10001646 | 3300025940 | Bacteria | 22158 |
| 387 | Ga0207691_10005530 | 3300025940 | Bacteria | 12204 |
| 388 | Ga0207691_10022504 | 3300025940 | Bacteria | 5943 |
| 389 | Ga0207691_10102166 | 3300025940 | Bacteria | 2558 |
| 390 | Ga0207691_10198172 | 3300025940 | Bacteria | 1749 |
| 391 | Ga0207711_10040039 | 3300025941 | Bacteria | 3986 |
| 392 | Ga0207711_10153710 | 3300025941 | Bacteria | 2078 |
| 393 | Ga0207689_10019538 | 3300025942 | Bacteria | 5709 |
| 394 | Ga0207689_10020740 | 3300025942 | Bacteria | 5526 |
| 395 | Ga0207679_10008067 | 3300025945 | Bacteria | 6696 |
| 396 | Ga0207667_10010163 | 3300025949 | Bacteria | 11024 |
| 397 | Ga0207667_10042307 | 3300025949 | Bacteria | 4843 |
| 398 | Ga0207667_10079186 | 3300025949 | Bacteria | 3406 |
| 399 | Ga0207667_10081551 | 3300025949 | Bacteria | 3351 |
| 400 | Ga0207651_10000756 | 3300025960 | Bacteria | 13879 |
| 401 | Ga0207651_10206507 | 3300025960 | Bacteria | 1578 |
| 402 | Ga0207712_10169429 | 3300025961 | Bacteria | 1705 |
| 403 | Ga0207668_10214479 | 3300025972 | Bacteria | 1541 |
| 404 | Ga0207658_10041751 | 3300025986 | Bacteria | 3323 |
| 405 | Ga0207677_10013806 | 3300026023 | Bacteria | 4692 |
| 406 | Ga0207677_10164866 | 3300026023 | Bacteria | 1726 |
| 407 | Ga0207703_10001030 | 3300026035 | Bacteria | 26749 |
| 408 | Ga0207639_10002239 | 3300026041 | Bacteria | 13005 |
| 409 | Ga0207678_10002499 | 3300026067 | Bacteria | 16723 |
| 410 | Ga0207678_10039178 | 3300026067 | Bacteria | 4113 |
| 411 | Ga0207678_10095097 | 3300026067 | Bacteria | 2546 |
| 412 | Ga0207678_10116849 | 3300026067 | Bacteria | 2276 |
| 413 | Ga0207678_10145619 | 3300026067 | Bacteria | 2022 |
| 414 | Ga0207678_10160490 | 3300026067 | Bacteria | 1920 |
| 415 | Ga0207708_10146461 | 3300026075 | Bacteria | 1856 |
| 416 | Ga0207708_10187781 | 3300026075 | Bacteria | 1643 |
| 417 | Ga0207708_10233452 | 3300026075 | Bacteria | 1477 |
| 418 | Ga0207702_10008112 | 3300026078 | Bacteria | 8886 |
| 419 | Ga0207641_10034707 | 3300026088 | Bacteria | 4197 |
| 420 | Ga0207648_10003035 | 3300026089 | Bacteria | 17739 |
| 421 | Ga0207648_10006536 | 3300026089 | Bacteria | 11571 |
| 422 | Ga0207648_10012621 | 3300026089 | Bacteria | 7903 |
| 423 | Ga0207676_10000229 | 3300026095 | Bacteria | 48726 |
| 424 | Ga0207674_10032206 | 3300026116 | Bacteria | 5501 |
| 425 | Ga0207675_100206385 | 3300026118 | Bacteria | 1888 |
| 426 | Ga0207683_10008851 | 3300026121 | Bacteria | 8588 |
| 427 | Ga0207683_10009189 | 3300026121 | Bacteria | 8423 |
| 428 | Ga0207683_10243082 | 3300026121 | Bacteria | 1642 |
| 429 | Ga0207698_10038526 | 3300026142 | Bacteria | 3533 |
| 430 | Ga0207698_10136737 | 3300026142 | Bacteria | 2104 |
| 431 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 432 | Ga0209371_1001369 | 3300027312 | Bacteria | 16809 |
| 433 | Ga0209282_1000043 | 3300027666 | Bacteria | 119260 |
| 434 | Ga0209282_1055043 | 3300027666 | Bacteria | 2253 |
| 435 | Ga0209974_10001122 | 3300027876 | Bacteria | 9505 |
| 436 | Ga0207428_10002714 | 3300027907 | Bacteria | 17645 |
| 437 | Ga0268266_10005375 | 3300028379 | Bacteria | 11966 |
| 438 | Ga0268266_10024020 | 3300028379 | Bacteria | 5187 |
| 439 | Ga0268266_10142955 | 3300028379 | Bacteria | 2148 |
| 440 | Ga0268266_10152146 | 3300028379 | Bacteria | 2086 |
| 441 | Ga0268266_10159107 | 3300028379 | Bacteria | 2042 |
| 442 | Ga0268266_10269284 | 3300028379 | Bacteria | 1581 |
| 443 | Ga0268265_10112664 | 3300028380 | Bacteria | 2224 |
| 444 | Ga0268265_10281762 | 3300028380 | Bacteria | 1488 |
| 445 | Ga0268264_10210705 | 3300028381 | Bacteria | 1784 |
| 446 | Ga0268264_10245057 | 3300028381 | Bacteria | 1662 |
| 447 | Ga0307517_10000024 | 3300028786 | Bacteria | 185597 |
| 448 | Ga0307515_10061534 | 3300028794 | Bacteria | 5323 |
| 449 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 450 | Ga0268256_1002578 | 3300030500 | Bacteria | 9061 |
| 451 | Ga0307511_10000001 | 3300030521 | Bacteria | 206079 |
| 452 | Ga0316181_1051064 | 3300030744 | Bacteria | 3279 |
| 453 | Ga0265332_10044576 | 3300031238 | Bacteria | 1913 |
| 454 | Ga0265331_10030832 | 3300031250 | Bacteria | 2667 |
| 455 | Ga0307513_10000057 | 3300031456 | Bacteria | 146564 |
| 456 | Ga0307513_10000206 | 3300031456 | Bacteria | 85338 |
| 457 | Ga0307513_10005251 | 3300031456 | Bacteria | 17162 |
| 458 | Ga0307513_10039329 | 3300031456 | Bacteria | 5244 |
| 459 | Ga0307513_10067054 | 3300031456 | Bacteria | 3768 |
| 460 | Ga0307513_10156503 | 3300031456 | Bacteria | 2178 |
| 461 | Ga0307408_100000072 | 3300031548 | Bacteria | 115918 |
| 462 | Ga0307408_100001768 | 3300031548 | Bacteria | 15769 |
| 463 | Ga0307408_100005659 | 3300031548 | Bacteria | 8332 |
| 464 | Ga0307408_100084788 | 3300031548 | Bacteria | 2377 |
| 465 | Ga0307508_10000028 | 3300031616 | Bacteria | 168639 |
| 466 | Ga0265314_10054139 | 3300031711 | Bacteria | 2778 |
| 467 | Ga0265314_10160908 | 3300031711 | Bacteria | 1366 |
| 468 | Ga0307516_10080305 | 3300031730 | Bacteria | 3105 |
| 469 | Ga0307413_10055005 | 3300031824 | Bacteria | 2418 |
| 470 | Ga0307406_10000278 | 3300031901 | Bacteria | 30154 |
| 471 | Ga0307412_10000235 | 3300031911 | Bacteria | 36152 |
| 472 | Ga0307412_10014920 | 3300031911 | Bacteria | 4593 |
| 473 | Ga0307412_10038789 | 3300031911 | Bacteria | 3070 |
| 474 | Ga0307412_10072561 | 3300031911 | Bacteria | 2353 |
| 475 | Ga0307414_10051343 | 3300032004 | Bacteria | 2862 |
| 476 | Ga0307414_10149333 | 3300032004 | Bacteria | 1841 |
| 477 | Ga0307411_10038395 | 3300032005 | Bacteria | 3020 |
| 478 | Ga0307415_100065365 | 3300032126 | Bacteria | 2534 |
| 479 | Ga0307510_10089416 | 3300033180 | Bacteria | 2932 |
| 480 | Ga0373944_0002367 | 3300035089 | Bacteria | 4803 |
| 481 | Ga0373944_0010804 | 3300035089 | Bacteria | 2495 |
| 482 | Ga0373952_0032224 | 3300035092 | Bacteria | 1169 |
| 483 | Ga0373923_0036767 | 3300035111 | Bacteria | 2000 |
| 484 | Ga0373932_0034506 | 3300035112 | Bacteria | 1426 |
| 485 | Ga0373936_0031832 | 3300035113 | Bacteria | 2084 |
| 486 | Ga0373953_0004104 | 3300035117 | Bacteria | 4615 |
| 487 | Ga0373954_0030188 | 3300035118 | Bacteria | 2499 |
| 488 | Ga0373943_0000789 | 3300035170 | Bacteria | 13880 |
| 489 | Ga0373946_0007208 | 3300035171 | Bacteria | 4059 |
| 490 | Ga0373946_0007751 | 3300035171 | Bacteria | 3937 |
| 491 | Ga0373955_0034161 | 3300035172 | Bacteria | 2683 |
| 492 | Ga0373942_0025825 | 3300035207 | Bacteria | 1517 |
| 493 | Ga0373935_0000272 | 3300035692 | Bacteria | 25407 |
| 494 | Ga0373935_0003759 | 3300035692 | Bacteria | 8861 |
| 495 | Ga0373927_0000980 | 3300035695 | Bacteria | 21707 |
| 496 | Ga0373927_0004169 | 3300035695 | Bacteria | 10157 |
| 497 | Ga0373927_0066002 | 3300035695 | Bacteria | 2340 |
| 498 | Ga0373947_0001732 | 3300035725 | Bacteria | 13348 |
| 499 | Ga0373947_0015139 | 3300035725 | Bacteria | 4427 |
| 500 | Ga0373947_0070660 | 3300035725 | Bacteria | 2140 |
| 501 | Ga0373937_0056762 | 3300036401 | Bacteria | 3596 |
| 502 | Ga0373937_0067997 | 3300036401 | Bacteria | 3284 |
| 503 | Ga0373925_0001601 | 3300037068 | Bacteria | 19118 |
| 504 | Ga0373925_0035877 | 3300037068 | Bacteria | 3660 |
| 505 | Ga0373925_0104562 | 3300037068 | Bacteria | 2180 |
| 506 | Ga0395899_0009643 | 3300037312 | Bacteria | 7410 |
| 507 | Ga0395900_0105087 | 3300037418 | Bacteria | 2901 |
| 508 | Ga0395898_0075301 | 3300037466 | Bacteria | 3260 |
| 509 | Ga0395905_0034718 | 3300037471 | Bacteria | 4736 |
| 510 | Ga0395905_0036256 | 3300037471 | Bacteria | 4632 |
| 511 | Ga0395905_0061025 | 3300037471 | Bacteria | 3526 |
| 512 | Ga0395905_0094045 | 3300037471 | Bacteria | 2811 |
| 513 | Ga0436364_0086959 | 3300037853 | Bacteria | 1627 |
| 514 | Ga0395901_0044011 | 3300038443 | Bacteria | 4630 |
| 515 | Ga0395901_0054747 | 3300038443 | Bacteria | 4147 |
| 516 | Ga0395901_0241016 | 3300038443 | Bacteria | 1886 |
| 517 | Ga0439438_000572 | 3300041405 | Bacteria | 16757 |
| 518 | Ga0439438_001328 | 3300041405 | Bacteria | 10954 |
| 519 | Ga0439447_004656 | 3300041407 | Bacteria | 4674 |
| 520 | Ga0439466_0008780 | 3300041411 | Bacteria | 3803 |
| 521 | Ga0439465_0032538 | 3300041413 | Bacteria | 1665 |
| 522 | Ga0439431_0003797 | 3300041997 | Bacteria | 3337 |
| 523 | Ga0439431_0005486 | 3300041997 | Bacteria | 2801 |
| 524 | Ga0439445_0007942 | 3300042004 | Bacteria | 2474 |
| 525 | Ga0439432_001391 | 3300042006 | Bacteria | 9132 |
| 526 | Ga0439432_007368 | 3300042006 | Bacteria | 3899 |
| 527 | Ga0439462_0002207 | 3300042015 | Bacteria | 4492 |
| 528 | Ga0439463_010067 | 3300042016 | Bacteria | 2323 |
| 529 | Ga0450890_010734 | 3300042127 | Bacteria | 1180 |
| 530 | Ga0466965_0006790 | 3300044683 | Bacteria | 5225 |
| 531 | Ga0466968_0004998 | 3300044735 | Bacteria | 4965 |
| 532 | Ga0466960_0005850 | 3300044901 | Bacteria | 4901 |
| 533 | Ga0451576_0044807 | 3300045051 | Bacteria | 4660 |
| 534 | Ga0495627_000054 | 3300046453 | Bacteria | 151899 |
| 535 | Ga0495592_0015807 | 3300046454 | Bacteria | 5726 |
| 536 | Ga0495592_0018339 | 3300046454 | Bacteria | 5321 |
| 537 | Ga0495603_0001822 | 3300046455 | Bacteria | 12583 |
| 538 | Ga0495603_0009552 | 3300046455 | Bacteria | 5861 |
| 539 | Ga0495629_0000499 | 3300046459 | Bacteria | 32883 |
| 540 | Ga0495629_0096420 | 3300046459 | Bacteria | 2063 |
| 541 | Ga0495638_0075628 | 3300046460 | Bacteria | 2052 |
| 542 | Ga0495638_0075776 | 3300046460 | Bacteria | 2049 |
| 543 | Ga0495641_0003876 | 3300046461 | Bacteria | 10902 |
| 544 | Ga0495651_0005001 | 3300046462 | Bacteria | 10126 |
| 545 | Ga0495651_0019040 | 3300046462 | Bacteria | 5319 |
| 546 | Ga0495651_0134730 | 3300046462 | Bacteria | 1799 |
| 547 | Ga0495653_0164598 | 3300046463 | Bacteria | 1536 |
| 548 | Ga0495580_0001242 | 3300046472 | Bacteria | 22494 |
| 549 | Ga0495580_0018432 | 3300046472 | Bacteria | 5196 |
| 550 | Ga0495582_0000969 | 3300046473 | Bacteria | 16048 |
| 551 | Ga0495582_0051943 | 3300046473 | Bacteria | 2261 |
| 552 | Ga0495605_0001215 | 3300046474 | Bacteria | 17172 |
| 553 | Ga0495605_0013343 | 3300046474 | Bacteria | 4531 |
| 554 | Ga0495639_0000003 | 3300046475 | Bacteria | 118479 |
| 555 | Ga0495639_0058950 | 3300046475 | Bacteria | 1757 |
| 556 | Ga0495639_0064242 | 3300046475 | Bacteria | 1686 |
| 557 | Ga0495662_0000185 | 3300046476 | Bacteria | 25164 |
| 558 | Ga0495662_0018852 | 3300046476 | Bacteria | 3339 |
| 559 | Ga0495584_0039085 | 3300046491 | Bacteria | 2398 |
| 560 | Ga0495594_0000865 | 3300046499 | Bacteria | 15562 |
| 561 | Ga0495596_0000058 | 3300046500 | Bacteria | 80763 |
| 562 | Ga0495607_0000021 | 3300046501 | Bacteria | 164571 |
| 563 | Ga0495607_0000509 | 3300046501 | Bacteria | 38503 |
| 564 | Ga0495607_0006603 | 3300046501 | Bacteria | 8142 |
| 565 | Ga0495606_0000177 | 3300046507 | Bacteria | 112843 |
| 566 | Ga0495606_0000234 | 3300046507 | Bacteria | 98166 |
| 567 | Ga0495608_0056094 | 3300046511 | Bacteria | 2603 |
| 568 | Ga0495610_0001463 | 3300046512 | Bacteria | 20832 |
| 569 | Ga0495616_0001432 | 3300046513 | Bacteria | 16598 |
| 570 | Ga0495618_0120523 | 3300046514 | Bacteria | 1680 |
| 571 | Ga0495620_0045919 | 3300046515 | Bacteria | 1889 |
| 572 | Ga0495630_0000566 | 3300046517 | Bacteria | 26945 |
| 573 | Ga0495631_0060576 | 3300046518 | Bacteria | 1642 |
| 574 | Ga0495632_0011702 | 3300046519 | Bacteria | 5107 |
| 575 | Ga0495637_0043181 | 3300046520 | Bacteria | 1926 |
| 576 | Ga0495643_0013677 | 3300046522 | Bacteria | 4849 |
| 577 | Ga0495648_0032067 | 3300046524 | Bacteria | 3453 |
| 578 | Ga0495648_0043977 | 3300046524 | Bacteria | 2792 |
| 579 | Ga0495663_0033271 | 3300046525 | Bacteria | 1539 |
| 580 | Ga0495663_0058780 | 3300046525 | Bacteria | 1205 |
| 581 | Ga0495654_0002515 | 3300046530 | Bacteria | 11781 |
| 582 | Ga0495654_0016304 | 3300046530 | Bacteria | 3931 |
| 583 | Ga0495665_0000138 | 3300046531 | Bacteria | 35409 |
| 584 | Ga0495665_0043657 | 3300046531 | Bacteria | 2384 |
| 585 | Ga0495640_0040832 | 3300046533 | Bacteria | 3246 |
| 586 | Ga0495586_0103683 | 3300046535 | Bacteria | 1580 |
| 587 | Ga0495587_0036029 | 3300046536 | Bacteria | 2978 |
| 588 | Ga0495598_0009887 | 3300046537 | Bacteria | 2268 |
| 589 | Ga0495598_0024321 | 3300046537 | Bacteria | 1641 |
| 590 | Ga0495609_0000566 | 3300046538 | Bacteria | 29042 |
| 591 | Ga0495597_0000329 | 3300046542 | Bacteria | 42746 |
| 592 | Ga0495622_0007663 | 3300046557 | Bacteria | 5015 |
| 593 | Ga0495622_0007851 | 3300046557 | Bacteria | 4953 |
| 594 | Ga0495622_0018272 | 3300046557 | Bacteria | 3266 |
| 595 | Ga0495633_0048406 | 3300046558 | Bacteria | 2007 |
| 596 | Ga0495633_0050295 | 3300046558 | Bacteria | 1965 |
| 597 | Ga0495667_0038472 | 3300046559 | Bacteria | 3185 |
| 598 | Ga0495667_0083373 | 3300046559 | Bacteria | 2076 |
| 599 | Ga0495656_0000047 | 3300046615 | Bacteria | 59690 |
| 600 | Ga0495656_0062975 | 3300046615 | Bacteria | 1624 |
| 601 | Ga0495634_0000360 | 3300046642 | Bacteria | 44196 |
| 602 | Ga0495634_0031617 | 3300046642 | Bacteria | 3644 |
| 603 | Ga0495634_0085115 | 3300046642 | Bacteria | 2061 |
| 604 | Ga0495625_0043121 | 3300046660 | Bacteria | 3274 |
| 605 | Ga0495635_0003164 | 3300046663 | Bacteria | 11340 |
| 606 | Ga0495635_0004706 | 3300046663 | Bacteria | 9482 |
| 607 | Ga0495661_0048361 | 3300046665 | Bacteria | 2584 |
| 608 | Ga0495588_0000431 | 3300046674 | Bacteria | 22035 |
| 609 | Ga0495588_0011695 | 3300046674 | Bacteria | 4125 |
| 610 | Ga0495588_0011898 | 3300046674 | Bacteria | 4097 |
| 611 | Ga0495588_0026021 | 3300046674 | Bacteria | 2919 |
| 612 | Ga0495646_0005530 | 3300046680 | Bacteria | 7992 |
| 613 | Ga0495658_0000136 | 3300046683 | Bacteria | 40715 |
| 614 | Ga0495658_0074047 | 3300046683 | Bacteria | 1984 |
| 615 | Ga0495669_0052395 | 3300046684 | Bacteria | 1833 |
| 616 | Ga0495613_0006681 | 3300046689 | Bacteria | 8617 |
| 617 | Ga0495624_0001994 | 3300046690 | Bacteria | 15576 |
| 618 | Ga0495624_0023634 | 3300046690 | Bacteria | 4051 |
| 619 | Ga0495670_0048730 | 3300046691 | Bacteria | 2119 |
| 620 | Ga0495671_0000966 | 3300046692 | Bacteria | 20124 |
| 621 | Ga0495671_0066028 | 3300046692 | Bacteria | 1781 |
| 622 | Ga0495649_0001060 | 3300046694 | Bacteria | 21502 |
| 623 | Ga0495649_0020791 | 3300046694 | Bacteria | 3678 |
