F492221

General Info

Members Datasets Scaffolds Average Seq Length
1253 477 1252 80

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0647910|Ga0495594_0647910_114_434
Length 98
Sequence VSPTTVGNRFQDALPAKNAQRDGDAMSMLDLFAWLVLLILAIMAMLPGMIAKERKHPWAQAVTVAGWVTLLFGFVLWPVALVWAYVDVPQPKAGEITR

Samples

Sample ID Description Type Environment
1 2643221736 Bosea sp. Root483D1 Isolate Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
56 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
57 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
104 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
107 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
125 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
126 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
127 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
128 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
135 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
136 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
137 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
138 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
139 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
142 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
209 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
210 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
211 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
221 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
222 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
223 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
224 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
225 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
226 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
227 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
234 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
235 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
236 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
237 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
238 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
239 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
240 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
241 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
242 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
243 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
244 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
245 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
247 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
249 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
250 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
251 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
252 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
255 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
256 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
257 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
258 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
259 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
262 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
263 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
264 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
265 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
266 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
267 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
268 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
269 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
270 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
271 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
272 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
273 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
282 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
285 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
286 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
287 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
290 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
307 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
308 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
311 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
320 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
335 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
336 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
337 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
338 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
339 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
340 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
347 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
348 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
349 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
350 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
351 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
352 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
353 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
354 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
355 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
356 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
357 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
358 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
359 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
360 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
361 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
362 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
363 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
364 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
365 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
366 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
367 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
368 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
369 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
370 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
371 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
372 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
373 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
374 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
375 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
376 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
377 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
378 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
379 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
389 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
393 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
394 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
395 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
396 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
397 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
398 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
399 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
400 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
401 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
402 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
403 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
404 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
405 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
406 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
407 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
415 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
416 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
417 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
418 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
419 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
420 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
421 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
422 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
423 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
424 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
425 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
426 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
427 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
428 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
429 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
430 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
431 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
432 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
433 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
434 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
435 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
436 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
437 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
438 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
439 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
440 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
441 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
442 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
443 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
444 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
445 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
446 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
447 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
448 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
449 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
450 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
451 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
452 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
453 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
454 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
455 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
456 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
457 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
458 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
459 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
460 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