| 624 | Ga0495660_0005739 | 3300046810 | Bacteria | 7414 |
| 625 | Ga0495581_0000614 | 3300047315 | Bacteria | 18660 |
| 626 | Ga0495674_0007275 | 3300047319 | Bacteria | 10588 |
| 627 | Ga0495674_0015008 | 3300047319 | Bacteria | 7249 |
| 628 | Ga0495674_0075980 | 3300047319 | Bacteria | 2890 |
| 629 | Ga0495672_0105675 | 3300047320 | Bacteria | 1519 |
| 630 | Ga0495676_0051185 | 3300047321 | Bacteria | 3307 |
| 631 | Ga0495676_0063557 | 3300047321 | Bacteria | 2876 |
| 632 | Ga0495680_0011212 | 3300047322 | Bacteria | 7959 |
| 633 | Ga0495673_0000210 | 3300047469 | Bacteria | 88390 |
| 634 | Ga0495673_0078116 | 3300047469 | Bacteria | 1377 |
| 635 | Ga0495684_0027601 | 3300047471 | Bacteria | 4358 |
| 636 | Ga0495684_0080508 | 3300047471 | Bacteria | 2473 |
| 637 | Ga0495684_0135889 | 3300047471 | Bacteria | 1845 |
| 638 | Ga0495686_0079814 | 3300047472 | Bacteria | 2001 |
| 639 | Ga0495593_0000819 | 3300047673 | Bacteria | 18024 |
| 640 | Ga0495602_0028809 | 3300048088 | Bacteria | 5305 |
| 641 | Ga0495602_0045740 | 3300048088 | Bacteria | 3959 |
| 642 | Ga0495602_0112414 | 3300048088 | Bacteria | 2210 |
| 643 | Ga0496100_0170719 | 3300048903 | Bacteria | 1566 |
| 644 | Ga0496101_0006529 | 3300048904 | Bacteria | 7512 |
| 645 | Ga0496102_0006975 | 3300048905 | Bacteria | 9639 |
| 646 | Ga0496102_0008353 | 3300048905 | Bacteria | 8866 |
| 647 | Ga0496102_0024053 | 3300048905 | Bacteria | 5414 |
| 648 | Ga0496104_0015976 | 3300048907 | Bacteria | 6813 |
| 649 | Ga0496104_0020930 | 3300048907 | Bacteria | 6000 |
| 650 | Ga0496104_0043800 | 3300048907 | Bacteria | 4203 |
| 651 | Ga0496104_0268571 | 3300048907 | Bacteria | 1618 |
| 652 | Ga0496105_0006073 | 3300048908 | Bacteria | 9241 |
| 653 | Ga0496105_0024500 | 3300048908 | Bacteria | 4903 |
| 654 | Ga0496105_0039450 | 3300048908 | Bacteria | 3892 |
| 655 | Ga0496106_0117893 | 3300048909 | Bacteria | 2072 |
| 656 | Ga0496106_0140580 | 3300048909 | Bacteria | 1899 |
| 657 | Ga0496107_0102142 | 3300048910 | Bacteria | 2102 |
| 658 | Ga0496108_0030525 | 3300048911 | Bacteria | 4467 |
| 659 | Ga0496108_0044563 | 3300048911 | Bacteria | 3702 |
| 660 | Ga0496108_0092410 | 3300048911 | Bacteria | 2573 |
| 661 | Ga0496108_0104267 | 3300048911 | Bacteria | 2420 |
| 662 | Ga0496108_0185934 | 3300048911 | Bacteria | 1800 |
| 663 | Ga0496109_0040860 | 3300048912 | Bacteria | 4201 |
| 664 | Ga0496109_0052831 | 3300048912 | Bacteria | 3705 |
| 665 | Ga0496109_0055922 | 3300048912 | Bacteria | 3600 |
| 666 | Ga0496109_0082047 | 3300048912 | Bacteria | 2971 |
| 667 | Ga0496109_0353873 | 3300048912 | Bacteria | 1387 |
| 668 | Ga0496110_0009704 | 3300048913 | Bacteria | 7796 |
| 669 | Ga0496110_0027915 | 3300048913 | Bacteria | 4842 |
| 670 | Ga0496110_0097595 | 3300048913 | Bacteria | 2633 |
| 671 | Ga0496112_0000545 | 3300048915 | Bacteria | 25805 |
| 672 | Ga0496112_0072787 | 3300048915 | Bacteria | 3397 |
| 673 | Ga0496112_0109196 | 3300048915 | Bacteria | 2737 |
| 674 | Ga0496112_0120166 | 3300048915 | Bacteria | 2597 |
| 675 | Ga0496113_0035720 | 3300048916 | Bacteria | 3636 |
| 676 | Ga0496113_0048240 | 3300048916 | Bacteria | 3168 |
| 677 | Ga0496113_0291071 | 3300048916 | Bacteria | 1307 |
| 678 | Ga0496114_0049847 | 3300048917 | Bacteria | 3484 |
| 679 | Ga0496114_0101901 | 3300048917 | Bacteria | 2452 |
| 680 | Ga0496115_0004982 | 3300048918 | Bacteria | 9640 |
| 681 | Ga0496115_0006020 | 3300048918 | Bacteria | 8856 |
| 682 | Ga0496115_0011568 | 3300048918 | Bacteria | 6616 |
| 683 | Ga0496115_0063427 | 3300048918 | Bacteria | 2981 |
| 684 | Ga0496115_0072802 | 3300048918 | Bacteria | 2788 |
| 685 | Ga0496116_0006171 | 3300048919 | Bacteria | 10957 |
| 686 | Ga0496116_0026738 | 3300048919 | Bacteria | 4209 |
| 687 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 688 | Ga0496117_0023846 | 3300048920 | Bacteria | 4859 |
| 689 | Ga0496117_0062647 | 3300048920 | Bacteria | 2547 |
| 690 | Ga0496118_0001366 | 3300048921 | Bacteria | 36777 |
| 691 | Ga0496118_0015432 | 3300048921 | Bacteria | 7069 |
| 692 | Ga0496118_0030785 | 3300048921 | Bacteria | 4467 |
| 693 | Ga0496118_0064217 | 3300048921 | Bacteria | 2695 |
| 694 | Ga0496118_0067566 | 3300048921 | Bacteria | 2601 |
| 695 | Ga0496119_0001100 | 3300048922 | Bacteria | 34059 |
| 696 | Ga0496120_0000337 | 3300048923 | Bacteria | 78140 |
| 697 | Ga0496120_0046768 | 3300048923 | Bacteria | 2499 |
| 698 | Ga0496121_0000444 | 3300048924 | Bacteria | 81596 |
| 699 | Ga0496121_0013412 | 3300048924 | Bacteria | 8809 |
| 700 | Ga0496121_0032600 | 3300048924 | Bacteria | 4732 |
| 701 | Ga0496121_0046058 | 3300048924 | Bacteria | 3738 |
| 702 | Ga0496121_0057551 | 3300048924 | Bacteria | 3221 |
| 703 | Ga0496121_0112481 | 3300048924 | Bacteria | 2074 |
| 704 | Ga0496121_0175225 | 3300048924 | Bacteria | 1553 |
| 705 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 706 | Ga0496122_0000214 | 3300048925 | Bacteria | 129132 |
| 707 | Ga0496122_0000908 | 3300048925 | Bacteria | 54441 |
| 708 | Ga0496122_0001245 | 3300048925 | Bacteria | 42799 |
| 709 | Ga0496122_0001281 | 3300048925 | Bacteria | 41818 |
| 710 | Ga0496122_0008833 | 3300048925 | Bacteria | 10758 |
| 711 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 712 | Ga0496123_0000289 | 3300048926 | Bacteria | 98253 |
| 713 | Ga0496123_0000412 | 3300048926 | Bacteria | 78170 |
| 714 | Ga0496123_0000524 | 3300048926 | Bacteria | 66159 |
| 715 | Ga0496123_0001497 | 3300048926 | Bacteria | 32439 |
| 716 | Ga0496123_0009986 | 3300048926 | Bacteria | 8458 |
| 717 | Ga0496123_0011434 | 3300048926 | Bacteria | 7691 |
| 718 | Ga0496123_0022278 | 3300048926 | Bacteria | 4889 |
| 719 | Ga0496124_0000174 | 3300048927 | Bacteria | 129228 |
| 720 | Ga0496124_0001510 | 3300048927 | Bacteria | 33896 |
| 721 | Ga0496124_0078611 | 3300048927 | Bacteria | 2718 |
| 722 | Ga0496125_0017989 | 3300048928 | Bacteria | 6718 |
| 723 | Ga0496125_0020013 | 3300048928 | Bacteria | 6291 |
| 724 | Ga0496125_0025329 | 3300048928 | Bacteria | 5435 |
| 725 | Ga0496125_0049442 | 3300048928 | Bacteria | 3494 |
| 726 | Ga0496125_0151148 | 3300048928 | Bacteria | 1594 |
| 727 | Ga0496126_0028624 | 3300048929 | Bacteria | 5306 |
| 728 | Ga0496126_0118755 | 3300048929 | Bacteria | 2295 |
| 729 | nmdc:mga03683_26852_c1 | 3300050489 | Bacteria | 2275 |
| 730 | nmdc:mga03683_5459_c1 | 3300050489 | Bacteria | 4293 |
| 731 | nmdc:mga03n38_45165_c1 | 3300050490 | Bacteria | 1939 |
| 732 | nmdc:mga03n38_55088_c1 | 3300050490 | Bacteria | 1790 |
| 733 | nmdc:mga00v17_183_c1 | 3300050491 | Bacteria | 37432 |
| 734 | nmdc:mga00v17_5231_c1 | 3300050491 | Bacteria | 6832 |
| 735 | nmdc:mga00v17_66735_c1 | 3300050491 | Bacteria | 2222 |
| 736 | nmdc:mga0yw44_123535_c1 | 3300050492 | Bacteria | 1669 |
| 737 | nmdc:mga0yw44_27381_c1 | 3300050492 | Bacteria | 3264 |
| 738 | nmdc:mga0yw44_751_c1 | 3300050492 | Bacteria | 12016 |
| 739 | nmdc:mga0yw44_824_c1 | 3300050492 | Bacteria | 11578 |
| 740 | nmdc:mga0k408_113591_c1 | 3300050493 | Bacteria | 1602 |
| 741 | nmdc:mga0k408_254_c1 | 3300050493 | Bacteria | 29029 |
| 742 | nmdc:mga06z11_30692_c1 | 3300050494 | Bacteria | 2603 |
| 743 | nmdc:mga06z11_73871_c1 | 3300050494 | Bacteria | 1812 |
| 744 | nmdc:mga06z11_97997_c1 | 3300050494 | Bacteria | 1604 |
| 745 | nmdc:mga07m45_2648_c1 | 3300050496 | Bacteria | 8434 |
| 746 | nmdc:mga07m45_6292_c1 | 3300050496 | Bacteria | 5995 |
| 747 | nmdc:mga05p37_22_c2 | 3300050507 | Bacteria | 58856 |
| 748 | nmdc:mga05p37_261893_c1 | 3300050507 | Bacteria | 2069 |
| 749 | nmdc:mga09592_20673_c1 | 3300050508 | Bacteria | 5417 |
| 750 | nmdc:mga09592_32610_c1 | 3300050508 | Bacteria | 4343 |
| 751 | nmdc:mga0qj67_20482_c1 | 3300050509 | Bacteria | 5064 |
| 752 | nmdc:mga06r32_244188_c1 | 3300050510 | Bacteria | 1783 |
| 753 | nmdc:mga06r32_3586_c1 | 3300050510 | Bacteria | 13851 |
| 754 | nmdc:mga08y16_177_c1 | 3300050511 | Bacteria | 56157 |
| 755 | nmdc:mga08y16_73407_c1 | 3300050511 | Bacteria | 3565 |
| 756 | nmdc:mga0sz30_11825_c1 | 3300050516 | Bacteria | 3382 |
| 757 | nmdc:mga0sz30_11989_c1 | 3300050516 | Bacteria | 3364 |
| 758 | nmdc:mga0sz30_52931_c1 | 3300050516 | Bacteria | 1724 |
| 759 | Ga0495601_0005831 | 3300053077 | Bacteria | 7183 |
| 760 | Ga0495601_0012914 | 3300053077 | Bacteria | 5015 |
| 761 | Ga0495619_0009243 | 3300053085 | Bacteria | 6228 |
| 762 | Ga0495619_0010489 | 3300053085 | Bacteria | 5828 |
| 763 | Ga0495619_0050326 | 3300053085 | Bacteria | 2750 |
| 764 | Ga0495619_0094159 | 3300053085 | Bacteria | 2032 |
| 765 | Ga0500643_000085 | 3300053087 | Bacteria | 98026 |
| 766 | Ga0500643_000111 | 3300053087 | Bacteria | 85038 |
| 767 | Ga0500644_0000670 | 3300053088 | Bacteria | 12478 |
| 768 | Ga0500646_0001150 | 3300053090 | Bacteria | 7153 |
| 769 | Ga0500646_0031108 | 3300053090 | Bacteria | 1468 |
| 770 | Ga0500566_0001138 | 3300053094 | Bacteria | 15446 |
| 771 | Ga0500566_0012902 | 3300053094 | Bacteria | 4922 |
| 772 | Ga0500641_0002711 | 3300053096 | Bacteria | 6258 |
| 773 | Ga0500641_0006974 | 3300053096 | Bacteria | 4021 |
| 774 | Ga0500641_0010572 | 3300053096 | Bacteria | 3337 |
| 775 | Ga0500555_002436 | 3300053103 | Bacteria | 5389 |
| 776 | Ga0500555_017007 | 3300053103 | Bacteria | 2096 |
| 777 | Ga0500556_0000004 | 3300053104 | Bacteria | 666287 |
| 778 | Ga0500556_0000022 | 3300053104 | Bacteria | 174894 |
| 779 | Ga0500560_000185 | 3300053107 | Bacteria | 7338 |
| 780 | Ga0500593_000258 | 3300053117 | Bacteria | 21754 |
| 781 | Ga0500594_0021154 | 3300053118 | Bacteria | 1629 |
| 782 | Ga0500594_0024845 | 3300053118 | Bacteria | 1530 |
| 783 | Ga0500595_000521 | 3300053119 | Bacteria | 23203 |
| 784 | Ga0500595_007107 | 3300053119 | Bacteria | 4680 |
| 785 | Ga0500608_001717 | 3300053122 | Bacteria | 7828 |
| 786 | Ga0500618_011643 | 3300053125 | Bacteria | 2327 |
| 787 | Ga0500642_0000036 | 3300053130 | Bacteria | 104249 |
| 788 | Ga0500642_0019327 | 3300053130 | Bacteria | 2655 |
| 789 | Ga0500652_000986 | 3300053131 | Bacteria | 9364 |
| 790 | Ga0500652_001282 | 3300053131 | Bacteria | 7967 |
| 791 | Ga0500652_051048 | 3300053131 | Bacteria | 1689 |
| 792 | Ga0500658_0029998 | 3300053134 | Bacteria | 2119 |
| 793 | Ga0500559_0000835 | 3300053136 | Bacteria | 19960 |
| 794 | Ga0500559_0010835 | 3300053136 | Bacteria | 3908 |
| 795 | Ga0500561_0001498 | 3300053137 | Bacteria | 3791 |
| 796 | Ga0500568_0000881 | 3300053139 | Bacteria | 21071 |
| 797 | Ga0500568_0008498 | 3300053139 | Bacteria | 4940 |
| 798 | Ga0500573_0040919 | 3300053140 | Bacteria | 2676 |
| 799 | Ga0500577_0022870 | 3300053142 | Bacteria | 2080 |
| 800 | Ga0500590_026161 | 3300053148 | Bacteria | 3027 |
| 801 | Ga0500603_000186 | 3300053150 | Bacteria | 16102 |
| 802 | Ga0500616_0000014 | 3300053153 | Bacteria | 637918 |
| 803 | Ga0500616_0011831 | 3300053153 | Bacteria | 5132 |
| 804 | Ga0500622_0001597 | 3300053156 | Bacteria | 17813 |
| 805 | Ga0500624_000900 | 3300053157 | Bacteria | 6326 |
| 806 | Ga0500627_0005113 | 3300053158 | Bacteria | 4312 |
| 807 | Ga0500634_0107248 | 3300053161 | Bacteria | 1386 |
| 808 | Ga0500638_107645 | 3300053162 | Bacteria | 1291 |
| 809 | Ga0500636_0000103 | 3300053177 | Bacteria | 43319 |
| 810 | Ga0500636_0002134 | 3300053177 | Bacteria | 10915 |
| 811 | Ga0500637_0000029 | 3300053178 | Bacteria | 52437 |
| 812 | Ga0500637_0002040 | 3300053178 | Bacteria | 8818 |
| 813 | Ga0500645_000978 | 3300053730 | Bacteria | 16206 |
| 814 | Ga0500661_000060 | 3300055283 | Bacteria | 17314 |
| 815 | Ga0587090_001792 | 3300059510 | Bacteria | 2242 |
| 816 | Ga0587072_001998 | 3300059643 | Bacteria | 2661 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035092 | Ga0373952_0032224 | Ga0373952_0032224_81_1157 | 286 |
| 2 | 3300048928 | Ga0496125_0151148 | Ga0496125_0151148_510_1583 | 292 |
| 3 | 3300050510 | nmdc:mga06r32_244188_c1 | nmdc:mga06r32_244188_c1_17_1111 | 295 |
| 4 | 3300048918 | Ga0496115_0063427 | Ga0496115_0063427_1857_2969 | 298 |
| 5 | 3300048916 | Ga0496113_0291071 | Ga0496113_0291071_134_1291 | 301 |
| 6 | 3300046525 | Ga0495663_0058780 | Ga0495663_0058780_152_1192 | 306 |
| 7 | 3300053131 | Ga0500652_051048 | Ga0500652_051048_554_1666 | 307 |
| 8 | 3300042127 | Ga0450890_010734 | Ga0450890_010734_69_1160 | 321 |
| 9 | 3300053118 | Ga0500594_0024845 | Ga0500594_0024845_400_1512 | 322 |
| 10 | iso_pu_bacteria | 8019547302 | 8019548604 | 322 |
| 11 | 3300053162 | Ga0500638_107645 | Ga0500638_107645_10_1239 | 327 |
| 12 | iso_pu_bacteria | 8019678201 | 8019681357 | 331 |
| 13 | 3300025941 | Ga0207711_10153710 | Ga0207711_101537102 | 337 |
| 14 | 3300005288 | Ga0065714_10004812 | Ga0065714_100048123 | 339 |
| 15 | 3300050516 | nmdc:mga0sz30_52931_c1 | nmdc:mga0sz30_52931_c1_463_1701 | 339 |
| 16 | 3300031456 | Ga0307513_10156503 | Ga0307513_101565032 | 340 |
| 17 | 3300009174 | Ga0105241_10258695 | Ga0105241_102586952 | 341 |
| 18 | 3300047471 | Ga0495684_0080508 | Ga0495684_0080508_1217_2458 | 341 |
| 19 | 3300005336 | Ga0070680_100046239 | Ga0070680_1000462393 | 342 |
| 20 | 3300005458 | Ga0070681_10051971 | Ga0070681_100519713 | 342 |
| 21 | 3300005563 | Ga0068855_100032864 | Ga0068855_1000328643 | 342 |
| 22 | 3300009545 | Ga0105237_10064955 | Ga0105237_100649555 | 342 |
| 23 | 3300013104 | Ga0157370_10081310 | Ga0157370_100813102 | 342 |
| 24 | 3300025909 | Ga0207705_10032712 | Ga0207705_100327123 | 342 |
| 25 | 3300025912 | Ga0207707_10062969 | Ga0207707_100629692 | 342 |
| 26 | 3300025913 | Ga0207695_10111593 | Ga0207695_101115932 | 342 |
| 27 | 3300025949 | Ga0207667_10042307 | Ga0207667_100423073 | 342 |
| 28 | 3300033180 | Ga0307510_10089416 | Ga0307510_100894163 | 342 |
| 29 | 3300048928 | Ga0496125_0017989 | Ga0496125_0017989_1784_3064 | 342 |
| 30 | 3300053150 | Ga0500603_000186 | Ga0500603_000186_8340_9620 | 342 |
| 31 | 3300053178 | Ga0500637_0002040 | Ga0500637_0002040_3411_4691 | 342 |
| 32 | 3300031711 | Ga0265314_10160908 | Ga0265314_101609081 | 343 |
| 33 | 3300048915 | Ga0496112_0000545 | Ga0496112_0000545_2026_3306 | 343 |
| 34 | 3300003354 | JGI25160J50197_1000885 | JGI25160J50197_100088521 | 344 |
| 35 | 3300005262 | Ga0065165_1021088 | Ga0065165_10210881 | 344 |
| 36 | 3300025284 | Ga0209130_1000395 | Ga0209130_100039521 | 344 |
| 37 | 3300025302 | Ga0207426_1001536 | Ga0207426_10015363 | 344 |
| 38 | 3300025960 | Ga0207651_10206507 | Ga0207651_102065071 | 344 |
| 39 | 3300048912 | Ga0496109_0353873 | Ga0496109_0353873_75_1355 | 344 |
| 40 | 3300053094 | Ga0500566_0012902 | Ga0500566_0012902_909_2189 | 344 |
| 41 | 3300053119 | Ga0500595_000521 | Ga0500595_000521_16033_17313 | 344 |
| 42 | 3300053178 | Ga0500637_0000029 | Ga0500637_0000029_43261_44541 | 344 |
| 43 | 3300055283 | Ga0500661_000060 | Ga0500661_000060_7787_9067 | 344 |
| 44 | 3300037471 | Ga0395905_0036256 | Ga0395905_0036256_1494_2774 | 345 |
| 45 | 3300025254 | Ga0209148_1000270 | Ga0209148_100027043 | 346 |
| 46 | 3300025272 | Ga0209455_1003700 | Ga0209455_10037003 | 346 |
| 47 | 3300053140 | Ga0500573_0040919 | Ga0500573_0040919_493_1773 | 346 |
| 48 | 3300048907 | Ga0496104_0268571 | Ga0496104_0268571_28_1266 | 347 |
| 49 | 3300048924 | Ga0496121_0046058 | Ga0496121_0046058_2239_3519 | 347 |
| 50 | 3300005937 | Ga0081455_10028320 | Ga0081455_1002832010 | 349 |
| 51 | 3300005983 | Ga0081540_1005412 | Ga0081540_10054125 | 350 |
| 52 | 3300046557 | Ga0495622_0018272 | Ga0495622_0018272_969_2249 | 350 |
| 53 | 3300053094 | Ga0500566_0001138 | Ga0500566_0001138_5170_6450 | 350 |
| 54 | 3300053122 | Ga0500608_001717 | Ga0500608_001717_6136_7416 | 350 |
| 55 | 3300053125 | Ga0500618_011643 | Ga0500618_011643_191_1471 | 350 |
| 56 | 3300053136 | Ga0500559_0000835 | Ga0500559_0000835_8776_10056 | 350 |
| 57 | 3300053177 | Ga0500636_0002134 | Ga0500636_0002134_3809_5089 | 350 |
| 58 | 3300053136 | Ga0500559_0010835 | Ga0500559_0010835_950_2230 | 351 |
| 59 | 3300053148 | Ga0500590_026161 | Ga0500590_026161_903_2183 | 351 |
| 60 | 3300053177 | Ga0500636_0000103 | Ga0500636_0000103_13861_15141 | 351 |
| 61 | 3300003354 | JGI25160J50197_1003106 | JGI25160J50197_10031064 | 352 |
| 62 | 3300003578 | Ga0006562J51391_1036730 | Ga0006562J51391_10367303 | 352 |
| 63 | 3300003856 | Ga0058692_1005471 | Ga0058692_10054712 | 352 |
| 64 | 3300003856 | Ga0058692_1007863 | Ga0058692_10078633 | 352 |
| 65 | 3300005616 | Ga0068852_100098566 | Ga0068852_1000985663 | 352 |
| 66 | 3300005985 | Ga0081539_10017043 | Ga0081539_100170433 | 352 |
| 67 | 3300006178 | Ga0075367_10020931 | Ga0075367_100209313 | 352 |
| 68 | 3300009093 | Ga0105240_10002091 | Ga0105240_1000209124 | 352 |
| 69 | 3300009545 | Ga0105237_10001252 | Ga0105237_1000125214 | 352 |
| 70 | 3300010375 | Ga0105239_10031204 | Ga0105239_100312045 | 352 |
| 71 | 3300025294 | Ga0209025_1001416 | Ga0209025_100141619 | 352 |
| 72 | 3300025302 | Ga0207426_1012078 | Ga0207426_10120783 | 352 |
| 73 | 3300027312 | Ga0209371_1000037 | Ga0209371_1000037184 | 352 |
| 74 | 3300027312 | Ga0209371_1001369 | Ga0209371_10013695 | 352 |
| 75 | 3300030500 | Ga0268256_1000039 | Ga0268256_1000039124 | 352 |
| 76 | 3300030500 | Ga0268256_1002578 | Ga0268256_10025784 | 352 |
| 77 | 3300030744 | Ga0316181_1051064 | Ga0316181_10510643 | 352 |
| 78 | 3300050494 | nmdc:mga06z11_30692_c1 | nmdc:mga06z11_30692_c1_784_2061 | 352 |
| 79 | 3300053107 | Ga0500560_000185 | Ga0500560_000185_1628_2905 | 352 |
| 80 | 3300004625 | Ga0055543_1003801 | Ga0055543_10038013 | 353 |
| 81 | 3300005262 | Ga0065165_1000435 | Ga0065165_10004358 | 353 |
| 82 | 3300005290 | Ga0065712_10067809 | Ga0065712_1006780912 | 353 |
| 83 | 3300006186 | Ga0075369_10022344 | Ga0075369_100223443 | 353 |
| 84 | 3300025261 | Ga0209233_1002691 | Ga0209233_10026916 | 353 |
| 85 | 3300031548 | Ga0307408_100001768 | Ga0307408_1000017688 | 353 |
| 86 | 3300003215 | JGI25153J46596_10000458 | JGI25153J46596_1000045821 | 354 |
| 87 | 3300005262 | Ga0065165_1005208 | Ga0065165_10052088 | 354 |
| 88 | 3300006048 | Ga0075363_100072228 | Ga0075363_1000722282 | 354 |
| 89 | 3300009174 | Ga0105241_10017947 | Ga0105241_100179475 | 354 |
| 90 | 3300009177 | Ga0105248_10030563 | Ga0105248_100305636 | 354 |
| 91 | 3300010375 | Ga0105239_10012384 | Ga0105239_100123848 | 354 |
| 92 | 3300010375 | Ga0105239_10017719 | Ga0105239_100177196 | 354 |
| 93 | 3300025295 | Ga0209564_1016881 | Ga0209564_10168813 | 354 |
| 94 | 3300025297 | Ga0209758_1000021 | Ga0209758_1000021370 | 354 |
| 95 | 3300025299 | Ga0209256_1003447 | Ga0209256_100344710 | 354 |
| 96 | 3300025304 | Ga0209257_1000883 | Ga0209257_100088316 | 354 |
| 97 | 3300025911 | Ga0207654_10010619 | Ga0207654_100106195 | 354 |
| 98 | 3300025934 | Ga0207686_10104944 | Ga0207686_101049442 | 354 |
| 99 | 3300035112 | Ga0373932_0034506 | Ga0373932_0034506_125_1405 | 354 |
| 100 | 3300035207 | Ga0373942_0025825 | Ga0373942_0025825_170_1450 | 354 |
| 101 | 3300046454 | Ga0495592_0018339 | Ga0495592_0018339_3111_4391 | 354 |
| 102 | 3300046462 | Ga0495651_0005001 | Ga0495651_0005001_3403_4683 | 354 |
| 103 | 3300046536 | Ga0495587_0036029 | Ga0495587_0036029_1642_2922 | 354 |
| 104 | 3300046559 | Ga0495667_0038472 | Ga0495667_0038472_1472_2752 | 354 |
| 105 | 3300047322 | Ga0495680_0011212 | Ga0495680_0011212_3207_4487 | 354 |
| 106 | 3300048088 | Ga0495602_0045740 | Ga0495602_0045740_36_1316 | 354 |
| 107 | 3300048905 | Ga0496102_0008353 | Ga0496102_0008353_2539_3819 | 354 |
| 108 | 3300048908 | Ga0496105_0006073 | Ga0496105_0006073_6327_7607 | 354 |
| 109 | 3300048911 | Ga0496108_0104267 | Ga0496108_0104267_924_2204 | 354 |
| 110 | 3300048912 | Ga0496109_0055922 | Ga0496109_0055922_1635_2915 | 354 |
| 111 | 3300048913 | Ga0496110_0009704 | Ga0496110_0009704_3897_5177 | 354 |
| 112 | 3300048915 | Ga0496112_0072787 | Ga0496112_0072787_1101_2381 | 354 |
| 113 | 3300048916 | Ga0496113_0035720 | Ga0496113_0035720_1431_2711 | 354 |
| 114 | 3300050490 | nmdc:mga03n38_55088_c1 | nmdc:mga03n38_55088_c1_481_1761 | 354 |
| 115 | 3300031548 | Ga0307408_100000072 | Ga0307408_10000007223 | 355 |
| 116 | 3300031901 | Ga0307406_10000278 | Ga0307406_1000027823 | 355 |
| 117 | 3300005548 | Ga0070665_100060634 | Ga0070665_1000606344 | 356 |
| 118 | 3300009551 | Ga0105238_10088911 | Ga0105238_100889112 | 356 |
| 119 | 3300013308 | Ga0157375_10376172 | Ga0157375_103761722 | 356 |
| 120 | 3300014968 | Ga0157379_10215329 | Ga0157379_102153292 | 356 |
| 121 | 3300025908 | Ga0207643_10051425 | Ga0207643_100514253 | 356 |
| 122 | 3300026121 | Ga0207683_10243082 | Ga0207683_102430821 | 356 |
| 123 | 3300028379 | Ga0268266_10152146 | Ga0268266_101521462 | 356 |
| 124 | 3300031238 | Ga0265332_10044576 | Ga0265332_100445762 | 356 |
| 125 | 3300031250 | Ga0265331_10030832 | Ga0265331_100308322 | 356 |
| 126 | 3300041413 | Ga0439465_0032538 | Ga0439465_0032538_468_1652 | 356 |
| 127 | 3300046453 | Ga0495627_000054 | Ga0495627_000054_64389_65669 | 356 |
| 128 | 3300046475 | Ga0495639_0058950 | Ga0495639_0058950_459_1739 | 356 |
| 129 | 3300046507 | Ga0495606_0000234 | Ga0495606_0000234_72248_73528 | 356 |
| 130 | 3300053087 | Ga0500643_000085 | Ga0500643_000085_38967_40247 | 356 |
| 131 | 3300053096 | Ga0500641_0002711 | Ga0500641_0002711_4494_5774 | 356 |
| 132 | 3300053103 | Ga0500555_002436 | Ga0500555_002436_647_1927 | 356 |
| 133 | 3300053118 | Ga0500594_0021154 | Ga0500594_0021154_300_1580 | 356 |
| 134 | 3300053134 | Ga0500658_0029998 | Ga0500658_0029998_68_1348 | 356 |
| 135 | 3300053139 | Ga0500568_0008498 | Ga0500568_0008498_3100_4380 | 356 |
| 136 | 3300005347 | Ga0070668_100130297 | Ga0070668_1001302971 | 357 |
| 137 | 3300005356 | Ga0070674_100215607 | Ga0070674_1002156071 | 357 |
| 138 | 3300006038 | Ga0075365_10105278 | Ga0075365_101052782 | 357 |
| 139 | 3300031456 | Ga0307513_10039329 | Ga0307513_100393295 | 357 |
| 140 | 3300035118 | Ga0373954_0030188 | Ga0373954_0030188_1019_2299 | 357 |
| 141 | 3300046511 | Ga0495608_0056094 | Ga0495608_0056094_547_1827 | 357 |
| 142 | 3300046518 | Ga0495631_0060576 | Ga0495631_0060576_308_1588 | 357 |
| 143 | 3300046525 | Ga0495663_0033271 | Ga0495663_0033271_84_1364 | 357 |
| 144 | 3300046559 | Ga0495667_0083373 | Ga0495667_0083373_315_1595 | 357 |
| 145 | 3300046674 | Ga0495588_0011898 | Ga0495588_0011898_1967_3247 | 357 |
| 146 | 3300047321 | Ga0495676_0051185 | Ga0495676_0051185_472_1752 | 357 |
| 147 | 3300048929 | Ga0496126_0028624 | Ga0496126_0028624_1473_2753 | 357 |
| 148 | 3300003215 | JGI25153J46596_10005476 | JGI25153J46596_100054765 | 358 |
| 149 | 3300003354 | JGI25160J50197_1001425 | JGI25160J50197_10014258 | 358 |
| 150 | 3300005543 | Ga0070672_100034386 | Ga0070672_1000343863 | 358 |
| 151 | 3300005544 | Ga0070686_100074033 | Ga0070686_1000740331 | 358 |
| 152 | 3300006038 | Ga0075365_10003264 | Ga0075365_100032646 | 358 |
| 153 | 3300006051 | Ga0075364_10007198 | Ga0075364_100071982 | 358 |
| 154 | 3300006177 | Ga0075362_10026692 | Ga0075362_100266922 | 358 |
| 155 | 3300006178 | Ga0075367_10006457 | Ga0075367_100064576 | 358 |
| 156 | 3300006186 | Ga0075369_10040790 | Ga0075369_100407902 | 358 |
| 157 | 3300006844 | Ga0075428_100056566 | Ga0075428_1000565663 | 358 |
| 158 | 3300006844 | Ga0075428_100381278 | Ga0075428_1003812781 | 358 |
| 159 | 3300006880 | Ga0075429_100149349 | Ga0075429_1001493491 | 358 |
| 160 | 3300009553 | Ga0105249_10112151 | Ga0105249_101121513 | 358 |
| 161 | 3300013308 | Ga0157375_10034947 | Ga0157375_100349472 | 358 |
| 162 | 3300014969 | Ga0157376_10039160 | Ga0157376_100391604 | 358 |
| 163 | 3300025295 | Ga0209564_1002665 | Ga0209564_10026653 | 358 |
| 164 | 3300025297 | Ga0209758_1000458 | Ga0209758_100045835 | 358 |
| 165 | 3300025302 | Ga0207426_1000217 | Ga0207426_1000217119 | 358 |
| 166 | 3300025940 | Ga0207691_10198172 | Ga0207691_101981721 | 358 |
| 167 | 3300025961 | Ga0207712_10169429 | Ga0207712_101694292 | 358 |
| 168 | 3300026067 | Ga0207678_10039178 | Ga0207678_100391783 | 358 |
| 169 | 3300026075 | Ga0207708_10146461 | Ga0207708_101464612 | 358 |
| 170 | 3300035089 | Ga0373944_0010804 | Ga0373944_0010804_249_1535 | 358 |
| 171 | 3300035111 | Ga0373923_0036767 | Ga0373923_0036767_211_1491 | 358 |
| 172 | 3300035170 | Ga0373943_0000789 | Ga0373943_0000789_10070_11350 | 358 |
| 173 | 3300035171 | Ga0373946_0007208 | Ga0373946_0007208_1416_2696 | 358 |
| 174 | 3300035692 | Ga0373935_0000272 | Ga0373935_0000272_17663_18943 | 358 |
| 175 | 3300035695 | Ga0373927_0000980 | Ga0373927_0000980_2181_3461 | 358 |
| 176 | 3300035695 | Ga0373927_0066002 | Ga0373927_0066002_234_1520 | 358 |
| 177 | 3300035725 | Ga0373947_0001732 | Ga0373947_0001732_9681_10961 | 358 |
| 178 | 3300036401 | Ga0373937_0056762 | Ga0373937_0056762_848_2128 | 358 |
| 179 | 3300037068 | Ga0373925_0001601 | Ga0373925_0001601_11054_12334 | 358 |
| 180 | 3300046454 | Ga0495592_0015807 | Ga0495592_0015807_603_1883 | 358 |
| 181 | 3300046455 | Ga0495603_0001822 | Ga0495603_0001822_4966_6246 | 358 |
| 182 | 3300046459 | Ga0495629_0000499 | Ga0495629_0000499_9667_10947 | 358 |
| 183 | 3300046459 | Ga0495629_0096420 | Ga0495629_0096420_148_1434 | 358 |
| 184 | 3300046460 | Ga0495638_0075628 | Ga0495638_0075628_647_1927 | 358 |
| 185 | 3300046461 | Ga0495641_0003876 | Ga0495641_0003876_2049_3329 | 358 |
| 186 | 3300046472 | Ga0495580_0001242 | Ga0495580_0001242_11516_12796 | 358 |
| 187 | 3300046473 | Ga0495582_0000969 | Ga0495582_0000969_9675_10955 | 358 |
| 188 | 3300046473 | Ga0495582_0051943 | Ga0495582_0051943_433_1719 | 358 |
| 189 | 3300046475 | Ga0495639_0000003 | Ga0495639_0000003_9690_10970 | 358 |
| 190 | 3300046476 | Ga0495662_0000185 | Ga0495662_0000185_6454_7734 | 358 |
| 191 | 3300046499 | Ga0495594_0000865 | Ga0495594_0000865_4619_5899 | 358 |
| 192 | 3300046514 | Ga0495618_0120523 | Ga0495618_0120523_50_1330 | 358 |
| 193 | 3300046517 | Ga0495630_0000566 | Ga0495630_0000566_6332_7612 | 358 |
| 194 | 3300046531 | Ga0495665_0000138 | Ga0495665_0000138_23181_24461 | 358 |
| 195 | 3300046531 | Ga0495665_0043657 | Ga0495665_0043657_389_1675 | 358 |
| 196 | 3300046533 | Ga0495640_0040832 | Ga0495640_0040832_681_1967 | 358 |
| 197 | 3300046535 | Ga0495586_0103683 | Ga0495586_0103683_205_1485 | 358 |
| 198 | 3300046557 | Ga0495622_0007663 | Ga0495622_0007663_261_1541 | 358 |
| 199 | 3300046642 | Ga0495634_0000360 | Ga0495634_0000360_33819_35099 | 358 |
| 200 | 3300046642 | Ga0495634_0031617 | Ga0495634_0031617_660_1946 | 358 |
| 201 | 3300046663 | Ga0495635_0003164 | Ga0495635_0003164_9664_10944 | 358 |
| 202 | 3300046674 | Ga0495588_0011695 | Ga0495588_0011695_2175_3455 | 358 |
| 203 | 3300046674 | Ga0495588_0026021 | Ga0495588_0026021_859_2139 | 358 |
| 204 | 3300046680 | Ga0495646_0005530 | Ga0495646_0005530_6282_7562 | 358 |
| 205 | 3300046683 | Ga0495658_0000136 | Ga0495658_0000136_33668_34948 | 358 |
| 206 | 3300046684 | Ga0495669_0052395 | Ga0495669_0052395_174_1454 | 358 |
| 207 | 3300046689 | Ga0495613_0006681 | Ga0495613_0006681_1206_2486 | 358 |
| 208 | 3300046690 | Ga0495624_0001994 | Ga0495624_0001994_8040_9320 | 358 |
| 209 | 3300046692 | Ga0495671_0066028 | Ga0495671_0066028_328_1608 | 358 |
| 210 | 3300047315 | Ga0495581_0000614 | Ga0495581_0000614_7701_8981 | 358 |
| 211 | 3300047319 | Ga0495674_0007275 | Ga0495674_0007275_8704_9990 | 358 |
| 212 | 3300047319 | Ga0495674_0015008 | Ga0495674_0015008_1425_2705 | 358 |
| 213 | 3300047321 | Ga0495676_0063557 | Ga0495676_0063557_280_1566 | 358 |
| 214 | 3300047469 | Ga0495673_0078116 | Ga0495673_0078116_68_1348 | 358 |
| 215 | 3300047471 | Ga0495684_0027601 | Ga0495684_0027601_2329_3609 | 358 |
| 216 | 3300047673 | Ga0495593_0000819 | Ga0495593_0000819_9413_10693 | 358 |
| 217 | 3300048907 | Ga0496104_0020930 | Ga0496104_0020930_1915_3195 | 358 |
| 218 | 3300048909 | Ga0496106_0140580 | Ga0496106_0140580_265_1545 | 358 |
| 219 | 3300048913 | Ga0496110_0097595 | Ga0496110_0097595_1120_2400 | 358 |
| 220 | 3300048924 | Ga0496121_0175225 | Ga0496121_0175225_102_1382 | 358 |
| 221 | 3300048927 | Ga0496124_0078611 | Ga0496124_0078611_642_1922 | 358 |
| 222 | 3300048928 | Ga0496125_0049442 | Ga0496125_0049442_1896_3176 | 358 |
| 223 | 3300048929 | Ga0496126_0118755 | Ga0496126_0118755_787_2067 | 358 |
| 224 | 3300050489 | nmdc:mga03683_26852_c1 | nmdc:mga03683_26852_c1_475_1755 | 358 |
| 225 | 3300050491 | nmdc:mga00v17_5231_c1 | nmdc:mga00v17_5231_c1_2660_3940 | 358 |
| 226 | 3300050492 | nmdc:mga0yw44_824_c1 | nmdc:mga0yw44_824_c1_7318_8598 | 358 |
| 227 | 3300050511 | nmdc:mga08y16_73407_c1 | nmdc:mga08y16_73407_c1_1196_2476 | 358 |