461 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
462 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
463 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
464 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
465 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
466 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
467 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
468 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
469 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
470 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
471 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
472 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
473 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
474 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
475 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
476 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
477 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.92
Metatranscriptomes 0
Isolates 0.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.17
Nodule 0.4
Rhizoplane 8.22
Rhizosphere 73.9
Stem 0
Stem Tuber 0
Unclassified 4.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c007842 3300000041 Bacteria 905
2 ARcpr5yngRDRAFT_c001352 3300000043 Bacteria 2703
3 ARSoilOldRDRAFT_c002613 3300000044 Bacteria 1577
4 JGI24737J22298_10099360 3300001990 Bacteria 862
5 JGI25153J46596_10002368 3300003215 Bacteria 10912
6 JGI25160J50197_1043164 3300003354 Bacteria 1018
7 JGI25404J52841_10003878 3300003659 Bacteria 2997
8 JGI25404J52841_10029094 3300003659 Bacteria 1185
9 Ga0055526_1096513 3300003771 Bacteria 548
10 JGI25405J52794_10013909 3300003911 Unclassified 1567
11 JGI25405J52794_10037902 3300003911 Unclassified 1014
12 Ga0055543_1021761 3300004625 Bacteria 1168
13 Ga0065165_1000972 3300005262 Bacteria 35758
14 Ga0065715_10183454 3300005293 Bacteria 1454
15 Ga0065707_10585927 3300005295 Bacteria 698
16 Ga0070658_11298986 3300005327 Bacteria 632
17 Ga0070676_11303168 3300005328 Bacteria 555
18 Ga0070683_100158241 3300005329 Bacteria 2149
19 Ga0070690_100532591 3300005330 Bacteria 883
20 Ga0070670_100059487 3300005331 Bacteria 3279
21 Ga0070670_101812498 3300005331 Bacteria 562
22 Ga0068869_100281133 3300005334 Bacteria 1338
23 Ga0068869_101440171 3300005334 Bacteria 611
24 Ga0070666_10012782 3300005335 Bacteria 5307
25 Ga0070666_10682505 3300005335 Bacteria 752
26 Ga0070666_11350868 3300005335 Bacteria 532
27 Ga0070680_100045207 3300005336 Bacteria 3580
28 Ga0070680_100099057 3300005336 Bacteria 2418
29 Ga0070680_100246325 3300005336 Bacteria 1511
30 Ga0070682_100022897 3300005337 Bacteria 3706
31 Ga0070682_100035492 3300005337 Bacteria 3045
32 Ga0070682_100731666 3300005337 Bacteria 796
33 Ga0070682_101903069 3300005337 Bacteria 521
34 Ga0068868_100385148 3300005338 Bacteria 1207
35 Ga0068868_100880283 3300005338 Bacteria 813
36 Ga0070660_100202332 3300005339 Bacteria 1611
37 Ga0070660_101161094 3300005339 Bacteria 654
38 Ga0070689_100046929 3300005340 Bacteria 3330
39 Ga0070689_100172396 3300005340 Bacteria 1753
40 Ga0070691_10510512 3300005341 Bacteria 696
41 Ga0070691_10781627 3300005341 Bacteria 580
42 Ga0070687_100166402 3300005343 Bacteria 1308
43 Ga0070687_100471077 3300005343 Bacteria 839
44 Ga0070687_100694339 3300005343 Bacteria 710
45 Ga0070661_100191462 3300005344 Bacteria 1560
46 Ga0070692_10028676 3300005345 Bacteria 2768
47 Ga0070668_100005808 3300005347 Bacteria 9156
48 Ga0070668_100194739 3300005347 Bacteria 1661
49 Ga0070668_100212540 3300005347 Bacteria 1592
50 Ga0070668_100810770 3300005347 Bacteria 832
51 Ga0070668_100895881 3300005347 Bacteria 793
52 Ga0070669_100775238 3300005353 Bacteria 814
53 Ga0070669_101319339 3300005353 Bacteria 625
54 Ga0070669_101586762 3300005353 Bacteria 570
55 Ga0070675_100041049 3300005354 Bacteria 3779
56 Ga0070671_100061772 3300005355 Bacteria 3120
57 Ga0070671_100572906 3300005355 Bacteria 974
58 Ga0070674_100031213 3300005356 Bacteria 3528
59 Ga0070674_100203948 3300005356 Bacteria 1529
60 Ga0070674_100437412 3300005356 Bacteria 1077
61 Ga0070673_100094789 3300005364 Bacteria 2447
62 Ga0070673_101517473 3300005364 Bacteria 632
63 Ga0070688_100080154 3300005365 Bacteria 2111
64 Ga0070688_100222245 3300005365 Bacteria 1331
65 Ga0070688_101293051 3300005365 Bacteria 588
66 Ga0070659_100353142 3300005366 Bacteria 1234
67 Ga0070659_100477303 3300005366 Bacteria 1061
68 Ga0070659_101508077 3300005366 Bacteria 599
69 Ga0070667_100073874 3300005367 Bacteria 2908
70 Ga0070667_100532053 3300005367 Bacteria 1079
71 Ga0070667_101635616 3300005367 Bacteria 605
72 Ga0070709_10009527 3300005434 Bacteria 5360
73 Ga0070714_100036455 3300005435 Bacteria 4125
74 Ga0070713_100003957 3300005436 Bacteria 9846
75 Ga0070710_10140347 3300005437 Bacteria 1481
76 Ga0070701_10154421 3300005438 Bacteria 1324
77 Ga0070701_11285924 3300005438 Bacteria 522
78 Ga0070711_100478200 3300005439 Bacteria 1023
79 Ga0070705_100050366 3300005440 Bacteria 2423
80 Ga0070705_100955155 3300005440 Bacteria 693
81 Ga0070700_100161700 3300005441 Bacteria 1542
82 Ga0070700_101198429 3300005441 Bacteria 634
83 Ga0070694_100265391 3300005444 Bacteria 1304
84 Ga0070694_100724769 3300005444 Bacteria 810
85 Ga0070694_101151423 3300005444 Bacteria 648
86 Ga0070663_100013331 3300005455 Bacteria 5237
87 Ga0070663_100018956 3300005455 Bacteria 4524
88 Ga0070663_100091272 3300005455 Bacteria 2257
89 Ga0070663_100120186 3300005455 Bacteria 1983
90 Ga0070663_100373757 3300005455 Bacteria 1159
91 Ga0070663_100448902 3300005455 Bacteria 1062
92 Ga0070678_100064462 3300005456 Bacteria 2716
93 Ga0070678_100197182 3300005456 Bacteria 1659
94 Ga0070678_100216450 3300005456 Bacteria 1590
95 Ga0070678_100470064 3300005456 Bacteria 1105
96 Ga0070678_100849457 3300005456 Bacteria 832
97 Ga0070678_101289911 3300005456 Bacteria 679
98 Ga0070662_100139925 3300005457 Bacteria 1874
99 Ga0070662_100590717 3300005457 Bacteria 933
100 Ga0070662_101349901 3300005457 Bacteria 614
101 Ga0070681_10031833 3300005458 Bacteria 5294
102 Ga0070681_10053505 3300005458 Bacteria 4023
103 Ga0068867_100032452 3300005459 Bacteria 3777
104 Ga0068867_100113282 3300005459 Bacteria 2086
105 Ga0068867_100785675 3300005459 Bacteria 848
106 Ga0070685_10077747 3300005466 Bacteria 1982
107 Ga0070685_10182719 3300005466 Bacteria 1351
108 Ga0070685_11053504 3300005466 Bacteria 612
109 Ga0070706_100184868 3300005467 Bacteria 1947
110 Ga0070707_100774472 3300005468 Bacteria 923
111 Ga0074259_11290175 3300005507 Bacteria 673
112 Ga0070679_100030768 3300005530 Bacteria 5302
113 Ga0070679_100062268 3300005530 Bacteria 3719
114 Ga0070679_100517890 3300005530 Bacteria 1137
115 Ga0070684_100094549 3300005535 Bacteria 2662
116 Ga0070684_100231267 3300005535 Bacteria 1688
117 Ga0068853_100303907 3300005539 Bacteria 1475
118 Ga0068853_100410778 3300005539 Bacteria 1268
119 Ga0068853_100885211 3300005539 Bacteria 857
120 Ga0070672_100129326 3300005543 Bacteria 2074
121 Ga0070686_100183250 3300005544 Bacteria 1489
122 Ga0070686_100456547 3300005544 Bacteria 983
123 Ga0070686_100459796 3300005544 Bacteria 980
124 Ga0070686_101252157 3300005544 Bacteria 618
125 Ga0070695_100149169 3300005545 Bacteria 1630
126 Ga0070695_101426307 3300005545 Bacteria 575
127 Ga0070696_100016292 3300005546 Bacteria 5001
128 Ga0070696_100288110 3300005546 Bacteria 1254
129 Ga0070696_101047268 3300005546 Bacteria 684
130 Ga0070693_100019995 3300005547 Bacteria 3523
131 Ga0070693_100186090 3300005547 Bacteria 1340
132 Ga0070693_100857264 3300005547 Bacteria 678
133 Ga0070665_100011571 3300005548 Bacteria 8922
134 Ga0070665_100020452 3300005548 Bacteria 6647
135 Ga0070665_100040475 3300005548 Bacteria 4684
136 Ga0070665_100134043 3300005548 Bacteria 2479
137 Ga0070665_100155154 3300005548 Bacteria 2291
138 Ga0070665_100195690 3300005548 Bacteria 2022
139 Ga0070665_100423681 3300005548 Bacteria 1340
140 Ga0070665_100561916 3300005548 Bacteria 1153
141 Ga0070665_100805195 3300005548 Bacteria 953
142 Ga0070665_101066909 3300005548 Bacteria 820
143 Ga0070665_101892241 3300005548 Bacteria 602
144 Ga0070704_100074081 3300005549 Bacteria 2482
145 Ga0070664_100142524 3300005564 Bacteria 2111
146 Ga0070664_100146153 3300005564 Bacteria 2085
147 Ga0070664_100803504 3300005564 Bacteria 879
148 Ga0068854_100994169 3300005578 Bacteria 742
149 Ga0070702_100026321 3300005615 Bacteria 3125
150 Ga0070702_101892678 3300005615 Bacteria 500
151 Ga0068859_100099798 3300005617 Bacteria 2959
152 Ga0068859_100120409 3300005617 Bacteria 2691
153 Ga0068859_100696812 3300005617 Bacteria 1106
154 Ga0068859_100699678 3300005617 Bacteria 1104
155 Ga0068864_100471159 3300005618 Bacteria 1204
156 Ga0068864_100558295 3300005618 Bacteria 1107
157 Ga0068864_100601003 3300005618 Bacteria 1067
158 Ga0068864_102656113 3300005618 Bacteria 506
159 Ga0068866_10059988 3300005718 Bacteria 1970
160 Ga0068866_10131341 3300005718 Bacteria 1425
161 Ga0068866_10762796 3300005718 Bacteria 669
162 Ga0068861_100080697 3300005719 Bacteria 2545
163 Ga0068861_100219292 3300005719 Bacteria 1607
164 Ga0068861_100272358 3300005719 Bacteria 1454
165 Ga0068861_100898880 3300005719 Bacteria 838
166 Ga0068870_10458936 3300005840 Bacteria 841
167 Ga0068870_10479818 3300005840 Bacteria 825
168 Ga0068863_100187832 3300005841 Bacteria 1985
169 Ga0068863_100583063 3300005841 Bacteria 1106
170 Ga0068863_101216087 3300005841 Bacteria 759
171 Ga0068863_101510799 3300005841 Bacteria 680
172 Ga0068863_101529367 3300005841 Bacteria 676
173 Ga0068858_100093478 3300005842 Bacteria 2799
174 Ga0068858_100471947 3300005842 Bacteria 1210
175 Ga0068858_101223421 3300005842 Bacteria 738
176 Ga0068860_100196329 3300005843 Bacteria 1954
177 Ga0068860_100311033 3300005843 Bacteria 1545
178 Ga0068860_100454918 3300005843 Bacteria 1273
179 Ga0068860_101447303 3300005843 Bacteria 708
180 Ga0068862_100036120 3300005844 Bacteria 4187
181 Ga0068862_100048786 3300005844 Bacteria 3615
182 Ga0068862_100116138 3300005844 Bacteria 2354
183 Ga0068862_100254624 3300005844 Bacteria 1601
184 Ga0068862_101097578 3300005844 Bacteria 791
185 Ga0068862_102686321 3300005844 Bacteria 509
186 Ga0081455_10016837 3300005937 Bacteria 7031
187 Ga0081455_10021723 3300005937 Bacteria 6012
188 Ga0081455_10042464 3300005937 Bacteria 3988
189 Ga0081455_10073390 3300005937 Bacteria 2829
190 Ga0081455_10129323 3300005937 Bacteria 1977
191 Ga0081455_10185745 3300005937 Bacteria 1570
192 Ga0081455_10198181 3300005937 Bacteria 1506
193 Ga0081540_1004156 3300005983 Bacteria 11159
194 Ga0081540_1007064 3300005983 Bacteria 8067
195 Ga0081540_1011715 3300005983 Bacteria 5836
196 Ga0081540_1011971 3300005983 Bacteria 5752
197 Ga0081540_1024072 3300005983 Bacteria 3542
198 Ga0081540_1031192 3300005983 Bacteria 2936
199 Ga0081540_1042121 3300005983 Bacteria 2359
200 Ga0081540_1058408 3300005983 Bacteria 1858
201 Ga0081540_1189996 3300005983 Bacteria 758
202 Ga0081540_1192669 3300005983 Bacteria 750
203 Ga0081540_1222820 3300005983 Bacteria 670
204 Ga0070717_10045340 3300006028 Bacteria 3594
205 Ga0075365_10006317 3300006038 Bacteria 6507
206 Ga0075365_10045720 3300006038 Bacteria 2873
207 Ga0075365_10192420 3300006038 Bacteria 1428
208 Ga0075365_10418385 3300006038 Bacteria 946
209 Ga0075365_10563470 3300006038 Bacteria 806
210 Ga0075368_10309163 3300006042 Bacteria 683
211 Ga0075363_100000323 3300006048 Bacteria 14268
212 Ga0075363_100039432 3300006048 Bacteria 2486
213 Ga0075363_100372025 3300006048 Bacteria 837
214 Ga0075364_10018097 3300006051 Bacteria 4408
215 Ga0075364_11235509 3300006051 Bacteria 506
216 Ga0070715_11012604 3300006163 Bacteria 518
217 Ga0070716_100000563 3300006173 Bacteria 15469
218 Ga0070716_100632194 3300006173 Bacteria 809
219 Ga0070716_101120903 3300006173 Bacteria 628
220 Ga0070712_100018194 3300006175 Bacteria 4560
221 Ga0070712_100470633 3300006175 Bacteria 1049
222 Ga0075362_10081571 3300006177 Bacteria 1491
223 Ga0075367_10007063 3300006178 Bacteria 5723
224 Ga0075367_10013426 3300006178 Bacteria 4402
225 Ga0075369_10006062 3300006186 Bacteria 4555
226 Ga0075369_10127205 3300006186 Bacteria 1156
227 Ga0075369_10255534 3300006186 Bacteria 814
228 Ga0075366_10311282 3300006195 Bacteria 964
229 Ga0097621_100010097 3300006237 Bacteria 6888
230 Ga0097621_100796628 3300006237 Bacteria 875
231 Ga0075370_10009352 3300006353 Bacteria 5086
232 Ga0075370_10010855 3300006353 Bacteria 4774
233 Ga0068871_100122561 3300006358 Bacteria 2197
234 Ga0068871_100140979 3300006358 Bacteria 2050
235 Ga0068871_100646315 3300006358 Bacteria 965
236 Ga0068871_101315770 3300006358 Bacteria 680
237 Ga0075428_100974934 3300006844 Bacteria 898
238 Ga0075433_10953790 3300006852 Bacteria 748
239 Ga0075434_100096621 3300006871 Bacteria 2959
240 Ga0075434_100194277 3300006871 Bacteria 2050
241 Ga0075434_100507075 3300006871 Bacteria 1227
242 Ga0075434_100688011 3300006871 Bacteria 1040
243 Ga0075434_100871026 3300006871 Bacteria 916
244 Ga0068865_100016598 3300006881 Bacteria 4716
245 Ga0068865_100142283 3300006881 Bacteria 1810
246 Ga0075436_100036272 3300006914 Bacteria 3403
247 Ga0075436_100446597 3300006914 Bacteria 941
248 Ga0075436_100817563 3300006914 Bacteria 694
249 Ga0075436_101435460 3300006914 Bacteria 523
250 Ga0097620_100099797 3300006931 Bacteria 2959
251 Ga0097620_100120403 3300006931 Bacteria 2691
252 Ga0097620_100696784 3300006931 Bacteria 1106
253 Ga0097620_100699593 3300006931 Bacteria 1104
254 Ga0099824_1011301 3300006942 Bacteria 10153
255 Ga0099822_1009259 3300006943 Bacteria 12439
256 Ga0075435_100812590 3300007076 Bacteria 814
257 Ga0075435_100829339 3300007076 Bacteria 805
258 Ga0099794_10073505 3300007265 Bacteria 1678
259 Ga0099795_10031628 3300007788 Bacteria 1824
260 Ga0099795_10508302 3300007788 Bacteria 563
261 Ga0105251_10065493 3300009011 Bacteria 1700
262 Ga0105250_10386012 3300009092 Bacteria 619
263 Ga0105240_10202311 3300009093 Bacteria 2327
264 Ga0111539_10123032 3300009094 Bacteria 3041
265 Ga0111539_10249985 3300009094 Bacteria 2065
266 Ga0111539_11423108 3300009094 Unclassified 804
267 Ga0105245_10202696 3300009098 Bacteria 1906
268 Ga0105245_10435988 3300009098 Bacteria 1316
269 Ga0105247_10226896 3300009101 Bacteria 1267
270 Ga0105247_10333711 3300009101 Bacteria 1061
271 Ga0105247_10714208 3300009101 Bacteria 756
272 Ga0105247_11507727 3300009101 Bacteria 548
273 Ga0105243_10015814 3300009148 Bacteria 5707
274 Ga0105243_10046627 3300009148 Bacteria 3410
275 Ga0105243_10402274 3300009148 Bacteria 1272
276 Ga0105243_10700508 3300009148 Bacteria 987
277 Ga0105243_12471298 3300009148 Unclassified 558
278 Ga0105243_12815504 3300009148 Bacteria 527
279 Ga0105241_10195969 3300009174 Bacteria 1684
280 Ga0105241_10457943 3300009174 Bacteria 1129
281 Ga0105241_11461166 3300009174 Bacteria 657
282 Ga0105241_11625912 3300009174 Bacteria 626
283 Ga0105241_11818824 3300009174 Bacteria 595
284 Ga0105241_12570919 3300009174 Bacteria 511
285 Ga0105242_10088851 3300009176 Bacteria 2596
286 Ga0105242_10673523 3300009176 Bacteria 1009
287 Ga0105242_12002808 3300009176 Bacteria 621
288 Ga0105248_10013026 3300009177 Bacteria 9166
289 Ga0105248_10229690 3300009177 Bacteria 2089
290 Ga0105248_10236486 3300009177 Bacteria 2056
291 Ga0105248_10435808 3300009177 Bacteria 1476
292 Ga0105248_11751108 3300009177 Bacteria 704
293 Ga0105237_10141121 3300009545 Bacteria 2403
294 Ga0105237_10254595 3300009545 Bacteria 1758
295 Ga0105237_10439512 3300009545 Bacteria 1310
296 Ga0105237_10911983 3300009545 Bacteria 886
297 Ga0105237_11207269 3300009545 Bacteria 763
298 Ga0105238_10037495 3300009551 Bacteria 4927
299 Ga0105238_10069682 3300009551 Bacteria 3517
300 Ga0105238_10157858 3300009551 Bacteria 2244
301 Ga0105238_10268355 3300009551 Bacteria 1687
302 Ga0105238_11047574 3300009551 Bacteria 837
303 Ga0105238_11227494 3300009551 Bacteria 774
304 Ga0105238_11446845 3300009551 Bacteria 715
305 Ga0105238_12529864 3300009551 Bacteria 549
306 Ga0105249_10017611 3300009553 Bacteria 6344
307 Ga0105249_10145606 3300009553 Bacteria 2276
308 Ga0105249_10956122 3300009553 Bacteria 925
309 Ga0105249_12611099 3300009553 Bacteria 577
310 Ga0099796_10207317 3300010159 Bacteria 798
311 Ga0105239_10055225 3300010375 Bacteria 4356
312 Ga0105239_10185479 3300010375 Bacteria 2328
313 Ga0105239_10187172 3300010375 Bacteria 2317
314 Ga0105239_10249047 3300010375 Bacteria 1995
315 Ga0105239_10253881 3300010375 Bacteria 1975
316 Ga0105239_10618369 3300010375 Bacteria 1236
317 Ga0105239_12725864 3300010375 Bacteria 577
318 Ga0105246_10035343 3300011119 Bacteria 3339
319 Ga0105246_11045372 3300011119 Bacteria 742
320 Ga0105246_11234240 3300011119 Bacteria 690
321 Ga0105246_11680199 3300011119 Bacteria 603
322 Ga0105246_12093803 3300011119 Bacteria 548
323 Ga0157346_1000549 3300012480 Bacteria 1607
324 Ga0157337_1010325 3300012483 Bacteria 720
325 Ga0157322_1007198 3300012490 Bacteria 819
326 Ga0157335_1011247 3300012492 Bacteria 731
327 Ga0157339_1005873 3300012505 Bacteria 984
328 Ga0157369_10462169 3300013105 Bacteria 1314
329 Ga0157374_11303762 3300013296 Bacteria 748
330 Ga0157374_12416185 3300013296 Bacteria 553
331 Ga0157378_10025025 3300013297 Bacteria 5258
332 Ga0157378_10630919 3300013297 Bacteria 1085
333 Ga0157378_10859657 3300013297 Bacteria 936
334 Ga0157378_11355380 3300013297 Bacteria 753
335 Ga0157378_11372372 3300013297 Bacteria 749
336 Ga0163162_10072411 3300013306 Bacteria 3501
337 Ga0163162_10614613 3300013306 Bacteria 1212
338 Ga0163162_10727460 3300013306 Bacteria 1113
339 Ga0163162_10949391 3300013306 Bacteria 971
340 Ga0163162_11246006 3300013306 Bacteria 845
341 Ga0163162_12537606 3300013306 Bacteria 589
342 Ga0157372_10383486 3300013307 Bacteria 1637
343 Ga0157372_11213489 3300013307 Bacteria 871
344 Ga0157372_11526840 3300013307 Bacteria 769
345 Ga0157375_10504102 3300013308 Bacteria 1374
346 Ga0157375_10936020 3300013308 Bacteria 1009
347 Ga0157375_10981988 3300013308 Bacteria 985
348 Ga0157375_11145437 3300013308 Bacteria 911
349 Ga0157375_11801159 3300013308 Bacteria 726
350 Ga0157375_12817263 3300013308 Bacteria 581
351 Ga0157375_13548440 3300013308 Bacteria 519
352 Ga0163163_10030831 3300014325 Bacteria 5171
353 Ga0163163_10833908 3300014325 Bacteria 985
354 Ga0163163_12446828 3300014325 Bacteria 580
355 Ga0163163_12659441 3300014325 Bacteria 558
356 Ga0157380_10041406 3300014326 Bacteria 3595
357 Ga0157380_10050663 3300014326 Bacteria 3281
358 Ga0157380_10133546 3300014326 Bacteria 2121
359 Ga0157380_10149280 3300014326 Bacteria 2018
360 Ga0157380_10161378 3300014326 Bacteria 1949
361 Ga0157377_10381825 3300014745 Bacteria 954
362 Ga0157377_10828728 3300014745 Bacteria 685
363 Ga0157379_10380830 3300014968 Bacteria 1294
364 Ga0157379_10935649 3300014968 Bacteria 824
365 Ga0157379_11735797 3300014968 Bacteria 612
366 Ga0157379_12620311 3300014968 Bacteria 505
367 Ga0157376_10331743 3300014969 Bacteria 1450
368 Ga0157376_10632865 3300014969 Bacteria 1068
369 Ga0157376_10761670 3300014969 Bacteria 978
370 Ga0157376_11382065 3300014969 Bacteria 735
371 Ga0163161_10022389 3300017792 Bacteria 4450
372 Ga0163161_10065384 3300017792 Bacteria 2654
373 Ga0163161_10705973 3300017792 Bacteria 840
374 Ga0209233_1044369 3300025261 Bacteria 941
375 Ga0209564_1006259 3300025295 Bacteria 6491
376 Ga0209758_1001191 3300025297 Bacteria 32851
377 Ga0209758_1014873 3300025297 Bacteria 4089
378 Ga0209758_1017637 3300025297 Bacteria 3541
379 Ga0209758_1182116 3300025297 Bacteria 504
380 Ga0209256_1000102 3300025299 Bacteria 199097
381 Ga0209256_1099012 3300025299 Bacteria 607
382 Ga0207426_1000598 3300025302 Bacteria 47559
383 Ga0207697_10153209 3300025315 Bacteria 1003
384 Ga0207692_10015582 3300025898 Bacteria 3348
385 Ga0207642_10666116 3300025899 Bacteria 653
386 Ga0207710_10243604 3300025900 Bacteria 897
387 Ga0207688_10075210 3300025901 Bacteria 1922
388 Ga0207688_10176629 3300025901 Bacteria 1272
389 Ga0207680_10096262 3300025903 Bacteria 1893
390 Ga0207680_10918689 3300025903 Bacteria 627
391 Ga0207680_11230386 3300025903 Unclassified 534
392 Ga0207647_10165890 3300025904 Bacteria 1287
393 Ga0207685_10018544 3300025905 Bacteria 2274
394 Ga0207685_10048080 3300025905 Bacteria 1632
395 Ga0207699_10021882 3300025906 Bacteria 3455
396 Ga0207645_10666861 3300025907 Bacteria 707
397 Ga0207705_10306961 3300025909 Bacteria 1218
398 Ga0207705_10436326 3300025909 Bacteria 1015
399 Ga0207705_10722427 3300025909 Bacteria 774
400 Ga0207654_10331804 3300025911 Bacteria 1043