| 228 | 3300050516 | nmdc:mga0sz30_11989_c1 | nmdc:mga0sz30_11989_c1_1636_2916 | 358 |
| 229 | 3300053077 | Ga0495601_0005831 | Ga0495601_0005831_3934_5220 | 358 |
| 230 | 3300053085 | Ga0495619_0010489 | Ga0495619_0010489_3946_5232 | 358 |
| 231 | 3300053085 | Ga0495619_0050326 | Ga0495619_0050326_174_1454 | 358 |
| 232 | 3300005338 | Ga0068868_100008937 | Ga0068868_1000089377 | 359 |
| 233 | 3300005341 | Ga0070691_10102534 | Ga0070691_101025341 | 359 |
| 234 | 3300005355 | Ga0070671_100058651 | Ga0070671_1000586511 | 359 |
| 235 | 3300005437 | Ga0070710_10006325 | Ga0070710_100063256 | 359 |
| 236 | 3300005458 | Ga0070681_10001122 | Ga0070681_100011226 | 359 |
| 237 | 3300005539 | Ga0068853_100042417 | Ga0068853_1000424173 | 359 |
| 238 | 3300005549 | Ga0070704_100113072 | Ga0070704_1001130722 | 359 |
| 239 | 3300005564 | Ga0070664_100058106 | Ga0070664_1000581063 | 359 |
| 240 | 3300005983 | Ga0081540_1016775 | Ga0081540_10167753 | 359 |
| 241 | 3300005985 | Ga0081539_10005493 | Ga0081539_100054939 | 359 |
| 242 | 3300006175 | Ga0070712_100040680 | Ga0070712_1000406804 | 359 |
| 243 | 3300009098 | Ga0105245_10015214 | Ga0105245_100152145 | 359 |
| 244 | 3300009098 | Ga0105245_10208600 | Ga0105245_102086002 | 359 |
| 245 | 3300009101 | Ga0105247_10014154 | Ga0105247_100141542 | 359 |
| 246 | 3300009174 | Ga0105241_10021271 | Ga0105241_100212715 | 359 |
| 247 | 3300009177 | Ga0105248_10075042 | Ga0105248_100750422 | 359 |
| 248 | 3300010375 | Ga0105239_10079779 | Ga0105239_100797793 | 359 |
| 249 | 3300011119 | Ga0105246_10029661 | Ga0105246_100296614 | 359 |
| 250 | 3300011119 | Ga0105246_10072651 | Ga0105246_100726511 | 359 |
| 251 | 3300013296 | Ga0157374_10116736 | Ga0157374_101167363 | 359 |
| 252 | 3300013306 | Ga0163162_10212367 | Ga0163162_102123672 | 359 |
| 253 | 3300014968 | Ga0157379_10025267 | Ga0157379_100252673 | 359 |
| 254 | 3300014969 | Ga0157376_10041642 | Ga0157376_100416424 | 359 |
| 255 | 3300015262 | Ga0182007_10008452 | Ga0182007_100084522 | 359 |
| 256 | 3300025898 | Ga0207692_10024369 | Ga0207692_100243692 | 359 |
| 257 | 3300025927 | Ga0207687_10004016 | Ga0207687_100040167 | 359 |
| 258 | 3300025928 | Ga0207700_10087806 | Ga0207700_100878062 | 359 |
| 259 | 3300025931 | Ga0207644_10099700 | Ga0207644_100997001 | 359 |
| 260 | 3300025933 | Ga0207706_10128895 | Ga0207706_101288952 | 359 |
| 261 | 3300025939 | Ga0207665_10016041 | Ga0207665_100160415 | 359 |
| 262 | 3300026023 | Ga0207677_10164866 | Ga0207677_101648662 | 359 |
| 263 | 3300026067 | Ga0207678_10002499 | Ga0207678_100024994 | 359 |
| 264 | 3300026067 | Ga0207678_10095097 | Ga0207678_100950972 | 359 |
| 265 | 3300026118 | Ga0207675_100206385 | Ga0207675_1002063852 | 359 |
| 266 | 3300028379 | Ga0268266_10159107 | Ga0268266_101591071 | 359 |
| 267 | 3300035117 | Ga0373953_0004104 | Ga0373953_0004104_3238_4518 | 359 |
| 268 | 3300035725 | Ga0373947_0015139 | Ga0373947_0015139_719_1999 | 359 |
| 269 | 3300037068 | Ga0373925_0104562 | Ga0373925_0104562_806_2086 | 359 |
| 270 | 3300042016 | Ga0439463_010067 | Ga0439463_010067_194_1474 | 359 |
| 271 | 3300046462 | Ga0495651_0019040 | Ga0495651_0019040_3673_4953 | 359 |
| 272 | 3300046463 | Ga0495653_0164598 | Ga0495653_0164598_87_1367 | 359 |
| 273 | 3300046642 | Ga0495634_0085115 | Ga0495634_0085115_140_1420 | 359 |
| 274 | 3300046663 | Ga0495635_0004706 | Ga0495635_0004706_6029_7309 | 359 |
| 275 | 3300046683 | Ga0495658_0074047 | Ga0495658_0074047_676_1956 | 359 |
| 276 | 3300047471 | Ga0495684_0135889 | Ga0495684_0135889_376_1656 | 359 |
| 277 | 3300048088 | Ga0495602_0028809 | Ga0495602_0028809_1948_3228 | 359 |
| 278 | 3300048904 | Ga0496101_0006529 | Ga0496101_0006529_683_1963 | 359 |
| 279 | 3300048905 | Ga0496102_0006975 | Ga0496102_0006975_2210_3490 | 359 |
| 280 | 3300048905 | Ga0496102_0024053 | Ga0496102_0024053_3441_4721 | 359 |
| 281 | 3300048907 | Ga0496104_0043800 | Ga0496104_0043800_1103_2383 | 359 |
| 282 | 3300048908 | Ga0496105_0024500 | Ga0496105_0024500_2833_4113 | 359 |
| 283 | 3300048908 | Ga0496105_0039450 | Ga0496105_0039450_449_1729 | 359 |
| 284 | 3300048910 | Ga0496107_0102142 | Ga0496107_0102142_742_2022 | 359 |
| 285 | 3300048911 | Ga0496108_0030525 | Ga0496108_0030525_1989_3269 | 359 |
| 286 | 3300048912 | Ga0496109_0040860 | Ga0496109_0040860_2485_3765 | 359 |
| 287 | 3300048913 | Ga0496110_0027915 | Ga0496110_0027915_3198_4478 | 359 |
| 288 | 3300048915 | Ga0496112_0120166 | Ga0496112_0120166_841_2121 | 359 |
| 289 | 3300048917 | Ga0496114_0049847 | Ga0496114_0049847_1926_3206 | 359 |
| 290 | 3300048918 | Ga0496115_0004982 | Ga0496115_0004982_695_1975 | 359 |
| 291 | 3300048918 | Ga0496115_0006020 | Ga0496115_0006020_28_1308 | 359 |
| 292 | 3300048918 | Ga0496115_0072802 | Ga0496115_0072802_1070_2350 | 359 |
| 293 | 3300053085 | Ga0495619_0009243 | Ga0495619_0009243_4853_6133 | 359 |
| 294 | 3300053085 | Ga0495619_0094159 | Ga0495619_0094159_338_1618 | 359 |
| 295 | 3300005548 | Ga0070665_100056683 | Ga0070665_1000566833 | 360 |
| 296 | 3300006048 | Ga0075363_100026100 | Ga0075363_1000261003 | 360 |
| 297 | 3300006846 | Ga0075430_100150711 | Ga0075430_1001507112 | 360 |
| 298 | 3300006948 | Ga0099826_10069819 | Ga0099826_100698192 | 360 |
| 299 | 3300009147 | Ga0114129_10466851 | Ga0114129_104668512 | 360 |
| 300 | 3300009148 | Ga0105243_10191857 | Ga0105243_101918572 | 360 |
| 301 | 3300013100 | Ga0157373_10028318 | Ga0157373_100283182 | 360 |
| 302 | 3300013102 | Ga0157371_10000071 | Ga0157371_100000716 | 360 |
| 303 | 3300013104 | Ga0157370_10000324 | Ga0157370_1000032447 | 360 |
| 304 | 3300027666 | Ga0209282_1055043 | Ga0209282_10550432 | 360 |
| 305 | 3300027876 | Ga0209974_10001122 | Ga0209974_100011229 | 360 |
| 306 | 3300028379 | Ga0268266_10005375 | Ga0268266_100053753 | 360 |
| 307 | 3300046474 | Ga0495605_0013343 | Ga0495605_0013343_337_1617 | 360 |
| 308 | 3300046558 | Ga0495633_0048406 | Ga0495633_0048406_210_1487 | 360 |
| 309 | 3300046674 | Ga0495588_0000431 | Ga0495588_0000431_1796_3073 | 360 |
| 310 | 3300046810 | Ga0495660_0005739 | Ga0495660_0005739_1281_2561 | 360 |
| 311 | 3300047320 | Ga0495672_0105675 | Ga0495672_0105675_98_1378 | 360 |
| 312 | 3300048916 | Ga0496113_0048240 | Ga0496113_0048240_711_1988 | 360 |
| 313 | 3300048920 | Ga0496117_0000031 | Ga0496117_0000031_222430_223707 | 360 |
| 314 | 3300048921 | Ga0496118_0015432 | Ga0496118_0015432_2381_3658 | 360 |
| 315 | 3300048923 | Ga0496120_0000337 | Ga0496120_0000337_71631_72908 | 360 |
| 316 | 3300048924 | Ga0496121_0112481 | Ga0496121_0112481_677_1954 | 360 |
| 317 | 3300048925 | Ga0496122_0000023 | Ga0496122_0000023_222418_223695 | 360 |
| 318 | 3300048926 | Ga0496123_0000027 | Ga0496123_0000027_157341_158618 | 360 |
| 319 | 3300048926 | Ga0496123_0011434 | Ga0496123_0011434_1435_2715 | 360 |
| 320 | 3300048927 | Ga0496124_0001510 | Ga0496124_0001510_27607_28884 | 360 |
| 321 | 3300050491 | nmdc:mga00v17_183_c1 | nmdc:mga00v17_183_c1_7409_8686 | 360 |
| 322 | 3300050492 | nmdc:mga0yw44_751_c1 | nmdc:mga0yw44_751_c1_2067_3344 | 360 |
| 323 | 3300050494 | nmdc:mga06z11_73871_c1 | nmdc:mga06z11_73871_c1_358_1635 | 360 |
| 324 | 3300053137 | Ga0500561_0001498 | Ga0500561_0001498_306_1583 | 360 |
| 325 | 3300053157 | Ga0500624_000900 | Ga0500624_000900_2296_3573 | 360 |
| 326 | 3300059510 | Ga0587090_001792 | Ga0587090_001792_803_2080 | 360 |
| 327 | 3300059643 | Ga0587072_001998 | Ga0587072_001998_330_1607 | 360 |
| 328 | 3300003791 | Ga0055530_10000438 | Ga0055530_100004389 | 361 |
| 329 | 3300003792 | Ga0055540_1000382 | Ga0055540_10003829 | 361 |
| 330 | 3300006038 | Ga0075365_10037179 | Ga0075365_100371793 | 361 |
| 331 | 3300009148 | Ga0105243_10005737 | Ga0105243_100057377 | 361 |
| 332 | 3300011119 | Ga0105246_10043205 | Ga0105246_100432051 | 361 |
| 333 | 3300014326 | Ga0157380_10003991 | Ga0157380_100039917 | 361 |
| 334 | 3300015261 | Ga0182006_1038795 | Ga0182006_10387952 | 361 |
| 335 | 3300025292 | Ga0209676_1001123 | Ga0209676_100112318 | 361 |
| 336 | 3300025295 | Ga0209564_1014814 | Ga0209564_10148142 | 361 |
| 337 | 3300025298 | Ga0209050_1000960 | Ga0209050_100096027 | 361 |
| 338 | 3300025303 | Ga0209051_1000692 | Ga0209051_100069227 | 361 |
| 339 | 3300025304 | Ga0209257_1005919 | Ga0209257_10059195 | 361 |
| 340 | 3300031548 | Ga0307408_100084788 | Ga0307408_1000847883 | 361 |
| 341 | 3300037471 | Ga0395905_0061025 | Ga0395905_0061025_1190_2473 | 361 |
| 342 | 3300046615 | Ga0495656_0062975 | Ga0495656_0062975_59_1342 | 361 |
| 343 | 3300048920 | Ga0496117_0062647 | Ga0496117_0062647_421_1701 | 361 |
| 344 | 3300048921 | Ga0496118_0067566 | Ga0496118_0067566_530_1810 | 361 |
| 345 | 3300050516 | nmdc:mga0sz30_11825_c1 | nmdc:mga0sz30_11825_c1_1215_2495 | 361 |
| 346 | 3300005548 | Ga0070665_100115556 | Ga0070665_1001155561 | 362 |
| 347 | 3300031911 | Ga0307412_10072561 | Ga0307412_100725612 | 362 |
| 348 | 3300032126 | Ga0307415_100065365 | Ga0307415_1000653652 | 362 |
| 349 | 3300041405 | Ga0439438_001328 | Ga0439438_001328_6358_7638 | 362 |
| 350 | 3300042006 | Ga0439432_007368 | Ga0439432_007368_1268_2548 | 362 |
| 351 | 3300048927 | Ga0496124_0000174 | Ga0496124_0000174_71008_72285 | 362 |
| 352 | 3300050490 | nmdc:mga03n38_45165_c1 | nmdc:mga03n38_45165_c1_299_1579 | 362 |
| 353 | 3300050492 | nmdc:mga0yw44_123535_c1 | nmdc:mga0yw44_123535_c1_88_1368 | 362 |
| 354 | 3300048922 | Ga0496119_0001100 | Ga0496119_0001100_32055_33335 | 363 |
| 355 | 3300048925 | Ga0496122_0001245 | Ga0496122_0001245_18901_20181 | 363 |
| 356 | 3300048926 | Ga0496123_0000524 | Ga0496123_0000524_725_2005 | 363 |
| 357 | 3300053104 | Ga0500556_0000022 | Ga0500556_0000022_93549_94829 | 363 |
| 358 | 3300005262 | Ga0065165_1002316 | Ga0065165_10023165 | 364 |
| 359 | 3300025302 | Ga0207426_1001558 | Ga0207426_100155817 | 364 |
| 360 | 3300031548 | Ga0307408_100005659 | Ga0307408_1000056596 | 364 |
| 361 | 3300031824 | Ga0307413_10055005 | Ga0307413_100550052 | 364 |
| 362 | 3300031911 | Ga0307412_10014920 | Ga0307412_100149203 | 364 |
| 363 | 3300032004 | Ga0307414_10051343 | Ga0307414_100513432 | 364 |
| 364 | 3300032005 | Ga0307411_10038395 | Ga0307411_100383953 | 364 |
| 365 | 3300053087 | Ga0500643_000111 | Ga0500643_000111_13310_14590 | 364 |
| 366 | 3300053103 | Ga0500555_017007 | Ga0500555_017007_785_2065 | 364 |
| 367 | 3300053130 | Ga0500642_0019327 | Ga0500642_0019327_1170_2450 | 364 |
| 368 | 3300053142 | Ga0500577_0022870 | Ga0500577_0022870_480_1760 | 364 |
| 369 | 3300005339 | Ga0070660_100001543 | Ga0070660_10000154314 | 365 |
| 370 | 3300005353 | Ga0070669_100046205 | Ga0070669_1000462052 | 365 |
| 371 | 3300005354 | Ga0070675_100019963 | Ga0070675_1000199632 | 365 |
| 372 | 3300005366 | Ga0070659_100004414 | Ga0070659_10000441410 | 365 |
| 373 | 3300005455 | Ga0070663_100164293 | Ga0070663_1001642932 | 365 |
| 374 | 3300005457 | Ga0070662_100000314 | Ga0070662_10000031422 | 365 |
| 375 | 3300005539 | Ga0068853_100046332 | Ga0068853_1000463324 | 365 |
| 376 | 3300005543 | Ga0070672_100232820 | Ga0070672_1002328201 | 365 |
| 377 | 3300005563 | Ga0068855_100006143 | Ga0068855_10000614317 | 365 |
| 378 | 3300005564 | Ga0070664_100023799 | Ga0070664_1000237995 | 365 |
| 379 | 3300005614 | Ga0068856_100044734 | Ga0068856_1000447344 | 365 |
| 380 | 3300013100 | Ga0157373_10005155 | Ga0157373_100051552 | 365 |
| 381 | 3300013102 | Ga0157371_10005016 | Ga0157371_1000501612 | 365 |
| 382 | 3300013307 | Ga0157372_10000840 | Ga0157372_1000084043 | 365 |
| 383 | 3300025919 | Ga0207657_10007528 | Ga0207657_100075281 | 365 |
| 384 | 3300025932 | Ga0207690_10003207 | Ga0207690_1000320710 | 365 |
| 385 | 3300025933 | Ga0207706_10007928 | Ga0207706_1000792810 | 365 |
| 386 | 3300025945 | Ga0207679_10008067 | Ga0207679_100080675 | 365 |
| 387 | 3300025949 | Ga0207667_10010163 | Ga0207667_1001016311 | 365 |
| 388 | 3300026067 | Ga0207678_10160490 | Ga0207678_101604902 | 365 |
| 389 | 3300026078 | Ga0207702_10008112 | Ga0207702_100081122 | 365 |
| 390 | 3300021384 | Ga0213876_10008758 | Ga0213876_100087586 | 366 |
| 391 | 3300044683 | Ga0466965_0006790 | Ga0466965_0006790_2919_4199 | 366 |
| 392 | 3300044735 | Ga0466968_0004998 | Ga0466968_0004998_1185_2465 | 366 |
| 393 | 3300044901 | Ga0466960_0005850 | Ga0466960_0005850_893_2173 | 366 |
| 394 | 3300053131 | Ga0500652_000986 | Ga0500652_000986_10_1290 | 366 |
| 395 | 3300006178 | Ga0075367_10118393 | Ga0075367_101183932 | 367 |
| 396 | 3300048919 | Ga0496116_0026738 | Ga0496116_0026738_2621_3901 | 367 |
| 397 | 3300048925 | Ga0496122_0000214 | Ga0496122_0000214_86806_88086 | 367 |
| 398 | 3300048926 | Ga0496123_0000289 | Ga0496123_0000289_10168_11448 | 367 |
| 399 | 3300053161 | Ga0500634_0107248 | Ga0500634_0107248_55_1335 | 367 |
| 400 | 3300031911 | Ga0307412_10038789 | Ga0307412_100387892 | 368 |
| 401 | 3300032004 | Ga0307414_10149333 | Ga0307414_101493331 | 368 |
| 402 | 3300035725 | Ga0373947_0070660 | Ga0373947_0070660_196_1476 | 368 |
| 403 | 3300005843 | Ga0068860_100270278 | Ga0068860_1002702782 | 369 |
| 404 | 3300028381 | Ga0268264_10245057 | Ga0268264_102450571 | 369 |
| 405 | 3300031730 | Ga0307516_10080305 | Ga0307516_100803053 | 369 |
| 406 | 3300046501 | Ga0495607_0000509 | Ga0495607_0000509_11356_12636 | 369 |
| 407 | 3300048917 | Ga0496114_0101901 | Ga0496114_0101901_283_1563 | 369 |
| 408 | 3300041405 | Ga0439438_000572 | Ga0439438_000572_10309_11589 | 370 |
| 409 | 3300041407 | Ga0439447_004656 | Ga0439447_004656_1694_2974 | 370 |
| 410 | 3300041411 | Ga0439466_0008780 | Ga0439466_0008780_696_1976 | 370 |
| 411 | 3300041997 | Ga0439431_0003797 | Ga0439431_0003797_1773_3053 | 370 |
| 412 | 3300041997 | Ga0439431_0005486 | Ga0439431_0005486_1434_2711 | 370 |
| 413 | 3300042004 | Ga0439445_0007942 | Ga0439445_0007942_171_1451 | 370 |
| 414 | 3300042006 | Ga0439432_001391 | Ga0439432_001391_5269_6549 | 370 |
| 415 | 3300003203 | JGI25406J46586_10000127 | JGI25406J46586_1000012711 | 371 |
| 416 | 3300005985 | Ga0081539_10000129 | Ga0081539_1000012925 | 371 |
| 417 | 3300053119 | Ga0500595_007107 | Ga0500595_007107_2524_3804 | 371 |
| 418 | 3300005331 | Ga0070670_100124977 | Ga0070670_1001249771 | 372 |