401 Ga0207654_10348526 3300025911 Bacteria 1019
402 Ga0207654_10434633 3300025911 Bacteria 918
403 Ga0207707_10923758 3300025912 Bacteria 720
404 Ga0207695_10150989 3300025913 Bacteria 2262
405 Ga0207671_10072995 3300025914 Bacteria 2562
406 Ga0207671_10073056 3300025914 Bacteria 2561
407 Ga0207671_10281962 3300025914 Bacteria 1310
408 Ga0207671_10762931 3300025914 Bacteria 768
409 Ga0207693_10005549 3300025915 Bacteria 10496
410 Ga0207693_10115612 3300025915 Bacteria 2106
411 Ga0207663_11546862 3300025916 Bacteria 534
412 Ga0207660_10862612 3300025917 Bacteria 739
413 Ga0207662_10003182 3300025918 Bacteria 8397
414 Ga0207662_10151602 3300025918 Bacteria 1475
415 Ga0207662_10703506 3300025918 Bacteria 708
416 Ga0207657_10073973 3300025919 Bacteria 2878
417 Ga0207657_10728268 3300025919 Bacteria 769
418 Ga0207649_10479446 3300025920 Bacteria 943
419 Ga0207652_10039247 3300025921 Bacteria 4018
420 Ga0207652_10059294 3300025921 Bacteria 3299
421 Ga0207646_10615970 3300025922 Bacteria 974
422 Ga0207681_10284537 3300025923 Bacteria 1303
423 Ga0207681_10808178 3300025923 Bacteria 783
424 Ga0207681_11222938 3300025923 Bacteria 631
425 Ga0207694_10050280 3300025924 Bacteria 3228
426 Ga0207694_10361631 3300025924 Bacteria 1203
427 Ga0207694_11147127 3300025924 Bacteria 658
428 Ga0207650_10245466 3300025925 Bacteria 1448
429 Ga0207659_10288665 3300025926 Bacteria 1343
430 Ga0207659_11270808 3300025926 Bacteria 632
431 Ga0207687_10042417 3300025927 Bacteria 3130
432 Ga0207700_10002764 3300025928 Bacteria 10112
433 Ga0207664_10016924 3300025929 Bacteria 5332
434 Ga0207644_10130952 3300025931 Bacteria 1920
435 Ga0207644_11059094 3300025931 Bacteria 681
436 Ga0207644_11621711 3300025931 Bacteria 542
437 Ga0207690_10050399 3300025932 Bacteria 2779
438 Ga0207690_10834586 3300025932 Bacteria 762
439 Ga0207690_11586722 3300025932 Bacteria 547
440 Ga0207706_10012295 3300025933 Bacteria 7799
441 Ga0207706_10050537 3300025933 Bacteria 3673
442 Ga0207686_10030297 3300025934 Bacteria 3201
443 Ga0207686_10467286 3300025934 Bacteria 973
444 Ga0207709_10007487 3300025935 Bacteria 6076
445 Ga0207709_10215722 3300025935 Bacteria 1380
446 Ga0207709_11643478 3300025935 Bacteria 534
447 Ga0207709_11800244 3300025935 Bacteria 509
448 Ga0207670_10115693 3300025936 Bacteria 1940
449 Ga0207669_10014385 3300025937 Bacteria 3964
450 Ga0207669_10049666 3300025937 Bacteria 2502
451 Ga0207669_10814320 3300025937 Bacteria 775
452 Ga0207669_11088656 3300025937 Bacteria 674
453 Ga0207704_10491864 3300025938 Bacteria 987
454 Ga0207704_10528053 3300025938 Bacteria 955
455 Ga0207704_10785212 3300025938 Bacteria 794
456 Ga0207704_11662687 3300025938 Bacteria 549
457 Ga0207665_10000555 3300025939 Bacteria 25158
458 Ga0207665_10488952 3300025939 Bacteria 949
459 Ga0207691_10069067 3300025940 Bacteria 3192
460 Ga0207691_10105826 3300025940 Bacteria 2506
461 Ga0207691_10144454 3300025940 Bacteria 2095
462 Ga0207691_10271654 3300025940 Bacteria 1460
463 Ga0207711_10026536 3300025941 Bacteria 4860
464 Ga0207711_10267306 3300025941 Bacteria 1573
465 Ga0207711_10543155 3300025941 Bacteria 1084
466 Ga0207689_10402148 3300025942 Bacteria 1142
467 Ga0207689_10489040 3300025942 Bacteria 1030
468 Ga0207679_10142274 3300025945 Bacteria 1941
469 Ga0207679_10207590 3300025945 Bacteria 1641
470 Ga0207679_11193750 3300025945 Bacteria 698
471 Ga0207679_11242434 3300025945 Bacteria 684
472 Ga0207679_11435495 3300025945 Bacteria 633
473 Ga0207667_10472108 3300025949 Bacteria 1274
474 Ga0207651_10199829 3300025960 Bacteria 1601
475 Ga0207651_11299659 3300025960 Bacteria 654
476 Ga0207712_10038289 3300025961 Bacteria 3278
477 Ga0207712_10047702 3300025961 Bacteria 2975
478 Ga0207712_10634916 3300025961 Bacteria 927
479 Ga0207668_10007777 3300025972 Bacteria 6377
480 Ga0207668_10015011 3300025972 Bacteria 4806
481 Ga0207668_10045606 3300025972 Bacteria 2991
482 Ga0207668_10132483 3300025972 Bacteria 1905
483 Ga0207668_10144188 3300025972 Bacteria 1835
484 Ga0207668_10186843 3300025972 Bacteria 1639
485 Ga0207640_11704675 3300025981 Bacteria 569
486 Ga0207658_10673984 3300025986 Bacteria 933
487 Ga0207658_10752002 3300025986 Bacteria 883
488 Ga0207677_10426608 3300026023 Bacteria 1131
489 Ga0207677_11847223 3300026023 Bacteria 561
490 Ga0207703_10018417 3300026035 Bacteria 5453
491 Ga0207703_12283777 3300026035 Bacteria 517
492 Ga0207639_10211836 3300026041 Bacteria 1668
493 Ga0207639_10326040 3300026041 Bacteria 1365
494 Ga0207639_10519307 3300026041 Bacteria 1090
495 Ga0207639_11043922 3300026041 Bacteria 766
496 Ga0207678_10005293 3300026067 Bacteria 11554
497 Ga0207678_10020358 3300026067 Bacteria 5821
498 Ga0207678_10046189 3300026067 Bacteria 3766
499 Ga0207678_10057323 3300026067 Bacteria 3352
500 Ga0207678_10111727 3300026067 Bacteria 2331
501 Ga0207678_10196208 3300026067 Bacteria 1725
502 Ga0207678_10628178 3300026067 Bacteria 943
503 Ga0207678_10628378 3300026067 Bacteria 943
504 Ga0207678_10967068 3300026067 Bacteria 753
505 Ga0207678_11977380 3300026067 Bacteria 508
506 Ga0207708_10820760 3300026075 Bacteria 801
507 Ga0207708_11667110 3300026075 Bacteria 560
508 Ga0207702_10082103 3300026078 Bacteria 2802
509 Ga0207702_10484655 3300026078 Bacteria 1204
510 Ga0207641_10560464 3300026088 Bacteria 1115
511 Ga0207641_10787587 3300026088 Bacteria 940
512 Ga0207641_11487923 3300026088 Bacteria 679
513 Ga0207641_12303101 3300026088 Bacteria 538
514 Ga0207648_10016432 3300026089 Bacteria 6761
515 Ga0207648_10075073 3300026089 Bacteria 2948
516 Ga0207676_10080166 3300026095 Bacteria 2649
517 Ga0207676_10462347 3300026095 Bacteria 1198
518 Ga0207676_10499052 3300026095 Bacteria 1155
519 Ga0207674_10616628 3300026116 Bacteria 1048
520 Ga0207675_100156219 3300026118 Bacteria 2174
521 Ga0207675_100306765 3300026118 Bacteria 1547
522 Ga0207675_100648730 3300026118 Bacteria 1062
523 Ga0207675_102435852 3300026118 Bacteria 535
524 Ga0207683_10010070 3300026121 Bacteria 8064
525 Ga0207683_10236218 3300026121 Bacteria 1667
526 Ga0207683_10259140 3300026121 Bacteria 1588
527 Ga0207683_10428652 3300026121 Bacteria 1218
528 Ga0207683_10555878 3300026121 Bacteria 1061
529 Ga0207683_11070919 3300026121 Bacteria 748
530 Ga0207698_10875311 3300026142 Bacteria 904
531 Ga0207698_12179178 3300026142 Bacteria 567
532 Ga0209589_1000006 3300027357 Bacteria 436292
533 Ga0209489_100007 3300027361 Bacteria 436292
534 Ga0209700_100008 3300027363 Bacteria 436292
535 Ga0209179_1027039 3300027512 Bacteria 1154
536 Ga0209588_1002310 3300027671 Bacteria 5162
537 Ga0209971_1032898 3300027682 Bacteria 1245
538 Ga0209966_1009527 3300027695 Bacteria 1736
539 Ga0209998_10002200 3300027717 Bacteria 4524
540 Ga0209813_10377447 3300027866 Bacteria 567
541 Ga0268266_10001258 3300028379 Bacteria 30968
542 Ga0268266_10018977 3300028379 Bacteria 5858
543 Ga0268266_10020213 3300028379 Bacteria 5676
544 Ga0268266_10049269 3300028379 Bacteria 3612
545 Ga0268266_10169246 3300028379 Bacteria 1982
546 Ga0268266_10392288 3300028379 Bacteria 1311
547 Ga0268266_10422628 3300028379 Bacteria 1263
548 Ga0268266_10437610 3300028379 Bacteria 1241
549 Ga0268266_11026550 3300028379 Bacteria 798
550 Ga0268266_11098736 3300028379 Bacteria 769
551 Ga0268266_11274456 3300028379 Bacteria 710
552 Ga0268266_11758741 3300028379 Bacteria 595
553 Ga0268265_10121807 3300028380 Bacteria 2150
554 Ga0268265_10331432 3300028380 Bacteria 1382
555 Ga0268265_10678265 3300028380 Bacteria 993
556 Ga0268265_11407338 3300028380 Bacteria 699
557 Ga0268264_10145554 3300028381 Bacteria 2118
558 Ga0268264_10270175 3300028381 Bacteria 1588
559 Ga0268264_10284493 3300028381 Bacteria 1550
560 Ga0268264_10478706 3300028381 Bacteria 1211
561 Ga0307517_10127283 3300028786 Bacteria 1852
562 Ga0307517_10173123 3300028786 Bacteria 1414
563 Ga0307517_10278060 3300028786 Bacteria 957
564 Ga0307515_10489262 3300028794 Bacteria 842
565 Ga0307515_10494632 3300028794 Bacteria 834
566 Ga0307511_10435833 3300030521 Bacteria 524
567 Ga0265332_10133785 3300031238 Bacteria 1040
568 Ga0307513_10147435 3300031456 Bacteria 2269
569 Ga0307513_10671147 3300031456 Bacteria 743
570 Ga0307509_10065201 3300031507 Bacteria 3827
571 Ga0307509_10406868 3300031507 Bacteria 1066
572 Ga0307509_10859531 3300031507 Bacteria 572
573 Ga0307508_10523537 3300031616 Bacteria 782
574 Ga0307516_10564519 3300031730 Bacteria 792
575 Ga0307406_10413738 3300031901 Bacteria 1072
576 Ga0307406_10581586 3300031901 Bacteria 921
577 Ga0307406_12133290 3300031901 Bacteria 502
578 Ga0307412_10265334 3300031911 Bacteria 1341
579 Ga0307412_10736290 3300031911 Bacteria 850
580 Ga0307412_11973203 3300031911 Bacteria 540
581 Ga0307409_100406447 3300031995 Bacteria 1302
582 Ga0307409_101026142 3300031995 Bacteria 844
583 Ga0307416_100091922 3300032002 Bacteria 2608
584 Ga0307510_10032730 3300033180 Bacteria 5854
585 Ga0307510_10056715 3300033180 Bacteria 4074
586 Ga0307510_10212192 3300033180 Bacteria 1457
587 Ga0307510_10318574 3300033180 Bacteria 1013
588 Ga0307510_10345934 3300033180 Bacteria 938
589 Ga0316214_1008956 3300033545 Bacteria 1350
590 Ga0373930_0026702 3300034816 Bacteria 1166
591 Ga0373930_0030034 3300034816 Bacteria 1114
592 Ga0373950_0038362 3300034818 Bacteria 910
593 Ga0373959_0004905 3300034820 Bacteria 2178
594 Ga0373959_0106147 3300034820 Bacteria 673
595 Ga0373938_0007189 3300034957 Bacteria 1952
596 Ga0373928_0210574 3300035084 Bacteria 564
597 Ga0373929_0089955 3300035085 Bacteria 760
598 Ga0373940_0141332 3300035088 Bacteria 761
599 Ga0373940_0248480 3300035088 Bacteria 599
600 Ga0373940_0285668 3300035088 Bacteria 565
601 Ga0373944_0034261 3300035089 Bacteria 1543
602 Ga0373949_0145944 3300035090 Bacteria 681
603 Ga0373951_0008447 3300035091 Bacteria 2326
604 Ga0373951_0028742 3300035091 Bacteria 1304
605 Ga0373951_0107841 3300035091 Bacteria 746
606 Ga0373952_0005797 3300035092 Bacteria 2269
607 Ga0373952_0087476 3300035092 Unclassified 804
608 Ga0373923_0003954 3300035111 Bacteria 4841
609 Ga0373923_0095710 3300035111 Bacteria 1304
610 Ga0373932_0075461 3300035112 Bacteria 1054
611 Ga0373936_0094052 3300035113 Bacteria 1259
612 Ga0373936_0236583 3300035113 Bacteria 813
613 Ga0373939_0006287 3300035114 Bacteria 2857
614 Ga0373939_0009037 3300035114 Bacteria 2460
615 Ga0373939_0175645 3300035114 Bacteria 796
616 Ga0373941_0098228 3300035115 Bacteria 1015
617 Ga0373945_0044391 3300035116 Bacteria 1616
618 Ga0373942_0089317 3300035207 Bacteria 926
619 Ga0373961_0014684 3300035241 Bacteria 1992
620 Ga0373961_0408748 3300035241 Bacteria 522
621 Ga0373962_0070868 3300035242 Bacteria 1041
622 Ga0373931_0148141 3300035691 Bacteria 1366
623 Ga0373931_0340359 3300035691 Bacteria 936
624 Ga0373931_0955163 3300035691 Bacteria 578
625 Ga0373935_0002324 3300035692 Bacteria 10853
626 Ga0373935_0036584 3300035692 Bacteria 3070
627 Ga0373935_0039187 3300035692 Bacteria 2970
628 Ga0373935_0846979 3300035692 Bacteria 676
629 Ga0373927_0008093 3300035695 Bacteria 7095
630 Ga0373927_0022118 3300035695 Bacteria 4166
631 Ga0373927_0085314 3300035695 Bacteria 2049
632 Ga0373933_0148920 3300035724 Bacteria 1481
633 Ga0373947_0023756 3300035725 Bacteria 3568
634 Ga0373947_0646608 3300035725 Bacteria 721
635 Ga0373937_0038440 3300036401 Bacteria 4360
636 Ga0373925_0007949 3300037068 Bacteria 7723
637 Ga0373925_0009375 3300037068 Bacteria 7126
638 Ga0373925_0024726 3300037068 Bacteria 4386
639 Ga0439465_0119163 3300041413 Bacteria 924
640 Ga0451789_1216464 3300041443 Bacteria 541
641 Ga0451800_0559582 3300041459 Bacteria 661
642 Ga0451807_1593632 3300041486 Bacteria 671
643 Ga0451807_2464568 3300041486 Bacteria 517
644 Ga0451843_0098124 3300041509 Bacteria 591
645 Ga0495592_0023961 3300046454 Bacteria 4642
646 Ga0495592_0173537 3300046454 Bacteria 1474
647 Ga0495592_0679713 3300046454 Bacteria 621
648 Ga0495603_0001793 3300046455 Bacteria 12674
649 Ga0495603_0011561 3300046455 Bacteria 5340
650 Ga0495603_0027624 3300046455 Bacteria 3424
651 Ga0495603_0039833 3300046455 Bacteria 2814
652 Ga0495603_0047784 3300046455 Bacteria 2548
653 Ga0495603_0102019 3300046455 Bacteria 1675
654 Ga0495590_0037512 3300046457 Bacteria 1690
655 Ga0495590_0041013 3300046457 Bacteria 1614
656 Ga0495629_0000539 3300046459 Bacteria 31196
657 Ga0495629_0000577 3300046459 Bacteria 29743
658 Ga0495629_0039402 3300046459 Bacteria 3326
659 Ga0495638_0001644 3300046460 Bacteria 19838
660 Ga0495638_0014644 3300046460 Bacteria 5291
661 Ga0495638_0016673 3300046460 Bacteria 4915
662 Ga0495638_0054288 3300046460 Bacteria 2491
663 Ga0495638_0107170 3300046460 Bacteria 1664
664 Ga0495638_0118515 3300046460 Bacteria 1566
665 Ga0495638_0182439 3300046460 Bacteria 1196
666 Ga0495638_0259646 3300046460 Bacteria 953
667 Ga0495641_0005270 3300046461 Bacteria 8794
668 Ga0495651_0003588 3300046462 Bacteria 11903
669 Ga0495653_0095216 3300046463 Bacteria 2168
670 Ga0495653_0312381 3300046463 Bacteria 1021
671 Ga0495653_0823025 3300046463 Bacteria 557
672 Ga0495650_0236519 3300046471 Bacteria 625
673 Ga0495580_0138039 3300046472 Bacteria 1690
674 Ga0495580_0183038 3300046472 Bacteria 1446
675 Ga0495580_0456669 3300046472 Bacteria 857
676 Ga0495580_0748491 3300046472 Bacteria 637
677 Ga0495582_0009685 3300046473 Bacteria 5308
678 Ga0495582_0010926 3300046473 Bacteria 4997
679 Ga0495582_0688375 3300046473 Unclassified 592
680 Ga0495605_0051546 3300046474 Bacteria 2004
681 Ga0495605_0073761 3300046474 Bacteria 1607
682 Ga0495605_0208238 3300046474 Bacteria 850
683 Ga0495605_0314600 3300046474 Bacteria 661
684 Ga0495639_0000442 3300046475 Bacteria 19757
685 Ga0495639_0040298 3300046475 Bacteria 2101
686 Ga0495639_0148784 3300046475 Bacteria 1129
687 Ga0495639_0594951 3300046475 Bacteria 568
688 Ga0495662_0001304 3300046476 Bacteria 12336
689 Ga0495664_0012504 3300046477 Bacteria 4808
690 Ga0495664_0074683 3300046477 Bacteria 2028
691 Ga0495664_0892896 3300046477 Bacteria 520
692 Ga0495584_0011625 3300046491 Bacteria 4508
693 Ga0495584_0189214 3300046491 Bacteria 1046
694 Ga0495584_0273606 3300046491 Bacteria 858
695 Ga0495584_0287706 3300046491 Bacteria 835
696 Ga0495584_0458111 3300046491 Bacteria 649
697 Ga0495585_0064965 3300046492 Bacteria 2000
698 Ga0495585_0087111 3300046492 Bacteria 1686
699 Ga0495585_0105752 3300046492 Bacteria 1501
700 Ga0495585_0159898 3300046492 Bacteria 1169
701 Ga0495585_0209978 3300046492 Bacteria 987
702 Ga0495594_0000326 3300046499 Bacteria 23640
703 Ga0495594_0071264 3300046499 Bacteria 1933
704 Ga0495594_0454991 3300046499 Bacteria 728
705 Ga0495594_0563463 3300046499 Bacteria 646
706 Ga0495594_0647910 3300046499 Unclassified 598
707 Ga0495596_0093580 3300046500 Bacteria 1167
708 Ga0495607_0169161 3300046501 Bacteria 1105
709 Ga0495607_0465917 3300046501 Bacteria 565
710 Ga0495583_0359725 3300046506 Bacteria 574
711 Ga0495606_0013709 3300046507 Bacteria 6382
712 Ga0495606_0386457 3300046507 Bacteria 733
713 Ga0495606_0641863 3300046507 Bacteria 515
714 Ga0495608_0019434 3300046511 Bacteria 4675
715 Ga0495610_0336126 3300046512 Bacteria 572
716 Ga0495616_0123422 3300046513 Bacteria 1193
717 Ga0495616_0285952 3300046513 Bacteria 700
718 Ga0495628_0009768 3300046516 Bacteria 8178
719 Ga0495630_0110500 3300046517 Bacteria 2082
720 Ga0495630_0920200 3300046517 Bacteria 666
721 Ga0495631_0053603 3300046518 Bacteria 1760
722 Ga0495631_0367513 3300046518 Bacteria 612
723 Ga0495632_0004170 3300046519 Bacteria 9902
724 Ga0495632_0023131 3300046519 Bacteria 3322
725 Ga0495632_0298038 3300046519 Bacteria 715
726 Ga0495632_0456611 3300046519 Bacteria 554
727 Ga0495643_0069219 3300046522 Bacteria 1855
728 Ga0495643_0115080 3300046522 Bacteria 1364
729 Ga0495644_0202317 3300046523 Bacteria 766
730 Ga0495644_0249780 3300046523 Bacteria 689
731 Ga0495648_0092234 3300046524 Bacteria 1692
732 Ga0495648_0127215 3300046524 Bacteria 1360
733 Ga0495648_0323829 3300046524 Bacteria 713
734 Ga0495648_0408249 3300046524 Bacteria 605
735 Ga0495663_0217047 3300046525 Bacteria 671
736 Ga0495666_0141126 3300046526 Bacteria 1123
737 Ga0495652_0005812 3300046529 Bacteria 11550
738 Ga0495652_0159818 3300046529 Bacteria 1751
739 Ga0495652_0478401 3300046529 Bacteria 867
740 Ga0495652_0540482 3300046529 Bacteria 803
741 Ga0495654_0332107 3300046530 Bacteria 615
742 Ga0495654_0384822 3300046530 Bacteria 559
743 Ga0495665_0003274 3300046531 Bacteria 8772
744 Ga0495640_0011752 3300046533 Bacteria 6720
745 Ga0495640_0036489 3300046533 Bacteria 3473
746 Ga0495640_0171701 3300046533 Bacteria 1385
747 Ga0495586_0815581 3300046535 Bacteria 538
748 Ga0495587_0006565 3300046536 Bacteria 7574
749 Ga0495598_0013064 3300046537 Bacteria 2051
750 Ga0495609_0091139 3300046538 Bacteria 1326
751 Ga0495609_0116238 3300046538 Bacteria 1152
752 Ga0495609_0135735 3300046538 Bacteria 1052
753 Ga0495621_0059383 3300046539 Bacteria 1385
754 Ga0495645_0028962 3300046543 Bacteria 4025
755 Ga0495645_0079316 3300046543 Bacteria 2358
756 Ga0495622_0019899 3300046557 Bacteria 3124
757 Ga0495622_0029021 3300046557 Bacteria 2585
758 Ga0495622_0120485 3300046557 Bacteria 1198
759 Ga0495633_0099765 3300046558 Bacteria 1348
760 Ga0495667_0005708 3300046559 Bacteria 8424
761 Ga0495667_0027140 3300046559 Bacteria 3860
762 Ga0495667_0451317 3300046559 Bacteria 808
763 Ga0495667_0688386 3300046559 Bacteria 634
764 Ga0495656_0126404 3300046615 Bacteria 1212
765 Ga0495656_0262440 3300046615 Bacteria 875
766 Ga0495656_0814770 3300046615 Bacteria 505
767 Ga0495668_0014912 3300046616 Bacteria 4547
768 Ga0495668_0264759 3300046616 Bacteria 941
769 Ga0495668_0338591 3300046616 Unclassified 825
770 Ga0495668_0619637 3300046616 Bacteria 598
771 Ga0495634_0001414 3300046642 Bacteria 21458
772 Ga0495634_0074278 3300046642 Bacteria 2234
773 Ga0495634_0578343 3300046642 Bacteria 653
774 Ga0495634_0661227 3300046642 Bacteria 603
775 Ga0495611_0018146 3300046648 Bacteria 3015
776 Ga0495611_0144128 3300046648 Bacteria 1112
777 Ga0495611_0312798 3300046648 Bacteria 723
778 Ga0495625_0007793 3300046660 Bacteria 9241
779 Ga0495625_0030003 3300046660 Bacteria 4060
780 Ga0495625_0449562 3300046660 Bacteria 796
781 Ga0495625_0495007 3300046660 Bacteria 748
782 Ga0495635_0007761 3300046663 Bacteria 7491
783 Ga0495635_0541430 3300046663 Bacteria 764
784 Ga0495635_0541447 3300046663 Bacteria 764
785 Ga0495659_0028885 3300046664 Bacteria 1922
786 Ga0495661_0027351 3300046665 Bacteria 3663
787 Ga0495661_0110155 3300046665 Bacteria 1536
788 Ga0495588_0577139 3300046674 Bacteria 589
789 Ga0495657_0006944 3300046675 Bacteria 8790
790 Ga0495657_0169994 3300046675 Bacteria 1343
791 Ga0495657_0732165 3300046675 Bacteria 567
792 Ga0495599_0028210 3300046678 Bacteria 3518
793 Ga0495599_0374280 3300046678 Bacteria 851
794 Ga0495623_0011888 3300046679 Bacteria 5641
795 Ga0495623_0624002 3300046679 Bacteria 558
796 Ga0495646_0009638 3300046680 Bacteria 6132
797 Ga0495646_0015945 3300046680 Bacteria 4769
798 Ga0495646_0431458 3300046680 Bacteria 682
799 Ga0495647_0032935 3300046681 Bacteria 1934
800 Ga0495658_0000944 3300046683 Bacteria 15496
801 Ga0495658_0014805 3300046683 Bacteria 3990
802 Ga0495669_0002768 3300046684 Bacteria 7193
803 Ga0495669_0573594 3300046684 Bacteria 549
804 Ga0495613_0130556 3300046689 Bacteria 1799
805 Ga0495613_0152652 3300046689 Bacteria 1646
806 Ga0495613_0168584 3300046689 Bacteria 1555
807 Ga0495624_0007531 3300046690 Bacteria 7639
808 Ga0495624_0030319 3300046690 Bacteria 3524
809 Ga0495624_0293604 3300046690 Bacteria 981
810 Ga0495670_0076406 3300046691 Bacteria 1702
811 Ga0495670_0437445 3300046691 Bacteria 708
812 Ga0495671_0019101 3300046692 Bacteria 3627
813 Ga0495671_0081664 3300046692 Bacteria 1584
814 Ga0495671_0191911 3300046692 Bacteria 992
815 Ga0495671_0202563 3300046692 Bacteria 962
816 Ga0495649_0024522 3300046694 Bacteria 3364
817 Ga0495649_0125484 3300046694 Bacteria 1356
818 Ga0495649_0232633 3300046694 Bacteria 951
819 Ga0495649_0469649 3300046694 Bacteria 627
820 Ga0495589_0051705 3300046794 Bacteria 2031
821 Ga0495589_0150778 3300046794 Bacteria 1110
822 Ga0495589_0185677 3300046794 Bacteria 985
823 Ga0495589_0348664 3300046794 Bacteria 682
824 Ga0495589_0495876 3300046794 Bacteria 558
825 Ga0495600_0036783 3300046809 Bacteria 3181
826 Ga0495600_0068134 3300046809 Bacteria 2326
827 Ga0495600_0601715 3300046809 Bacteria 668
828 Ga0495660_0177798 3300046810 Bacteria 1032
829 Ga0495660_0191940 3300046810 Bacteria 981
830 Ga0495581_0014473 3300047315 Bacteria 4576
831 Ga0495581_0018644 3300047315 Bacteria 4030
832 Ga0495581_0252600 3300047315 Bacteria 1031