| 419 | 3300005455 | Ga0070663_100153489 | Ga0070663_1001534891 | 372 |
| 420 | 3300005467 | Ga0070706_100069273 | Ga0070706_1000692733 | 372 |
| 421 | 3300005564 | Ga0070664_100128212 | Ga0070664_1001282123 | 372 |
| 422 | 3300005937 | Ga0081455_10046638 | Ga0081455_100466383 | 372 |
| 423 | 3300006871 | Ga0075434_100148420 | Ga0075434_1001484201 | 372 |
| 424 | 3300009551 | Ga0105238_10216545 | Ga0105238_102165452 | 372 |
| 425 | 3300010375 | Ga0105239_10229993 | Ga0105239_102299932 | 372 |
| 426 | 3300011119 | Ga0105246_10095463 | Ga0105246_100954632 | 372 |
| 427 | 3300014325 | Ga0163163_10243246 | Ga0163163_102432462 | 372 |
| 428 | 3300025297 | Ga0209758_1038791 | Ga0209758_10387912 | 372 |
| 429 | 3300025904 | Ga0207647_10060902 | Ga0207647_100609022 | 372 |
| 430 | 3300025910 | Ga0207684_10096591 | Ga0207684_100965912 | 372 |
| 431 | 3300025920 | Ga0207649_10165386 | Ga0207649_101653862 | 372 |
| 432 | 3300025924 | Ga0207694_10079167 | Ga0207694_100791673 | 372 |
| 433 | 3300025927 | Ga0207687_10010612 | Ga0207687_100106127 | 372 |
| 434 | 3300025934 | Ga0207686_10116915 | Ga0207686_101169152 | 372 |
| 435 | 3300025940 | Ga0207691_10102166 | Ga0207691_101021663 | 372 |
| 436 | 3300025942 | Ga0207689_10020740 | Ga0207689_100207403 | 372 |
| 437 | 3300025949 | Ga0207667_10079186 | Ga0207667_100791863 | 372 |
| 438 | 3300026067 | Ga0207678_10116849 | Ga0207678_101168492 | 372 |
| 439 | 3300026067 | Ga0207678_10145619 | Ga0207678_101456192 | 372 |
| 440 | 3300026116 | Ga0207674_10032206 | Ga0207674_100322066 | 372 |
| 441 | 3300028379 | Ga0268266_10024020 | Ga0268266_100240204 | 372 |
| 442 | 3300028379 | Ga0268266_10142955 | Ga0268266_101429551 | 372 |
| 443 | 3300028794 | Ga0307515_10061534 | Ga0307515_100615344 | 372 |
| 444 | 3300031711 | Ga0265314_10054139 | Ga0265314_100541392 | 372 |
| 445 | 3300046460 | Ga0495638_0075776 | Ga0495638_0075776_756_2036 | 372 |
| 446 | 3300046507 | Ga0495606_0000177 | Ga0495606_0000177_31743_33023 | 372 |
| 447 | 3300046520 | Ga0495637_0043181 | Ga0495637_0043181_620_1900 | 372 |
| 448 | 3300046660 | Ga0495625_0043121 | Ga0495625_0043121_700_1980 | 372 |
| 449 | 3300046694 | Ga0495649_0001060 | Ga0495649_0001060_3574_4854 | 372 |
| 450 | 3300048911 | Ga0496108_0185934 | Ga0496108_0185934_40_1320 | 372 |
| 451 | 3300048919 | Ga0496116_0006171 | Ga0496116_0006171_3761_5041 | 372 |
| 452 | 3300048923 | Ga0496120_0046768 | Ga0496120_0046768_677_1957 | 372 |
| 453 | 3300048924 | Ga0496121_0013412 | Ga0496121_0013412_499_1779 | 372 |
| 454 | 3300048925 | Ga0496122_0008833 | Ga0496122_0008833_9337_10617 | 372 |
| 455 | 3300048926 | Ga0496123_0009986 | Ga0496123_0009986_499_1779 | 372 |
| 456 | 3300048928 | Ga0496125_0020013 | Ga0496125_0020013_1246_2526 | 372 |
| 457 | 3300053088 | Ga0500644_0000670 | Ga0500644_0000670_8038_9318 | 372 |
| 458 | 3300053090 | Ga0500646_0001150 | Ga0500646_0001150_1964_3244 | 372 |
| 459 | 3300053096 | Ga0500641_0006974 | Ga0500641_0006974_904_2184 | 372 |
| 460 | 3300053096 | Ga0500641_0010572 | Ga0500641_0010572_1868_3148 | 372 |
| 461 | 3300053104 | Ga0500556_0000004 | Ga0500556_0000004_357383_358663 | 372 |
| 462 | 3300053131 | Ga0500652_001282 | Ga0500652_001282_3376_4656 | 372 |
| 463 | 3300053139 | Ga0500568_0000881 | Ga0500568_0000881_15106_16386 | 372 |
| 464 | 3300053153 | Ga0500616_0000014 | Ga0500616_0000014_384678_385958 | 372 |
| 465 | 3300053156 | Ga0500622_0001597 | Ga0500622_0001597_3076_4356 | 372 |
| 466 | 3300053158 | Ga0500627_0005113 | Ga0500627_0005113_1597_2877 | 372 |
| 467 | 3300003215 | JGI25153J46596_10000454 | JGI25153J46596_1000045423 | 373 |
| 468 | 3300005328 | Ga0070676_10000423 | Ga0070676_100004233 | 373 |
| 469 | 3300005331 | Ga0070670_100019756 | Ga0070670_1000197563 | 373 |
| 470 | 3300005333 | Ga0070677_10020404 | Ga0070677_100204042 | 373 |
| 471 | 3300005338 | Ga0068868_100002392 | Ga0068868_1000023922 | 373 |
| 472 | 3300005354 | Ga0070675_100006144 | Ga0070675_1000061441 | 373 |
| 473 | 3300005355 | Ga0070671_100020945 | Ga0070671_1000209454 | 373 |
| 474 | 3300005364 | Ga0070673_100004590 | Ga0070673_1000045904 | 373 |
| 475 | 3300005459 | Ga0068867_100011295 | Ga0068867_1000112955 | 373 |
| 476 | 3300005543 | Ga0070672_100004415 | Ga0070672_1000044155 | 373 |
| 477 | 3300005840 | Ga0068870_10002691 | Ga0068870_100026912 | 373 |
| 478 | 3300005844 | Ga0068862_100146573 | Ga0068862_1001465731 | 373 |
| 479 | 3300005983 | Ga0081540_1016256 | Ga0081540_10162565 | 373 |
| 480 | 3300006038 | Ga0075365_10135837 | Ga0075365_101358372 | 373 |
| 481 | 3300006051 | Ga0075364_10083930 | Ga0075364_100839302 | 373 |
| 482 | 3300006177 | Ga0075362_10007237 | Ga0075362_100072374 | 373 |
| 483 | 3300006195 | Ga0075366_10071680 | Ga0075366_100716802 | 373 |
| 484 | 3300006881 | Ga0068865_100055813 | Ga0068865_1000558131 | 373 |
| 485 | 3300025297 | Ga0209758_1013030 | Ga0209758_10130303 | 373 |
| 486 | 3300025893 | Ga0207682_10032032 | Ga0207682_100320322 | 373 |
| 487 | 3300025907 | Ga0207645_10001419 | Ga0207645_1000141910 | 373 |
| 488 | 3300025925 | Ga0207650_10005540 | Ga0207650_100055401 | 373 |
| 489 | 3300025926 | Ga0207659_10045529 | Ga0207659_100455291 | 373 |
| 490 | 3300025931 | Ga0207644_10087926 | Ga0207644_100879263 | 373 |
| 491 | 3300025938 | Ga0207704_10036609 | Ga0207704_100366093 | 373 |
| 492 | 3300025940 | Ga0207691_10005530 | Ga0207691_100055309 | 373 |
| 493 | 3300025942 | Ga0207689_10019538 | Ga0207689_100195385 | 373 |
| 494 | 3300025960 | Ga0207651_10000756 | Ga0207651_100007569 | 373 |
| 495 | 3300025972 | Ga0207668_10214479 | Ga0207668_102144792 | 373 |
| 496 | 3300026023 | Ga0207677_10013806 | Ga0207677_100138066 | 373 |
| 497 | 3300026075 | Ga0207708_10233452 | Ga0207708_102334521 | 373 |
| 498 | 3300026089 | Ga0207648_10006536 | Ga0207648_100065363 | 373 |
| 499 | 3300028786 | Ga0307517_10000024 | Ga0307517_1000002489 | 373 |
| 500 | 3300031456 | Ga0307513_10067054 | Ga0307513_100670543 | 373 |
| 501 | 3300031616 | Ga0307508_10000028 | Ga0307508_1000002828 | 373 |
| 502 | 3300046501 | Ga0495607_0000021 | Ga0495607_0000021_145729_147009 | 373 |
| 503 | 3300046519 | Ga0495632_0011702 | Ga0495632_0011702_702_1979 | 373 |
| 504 | 3300048924 | Ga0496121_0057551 | Ga0496121_0057551_1330_2610 | 373 |
| 505 | 3300050489 | nmdc:mga03683_5459_c1 | nmdc:mga03683_5459_c1_680_1960 | 373 |
| 506 | 3300005331 | Ga0070670_100000540 | Ga0070670_10000054021 | 374 |
| 507 | 3300005983 | Ga0081540_1006083 | Ga0081540_10060837 | 374 |
| 508 | 3300009101 | Ga0105247_10053536 | Ga0105247_100535362 | 374 |
| 509 | 3300048925 | Ga0496122_0001281 | Ga0496122_0001281_22813_24051 | 374 |
| 510 | 3300048926 | Ga0496123_0001497 | Ga0496123_0001497_23533_24771 | 374 |
| 511 | 3300005563 | Ga0068855_100129838 | Ga0068855_1001298383 | 375 |
| 512 | 3300006195 | Ga0075366_10001115 | Ga0075366_100011158 | 375 |
| 513 | 3300025949 | Ga0207667_10081551 | Ga0207667_100815513 | 375 |
| 514 | 3300038443 | Ga0395901_0054747 | Ga0395901_0054747_1102_2382 | 375 |
| 515 | 3300038443 | Ga0395901_0241016 | Ga0395901_0241016_128_1405 | 375 |
| 516 | 3300046558 | Ga0495633_0050295 | Ga0495633_0050295_444_1724 | 375 |
| 517 | 3300048903 | Ga0496100_0170719 | Ga0496100_0170719_37_1278 | 375 |
| 518 | 3300048928 | Ga0496125_0025329 | Ga0496125_0025329_14_1255 | 375 |
| 519 | 3300050493 | nmdc:mga0k408_254_c1 | nmdc:mga0k408_254_c1_26783_28063 | 375 |
| 520 | 3300006175 | Ga0070712_100025017 | Ga0070712_1000250173 | 376 |
| 521 | 3300030521 | Ga0307511_10000001 | Ga0307511_1000000126 | 376 |
| 522 | 3300037312 | Ga0395899_0009643 | Ga0395899_0009643_1139_2419 | 376 |
| 523 | 3300037418 | Ga0395900_0105087 | Ga0395900_0105087_65_1345 | 376 |
| 524 | 3300037466 | Ga0395898_0075301 | Ga0395898_0075301_1633_2913 | 376 |
| 525 | 3300037471 | Ga0395905_0094045 | Ga0395905_0094045_281_1561 | 376 |
| 526 | 3300038443 | Ga0395901_0044011 | Ga0395901_0044011_3070_4350 | 376 |
| 527 | 3300006173 | Ga0070716_100056515 | Ga0070716_1000565153 | 377 |
| 528 | 3300013100 | Ga0157373_10006975 | Ga0157373_100069756 | 377 |
| 529 | 3300025939 | Ga0207665_10072941 | Ga0207665_100729413 | 377 |
| 530 | 3300037471 | Ga0395905_0034718 | Ga0395905_0034718_1063_2343 | 377 |
| 531 | 3300037853 | Ga0436364_0086959 | Ga0436364_0086959_141_1421 | 377 |
| 532 | 3300048921 | Ga0496118_0030785 | Ga0496118_0030785_1536_2816 | 377 |
| 533 | 3300035172 | Ga0373955_0034161 | Ga0373955_0034161_380_1660 | 378 |
| 534 | 3300036401 | Ga0373937_0067997 | Ga0373937_0067997_1652_2932 | 378 |
| 535 | 3300046462 | Ga0495651_0134730 | Ga0495651_0134730_482_1762 | 378 |
| 536 | 3300046524 | Ga0495648_0032067 | Ga0495648_0032067_1517_2797 | 378 |
| 537 | 3300046530 | Ga0495654_0002515 | Ga0495654_0002515_4693_5970 | 378 |
| 538 | 3300046530 | Ga0495654_0016304 | Ga0495654_0016304_1231_2511 | 378 |
| 539 | 3300048088 | Ga0495602_0112414 | Ga0495602_0112414_875_2155 | 378 |
| 540 | 3300053077 | Ga0495601_0012914 | Ga0495601_0012914_3001_4281 | 378 |
| 541 | 3300053090 | Ga0500646_0031108 | Ga0500646_0031108_107_1384 | 378 |
| 542 | 3300053130 | Ga0500642_0000036 | Ga0500642_0000036_32696_33976 | 378 |
| 543 | 3300003187 | JGI25151J46595_10000616 | JGI25151J46595_100006167 | 379 |
| 544 | 3300005356 | Ga0070674_100004301 | Ga0070674_1000043017 | 379 |
| 545 | 3300005543 | Ga0070672_100120954 | Ga0070672_1001209542 | 379 |
| 546 | 3300013306 | Ga0163162_10078424 | Ga0163162_100784244 | 379 |
| 547 | 3300025294 | Ga0209025_1000029 | Ga0209025_1000029428 | 379 |
| 548 | 3300025937 | Ga0207669_10021254 | Ga0207669_100212542 | 379 |
| 549 | 3300025291 | Ga0209675_1007816 | Ga0209675_10078164 | 381 |
| 550 | iso_pu_bacteria | 2643221736 | 2644746889 | 381 |
| 551 | iso_pu_bacteria | 2841760612 | 2841762368 | 381 |
| 552 | iso_pu_bacteria | 2841911363 | 2841915917 | 381 |
| 553 | iso_pu_bacteria | 2841917233 | 2841921703 | 381 |
| 554 | iso_pu_bacteria | 2844104063 | 2844109906 | 381 |
| 555 | iso_pu_bacteria | 2851182111 | 2851186935 | 381 |
| 556 | iso_pu_bacteria | 2851246043 | 2851248381 | 381 |
| 557 | iso_pu_bacteria | 3003665799 | 3003669311 | 381 |
| 558 | iso_pu_bacteria | 8057529695 | 8057535479 | 381 |
| 559 | 3300005466 | Ga0070685_10030732 | Ga0070685_100307322 | 382 |
| 560 | 3300005577 | Ga0068857_100285160 | Ga0068857_1002851601 | 382 |
| 561 | 3300005617 | Ga0068859_100209286 | Ga0068859_1002092862 | 382 |
| 562 | 3300005841 | Ga0068863_100055965 | Ga0068863_1000559654 | 382 |
| 563 | 3300005842 | Ga0068858_100150134 | Ga0068858_1001501343 | 382 |
| 564 | 3300006931 | Ga0097620_100209282 | Ga0097620_1002092822 | 382 |
| 565 | 3300009101 | Ga0105247_10015117 | Ga0105247_100151173 | 382 |
| 566 | 3300011119 | Ga0105246_10066598 | Ga0105246_100665983 | 382 |
| 567 | 3300025907 | Ga0207645_10017773 | Ga0207645_100177733 | 382 |
| 568 | 3300025918 | Ga0207662_10057439 | Ga0207662_100574393 | 382 |
| 569 | 3300005333 | Ga0070677_10001412 | Ga0070677_100014127 | 383 |
| 570 | 3300005355 | Ga0070671_100071366 | Ga0070671_1000713664 | 383 |
| 571 | 3300005356 | Ga0070674_100004334 | Ga0070674_1000043349 | 383 |
| 572 | 3300005364 | Ga0070673_100060505 | Ga0070673_1000605052 | 383 |
| 573 | 3300005456 | Ga0070678_100055870 | Ga0070678_1000558703 | 383 |
| 574 | 3300005457 | Ga0070662_100100221 | Ga0070662_1001002212 | 383 |
| 575 | 3300005719 | Ga0068861_100084356 | Ga0068861_1000843562 | 383 |
| 576 | 3300006038 | Ga0075365_10048159 | Ga0075365_100481592 | 383 |
| 577 | 3300006042 | Ga0075368_10032229 | Ga0075368_100322293 | 383 |
| 578 | 3300006880 | Ga0075429_100006885 | Ga0075429_1000068855 | 383 |
| 579 | 3300014969 | Ga0157376_10199753 | Ga0157376_101997532 | 383 |
| 580 | 3300025893 | Ga0207682_10002668 | Ga0207682_100026687 | 383 |
| 581 | 3300025908 | Ga0207643_10029867 | Ga0207643_100298673 | 383 |
| 582 | 3300025937 | Ga0207669_10006937 | Ga0207669_100069374 | 383 |
| 583 | 3300025940 | Ga0207691_10001646 | Ga0207691_100016467 | 383 |
| 584 | 3300026075 | Ga0207708_10187781 | Ga0207708_101877812 | 383 |
| 585 | 3300026089 | Ga0207648_10003035 | Ga0207648_100030358 | 383 |
| 586 | 3300026121 | Ga0207683_10009189 | Ga0207683_100091897 | 383 |
| 587 | 3300028380 | Ga0268265_10281762 | Ga0268265_102817621 | 383 |
| 588 | 3300046537 | Ga0495598_0024321 | Ga0495598_0024321_288_1568 | 383 |
| 589 | 3300050508 | nmdc:mga09592_32610_c1 | nmdc:mga09592_32610_c1_793_2070 | 383 |
| 590 | iso_pu_bacteria | 2537561587 | 2537873636 | 383 |
| 591 | iso_pu_bacteria | 2554235003 | 2554248905 | 383 |
| 592 | iso_pu_bacteria | 2558860242 | 2559295993 | 383 |
| 593 | iso_pu_bacteria | 2599185210 | 2599603214 | 383 |
| 594 | iso_pu_bacteria | 2600255279 | 2601610881 | 383 |
| 595 | iso_pu_bacteria | 2600255308 | 2601747655 | 383 |
| 596 | iso_pu_bacteria | 2643221582 | 2643921517 | 383 |
| 597 | iso_pu_bacteria | 2643221693 | 2644521571 | 383 |
| 598 | iso_pu_bacteria | 2808606387 | 2808988181 | 383 |
| 599 | iso_pu_bacteria | 2818991439 | 2819561003 | 383 |
| 600 | iso_pu_bacteria | 2838675328 | 2838678629 | 383 |
| 601 | iso_pu_bacteria | 2838714209 | 2838718283 | 383 |
| 602 | iso_pu_bacteria | 2838719591 | 2838722925 | 383 |
| 603 | iso_pu_bacteria | 2838724970 | 2838728349 | 383 |
| 604 | iso_pu_bacteria | 2841846520 | 2841850481 | 383 |
| 605 | iso_pu_bacteria | 2841859092 | 2841863267 | 383 |
| 606 | iso_pu_bacteria | 2842124991 | 2842129009 | 383 |
| 607 | iso_pu_bacteria | 2842130223 | 2842133521 | 383 |
| 608 | iso_pu_bacteria | 2842152218 | 2842155567 | 383 |
| 609 | iso_pu_bacteria | 2842170452 | 2842174475 | 383 |
| 610 | iso_pu_bacteria | 2842175837 | 2842179135 | 383 |
| 611 | iso_pu_bacteria | 2842187318 | 2842190707 | 383 |
| 612 | iso_pu_bacteria | 2842211629 | 2842214969 | 383 |
| 613 | iso_pu_bacteria | 2842224351 | 2842227690 | 383 |
| 614 | iso_pu_bacteria | 2842515876 | 2842519996 | 383 |
| 615 | iso_pu_bacteria | 2842733646 | 2842738022 | 383 |
| 616 | iso_pu_bacteria | 2854911287 | 2854915740 | 383 |
| 617 | iso_pu_bacteria | 2899792073 | 2899795364 | 383 |
| 618 | iso_pu_bacteria | 2899845264 | 2899849343 | 383 |
| 619 | iso_pu_bacteria | 2904541872 | 2904542729 | 383 |
| 620 | iso_pu_bacteria | 2915650412 | 2915654495 | 383 |
| 621 | iso_pu_bacteria | 2919114240 | 2919118459 | 383 |