833 Ga0495604_0005487 3300047317 Bacteria 10056
834 Ga0495604_0151962 3300047317 Bacteria 1644
835 Ga0495604_0410472 3300047317 Bacteria 890
836 Ga0495636_0019022 3300047318 Bacteria 2758
837 Ga0495636_0366581 3300047318 Bacteria 682
838 Ga0495674_0000879 3300047319 Bacteria 28789
839 Ga0495674_0011383 3300047319 Bacteria 8397
840 Ga0495672_0019817 3300047320 Bacteria 4426
841 Ga0495672_0083377 3300047320 Bacteria 1776
842 Ga0495676_0151694 3300047321 Bacteria 1648
843 Ga0495676_0443306 3300047321 Bacteria 857
844 Ga0495680_0005531 3300047322 Bacteria 11860
845 Ga0495683_0178678 3300047323 Bacteria 971
846 Ga0495683_0269676 3300047323 Unclassified 740
847 Ga0495683_0285548 3300047323 Bacteria 713
848 Ga0495683_0391077 3300047323 Bacteria 580
849 Ga0495675_0003412 3300047444 Bacteria 9573
850 Ga0495675_0611890 3300047444 Bacteria 617
851 Ga0495677_0076022 3300047445 Bacteria 1255
852 Ga0495677_0155702 3300047445 Bacteria 881
853 Ga0495673_0042897 3300047469 Bacteria 2027
854 Ga0495673_0062561 3300047469 Bacteria 1589
855 Ga0495673_0275995 3300047469 Bacteria 608
856 Ga0495673_0359361 3300047469 Bacteria 513
857 Ga0495684_0026792 3300047471 Bacteria 4430
858 Ga0495686_0049811 3300047472 Bacteria 2634
859 Ga0495686_0067905 3300047472 Bacteria 2200
860 Ga0495686_0084772 3300047472 Bacteria 1931
861 Ga0495686_0123655 3300047472 Bacteria 1540
862 Ga0495686_0165489 3300047472 Bacteria 1289
863 Ga0495686_0348129 3300047472 Bacteria 806
864 Ga0495686_0552429 3300047472 Bacteria 601
865 Ga0495686_0655070 3300047472 Bacteria 539
866 Ga0495593_0001040 3300047673 Bacteria 16301
867 Ga0495593_0049360 3300047673 Bacteria 2233
868 Ga0495593_0108364 3300047673 Bacteria 1420
869 Ga0495602_0010182 3300048088 Bacteria 9761
870 Ga0495602_0148350 3300048088 Bacteria 1847
871 Ga0495614_0081871 3300048089 Bacteria 1399
872 Ga0495614_0188163 3300048089 Bacteria 931
873 Ga0495615_0013752 3300048090 Bacteria 1697
874 Ga0495615_0023431 3300048090 Bacteria 1415
875 Ga0495615_0024238 3300048090 Bacteria 1398
876 Ga0495626_0124557 3300048091 Bacteria 1105
877 Ga0496100_0067588 3300048903 Bacteria 2374
878 Ga0496100_0112857 3300048903 Bacteria 1891
879 Ga0496100_0177351 3300048903 Bacteria 1539
880 Ga0496100_0215194 3300048903 Bacteria 1407
881 Ga0496100_0308312 3300048903 Bacteria 1186
882 Ga0496100_0402640 3300048903 Bacteria 1042
883 Ga0496101_0015603 3300048904 Bacteria 5124
884 Ga0496101_0072428 3300048904 Bacteria 2529
885 Ga0496101_0177683 3300048904 Bacteria 1638
886 Ga0496101_0200192 3300048904 Bacteria 1544
887 Ga0496101_0238268 3300048904 Bacteria 1415
888 Ga0496101_0444724 3300048904 Bacteria 1022
889 Ga0496101_0456974 3300048904 Bacteria 1008
890 Ga0496101_0517466 3300048904 Bacteria 943
891 Ga0496101_0555434 3300048904 Bacteria 908
892 Ga0496101_0994086 3300048904 Bacteria 660
893 Ga0496101_1266610 3300048904 Bacteria 577
894 Ga0496102_0010356 3300048905 Bacteria 8020
895 Ga0496102_0015547 3300048905 Bacteria 6632
896 Ga0496102_0050249 3300048905 Bacteria 3796
897 Ga0496102_0185775 3300048905 Bacteria 1959
898 Ga0496102_0235439 3300048905 Bacteria 1726
899 Ga0496102_0307526 3300048905 Bacteria 1494
900 Ga0496102_0333102 3300048905 Bacteria 1429
901 Ga0496102_1710853 3300048905 Bacteria 547
902 Ga0496103_0005261 3300048906 Bacteria 7766
903 Ga0496103_0218289 3300048906 Bacteria 1226
904 Ga0496103_0677920 3300048906 Bacteria 654
905 Ga0496104_0004592 3300048907 Bacteria 12036
906 Ga0496104_0176863 3300048907 Bacteria 2044
907 Ga0496104_0198630 3300048907 Bacteria 1917
908 Ga0496104_0282867 3300048907 Bacteria 1571
909 Ga0496104_0304780 3300048907 Bacteria 1505
910 Ga0496104_0319554 3300048907 Bacteria 1465
911 Ga0496104_0814694 3300048907 Bacteria 839
912 Ga0496105_0004448 3300048908 Bacteria 10554
913 Ga0496105_0140914 3300048908 Bacteria 1984
914 Ga0496105_0230784 3300048908 Bacteria 1504
915 Ga0496105_0298179 3300048908 Bacteria 1296
916 Ga0496106_0016658 3300048909 Bacteria 5437
917 Ga0496106_0343542 3300048909 Bacteria 1198
918 Ga0496106_0464900 3300048909 Bacteria 1016
919 Ga0496106_0600893 3300048909 Bacteria 881
920 Ga0496106_1249988 3300048909 Bacteria 578
921 Ga0496106_1532342 3300048909 Bacteria 512
922 Ga0496107_0025500 3300048910 Bacteria 4186
923 Ga0496107_0031966 3300048910 Bacteria 3758
924 Ga0496107_0061446 3300048910 Bacteria 2720
925 Ga0496107_0173666 3300048910 Bacteria 1599
926 Ga0496107_0398134 3300048910 Bacteria 1024
927 Ga0496107_0398248 3300048910 Bacteria 1024
928 Ga0496107_0510522 3300048910 Bacteria 891
929 Ga0496107_0578429 3300048910 Bacteria 831
930 Ga0496108_0009122 3300048911 Bacteria 8029
931 Ga0496108_0094501 3300048911 Bacteria 2545
932 Ga0496108_0119119 3300048911 Bacteria 2263
933 Ga0496108_1094298 3300048911 Bacteria 677
934 Ga0496109_0000835 3300048912 Bacteria 25687
935 Ga0496109_0084243 3300048912 Bacteria 2932
936 Ga0496109_0088443 3300048912 Bacteria 2863
937 Ga0496109_0113033 3300048912 Bacteria 2525
938 Ga0496109_0349161 3300048912 Bacteria 1397
939 Ga0496109_1974384 3300048912 Bacteria 516
940 Ga0496110_0004806 3300048913 Bacteria 10522
941 Ga0496110_0216053 3300048913 Bacteria 1743
942 Ga0496110_0673905 3300048913 Bacteria 935
943 Ga0496110_0903764 3300048913 Bacteria 789
944 Ga0496110_1354619 3300048913 Bacteria 621
945 Ga0496110_1786821 3300048913 Bacteria 525
946 Ga0496111_0000843 3300048914 Bacteria 16552
947 Ga0496111_0032370 3300048914 Bacteria 3727
948 Ga0496111_0413295 3300048914 Bacteria 997
949 Ga0496111_0798677 3300048914 Bacteria 683
950 Ga0496112_0006451 3300048915 Bacteria 10297
951 Ga0496112_0337525 3300048915 Bacteria 1450
952 Ga0496112_0337528 3300048915 Bacteria 1450
953 Ga0496112_0489942 3300048915 Bacteria 1165
954 Ga0496112_0572890 3300048915 Bacteria 1062
955 Ga0496112_0637917 3300048915 Bacteria 996
956 Ga0496112_0925186 3300048915 Bacteria 793
957 Ga0496112_1591029 3300048915 Bacteria 567
958 Ga0496112_1693086 3300048915 Bacteria 545
959 Ga0496113_0001943 3300048916 Bacteria 11836
960 Ga0496113_0309389 3300048916 Bacteria 1265
961 Ga0496113_1308100 3300048916 Bacteria 563
962 Ga0496114_0062620 3300048917 Bacteria 3113
963 Ga0496114_0300426 3300048917 Bacteria 1417
964 Ga0496114_0430074 3300048917 Bacteria 1169
965 Ga0496114_0587181 3300048917 Bacteria 983
966 Ga0496114_1072588 3300048917 Bacteria 690
967 Ga0496114_1170964 3300048917 Bacteria 654
968 Ga0496115_0004407 3300048918 Bacteria 10195
969 Ga0496115_0026152 3300048918 Bacteria 4552
970 Ga0496115_0101559 3300048918 Bacteria 2358
971 Ga0496115_0140718 3300048918 Bacteria 1991
972 Ga0496115_0164323 3300048918 Bacteria 1835
973 Ga0496115_0190776 3300048918 Bacteria 1693
974 Ga0496115_0252855 3300048918 Bacteria 1450
975 Ga0496115_0812618 3300048918 Bacteria 727
976 Ga0496117_0057661 3300048920 Bacteria 2695
977 Ga0496117_0122230 3300048920 Bacteria 1597
978 Ga0496118_0008710 3300048921 Bacteria 10424
979 Ga0496118_0034470 3300048921 Bacteria 4129
980 Ga0496118_0154433 3300048921 Bacteria 1431
981 Ga0496121_0000594 3300048924 Bacteria 67953
982 Ga0496121_0002100 3300048924 Bacteria 31362
983 Ga0496121_0184949 3300048924 Bacteria 1499
984 Ga0496121_0255336 3300048924 Bacteria 1213
985 Ga0496121_0391228 3300048924 Bacteria 913
986 Ga0496121_0422811 3300048924 Bacteria 866
987 Ga0496121_0799455 3300048924 Bacteria 554
988 Ga0496124_0276687 3300048927 Bacteria 1226
989 Ga0496124_0310303 3300048927 Bacteria 1135
990 Ga0496125_0013564 3300048928 Bacteria 8004
991 Ga0496125_0298594 3300048928 Bacteria 988
992 Ga0496125_0680239 3300048928 Bacteria 549
993 Ga0496126_0003493 3300048929 Bacteria 19836
994 Ga0496126_0022745 3300048929 Bacteria 6089
995 Ga0496126_0040847 3300048929 Bacteria 4298
996 Ga0496126_0048775 3300048929 Bacteria 3868
997 Ga0496126_0099808 3300048929 Bacteria 2542
998 Ga0496126_0132257 3300048929 Bacteria 2155
999 Ga0496126_0154891 3300048929 Bacteria 1962
1000 Ga0496126_0255447 3300048929 Bacteria 1459
1001 Ga0496126_0283726 3300048929 Bacteria 1371
1002 Ga0496126_0583410 3300048929 Bacteria 883
1003 Ga0496126_0598069 3300048929 Bacteria 869
1004 Ga0496126_0638987 3300048929 Bacteria 834
1005 Ga0496126_0870230 3300048929 Bacteria 686
1006 Ga0496126_0958984 3300048929 Bacteria 644
1007 Ga0496126_1253413 3300048929 Bacteria 542
1008 Ga0496126_1384260 3300048929 Bacteria 508
1009 Ga0495678_157394 3300049459 Bacteria 729
1010 Ga0495682_0067000 3300049460 Bacteria 1294
1011 Ga0495682_0109212 3300049460 Bacteria 991
1012 Ga0495682_0332059 3300049460 Bacteria 536
1013 Ga0495682_0360344 3300049460 Bacteria 512
1014 Ga0501032_0050133 3300049569 Bacteria 2815
1015 Ga0501032_0138768 3300049569 Bacteria 1601
1016 Ga0501032_0219880 3300049569 Bacteria 1236
1017 Ga0501033_0096488 3300049570 Bacteria 2160
1018 Ga0501033_0236782 3300049570 Bacteria 1295
1019 Ga0501033_0901072 3300049570 Unclassified 594
1020 Ga0501034_0031515 3300049571 Bacteria 5384
1021 Ga0501034_0100325 3300049571 Bacteria 2889
1022 Ga0501034_0149236 3300049571 Bacteria 2314
1023 Ga0501036_0032679 3300049572 Bacteria 4398
1024 Ga0501036_0061151 3300049572 Bacteria 3190
1025 Ga0501036_0296881 3300049572 Bacteria 1351
1026 Ga0501037_0009457 3300049573 Bacteria 7155
1027 Ga0501037_0257776 3300049573 Bacteria 1219
1028 Ga0501037_0262473 3300049573 Bacteria 1206
1029 Ga0501038_0025785 3300049574 Bacteria 5237
1030 Ga0501038_0089046 3300049574 Bacteria 2590
1031 Ga0501038_0178929 3300049574 Bacteria 1712
1032 Ga0501039_0015343 3300049575 Bacteria 5864
1033 Ga0501039_0034558 3300049575 Bacteria 3901
1034 Ga0501040_0071467 3300049576 Bacteria 2396
1035 Ga0501040_0331478 3300049576 Bacteria 1089
1036 Ga0501042_0079676 3300049578 Bacteria 2347
1037 Ga0501042_1448505 3300049578 Bacteria 501
1038 Ga0501043_0006016 3300049579 Bacteria 9755
1039 Ga0501043_0027235 3300049579 Bacteria 4488
1040 Ga0501043_0106369 3300049579 Bacteria 2203
1041 Ga0501043_0116471 3300049579 Bacteria 2097
1042 Ga0501043_0282920 3300049579 Bacteria 1271
1043 Ga0501046_0025626 3300049580 Bacteria 4825
1044 Ga0501046_0103928 3300049580 Bacteria 2177
1045 Ga0501047_0012665 3300049581 Bacteria 7990
1046 Ga0501047_0142395 3300049581 Bacteria 2275
1047 Ga0501047_0530447 3300049581 Bacteria 1002
1048 Ga0501048_0175148 3300049582 Bacteria 1520
1049 Ga0501048_0374886 3300049582 Bacteria 1016