| 622 | iso_pu_bacteria | 2919462493 | 2919467408 | 383 |
| 623 | iso_pu_bacteria | 2926754445 | 2926754989 | 383 |
| 624 | iso_pu_bacteria | 2926760298 | 2926762152 | 383 |
| 625 | iso_pu_bacteria | 2933006813 | 2933010584 | 383 |
| 626 | iso_pu_bacteria | 2933011516 | 2933015744 | 383 |
| 627 | iso_pu_bacteria | 2933594066 | 2933597518 | 383 |
| 628 | iso_pu_bacteria | 2979089926 | 2979092578 | 383 |
| 629 | iso_pu_bacteria | 2979095461 | 2979100031 | 383 |
| 630 | iso_pu_bacteria | 2979100975 | 2979104550 | 383 |
| 631 | iso_pu_bacteria | 2981284811 | 2981285140 | 383 |
| 632 | iso_pu_bacteria | 2981289755 | 2981290085 | 383 |
| 633 | iso_pu_bacteria | 2981980479 | 2981981281 | 383 |
| 634 | iso_pu_bacteria | 2981985349 | 2981986173 | 383 |
| 635 | iso_pu_bacteria | 2984518228 | 2984522765 | 383 |
| 636 | iso_pu_bacteria | 2984537506 | 2984542072 | 383 |
| 637 | iso_pu_bacteria | 2984601300 | 2984601502 | 383 |
| 638 | iso_pu_bacteria | 2996310559 | 2996312621 | 383 |
| 639 | iso_pu_bacteria | 8003570095 | 8003573730 | 383 |
| 640 | iso_pu_bacteria | 8055909800 | 8055912313 | 383 |
| 641 | 3300003187 | JGI25151J46595_10000162 | JGI25151J46595_100001622 | 384 |
| 642 | 3300003187 | JGI25151J46595_10001493 | JGI25151J46595_100014937 | 384 |
| 643 | 3300025294 | Ga0209025_1000146 | Ga0209025_100014681 | 384 |
| 644 | 3300025297 | Ga0209758_1002993 | Ga0209758_100299310 | 384 |
| 645 | iso_pu_bacteria | 2507262055 | 2507511326 | 384 |
| 646 | iso_pu_bacteria | 2508501009 | 2508545123 | 384 |
| 647 | iso_pu_bacteria | 2508501042 | 2508693877 | 384 |
| 648 | iso_pu_bacteria | 2508501050 | 2508729140 | 384 |
| 649 | iso_pu_bacteria | 2508501050 | 2508730765 | 384 |
| 650 | iso_pu_bacteria | 2508501114 | 2509078047 | 384 |
| 651 | iso_pu_bacteria | 2509276019 | 2509379848 | 384 |
| 652 | iso_pu_bacteria | 2510917026 | 2511174481 | 384 |
| 653 | iso_pu_bacteria | 2511231008 | 2511276904 | 384 |
| 654 | iso_pu_bacteria | 2511231156 | 2511824548 | 384 |
| 655 | iso_pu_bacteria | 2513237139 | 2513877515 | 384 |
| 656 | iso_pu_bacteria | 2513237144 | 2513914792 | 384 |
| 657 | iso_pu_bacteria | 2513237146 | 2513923966 | 384 |
| 658 | iso_pu_bacteria | 2515154112 | 2515625101 | 384 |
| 659 | iso_pu_bacteria | 2516143018 | 2516208125 | 384 |
| 660 | iso_pu_bacteria | 2519899620 | 2520376849 | 384 |
| 661 | iso_pu_bacteria | 2524023207 | 2524452662 | 384 |
| 662 | iso_pu_bacteria | 2547132374 | 2548500439 | 384 |
| 663 | iso_pu_bacteria | 2582581283 | 2585169112 | 384 |
| 664 | iso_pu_bacteria | 2582581865 | 2585390433 | 384 |
| 665 | iso_pu_bacteria | 2585427633 | 2585996314 | 384 |
| 666 | iso_pu_bacteria | 2599185156 | 2599334133 | 384 |
| 667 | iso_pu_bacteria | 2599185170 | 2599416008 | 384 |
| 668 | iso_pu_bacteria | 2599185188 | 2599502329 | 384 |
| 669 | iso_pu_bacteria | 2599185212 | 2599616536 | 384 |
| 670 | iso_pu_bacteria | 2599185214 | 2599627681 | 384 |
| 671 | iso_pu_bacteria | 2599185226 | 2599677250 | 384 |
| 672 | iso_pu_bacteria | 2599185227 | 2599684695 | 384 |
| 673 | iso_pu_bacteria | 2599185229 | 2599696638 | 384 |
| 674 | iso_pu_bacteria | 2599185248 | 2599769123 | 384 |
| 675 | iso_pu_bacteria | 2599185289 | 2599888367 | 384 |
| 676 | iso_pu_bacteria | 2599185291 | 2599895905 | 384 |
| 677 | iso_pu_bacteria | 2599185292 | 2599905848 | 384 |
| 678 | iso_pu_bacteria | 2599185300 | 2599932609 | 384 |
| 679 | iso_pu_bacteria | 2599185302 | 2599941193 | 384 |
| 680 | iso_pu_bacteria | 2599185304 | 2599953287 | 384 |
| 681 | iso_pu_bacteria | 2599185305 | 2599957789 | 384 |
| 682 | iso_pu_bacteria | 2599185306 | 2599968884 | 384 |
| 683 | iso_pu_bacteria | 2599185308 | 2599980404 | 384 |
| 684 | iso_pu_bacteria | 2599185309 | 2599986390 | 384 |
| 685 | iso_pu_bacteria | 2599185310 | 2599992079 | 384 |
| 686 | iso_pu_bacteria | 2599185311 | 2599992396 | 384 |
| 687 | iso_pu_bacteria | 2599185312 | 2599998835 | 384 |
| 688 | iso_pu_bacteria | 2599185313 | 2600004128 | 384 |
| 689 | iso_pu_bacteria | 2599185314 | 2600014215 | 384 |
| 690 | iso_pu_bacteria | 2599185315 | 2600015513 | 384 |
| 691 | iso_pu_bacteria | 2599185316 | 2600026951 | 384 |
| 692 | iso_pu_bacteria | 2599185317 | 2600030852 | 384 |
| 693 | iso_pu_bacteria | 2599185318 | 2600038362 | 384 |
| 694 | iso_pu_bacteria | 2599185319 | 2600044417 | 384 |
| 695 | iso_pu_bacteria | 2599185320 | 2600047514 | 384 |
| 696 | iso_pu_bacteria | 2599185321 | 2600050721 | 384 |
| 697 | iso_pu_bacteria | 2599185322 | 2600062635 | 384 |
| 698 | iso_pu_bacteria | 2599185323 | 2600067983 | 384 |
| 699 | iso_pu_bacteria | 2599185324 | 2600072758 | 384 |
| 700 | iso_pu_bacteria | 2599185325 | 2600077056 | 384 |
| 701 | iso_pu_bacteria | 2600254930 | 2600360656 | 384 |
| 702 | iso_pu_bacteria | 2602042107 | 2603859411 | 384 |
| 703 | iso_pu_bacteria | 2615840624 | 2616294264 | 384 |
| 704 | iso_pu_bacteria | 2617270735 | 2617351880 | 384 |
| 705 | iso_pu_bacteria | 2643221569 | 2643860746 | 384 |
| 706 | iso_pu_bacteria | 2643221570 | 2643864545 | 384 |
| 707 | iso_pu_bacteria | 2643221596 | 2643992843 | 384 |
| 708 | iso_pu_bacteria | 2643221607 | 2644048509 | 384 |
| 709 | iso_pu_bacteria | 2643221609 | 2644058237 | 384 |
| 710 | iso_pu_bacteria | 2643221609 | 2644062716 | 384 |
| 711 | iso_pu_bacteria | 2643221611 | 2644073290 | 384 |
| 712 | iso_pu_bacteria | 2643221611 | 2644076270 | 384 |
| 713 | iso_pu_bacteria | 2643221621 | 2644120908 | 384 |
| 714 | iso_pu_bacteria | 2643221626 | 2644149493 | 384 |
| 715 | iso_pu_bacteria | 2643221628 | 2644162897 | 384 |
| 716 | iso_pu_bacteria | 2643221636 | 2644201870 | 384 |
| 717 | iso_pu_bacteria | 2643221652 | 2644291766 | 384 |
| 718 | iso_pu_bacteria | 2643221658 | 2644325656 | 384 |
| 719 | iso_pu_bacteria | 2643221672 | 2644400955 | 384 |
| 720 | iso_pu_bacteria | 2643221686 | 2644481311 | 384 |
| 721 | iso_pu_bacteria | 2643221717 | 2644647014 | 384 |
| 722 | iso_pu_bacteria | 2667528170 | 2671088597 | 384 |
| 723 | iso_pu_bacteria | 2667528176 | 2671125178 | 384 |
| 724 | iso_pu_bacteria | 2675903515 | 2678263738 | 384 |
| 725 | iso_pu_bacteria | 2690316117 | 2692317764 | 384 |
| 726 | iso_pu_bacteria | 2718217882 | 2719184256 | 384 |
| 727 | iso_pu_bacteria | 2718217997 | 2719669598 | 384 |
| 728 | iso_pu_bacteria | 2718218009 | 2719729829 | 384 |
| 729 | iso_pu_bacteria | 2718218199 | 2720494614 | 384 |
| 730 | iso_pu_bacteria | 2718218232 | 2720610949 | 384 |
| 731 | iso_pu_bacteria | 2718218233 | 2720616830 | 384 |
| 732 | iso_pu_bacteria | 2718218235 | 2720628188 | 384 |
| 733 | iso_pu_bacteria | 2718218269 | 2720771766 | 384 |
| 734 | iso_pu_bacteria | 2718218363 | 2721144079 | 384 |
| 735 | iso_pu_bacteria | 2718218365 | 2721156768 | 384 |
| 736 | iso_pu_bacteria | 2718218366 | 2721161454 | 384 |
| 737 | iso_pu_bacteria | 2721755514 | 2722837407 | 384 |
| 738 | iso_pu_bacteria | 2721755556 | 2723031020 | 384 |
| 739 | iso_pu_bacteria | 2721755684 | 2723563526 | 384 |
| 740 | iso_pu_bacteria | 2721755685 | 2723571520 | 384 |
| 741 | iso_pu_bacteria | 2721755810 | 2724040983 | 384 |
| 742 | iso_pu_bacteria | 2721755819 | 2724087315 | 384 |
| 743 | iso_pu_bacteria | 2721755822 | 2724101026 | 384 |
| 744 | iso_pu_bacteria | 2721755823 | 2724108268 | 384 |
| 745 | iso_pu_bacteria | 2728369352 | 2730105486 | 384 |
| 746 | iso_pu_bacteria | 2728369365 | 2730162396 | 384 |
| 747 | iso_pu_bacteria | 2728369397 | 2730295529 | 384 |
| 748 | iso_pu_bacteria | 2738541277 | 2738721055 | 384 |
| 749 | iso_pu_bacteria | 2738543012 | 2739244604 | 384 |
| 750 | iso_pu_bacteria | 2738543019 | 2739280254 | 384 |
| 751 | iso_pu_bacteria | 2744054620 | 2745010069 | 384 |
| 752 | iso_pu_bacteria | 2751185821 | 2753459682 | 384 |
| 753 | iso_pu_bacteria | 2765235802 | 2765464534 | 384 |
| 754 | iso_pu_bacteria | 2767802442 | 2770199405 | 384 |
| 755 | iso_pu_bacteria | 2773857925 | 2774871342 | 384 |
| 756 | iso_pu_bacteria | 2775506901 | 2776258894 | 384 |
| 757 | iso_pu_bacteria | 2775506901 | 2776259389 | 384 |
| 758 | iso_pu_bacteria | 2775506901 | 2776266356 | 384 |
| 759 | iso_pu_bacteria | 2775506902 | 2776266980 | 384 |
| 760 | iso_pu_bacteria | 2775506904 | 2776283052 | 384 |
| 761 | iso_pu_bacteria | 2791355091 | 2792623385 | 384 |
| 762 | iso_pu_bacteria | 2791355092 | 2792629299 | 384 |
| 763 | iso_pu_bacteria | 2791355256 | 2793295913 | 384 |
| 764 | iso_pu_bacteria | 2791355260 | 2793321852 | 384 |
| 765 | iso_pu_bacteria | 2791355261 | 2793326905 | 384 |
| 766 | iso_pu_bacteria | 2791355262 | 2793336299 | 384 |
| 767 | iso_pu_bacteria | 2791355264 | 2793348551 | 384 |
| 768 | iso_pu_bacteria | 2791355265 | 2793354176 | 384 |
| 769 | iso_pu_bacteria | 2791355520 | 2794594890 | 384 |
| 770 | iso_pu_bacteria | 2802429603 | 2805918835 | 384 |
| 771 | iso_pu_bacteria | 2802429605 | 2805929825 | 384 |
| 772 | iso_pu_bacteria | 2802429606 | 2805933169 | 384 |
| 773 | iso_pu_bacteria | 2816332133 | 2816475192 | 384 |
| 774 | iso_pu_bacteria | 2818991446 | 2819598616 | 384 |
| 775 | iso_pu_bacteria | 2824600985 | 2824606460 | 384 |
| 776 | iso_pu_bacteria | 2824609381 | 2824614578 | 384 |
| 777 | iso_pu_bacteria | 2824653114 | 2824656223 | 384 |
| 778 | iso_pu_bacteria | 2824661429 | 2824662004 | 384 |
| 779 | iso_pu_bacteria | 2824661429 | 2824667669 | 384 |
| 780 | iso_pu_bacteria | 2824696289 | 2824698801 | 384 |
| 781 | iso_pu_bacteria | 2824704595 | 2824708782 | 384 |
| 782 | iso_pu_bacteria | 2824753945 | 2824757161 | 384 |
| 783 | iso_pu_bacteria | 2824763712 | 2824766759 | 384 |
| 784 | iso_pu_bacteria | 2825651385 | 2825651879 | 384 |
| 785 | iso_pu_bacteria | 2826581358 | 2826581552 | 384 |
| 786 | iso_pu_bacteria | 2828305725 | 2828310008 | 384 |
| 787 | iso_pu_bacteria | 2835312727 | 2835312801 | 384 |
| 788 | iso_pu_bacteria | 2838016132 | 2838019662 | 384 |
| 789 | iso_pu_bacteria | 2838022645 | 2838027135 | 384 |
| 790 | iso_pu_bacteria | 2838035591 | 2838036128 | 384 |
| 791 | iso_pu_bacteria | 2838054893 | 2838061253 | 384 |
| 792 | iso_pu_bacteria | 2838061910 | 2838066441 | 384 |
| 793 | iso_pu_bacteria | 2838068647 | 2838072533 | 384 |
| 794 | iso_pu_bacteria | 2838074704 | 2838077770 | 384 |
| 795 | iso_pu_bacteria | 2838661181 | 2838668475 | 384 |
| 796 | iso_pu_bacteria | 2838668709 | 2838669105 | 384 |
| 797 | iso_pu_bacteria | 2838701080 | 2838701234 | 384 |
| 798 | iso_pu_bacteria | 2840764183 | 2840766012 | 384 |
| 799 | iso_pu_bacteria | 2841957949 | 2841963386 | 384 |
| 800 | iso_pu_bacteria | 2842038055 | 2842039045 | 384 |
| 801 | iso_pu_bacteria | 2842045827 | 2842048008 | 384 |
| 802 | iso_pu_bacteria | 2842146304 | 2842146701 | 384 |
| 803 | iso_pu_bacteria | 2842192696 | 2842193910 | 384 |
| 804 | iso_pu_bacteria | 2842198810 | 2842200609 | 384 |
| 805 | iso_pu_bacteria | 2842205361 | 2842208484 | 384 |
| 806 | iso_pu_bacteria | 2842250916 | 2842251069 | 384 |
| 807 | iso_pu_bacteria | 2842278818 | 2842282170 | 384 |
| 808 | iso_pu_bacteria | 2842285085 | 2842289207 | 384 |
| 809 | iso_pu_bacteria | 2842311132 | 2842313255 | 384 |
| 810 | iso_pu_bacteria | 2842317721 | 2842319323 | 384 |
| 811 | iso_pu_bacteria | 2842333319 | 2842338094 | 384 |
| 812 | iso_pu_bacteria | 2842402390 | 2842407413 | 384 |
| 813 | iso_pu_bacteria | 2842409023 | 2842413338 | 384 |
| 814 | iso_pu_bacteria | 2842415677 | 2842419981 | 384 |
| 815 | iso_pu_bacteria | 2842422224 | 2842426019 | 384 |
| 816 | iso_pu_bacteria | 2842428310 | 2842430166 | 384 |
| 817 | iso_pu_bacteria | 2842441272 | 2842442882 | 384 |
| 818 | iso_pu_bacteria | 2842447887 | 2842452440 | 384 |
| 819 | iso_pu_bacteria | 2842462802 | 2842464470 | 384 |
| 820 | iso_pu_bacteria | 2842469257 | 2842471163 | 384 |
| 821 | iso_pu_bacteria | 2842489311 | 2842490657 | 384 |
| 822 | iso_pu_bacteria | 2842495871 | 2842498925 | 384 |
| 823 | iso_pu_bacteria | 2842677519 | 2842680168 | 384 |
| 824 | iso_pu_bacteria | 2842718218 | 2842719394 | 384 |
| 825 | iso_pu_bacteria | 2842733646 | 2842735509 | 384 |
| 826 | iso_pu_bacteria | 2842747753 | 2842751397 | 384 |
| 827 | iso_pu_bacteria | 2842805378 | 2842809792 | 384 |
| 828 | iso_pu_bacteria | 2842815866 | 2842821091 | 384 |
| 829 | iso_pu_bacteria | 2842849001 | 2842854220 | 384 |
| 830 | iso_pu_bacteria | 2842854478 | 2842858503 | 384 |
| 831 | iso_pu_bacteria | 2842922631 | 2842925586 | 384 |
| 832 | iso_pu_bacteria | 2844163670 | 2844170833 | 384 |
| 833 | iso_pu_bacteria | 2844533157 | 2844539143 | 384 |
| 834 | iso_pu_bacteria | 2847417321 | 2847423735 | 384 |
| 835 | iso_pu_bacteria | 2847939898 | 2847940087 | 384 |
| 836 | iso_pu_bacteria | 2848858292 | 2848863494 | 384 |
| 837 | iso_pu_bacteria | 2848992105 | 2848998821 | 384 |
| 838 | iso_pu_bacteria | 2850079185 | 2850085625 | 384 |
| 839 | iso_pu_bacteria | 2854896431 | 2854901124 | 384 |
| 840 | iso_pu_bacteria | 2854916844 | 2854918515 | 384 |
| 841 | iso_pu_bacteria | 2855872281 | 2855873067 | 384 |
| 842 | iso_pu_bacteria | 2857509624 | 2857513966 | 384 |
| 843 | iso_pu_bacteria | 2857524615 | 2857529176 | 384 |
| 844 | iso_pu_bacteria | 2857537821 | 2857540351 | 384 |
| 845 | iso_pu_bacteria | 2874590934 | 2874591065 | 384 |
| 846 | iso_pu_bacteria | 2874628541 | 2874629807 | 384 |
| 847 | iso_pu_bacteria | 2874645413 | 2874645449 | 384 |
| 848 | iso_pu_bacteria | 2876761206 | 2876770272 | 384 |
| 849 | iso_pu_bacteria | 2876771140 | 2876771201 | 384 |
| 850 | iso_pu_bacteria | 2876808645 | 2876817099 | 384 |
| 851 | iso_pu_bacteria | 2876818435 | 2876818513 | 384 |
| 852 | iso_pu_bacteria | 2879074833 | 2879074930 | 384 |
| 853 | iso_pu_bacteria | 2879099564 | 2879105437 | 384 |
| 854 | iso_pu_bacteria | 2879110137 | 2879117517 | 384 |
| 855 | iso_pu_bacteria | 2879127579 | 2879135682 | 384 |
| 856 | iso_pu_bacteria | 2879142872 | 2879150870 | 384 |
| 857 | iso_pu_bacteria | 2881927736 | 2881928447 | 384 |
| 858 | iso_pu_bacteria | 2882456835 | 2882460271 | 384 |
| 859 | iso_pu_bacteria | 2882456835 | 2882462698 | 384 |
| 860 | iso_pu_bacteria | 2885192300 | 2885196781 | 384 |
| 861 | iso_pu_bacteria | 2885383462 | 2885386185 | 384 |
| 862 | iso_pu_bacteria | 2885409591 | 2885411956 | 384 |
| 863 | iso_pu_bacteria | 2888388044 | 2888394139 | 384 |
| 864 | iso_pu_bacteria | 2888419890 | 2888424168 | 384 |