1050 Ga0501067_0113603 3300049583 Bacteria 1506
1051 Ga0501067_0255980 3300049583 Bacteria 974
1052 Ga0501067_0659106 3300049583 Bacteria 588
1053 Ga0501068_0022897 3300049584 Bacteria 3657
1054 Ga0501068_0090117 3300049584 Bacteria 1891
1055 Ga0501069_0009123 3300049585 Bacteria 5235
1056 Ga0501069_0143574 3300049585 Bacteria 1370
1057 Ga0501069_0159772 3300049585 Bacteria 1297
1058 Ga0501070_0013556 3300049586 Bacteria 6871
1059 Ga0501070_0128551 3300049586 Bacteria 2093
1060 Ga0501070_0288272 3300049586 Bacteria 1338
1061 Ga0501070_0289767 3300049586 Bacteria 1334
1062 Ga0501070_0359506 3300049586 Bacteria 1181
1063 Ga0501070_0414301 3300049586 Bacteria 1088
1064 Ga0501071_0025103 3300049587 Bacteria 4173
1065 Ga0501071_0071942 3300049587 Bacteria 2521
1066 Ga0501072_0019989 3300049588 Bacteria 5185
1067 Ga0501072_0677639 3300049588 Bacteria 811
1068 Ga0501072_0739585 3300049588 Bacteria 772
1069 Ga0501073_0067179 3300049589 Bacteria 2499
1070 Ga0501073_0279211 3300049589 Bacteria 1152
1071 Ga0501073_0557656 3300049589 Bacteria 791
1072 Ga0501074_0010334 3300049590 Bacteria 6771
1073 Ga0501074_0033573 3300049590 Bacteria 3720
1074 Ga0501074_0119841 3300049590 Bacteria 1882
1075 Ga0501074_0177885 3300049590 Bacteria 1518
1076 Ga0501076_0186970 3300049592 Bacteria 1690
1077 Ga0501077_0203227 3300049593 Bacteria 1259
1078 Ga0501079_0328381 3300049741 Bacteria 1198
1079 Ga0501080_0104956 3300049742 Bacteria 2620
1080 Ga0501080_0158095 3300049742 Bacteria 2093
1081 Ga0501080_0267476 3300049742 Bacteria 1556
1082 Ga0501080_0490721 3300049742 Bacteria 1098
1083 Ga0501080_0710516 3300049742 Bacteria 886
1084 Ga0501081_0578919 3300049743 Bacteria 840
1085 Ga0501083_0086936 3300049744 Bacteria 2067
1086 Ga0501083_0355793 3300049744 Bacteria 952
1087 Ga0501035_0000418 3300049822 Bacteria 47993
1088 Ga0501035_0028100 3300049822 Bacteria 5136
1089 Ga0501035_0174749 3300049822 Bacteria 1853
1090 Ga0501044_0226132 3300049823 Bacteria 1820
1091 Ga0501044_0520939 3300049823 Bacteria 1088
1092 Ga0501045_0275429 3300049824 Bacteria 1253
1093 Ga0501045_0343561 3300049824 Bacteria 1111
1094 Ga0501045_1421143 3300049824 Bacteria 504
1095 nmdc:mga03683_285846_c1 3300050489 Bacteria 771
1096 nmdc:mga03683_61100_c1 3300050489 Bacteria 1592
1097 nmdc:mga03n38_1371_c1 3300050490 Bacteria 6913
1098 nmdc:mga03n38_25831_c1 3300050490 Bacteria 2418
1099 nmdc:mga03n38_288638_c1 3300050490 Bacteria 878
1100 nmdc:mga03n38_545_c1 3300050490 Bacteria 9552
1101 nmdc:mga00v17_1000904_c1 3300050491 Bacteria 526
1102 nmdc:mga00v17_536794_c1 3300050491 Bacteria 757
1103 nmdc:mga0yw44_1029325_c1 3300050492 Bacteria 557
1104 nmdc:mga0yw44_15036_c1 3300050492 Bacteria 4132
1105 nmdc:mga0yw44_1874_c1 3300050492 Bacteria 8651
1106 nmdc:mga0yw44_235748_c1 3300050492 Bacteria 1215
1107 nmdc:mga0yw44_309953_c1 3300050492 Bacteria 1059
1108 nmdc:mga0yw44_746756_c1 3300050492 Bacteria 665
1109 nmdc:mga0k408_231023_c1 3300050493 Bacteria 1104
1110 nmdc:mga06z11_184363_c1 3300050494 Bacteria 1205
1111 nmdc:mga06z11_40864_c1 3300050494 Bacteria 2317
1112 nmdc:mga06z11_551_c1 3300050494 Bacteria 13729
1113 nmdc:mga06z11_7326_c1 3300050494 Bacteria 4534
1114 nmdc:mga04h51_627_c1 3300050495 Bacteria 8282
1115 nmdc:mga07m45_24365_c1 3300050496 Bacteria 2299
1116 nmdc:mga07m45_308415_c1 3300050496 Bacteria 920
1117 nmdc:mga07m45_40863_c1 3300050496 Bacteria 2596
1118 nmdc:mga07m45_826852_c1 3300050496 Bacteria 530
1119 nmdc:mga05p37_5338_c1 3300050507 Bacteria 15091
1120 nmdc:mga08y16_166453_c1 3300050511 Bacteria 2290
1121 nmdc:mga08y16_516083_c1 3300050511 Bacteria 1212
1122 nmdc:mga0n895_10845_c1 3300050512 Bacteria 8087
1123 nmdc:mga0n895_210408_c1 3300050512 Bacteria 1975
1124 nmdc:mga0n895_263341_c1 3300050512 Bacteria 1749
1125 nmdc:mga0n895_5680_c1 3300050512 Bacteria 10457
1126 nmdc:mga0n895_822307_c1 3300050512 Bacteria 918
1127 nmdc:mga0rr50_228834_c1 3300050513 Bacteria 1538
1128 nmdc:mga08x19_1145081_c1 3300050514 Bacteria 552
1129 nmdc:mga08x19_1265291_c1 3300050514 Bacteria 523
1130 nmdc:mga08x19_243156_c1 3300050514 Bacteria 1241
1131 nmdc:mga08x19_401049_c1 3300050514 Bacteria 962
1132 nmdc:mga0a205_6087_c1 3300050515 Bacteria 10880
1133 nmdc:mga0sz30_1059_c3 3300050516 Bacteria 6768
1134 nmdc:mga0sz30_152260_c1 3300050516 Bacteria 1023
1135 nmdc:mga0sz30_226114_c1 3300050516 Bacteria 832
1136 Ga0495601_0307059 3300053077 Bacteria 1033
1137 Ga0495612_0015932 3300053078 Bacteria 3012
1138 Ga0495612_0169295 3300053078 Bacteria 956
1139 Ga0495612_0200620 3300053078 Bacteria 880
1140 Ga0495612_0499169 3300053078 Bacteria 558
1141 Ga0495612_0617592 3300053078 Bacteria 501
1142 Ga0500635_0040778 3300053080 Bacteria 1550
1143 Ga0500635_0065573 3300053080 Bacteria 1277
1144 Ga0495655_0106569 3300053083 Bacteria 837
1145 Ga0495595_0397832 3300053084 Bacteria 698
1146 Ga0495619_0000687 3300053085 Bacteria 22137
1147 Ga0500578_0277678 3300053086 Bacteria 1000
1148 Ga0500643_000707 3300053087 Bacteria 22129
1149 Ga0500643_028539 3300053087 Bacteria 1725
1150 Ga0500643_111515 3300053087 Bacteria 739
1151 Ga0500644_0004606 3300053088 Bacteria 3457
1152 Ga0500644_0068996 3300053088 Bacteria 1268
1153 Ga0500646_0008141 3300053090 Bacteria 2679
1154 Ga0500646_0186287 3300053090 Bacteria 706
1155 Ga0500646_0215488 3300053090 Bacteria 664
1156 Ga0500647_0009309 3300053091 Bacteria 4305
1157 Ga0500583_0051114 3300053092 Bacteria 1919
1158 Ga0500583_0389583 3300053092 Bacteria 670
1159 Ga0500651_0216118 3300053093 Bacteria 1126
1160 Ga0500566_0000007 3300053094 Bacteria 144968
1161 Ga0500566_0001717 3300053094 Bacteria 12864
1162 Ga0500566_0047473 3300053094 Bacteria 2465
1163 Ga0500566_0230177 3300053094 Bacteria 915
1164 Ga0500566_0378002 3300053094 Bacteria 641
1165 Ga0500641_0008115 3300053096 Bacteria 3741
1166 Ga0500650_0072519 3300053098 Bacteria 1610
1167 Ga0500650_0138777 3300053098 Bacteria 1128
1168 Ga0500650_0419718 3300053098 Bacteria 577
1169 Ga0500650_0460751 3300053098 Bacteria 544
1170 Ga0500554_037966 3300053102 Bacteria 1463
1171 Ga0500555_123674 3300053103 Bacteria 645
1172 Ga0500556_0000058 3300053104 Bacteria 114257
1173 Ga0500556_0027483 3300053104 Bacteria 1901
1174 Ga0500556_0125073 3300053104 Bacteria 1005
1175 Ga0500556_0241443 3300053104 Bacteria 711
1176 Ga0500562_001107 3300053108 Bacteria 6624
1177 Ga0500562_001780 3300053108 Bacteria 5384
1178 Ga0500562_017167 3300053108 Bacteria 1864
1179 Ga0500562_124163 3300053108 Unclassified 703
1180 Ga0500569_164372 3300053109 Bacteria 751
1181 Ga0500569_209423 3300053109 Bacteria 663
1182 Ga0500595_000662 3300053119 Bacteria 20656
1183 Ga0500595_004598 3300053119 Bacteria 6156
1184 Ga0500595_026088 3300053119 Bacteria 2017
1185 Ga0500595_129538 3300053119 Bacteria 710
1186 Ga0500607_094919 3300053121 Bacteria 1493
1187 Ga0500614_073661 3300053123 Bacteria 943
1188 Ga0500642_0003271 3300053130 Bacteria 4874
1189 Ga0500642_0087305 3300053130 Bacteria 1439
1190 Ga0500655_028502 3300053133 Bacteria 1069
1191 Ga0500655_040641 3300053133 Bacteria 912
1192 Ga0500658_0007459 3300053134 Bacteria 4043
1193 Ga0500658_0026987 3300053134 Bacteria 2217
1194 Ga0500658_0233695 3300053134 Bacteria 844
1195 Ga0500658_0272354 3300053134 Bacteria 778
1196 Ga0500658_0405159 3300053134 Bacteria 624
1197 Ga0500658_0475436 3300053134 Bacteria 567
1198 Ga0500658_0584526 3300053134 Bacteria 500
1199 Ga0500559_0122344 3300053136 Bacteria 1211
1200 Ga0500559_0181486 3300053136 Bacteria 992
1201 Ga0500561_0210326 3300053137 Bacteria 616
1202 Ga0500568_0062587 3300053139 Bacteria 1437
1203 Ga0500568_0346392 3300053139 Bacteria 539
1204 Ga0500568_0381028 3300053139 Bacteria 511
1205 Ga0500577_0000021 3300053142 Bacteria 43315
1206 Ga0500577_0000172 3300053142 Bacteria 16529
1207 Ga0500577_0085127 3300053142 Bacteria 1268
1208 Ga0500577_0355855 3300053142 Bacteria 640
1209 Ga0500586_001079 3300053145 Bacteria 5629
1210 Ga0500588_0251320 3300053146 Bacteria 664
1211 Ga0500588_0276755 3300053146 Bacteria 633
1212 Ga0500588_0396351 3300053146 Unclassified 526
1213 Ga0500589_060169 3300053147 Bacteria 1742
1214 Ga0500589_237800 3300053147 Bacteria 676
1215 Ga0500590_054911 3300053148 Bacteria 2016
1216 Ga0500590_124874 3300053148 Bacteria 1200
1217 Ga0500603_001079 3300053150 Bacteria 6423
1218 Ga0500603_015891 3300053150 Bacteria 1778
1219 Ga0500603_144887 3300053150 Unclassified 733
1220 Ga0500604_0012298 3300053151 Bacteria 2310
1221 Ga0500616_0011874 3300053153 Bacteria 5120
1222 Ga0500616_0047738 3300053153 Bacteria 2272
1223 Ga0500619_288599 3300053154 Bacteria 532
1224 Ga0500622_0137146 3300053156 Bacteria 1171
1225 Ga0500622_0191046 3300053156 Bacteria 938
1226 Ga0500627_0432317 3300053158 Bacteria 556
1227 Ga0500633_0064998 3300053160 Bacteria 1291
1228 Ga0500633_0117248 3300053160 Bacteria 989
1229 Ga0500633_0244914 3300053160 Bacteria 667
1230 Ga0500634_0374014 3300053161 Bacteria 535
1231 Ga0500638_182891 3300053162 Bacteria 903
1232 Ga0500638_308239 3300053162 Bacteria 607
1233 Ga0500639_018849 3300053163 Bacteria 3641
1234 Ga0500639_030525 3300053163 Bacteria 2849
1235 Ga0500639_147762 3300053163 Bacteria 1088
1236 Ga0500637_0000363 3300053178 Bacteria 17196
1237 Ga0500637_0000556 3300053178 Bacteria 14631
1238 Ga0500637_0001156 3300053178 Bacteria 10943
1239 Ga0500637_0209497 3300053178 Bacteria 1106
1240 Ga0500637_0314433 3300053178 Bacteria 849
1241 Ga0500567_073565 3300053723 Bacteria 1495
1242 Ga0500645_036556 3300053730 Bacteria 1461
1243 Ga0500645_197941 3300053730 Bacteria 543
1244 Ga0500599_000207 3300053736 Bacteria 5486
1245 Ga0500601_023480 3300053737 Bacteria 716
1246 Ga0501084_0080061 3300054114 Bacteria 2739
1247 Ga0501084_0081953 3300054114 Bacteria 2707
1248 Ga0500661_004329 3300055283 Bacteria 2657
1249 Ga0500661_010307 3300055283 Bacteria 1703
1250 Ga0501082_0067703 3300060353 Bacteria 3075
1251 Ga0501082_0088742 3300060353 Bacteria 2668
1252 Ga0530510_0085419 3300061734 Bacteria 2299

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0456669 Ga0495580_0456669_350_670 69
2 3300046499 Ga0495594_0647910 Ga0495594_0647910_114_434 70
3 iso_pu_bacteria 2643221736 2644744060 73
4 3300006173 Ga0070716_100632194 Ga0070716_1006321942 75
5 3300006942 Ga0099824_1011301 Ga0099824_10113015 75
6 3300006943 Ga0099822_1009259 Ga0099822_10092593 75
7 3300013297 Ga0157378_11355380 Ga0157378_113553801 75
8 3300025939 Ga0207665_10488952 Ga0207665_104889522 75
9 3300027357 Ga0209589_1000006 Ga0209589_100000692 75
10 3300027361 Ga0209489_100007 Ga0209489_10000792 75
11 3300027363 Ga0209700_100008 Ga0209700_10000892 75
12 3300028786 Ga0307517_10127283 Ga0307517_101272832 75
13 3300030521 Ga0307511_10435833 Ga0307511_104358332 75
14 3300033180 Ga0307510_10212192 Ga0307510_102121922 75
15 3300033180 Ga0307510_10345934 Ga0307510_103459341 75
16 3300041443 Ga0451789_1216464 Ga0451789_1216464_164_400 75
17 3300046455 Ga0495603_0011561 Ga0495603_0011561_979_1221 75
18 3300046455 Ga0495603_0047784 Ga0495603_0047784_2036_2272 75
19 3300046457 Ga0495590_0037512 Ga0495590_0037512_553_789 75
20 3300046460 Ga0495638_0016673 Ga0495638_0016673_2624_2860 75
21 3300046460 Ga0495638_0054288 Ga0495638_0054288_1141_1377 75
22 3300046491 Ga0495584_0011625 Ga0495584_0011625_250_486 75
23 3300046491 Ga0495584_0273606 Ga0495584_0273606_250_486 75
24 3300046492 Ga0495585_0105752 Ga0495585_0105752_667_903 75
25 3300046492 Ga0495585_0159898 Ga0495585_0159898_135_371 75
26 3300046513 Ga0495616_0123422 Ga0495616_0123422_183_419 75
27 3300046519 Ga0495632_0004170 Ga0495632_0004170_3142_3378 75
28 3300046519 Ga0495632_0023131 Ga0495632_0023131_968_1204 75
29 3300046524 Ga0495648_0092234 Ga0495648_0092234_634_870 75
30 3300046525 Ga0495663_0217047 Ga0495663_0217047_405_641 75
31 3300046537 Ga0495598_0013064 Ga0495598_0013064_385_621 75
32 3300046538 Ga0495609_0116238 Ga0495609_0116238_202_438 75
33 3300046539 Ga0495621_0059383 Ga0495621_0059383_191_427 75
34 3300046558 Ga0495633_0099765 Ga0495633_0099765_667_903 75
35 3300046615 Ga0495656_0262440 Ga0495656_0262440_138_374 75
36 3300046616 Ga0495668_0014912 Ga0495668_0014912_3827_4063 75
37 3300046648 Ga0495611_0018146 Ga0495611_0018146_2087_2323 75
38 3300046660 Ga0495625_0007793 Ga0495625_0007793_3835_4071 75
39 3300046660 Ga0495625_0030003 Ga0495625_0030003_2609_2845 75
40 3300046664 Ga0495659_0028885 Ga0495659_0028885_643_879 75
41 3300046691 Ga0495670_0437445 Ga0495670_0437445_181_417 75
42 3300046692 Ga0495671_0019101 Ga0495671_0019101_2693_2929 75
43 3300046694 Ga0495649_0024522 Ga0495649_0024522_1340_1576 75
44 3300046694 Ga0495649_0469649 Ga0495649_0469649_74_310 75
45 3300046794 Ga0495589_0348664 Ga0495589_0348664_433_669 75
46 3300047318 Ga0495636_0366581 Ga0495636_0366581_400_636 75
47 3300047323 Ga0495683_0178678 Ga0495683_0178678_67_303 75
48 3300047469 Ga0495673_0042897 Ga0495673_0042897_1697_1933 75
49 3300047469 Ga0495673_0359361 Ga0495673_0359361_201_437 75
50 3300047472 Ga0495686_0123655 Ga0495686_0123655_839_1075 75
51 3300048090 Ga0495615_0024238 Ga0495615_0024238_715_951 75
52 3300049460 Ga0495682_0067000 Ga0495682_0067000_917_1153 75
53 3300049460 Ga0495682_0109212 Ga0495682_0109212_473_709 75
54 3300053080 Ga0500635_0040778 Ga0500635_0040778_991_1233 75
55 3300053080 Ga0500635_0065573 Ga0500635_0065573_258_494 75
56 3300053088 Ga0500644_0068996 Ga0500644_0068996_607_843 75
57 3300053093 Ga0500651_0216118 Ga0500651_0216118_722_958 75
58 3300053094 Ga0500566_0230177 Ga0500566_0230177_258_500 75
59 3300053098 Ga0500650_0072519 Ga0500650_0072519_949_1185 75
60 3300053134 Ga0500658_0233695 Ga0500658_0233695_595_831 75
61 3300053134 Ga0500658_0584526 Ga0500658_0584526_55_291 75
62 3300053146 Ga0500588_0251320 Ga0500588_0251320_239_475 75
63 3300053148 Ga0500590_054911 Ga0500590_054911_19_255 75
64 3300053150 Ga0500603_001079 Ga0500603_001079_2514_2756 75
65 3300053150 Ga0500603_144887 Ga0500603_144887_159_395 75
66 3300053158 Ga0500627_0432317 Ga0500627_0432317_146_382 75
67 3300053162 Ga0500638_308239 Ga0500638_308239_65_307 75
68 3300053163 Ga0500639_147762 Ga0500639_147762_93_329 75
69 3300053178 Ga0500637_0000556 Ga0500637_0000556_4312_4548 75
70 3300003215 JGI25153J46596_10002368 JGI25153J46596_100023686 76
71 3300003354 JGI25160J50197_1043164 JGI25160J50197_10431642 76
72 3300003659 JGI25404J52841_10003878 JGI25404J52841_100038782 76
73 3300003659 JGI25404J52841_10029094 JGI25404J52841_100290942 76
74 3300003771 Ga0055526_1096513 Ga0055526_10965131 76
75 3300004625 Ga0055543_1021761 Ga0055543_10217612 76
76 3300005262 Ga0065165_1000972 Ga0065165_100097217 76
77 3300005327 Ga0070658_11298986 Ga0070658_112989861 76
78 3300005336 Ga0070680_100246325 Ga0070680_1002463252 76
79 3300005337 Ga0070682_100731666 Ga0070682_1007316662 76
80 3300005353 Ga0070669_101319339 Ga0070669_1013193391 76
81 3300005366 Ga0070659_101508077 Ga0070659_1015080771 76
82 3300005367 Ga0070667_100532053 Ga0070667_1005320532 76
83 3300005441 Ga0070700_100161700 Ga0070700_1001617002 76
84 3300005455 Ga0070663_100013331 Ga0070663_1000133312 76
85 3300005455 Ga0070663_100373757 Ga0070663_1003737572 76
86 3300005456 Ga0070678_100849457 Ga0070678_1008494572 76
87 3300005458 Ga0070681_10053505 Ga0070681_100535054 76
88 3300005459 Ga0068867_100785675 Ga0068867_1007856752 76
89 3300005530 Ga0070679_100062268 Ga0070679_1000622683 76
90 3300005539 Ga0068853_100303907 Ga0068853_1003039072 76
91 3300005539 Ga0068853_100410778 Ga0068853_1004107782 76
92 3300005547 Ga0070693_100186090 Ga0070693_1001860902 76
93 3300005548 Ga0070665_100011571 Ga0070665_1000115714 76
94 3300005548 Ga0070665_100040475 Ga0070665_1000404755 76
95 3300005548 Ga0070665_100134043 Ga0070665_1001340432 76
96 3300005548 Ga0070665_100195690 Ga0070665_1001956903 76
97 3300005548 Ga0070665_100423681 Ga0070665_1004236812 76
98 3300005548 Ga0070665_101066909 Ga0070665_1010669092 76
99 3300005564 Ga0070664_100803504 Ga0070664_1008035042 76
100 3300005617 Ga0068859_100699678 Ga0068859_1006996782 76
101 3300005618 Ga0068864_100558295 Ga0068864_1005582952 76
102 3300005618 Ga0068864_102656113 Ga0068864_1026561132 76
103 3300005718 Ga0068866_10762796 Ga0068866_107627962 76
104 3300005840 Ga0068870_10458936 Ga0068870_104589362 76
105 3300005841 Ga0068863_101510799 Ga0068863_1015107991 76
106 3300005841 Ga0068863_101529367 Ga0068863_1015293672 76
107 3300005843 Ga0068860_100311033 Ga0068860_1003110333 76
108 3300005844 Ga0068862_100116138 Ga0068862_1001161382 76
109 3300005937 Ga0081455_10073390 Ga0081455_100733902 76
110 3300005937 Ga0081455_10129323 Ga0081455_101293232 76
111 3300005983 Ga0081540_1004156 Ga0081540_10041566 76
112 3300005983 Ga0081540_1007064 Ga0081540_10070645 76
113 3300005983 Ga0081540_1024072 Ga0081540_10240722 76
114 3300005983 Ga0081540_1031192 Ga0081540_10311924 76
115 3300005983 Ga0081540_1042121 Ga0081540_10421212 76
116 3300005983 Ga0081540_1058408 Ga0081540_10584082 76
117 3300005983 Ga0081540_1189996 Ga0081540_11899962 76
118 3300005983 Ga0081540_1192669 Ga0081540_11926692 76
119 3300005983 Ga0081540_1222820 Ga0081540_12228202 76
120 3300006038 Ga0075365_10006317 Ga0075365_100063175 76
121 3300006038 Ga0075365_10045720 Ga0075365_100457203 76
122 3300006038 Ga0075365_10418385 Ga0075365_104183852 76
123 3300006038 Ga0075365_10563470 Ga0075365_105634702 76
124 3300006042 Ga0075368_10309163 Ga0075368_103091632 76
125 3300006048 Ga0075363_100039432 Ga0075363_1000394323 76
126 3300006048 Ga0075363_100372025 Ga0075363_1003720252 76
127 3300006051 Ga0075364_11235509 Ga0075364_112355092 76
128 3300006178 Ga0075367_10013426 Ga0075367_100134262 76
129 3300006186 Ga0075369_10006062 Ga0075369_100060623 76
130 3300006186 Ga0075369_10127205 Ga0075369_101272051 76
131 3300006195 Ga0075366_10311282 Ga0075366_103112822 76
132 3300006353 Ga0075370_10010855 Ga0075370_100108557 76
133 3300006358 Ga0068871_101315770 Ga0068871_1013157702 76
134 3300006871 Ga0075434_100096621 Ga0075434_1000966212 76
135 3300006871 Ga0075434_100871026 Ga0075434_1008710262 76
136 3300006914 Ga0075436_100446597 Ga0075436_1004465972 76
137 3300006931 Ga0097620_100699593 Ga0097620_1006995932 76
138 3300007076 Ga0075435_100812590 Ga0075435_1008125902 76
139 3300009093 Ga0105240_10202311 Ga0105240_102023113 76
140 3300009174 Ga0105241_10457943 Ga0105241_104579431 76
141 3300009174 Ga0105241_11818824 Ga0105241_118188242 76
142 3300009176 Ga0105242_12002808 Ga0105242_120028081 76
143 3300009177 Ga0105248_10229690 Ga0105248_102296902 76
144 3300009545 Ga0105237_10254595 Ga0105237_102545952 76
145 3300009545 Ga0105237_10439512 Ga0105237_104395122 76
146 3300009545 Ga0105237_11207269 Ga0105237_112072691 76
147 3300009551 Ga0105238_10069682 Ga0105238_100696823 76
148 3300009551 Ga0105238_10157858 Ga0105238_101578582 76
149 3300009551 Ga0105238_10268355 Ga0105238_102683553 76
150 3300009551 Ga0105238_11227494 Ga0105238_112274942 76
151 3300009551 Ga0105238_11446845 Ga0105238_114468452 76
152 3300009551 Ga0105238_12529864 Ga0105238_125298642 76
153 3300010375 Ga0105239_10055225 Ga0105239_100552254 76
154 3300010375 Ga0105239_10253881 Ga0105239_102538813 76
155 3300010375 Ga0105239_10618369 Ga0105239_106183691 76
156 3300011119 Ga0105246_11680199 Ga0105246_116801991 76
157 3300013297 Ga0157378_11372372 Ga0157378_113723722 76
158 3300013307 Ga0157372_10383486 Ga0157372_103834862 76
159 3300013308 Ga0157375_11801159 Ga0157375_118011591 76
160 3300014325 Ga0163163_12446828 Ga0163163_124468282 76
161 3300014745 Ga0157377_10828728 Ga0157377_108287282 76
162 3300014969 Ga0157376_10632865 Ga0157376_106328653 76
163 3300014969 Ga0157376_10761670 Ga0157376_107616702 76
164 3300025295 Ga0209564_1006259 Ga0209564_10062593 76
165 3300025297 Ga0209758_1001191 Ga0209758_10011916 76
166 3300025297 Ga0209758_1014873 Ga0209758_10148734 76
167 3300025297 Ga0209758_1017637 Ga0209758_10176374 76
168 3300025297 Ga0209758_1182116 Ga0209758_11821162 76
169 3300025299 Ga0209256_1099012 Ga0209256_10990122 76
170 3300025302 Ga0207426_1000598 Ga0207426_100059827 76
171 3300025899 Ga0207642_10666116 Ga0207642_106661162 76
172 3300025905 Ga0207685_10048080 Ga0207685_100480802 76
173 3300025909 Ga0207705_10436326 Ga0207705_104363261 76
174 3300025909 Ga0207705_10722427 Ga0207705_107224272 76
175 3300025911 Ga0207654_10331804 Ga0207654_103318042 76
176 3300025911 Ga0207654_10348526 Ga0207654_103485261 76
177 3300025912 Ga0207707_10923758 Ga0207707_109237581 76
178 3300025913 Ga0207695_10150989 Ga0207695_101509892 76
179 3300025914 Ga0207671_10073056 Ga0207671