| 865 | iso_pu_bacteria | 2889295896 | 2889297549 | 384 |
| 866 | iso_pu_bacteria | 2889295896 | 2889298325 | 384 |
| 867 | iso_pu_bacteria | 2893066018 | 2893071290 | 384 |
| 868 | iso_pu_bacteria | 2894232714 | 2894237160 | 384 |
| 869 | iso_pu_bacteria | 2896384573 | 2896391884 | 384 |
| 870 | iso_pu_bacteria | 2897803580 | 2897807369 | 384 |
| 871 | iso_pu_bacteria | 2899924645 | 2899926771 | 384 |
| 872 | iso_pu_bacteria | 2904449895 | 2904454736 | 384 |
| 873 | iso_pu_bacteria | 2904456579 | 2904460341 | 384 |
| 874 | iso_pu_bacteria | 2904479285 | 2904482573 | 384 |
| 875 | iso_pu_bacteria | 2904541872 | 2904546485 | 384 |
| 876 | iso_pu_bacteria | 2904541872 | 2904547465 | 384 |
| 877 | iso_pu_bacteria | 2904711408 | 2904720878 | 384 |
| 878 | iso_pu_bacteria | 2906626472 | 2906629832 | 384 |
| 879 | iso_pu_bacteria | 2913036834 | 2913039610 | 384 |
| 880 | iso_pu_bacteria | 2919073203 | 2919076685 | 384 |
| 881 | iso_pu_bacteria | 2919462493 | 2919464136 | 384 |
| 882 | iso_pu_bacteria | 2919481497 | 2919487428 | 384 |
| 883 | iso_pu_bacteria | 2920760137 | 2920764946 | 384 |
| 884 | iso_pu_bacteria | 2920822456 | 2920827957 | 384 |
| 885 | iso_pu_bacteria | 2922368715 | 2922377645 | 384 |
| 886 | iso_pu_bacteria | 2923586266 | 2923586274 | 384 |
| 887 | iso_pu_bacteria | 2928037797 | 2928043779 | 384 |
| 888 | iso_pu_bacteria | 2928044640 | 2928050636 | 384 |
| 889 | iso_pu_bacteria | 2928051484 | 2928056988 | 384 |
| 890 | iso_pu_bacteria | 2928064002 | 2928070676 | 384 |
| 891 | iso_pu_bacteria | 2928070936 | 2928078234 | 384 |
| 892 | iso_pu_bacteria | 2928084124 | 2928086119 | 384 |
| 893 | iso_pu_bacteria | 2928115317 | 2928116798 | 384 |
| 894 | iso_pu_bacteria | 2928115317 | 2928119777 | 384 |
| 895 | iso_pu_bacteria | 2929144301 | 2929147198 | 384 |
| 896 | iso_pu_bacteria | 2929160207 | 2929165033 | 384 |
| 897 | iso_pu_bacteria | 2929160207 | 2929165931 | 384 |
| 898 | iso_pu_bacteria | 2929520902 | 2929524537 | 384 |
| 899 | iso_pu_bacteria | 2929615660 | 2929623383 | 384 |
| 900 | iso_pu_bacteria | 2929624759 | 2929632525 | 384 |
| 901 | iso_pu_bacteria | 2931369376 | 2931369460 | 384 |
| 902 | iso_pu_bacteria | 2932784394 | 2932788144 | 384 |
| 903 | iso_pu_bacteria | 2932794094 | 2932798564 | 384 |
| 904 | iso_pu_bacteria | 2932801729 | 2932803127 | 384 |
| 905 | iso_pu_bacteria | 2932809354 | 2932813518 | 384 |
| 906 | iso_pu_bacteria | 2932818245 | 2932820215 | 384 |
| 907 | iso_pu_bacteria | 2933016740 | 2933022687 | 384 |
| 908 | iso_pu_bacteria | 2933577622 | 2933585288 | 384 |
| 909 | iso_pu_bacteria | 2935608549 | 2935612439 | 384 |
| 910 | iso_pu_bacteria | 2935616580 | 2935620211 | 384 |
| 911 | iso_pu_bacteria | 2935638405 | 2935640530 | 384 |
| 912 | iso_pu_bacteria | 2935648319 | 2935650341 | 384 |
| 913 | iso_pu_bacteria | 2935656913 | 2935658488 | 384 |
| 914 | iso_pu_bacteria | 2935665750 | 2935668723 | 384 |
| 915 | iso_pu_bacteria | 2935675223 | 2935682022 | 384 |
| 916 | iso_pu_bacteria | 2935684952 | 2935687029 | 384 |
| 917 | iso_pu_bacteria | 2935694250 | 2935696999 | 384 |
| 918 | iso_pu_bacteria | 2935703347 | 2935709767 | 384 |
| 919 | iso_pu_bacteria | 2935713505 | 2935716717 | 384 |
| 920 | iso_pu_bacteria | 2935722832 | 2935723158 | 384 |
| 921 | iso_pu_bacteria | 2935732158 | 2935734715 | 384 |
| 922 | iso_pu_bacteria | 2935741537 | 2935744494 | 384 |
| 923 | iso_pu_bacteria | 2935750917 | 2935752995 | 384 |
| 924 | iso_pu_bacteria | 2935760218 | 2935766892 | 384 |
| 925 | iso_pu_bacteria | 2935769743 | 2935774551 | 384 |
| 926 | iso_pu_bacteria | 2935777560 | 2935781842 | 384 |
| 927 | iso_pu_bacteria | 2935785616 | 2935789434 | 384 |
| 928 | iso_pu_bacteria | 2935793552 | 2935797523 | 384 |
| 929 | iso_pu_bacteria | 2935801545 | 2935804643 | 384 |
| 930 | iso_pu_bacteria | 2935810662 | 2935815794 | 384 |
| 931 | iso_pu_bacteria | 2935819856 | 2935823928 | 384 |
| 932 | iso_pu_bacteria | 2935827899 | 2935832036 | 384 |
| 933 | iso_pu_bacteria | 2935837841 | 2935841133 | 384 |
| 934 | iso_pu_bacteria | 2935847175 | 2935852925 | 384 |
| 935 | iso_pu_bacteria | 2935855204 | 2935859097 | 384 |
| 936 | iso_pu_bacteria | 2935864058 | 2935864278 | 384 |
| 937 | iso_pu_bacteria | 2935873716 | 2935875370 | 384 |
| 938 | iso_pu_bacteria | 2935883170 | 2935885466 | 384 |
| 939 | iso_pu_bacteria | 2935908558 | 2935913383 | 384 |
| 940 | iso_pu_bacteria | 2935916978 | 2935922132 | 384 |
| 941 | iso_pu_bacteria | 2935926038 | 2935931300 | 384 |
| 942 | iso_pu_bacteria | 2935934488 | 2935935582 | 384 |
| 943 | iso_pu_bacteria | 2935942939 | 2935947148 | 384 |
| 944 | iso_pu_bacteria | 2935951376 | 2935953757 | 384 |
| 945 | iso_pu_bacteria | 2935959822 | 2935964340 | 384 |
| 946 | iso_pu_bacteria | 2935967501 | 2935968783 | 384 |
| 947 | iso_pu_bacteria | 2935975950 | 2935976991 | 384 |
| 948 | iso_pu_bacteria | 2935984226 | 2935986050 | 384 |
| 949 | iso_pu_bacteria | 2935992306 | 2935995652 | 384 |
| 950 | iso_pu_bacteria | 2936002035 | 2936008071 | 384 |
| 951 | iso_pu_bacteria | 2936011229 | 2936013100 | 384 |
| 952 | iso_pu_bacteria | 2936019824 | 2936021813 | 384 |
| 953 | iso_pu_bacteria | 2936028420 | 2936030393 | 384 |
| 954 | iso_pu_bacteria | 2936037263 | 2936041696 | 384 |
| 955 | iso_pu_bacteria | 2936046547 | 2936048007 | 384 |
| 956 | iso_pu_bacteria | 2936055302 | 2936058007 | 384 |
| 957 | iso_pu_bacteria | 2939631187 | 2939632484 | 384 |
| 958 | iso_pu_bacteria | 2940556831 | 2940558908 | 384 |
| 959 | iso_pu_bacteria | 2941479691 | 2941482695 | 384 |
| 960 | iso_pu_bacteria | 2941499720 | 2941502460 | 384 |
| 961 | iso_pu_bacteria | 2941531003 | 2941537674 | 384 |
| 962 | iso_pu_bacteria | 2941538514 | 2941541605 | 384 |
| 963 | iso_pu_bacteria | 2945945610 | 2945946944 | 384 |
| 964 | iso_pu_bacteria | 2945972063 | 2945976643 | 384 |
| 965 | iso_pu_bacteria | 2960617483 | 2960619479 | 384 |
| 966 | iso_pu_bacteria | 2981284811 | 2981286024 | 384 |
| 967 | iso_pu_bacteria | 2981284811 | 2981289653 | 384 |
| 968 | iso_pu_bacteria | 2981289755 | 2981290975 | 384 |
| 969 | iso_pu_bacteria | 2981289755 | 2981294599 | 384 |
| 970 | iso_pu_bacteria | 2981980479 | 2981981674 | 384 |
| 971 | iso_pu_bacteria | 2981980479 | 2981985247 | 384 |
| 972 | iso_pu_bacteria | 2981985349 | 2981986570 | 384 |
| 973 | iso_pu_bacteria | 2981985349 | 2981990186 | 384 |
| 974 | iso_pu_bacteria | 2988728565 | 2988728708 | 384 |
| 975 | iso_pu_bacteria | 2989349275 | 2989352384 | 384 |
| 976 | iso_pu_bacteria | 2990710928 | 2990715124 | 384 |
| 977 | iso_pu_bacteria | 2996893221 | 2996894798 | 384 |
| 978 | iso_pu_bacteria | 3003930520 | 3003935804 | 384 |
| 979 | iso_pu_bacteria | 3005506211 | 3005510101 | 384 |
| 980 | iso_pu_bacteria | 3007866637 | 3007869638 | 384 |
| 981 | iso_pu_bacteria | 643692032 | 643821901 | 384 |
| 982 | iso_pu_bacteria | 8005282627 | 8005287357 | 384 |
| 983 | iso_pu_bacteria | 8005289223 | 8005289910 | 384 |
| 984 | iso_pu_bacteria | 8005301065 | 8005307403 | 384 |
| 985 | iso_pu_bacteria | 8005382845 | 8005389269 | 384 |
| 986 | iso_pu_bacteria | 8005395548 | 8005396867 | 384 |
| 987 | iso_pu_bacteria | 8005430974 | 8005435753 | 384 |
| 988 | iso_pu_bacteria | 8005497431 | 8005503497 | 384 |
| 989 | iso_pu_bacteria | 8005619151 | 8005625799 | 384 |
| 990 | iso_pu_bacteria | 8005626139 | 8005632056 | 384 |
| 991 | iso_pu_bacteria | 8005668836 | 8005675375 | 384 |
| 992 | iso_pu_bacteria | 8005688590 | 8005688692 | 384 |
| 993 | iso_pu_bacteria | 8006926726 | 8006931298 | 384 |
| 994 | iso_pu_bacteria | 8016511872 | 8016517507 | 384 |
| 995 | iso_pu_bacteria | 8016522445 | 8016524177 | 384 |
| 996 | iso_pu_bacteria | 8016530956 | 8016537723 | 384 |
| 997 | iso_pu_bacteria | 8016539877 | 8016542005 | 384 |
| 998 | iso_pu_bacteria | 8016548790 | 8016551280 | 384 |
| 999 | iso_pu_bacteria | 8016557553 | 8016559671 | 384 |
| 1000 | iso_pu_bacteria | 8016583857 | 8016587868 | 384 |
| 1001 | iso_pu_bacteria | 8016595262 | 8016597611 | 384 |
| 1002 | iso_pu_bacteria | 8016622563 | 8016629668 | 384 |
| 1003 | iso_pu_bacteria | 8016630954 | 8016637755 | 384 |
| 1004 | iso_pu_bacteria | 8017057580 | 8017059109 | 384 |
| 1005 | iso_pu_bacteria | 8018127388 | 8018134576 | 384 |
| 1006 | iso_pu_bacteria | 8019530166 | 8019537397 | 384 |
| 1007 | iso_pu_bacteria | 8019597564 | 8019607159 | 384 |
| 1008 | iso_pu_bacteria | 8019608314 | 8019611349 | 384 |
| 1009 | iso_pu_bacteria | 8019619141 | 8019624788 | 384 |
| 1010 | iso_pu_bacteria | 8019629233 | 8019637353 | 384 |
| 1011 | iso_pu_bacteria | 8019638758 | 8019642242 | 384 |
| 1012 | iso_pu_bacteria | 8019648815 | 8019656929 | 384 |
| 1013 | iso_pu_bacteria | 8019668869 | 8019674739 | 384 |
| 1014 | iso_pu_bacteria | 8019687851 | 8019694460 | 384 |
| 1015 | iso_pu_bacteria | 8024501048 | 8024506960 | 384 |
| 1016 | iso_pu_bacteria | 8054002106 | 8054008344 | 384 |
| 1017 | iso_pu_bacteria | 8054002106 | 8054008779 | 384 |
| 1018 | iso_pu_bacteria | 8055742211 | 8055743327 | 384 |
| 1019 | iso_pu_bacteria | 8056143049 | 8056145658 | 384 |
| 1020 | iso_pu_bacteria | 8056382006 | 8056385464 | 384 |
| 1021 | 3300004625 | Ga0055543_1011419 | Ga0055543_10114191 | 385 |
| 1022 | 3300005262 | Ga0065165_1000393 | Ga0065165_100039325 | 385 |
| 1023 | 3300005331 | Ga0070670_100009738 | Ga0070670_1000097387 | 385 |
| 1024 | 3300005618 | Ga0068864_100014385 | Ga0068864_1000143854 | 385 |
| 1025 | 3300005841 | Ga0068863_100010812 | Ga0068863_1000108124 | 385 |
| 1026 | 3300006844 | Ga0075428_100001618 | Ga0075428_1000016187 | 385 |
| 1027 | 3300006846 | Ga0075430_100024745 | Ga0075430_1000247455 | 385 |
| 1028 | 3300006847 | Ga0075431_100007036 | Ga0075431_10000703612 | 385 |
| 1029 | 3300006880 | Ga0075429_100022227 | Ga0075429_1000222276 | 385 |
| 1030 | 3300009094 | Ga0111539_10000418 | Ga0111539_1000041834 | 385 |
| 1031 | 3300009147 | Ga0114129_10000336 | Ga0114129_1000033622 | 385 |
| 1032 | 3300013104 | Ga0157370_10001357 | Ga0157370_1000135722 | 385 |
| 1033 | 3300014325 | Ga0163163_10004624 | Ga0163163_100046249 | 385 |
| 1034 | 3300025284 | Ga0209130_1000061 | Ga0209130_100006127 | 385 |
| 1035 | 3300025925 | Ga0207650_10044581 | Ga0207650_100445812 | 385 |
| 1036 | 3300027907 | Ga0207428_10002714 | Ga0207428_100027144 | 385 |
| 1037 | 3300046522 | Ga0495643_0013677 | Ga0495643_0013677_3334_4614 | 385 |
| 1038 | 3300050507 | nmdc:mga05p37_22_c2 | nmdc:mga05p37_22_c2_35404_36684 | 385 |
| 1039 | 3300050508 | nmdc:mga09592_20673_c1 | nmdc:mga09592_20673_c1_602_1882 | 385 |
| 1040 | 3300050509 | nmdc:mga0qj67_20482_c1 | nmdc:mga0qj67_20482_c1_2874_4154 | 385 |
| 1041 | 3300050510 | nmdc:mga06r32_3586_c1 | nmdc:mga06r32_3586_c1_1006_2286 | 385 |
| 1042 | 3300050511 | nmdc:mga08y16_177_c1 | nmdc:mga08y16_177_c1_9297_10577 | 385 |
| 1043 | 3300035089 | Ga0373944_0002367 | Ga0373944_0002367_71_1351 | 386 |
| 1044 | 3300035113 | Ga0373936_0031832 | Ga0373936_0031832_415_1695 | 386 |
| 1045 | 3300035171 | Ga0373946_0007751 | Ga0373946_0007751_2365_3645 | 386 |
| 1046 | 3300035692 | Ga0373935_0003759 | Ga0373935_0003759_6068_7348 | 386 |
| 1047 | 3300035695 | Ga0373927_0004169 | Ga0373927_0004169_7321_8601 | 386 |
| 1048 | 3300045051 | Ga0451576_0044807 | Ga0451576_0044807_2926_4203 | 386 |
| 1049 | 3300046455 | Ga0495603_0009552 | Ga0495603_0009552_3546_4826 | 386 |
| 1050 | 3300046472 | Ga0495580_0018432 | Ga0495580_0018432_1064_2344 | 386 |
| 1051 | 3300046476 | Ga0495662_0018852 | Ga0495662_0018852_619_1899 | 386 |
| 1052 | 3300046491 | Ga0495584_0039085 | Ga0495584_0039085_796_2076 | 386 |
| 1053 | 3300046515 | Ga0495620_0045919 | Ga0495620_0045919_598_1878 | 386 |
| 1054 | 3300046537 | Ga0495598_0009887 | Ga0495598_0009887_385_1665 | 386 |
| 1055 | 3300046557 | Ga0495622_0007851 | Ga0495622_0007851_2745_4025 | 386 |
| 1056 | 3300046690 | Ga0495624_0023634 | Ga0495624_0023634_2320_3600 | 386 |
| 1057 | 3300047319 | Ga0495674_0075980 | Ga0495674_0075980_1454_2734 | 386 |
| 1058 | 3300047472 | Ga0495686_0079814 | Ga0495686_0079814_162_1442 | 386 |
| 1059 | 3300002704 | JGI25155J39150_1000024 | JGI25155J39150_10000242 | 387 |
| 1060 | 3300002705 | JGI25156J39149_1000005 | JGI25156J39149_1000005252 | 387 |
| 1061 | 3300002738 | JGI25154J39366_1000017 | JGI25154J39366_1000017244 | 387 |
| 1062 | 3300002741 | JGI25157J39369_1000003 | JGI25157J39369_1000003260 | 387 |
| 1063 | 3300002741 | JGI25157J39369_1000054 | JGI25157J39369_100005495 | 387 |
| 1064 | 3300002987 | JGI25159J45721_1000273 | JGI25159J45721_100027316 | 387 |
| 1065 | 3300003187 | JGI25151J46595_10037173 | JGI25151J46595_100371732 | 387 |
| 1066 | 3300003354 | JGI25160J50197_1000483 | JGI25160J50197_10004832 | 387 |
| 1067 | 3300003374 | JGI25161J50226_1000352 | JGI25161J50226_10003522 | 387 |
| 1068 | 3300004625 | Ga0055543_1006051 | Ga0055543_10060512 | 387 |
| 1069 | 3300005330 | Ga0070690_100011894 | Ga0070690_1000118943 | 387 |
| 1070 | 3300005335 | Ga0070666_10010604 | Ga0070666_100106045 | 387 |
| 1071 | 3300005354 | Ga0070675_100000613 | Ga0070675_1000006134 | 387 |
| 1072 | 3300005355 | Ga0070671_100035174 | Ga0070671_1000351742 | 387 |
| 1073 | 3300005364 | Ga0070673_100010305 | Ga0070673_1000103052 | 387 |
| 1074 | 3300005365 | Ga0070688_100011113 | Ga0070688_1000111133 | 387 |
| 1075 | 3300005367 | Ga0070667_100010275 | Ga0070667_1000102756 | 387 |
| 1076 | 3300005456 | Ga0070678_100004507 | Ga0070678_1000045075 | 387 |
| 1077 | 3300005457 | Ga0070662_100019907 | Ga0070662_1000199073 | 387 |
| 1078 | 3300005543 | Ga0070672_100137273 | Ga0070672_1001372732 | 387 |
| 1079 | 3300005563 | Ga0068855_100073215 | Ga0068855_1000732153 | 387 |
| 1080 | 3300005616 | Ga0068852_100290300 | Ga0068852_1002903002 | 387 |
| 1081 | 3300005617 | Ga0068859_100001476 | Ga0068859_1000014764 | 387 |
| 1082 | 3300005618 | Ga0068864_100000212 | Ga0068864_10000021231 | 387 |
| 1083 | 3300005841 | Ga0068863_100001367 | Ga0068863_10000136725 | 387 |
| 1084 | 3300005841 | Ga0068863_100075563 | Ga0068863_1000755633 | 387 |
| 1085 | 3300005842 | Ga0068858_100002088 | Ga0068858_1000020885 | 387 |
| 1086 | 3300005843 | Ga0068860_100270757 | Ga0068860_1002707572 | 387 |
| 1087 | 3300006038 | Ga0075365_10020188 | Ga0075365_100201882 | 387 |
| 1088 | 3300006042 | Ga0075368_10002604 | Ga0075368_100026045 | 387 |
| 1089 | 3300006048 | Ga0075363_100044611 | Ga0075363_1000446113 | 387 |
| 1090 | 3300006051 | Ga0075364_10039004 | Ga0075364_100390043 | 387 |
| 1091 | 3300006178 | Ga0075367_10010157 | Ga0075367_100101572 | 387 |
| 1092 | 3300006178 | Ga0075367_10054273 | Ga0075367_100542733 | 387 |
| 1093 | 3300006186 | Ga0075369_10006145 | Ga0075369_100061451 | 387 |
| 1094 | 3300006195 | Ga0075366_10008595 | Ga0075366_100085952 | 387 |
| 1095 | 3300006237 | Ga0097621_100040078 | Ga0097621_1000400783 | 387 |
| 1096 | 3300006353 | Ga0075370_10045805 | Ga0075370_100458054 | 387 |
| 1097 | 3300006881 | Ga0068865_100061310 | Ga0068865_1000613103 | 387 |
| 1098 | 3300006931 | Ga0097620_100001476 | Ga0097620_1000014764 | 387 |
| 1099 | 3300006946 | Ga0079104_1009489 | Ga0079104_10094894 | 387 |
| 1100 | 3300009177 | Ga0105248_10015734 | Ga0105248_100157347 | 387 |
| 1101 | 3300009553 | Ga0105249_10025877 | Ga0105249_100258773 | 387 |
| 1102 | 3300013296 | Ga0157374_10022494 | Ga0157374_100224943 | 387 |
| 1103 | 3300014325 | Ga0163163_10008095 | Ga0163163_100080959 | 387 |
| 1104 | 3300025206 | Ga0209435_100002 | Ga0209435_100002367 | 387 |
| 1105 | 3300025208 | Ga0209436_100352 | Ga0209436_1003522 | 387 |
| 1106 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012510 | 387 |
| 1107 | 3300025250 | Ga0209026_1000001 | Ga0209026_10000011166 | 387 |
| 1108 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000012141 | 387 |
| 1109 | 3300025263 | Ga0209565_1000678 | Ga0209565_10006789 | 387 |
| 1110 | 3300025284 | Ga0209130_1000450 | Ga0209130_100045032 | 387 |
| 1111 | 3300025291 | Ga0209675_1001531 | Ga0209675_10015313 | 387 |
| 1112 | 3300025291 | Ga0209675_1002999 | Ga0209675_10029992 | 387 |
| 1113 | 3300025292 | Ga0209676_1005394 | Ga0209676_10053943 | 387 |
| 1114 | 3300025294 | Ga0209025_1011968 | Ga0209025_10119685 | 387 |
| 1115 | 3300025294 | Ga0209025_1018594 | Ga0209025_10185943 | 387 |
| 1116 | 3300025297 | Ga0209758_1003945 | Ga0209758_10039453 | 387 |
| 1117 | 3300025299 | Ga0209256_1001387 | Ga0209256_100138726 | 387 |
| 1118 | 3300025302 | Ga0207426_1000428 | Ga0207426_100042843 | 387 |
| 1119 | 3300025315 | Ga0207697_10031808 | Ga0207697_100318083 | 387 |
| 1120 | 3300025903 | Ga0207680_10004622 | Ga0207680_100046225 | 387 |
| 1121 | 3300025926 | Ga0207659_10000631 | Ga0207659_100006312 | 387 |
| 1122 | 3300025931 | Ga0207644_10037494 | Ga0207644_100374943 | 387 |
| 1123 | 3300025933 | Ga0207706_10019241 | Ga0207706_100192415 | 387 |
| 1124 | 3300025940 | Ga0207691_10022504 | Ga0207691_100225045 | 387 |
| 1125 | 3300025941 | Ga0207711_10040039 | Ga0207711_100400394 | 387 |
| 1126 | 3300025986 | Ga0207658_10041751 | Ga0207658_100417514 | 387 |
| 1127 | 3300026035 | Ga0207703_10001030 | Ga0207703_1000103027 | 387 |
| 1128 | 3300026088 | Ga0207641_10034707 | Ga0207641_100347072 | 387 |
| 1129 | 3300026089 | Ga0207648_10012621 | Ga0207648_100126216 | 387 |
| 1130 | 3300026095 | Ga0207676_10000229 | Ga0207676_100002295 | 387 |
| 1131 | 3300026121 | Ga0207683_10008851 | Ga0207683_100088514 | 387 |
| 1132 | 3300026142 | Ga0207698_10136737 | Ga0207698_101367371 | 387 |
| 1133 | 3300028380 | Ga0268265_10112664 | Ga0268265_101126643 | 387 |
| 1134 | 3300028381 | Ga0268264_10210705 | Ga0268264_102107052 | 387 |
| 1135 | 3300031456 | Ga0307513_10000057 | Ga0307513_10000057109 | 387 |
| 1136 | 3300031456 | Ga0307513_10000206 | Ga0307513_100002066 | 387 |
| 1137 | 3300031456 | Ga0307513_10005251 | Ga0307513_1000525114 | 387 |
| 1138 | 3300048911 | Ga0496108_0044563 | Ga0496108_0044563_185_1462 | 387 |
| 1139 | 3300048912 | Ga0496109_0082047 | Ga0496109_0082047_846_2123 | 387 |
| 1140 | 3300050491 | nmdc:mga00v17_66735_c1 | nmdc:mga00v17_66735_c1_849_2129 | 387 |
| 1141 | 3300050492 | nmdc:mga0yw44_27381_c1 | nmdc:mga0yw44_27381_c1_1862_3142 | 387 |
| 1142 | 3300050494 | nmdc:mga06z11_97997_c1 | nmdc:mga06z11_97997_c1_194_1471 | 387 |
| 1143 | 3300050496 | nmdc:mga07m45_6292_c1 | nmdc:mga07m45_6292_c1_2967_4244 | 387 |
| 1144 | 3300050507 | nmdc:mga05p37_261893_c1 | nmdc:mga05p37_261893_c1_655_1932 | 387 |
| 1145 | 3300053117 | Ga0500593_000258 | Ga0500593_000258_17747_19024 | 387 |
| 1146 | 3300053730 | Ga0500645_000978 | Ga0500645_000978_12922_14199 | 387 |
| 1147 | 2162886007 | SwRhRL2b_contig_2555482 | SwRhRL2b_0988.00001450 | 388 |
| 1148 | 3300001979 | JGI24740J21852_10002160 | JGI24740J21852_100021609 | 388 |
| 1149 | 3300001989 | JGI24739J22299_10007080 | JGI24739J22299_100070803 | 388 |
| 1150 | 3300003187 | JGI25151J46595_10000323 | JGI25151J46595_1000032335 | 388 |
| 1151 | 3300003187 | JGI25151J46595_10002779 | JGI25151J46595_100027793 | 388 |
| 1152 | 3300003781 | Ga0055536_1000791 | Ga0055536_10007914 | 388 |
| 1153 | 3300003781 | Ga0055536_1003436 | Ga0055536_10034366 | 388 |
| 1154 | 3300003784 | Ga0055534_1004223 | Ga0055534_10042235 | 388 |
| 1155 | 3300003791 | Ga0055530_10000022 | Ga0055530_1000002259 | 388 |
| 1156 | 3300003792 | Ga0055540_1000395 | Ga0055540_100039538 | 388 |
| 1157 | 3300003794 | Ga0055531_10000392 | Ga0055531_100003924 | 388 |
| 1158 | 3300005288 | Ga0065714_10002256 | Ga0065714_1000225620 | 388 |
| 1159 | 3300005289 | Ga0065704_10070552 | Ga0065704_1007055210 | 388 |
| 1160 | 3300005459 | Ga0068867_100164844 | Ga0068867_1001648442 | 388 |
| 1161 | 3300005467 | Ga0070706_100000680 | Ga0070706_1000006805 | 388 |
| 1162 | 3300005468 | Ga0070707_100072123 | Ga0070707_1000721232 | 388 |
| 1163 | 3300005471 | Ga0070698_100177318 | Ga0070698_1001773182 | 388 |
| 1164 | 3300005539 | Ga0068853_100001041 | Ga0068853_10000104112 | 388 |
| 1165 | 3300006051 | Ga0075364_10069203 | Ga0075364_100692032 | 388 |
| 1166 | 3300006178 | Ga0075367_10001552 | Ga0075367_100015527 | 388 |
| 1167 | 3300006186 | Ga0075369_10007612 | Ga0075369_100076122 | 388 |
| 1168 | 3300006195 | Ga0075366_10006288 | Ga0075366_100062884 | 388 |
| 1169 | 3300006195 | Ga0075366_10056681 | Ga0075366_100566811 | 388 |
| 1170 | 3300006353 | Ga0075370_10002782 | Ga0075370_100027825 | 388 |
| 1171 | 3300006353 | Ga0075370_10023143 | Ga0075370_100231434 | 388 |
| 1172 | 3300006948 | Ga0099826_10000013 | Ga0099826_10000013174 | 388 |
| 1173 | 3300009036 | Ga0105244_10013800 | Ga0105244_100138003 | 388 |
| 1174 | 3300009148 | Ga0105243_10006368 | Ga0105243_100063686 | 388 |
| 1175 | 3300009551 | Ga0105238_10006513 | Ga0105238_100065132 | 388 |
| 1176 | 3300009553 | Ga0105249_10064073 | Ga0105249_100640732 | 388 |
| 1177 | 3300011119 | Ga0105246_10011263 | Ga0105246_100112631 | 388 |
| 1178 | 3300013104 | Ga0157370_10100354 | Ga0157370_101003543 | 388 |
| 1179 | 3300014497 | Ga0182008_10000325 | Ga0182008_100003254 | 388 |
| 1180 | 3300014497 | Ga0182008_10001424 | Ga0182008_1000142410 | 388 |
| 1181 | 3300015261 | Ga0182006_1002542 | Ga0182006_10025425 | 388 |
| 1182 | 3300015262 | Ga0182007_10000588 | Ga0182007_100005885 | 388 |
| 1183 | 3300017792 | Ga0163161_10109587 | Ga0163161_101095872 | 388 |
| 1184 | 3300025208 | Ga0209436_110094 | Ga0209436_1100942 | 388 |
| 1185 | 3300025245 | Ga0207425_1000243 | Ga0207425_100024338 | 388 |
| 1186 | 3300025258 | Ga0209129_1000030 | Ga0209129_100003042 | 388 |
| 1187 | 3300025263 | Ga0209565_1000019 | Ga0209565_1000019113 | 388 |
| 1188 | 3300025273 | Ga0209673_1000095 | Ga0209673_100009532 | 388 |
| 1189 | 3300025273 | Ga0209673_1000121 | Ga0209673_1000121152 | 388 |
| 1190 | 3300025273 | Ga0209673_1002789 | Ga0209673_10027899 | 388 |
| 1191 | 3300025284 | Ga0209130_1000011 | Ga0209130_1000011106 | 388 |
| 1192 | 3300025284 | Ga0209130_1000903 | Ga0209130_10009038 | 388 |
| 1193 | 3300025291 | Ga0209675_1000073 | Ga0209675_100007338 | 388 |
| 1194 | 3300025292 | Ga0209676_1000193 | Ga0209676_100019356 | 388 |
| 1195 | 3300025292 | Ga0209676_1001188 | Ga0209676_100118823 | 388 |
| 1196 | 3300025292 | Ga0209676_1002784 | Ga0209676_100278412 | 388 |
| 1197 | 3300025294 | Ga0209025_1000145 | Ga0209025_100014570 | 388 |
| 1198 | 3300025294 | Ga0209025_1000494 | Ga0209025_100049440 | 388 |
| 1199 | 3300025294 | Ga0209025_1010461 | Ga0209025_10104616 | 388 |
| 1200 | 3300025295 | Ga0209564_1000056 | Ga0209564_100005629 | 388 |
| 1201 | 3300025297 | Ga0209758_1000037 | Ga0209758_1000037298 | 388 |
| 1202 | 3300025298 | Ga0209050_1000193 | Ga0209050_100019356 | 388 |
| 1203 | 3300025298 | Ga0209050_1000704 | Ga0209050_10007044 | 388 |
| 1204 | 3300025298 | Ga0209050_1005033 | Ga0209050_10050337 | 388 |
| 1205 | 3300025299 | Ga0209256_1000043 | Ga0209256_100004329 | 388 |
| 1206 | 3300025299 | Ga0209256_1000171 | Ga0209256_1000171102 | 388 |
| 1207 | 3300025302 | Ga0207426_1000029 | Ga0207426_1000029297 | 388 |
| 1208 | 3300025302 | Ga0207426_1000068 | Ga0207426_100006824 | 388 |
| 1209 | 3300025303 | Ga0209051_1000147 | Ga0209051_100014756 | 388 |
| 1210 | 3300025303 | Ga0209051_1000186 | Ga0209051_100018650 | 388 |
| 1211 | 3300025304 | Ga0209257_1000547 | Ga0209257_10005479 | 388 |
| 1212 | 3300025304 | Ga0209257_1000663 | Ga0209257_10006637 | 388 |
| 1213 | 3300025910 | Ga0207684_10001213 | Ga0207684_100012133 | 388 |
| 1214 | 3300025924 | Ga0207694_10063111 | Ga0207694_100631111 | 388 |
| 1215 | 3300025935 | Ga0207709_10002938 | Ga0207709_100029385 | 388 |
| 1216 | 3300026041 | Ga0207639_10002239 | Ga0207639_100022395 | 388 |
| 1217 | 3300026142 | Ga0207698_10038526 | Ga0207698_100385262 | 388 |
| 1218 | 3300027666 | Ga0209282_1000043 | Ga0209282_100004382 | 388 |
| 1219 | 3300028379 | Ga0268266_10269284 | Ga0268266_102692842 | 388 |
| 1220 | 3300031911 | Ga0307412_10000235 | Ga0307412_1000023527 | 388 |
| 1221 | 3300037068 | Ga0373925_0035877 | Ga0373925_0035877_340_1620 | 388 |
| 1222 | 3300042015 | Ga0439462_0002207 | Ga0439462_0002207_2638_3921 | 388 |
| 1223 | 3300046474 | Ga0495605_0001215 | Ga0495605_0001215_10594_11874 | 388 |
| 1224 | 3300046475 | Ga0495639_0064242 | Ga0495639_0064242_252_1532 | 388 |
| 1225 | 3300046500 | Ga0495596_0000058 | Ga0495596_0000058_74556_75836 | 388 |
| 1226 | 3300046501 | Ga0495607_0006603 | Ga0495607_0006603_6795_8075 | 388 |
| 1227 | 3300046512 | Ga0495610_0001463 | Ga0495610_0001463_5821_7101 | 388 |
| 1228 | 3300046513 | Ga0495616_0001432 | Ga0495616_0001432_4396_5676 | 388 |
| 1229 | 3300046524 | Ga0495648_0043977 | Ga0495648_0043977_1224_2504 | 388 |
| 1230 | 3300046538 | Ga0495609_0000566 | Ga0495609_0000566_958_2238 | 388 |
| 1231 | 3300046542 | Ga0495597_0000329 | Ga0495597_0000329_40716_41996 | 388 |
| 1232 | 3300046615 | Ga0495656_0000047 | Ga0495656_0000047_31249_32529 | 388 |
| 1233 | 3300046665 | Ga0495661_0048361 | Ga0495661_0048361_966_2246 | 388 |
| 1234 | 3300046691 | Ga0495670_0048730 | Ga0495670_0048730_86_1366 | 388 |
| 1235 | 3300046692 | Ga0495671_0000966 | Ga0495671_0000966_12434_13714 | 388 |
| 1236 | 3300046694 | Ga0495649_0020791 | Ga0495649_0020791_684_1964 | 388 |
| 1237 | 3300047469 | Ga0495673_0000210 | Ga0495673_0000210_3023_4303 | 388 |
| 1238 | 3300048907 | Ga0496104_0015976 | Ga0496104_0015976_5156_6436 | 388 |
| 1239 | 3300048909 | Ga0496106_0117893 | Ga0496106_0117893_196_1476 | 388 |
| 1240 | 3300048911 | Ga0496108_0092410 | Ga0496108_0092410_749_2029 | 388 |
| 1241 | 3300048912 | Ga0496109_0052831 | Ga0496109_0052831_2287_3567 | 388 |
| 1242 | 3300048915 | Ga0496112_0109196 | Ga0496112_0109196_1358_2638 | 388 |
| 1243 | 3300048918 | Ga0496115_0011568 | Ga0496115_0011568_1153_2433 | 388 |
| 1244 | 3300048920 | Ga0496117_0023846 | Ga0496117_0023846_490_1770 | 388 |
| 1245 | 3300048921 | Ga0496118_0001366 | Ga0496118_0001366_8619_9899 | 388 |
| 1246 | 3300048921 | Ga0496118_0064217 | Ga0496118_0064217_1157_2437 | 388 |
| 1247 | 3300048924 | Ga0496121_0000444 | Ga0496121_0000444_39238_40518 | 388 |
| 1248 | 3300048924 | Ga0496121_0032600 | Ga0496121_0032600_482_1762 | 388 |
| 1249 | 3300048925 | Ga0496122_0000908 | Ga0496122_0000908_17619_18899 | 388 |
| 1250 | 3300048926 | Ga0496123_0000412 | Ga0496123_0000412_44457_45737 | 388 |
| 1251 | 3300048926 | Ga0496123_0022278 | Ga0496123_0022278_2234_3514 | 388 |
| 1252 | 3300050493 | nmdc:mga0k408_113591_c1 | nmdc:mga0k408_113591_c1_115_1395 | 388 |
| 1253 | 3300050496 | nmdc:mga07m45_2648_c1 | nmdc:mga07m45_2648_c1_5565_6845 | 388 |
| 1254 | 3300053153 | Ga0500616_0011831 | Ga0500616_0011831_1291_2571 | 388 |
| 1255 | iso_pu_bacteria | 8019659431 | 8019665203 | 388 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.7967 | 19 | 386 |
| 7qha-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7746 | 3 | 388 |
| 7qha-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7689 | 3 | 388 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.756 | 19 | 386 |
| 4r0c-assembly1.cif.gz_D | crystal structure of the alcanivorax borkumensis ydah transporter reveals an unusual topology | 0.6441 | 37 | 383 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6YCG9_3_406_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.6011 | 2 | 371 | 1.20.1530.20 |
| af_I6YCG9_3_406_1.20.1530.20 | Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; | 0.5756 | 2 | 371 | 1.20.1530.20 |
| af_A6NC51_4_206_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3168 | 55 | 251 | 1.20.1070.10 |
| af_A6NC51_4_206_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3047 | 55 | 251 | 1.20.1070.10 |
| af_Q1ZXE9_716_918_1.20.1410.10 | Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain | 0.3034 | 48 | 227 | 1.20.1410.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527ZKM0-F1-model_v4 | TRAP transporter large permease | 0.9387 | 48 | 265 |
GO:0005886
GO:0022857 |
| AF-X1CUY5-F1-model_v4 | TRAP C4-dicarboxylate transport system permease DctM subunit domain-containing protein | 0.934 | 47 | 257 |
GO:0005886
GO:0022857 |
| AF-A0A7W8PJF4-F1-model_v4 | TRAP transporter large permease protein | 0.9166 | 69 | 385 |
GO:0005886
GO:0022857 |
| AF-X1KG46-F1-model_v4 | TRAP C4-dicarboxylate transport system permease DctM subunit domain-containing protein | 0.9103 | 87 | 249 |
GO:0005886
GO:0022857 |
| AF-X0TLF2-F1-model_v4 | TRAP C4-dicarboxylate transport system permease DctM subunit domain-containing protein | 0.8942 | 52 | 384 |
GO:0005886
GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar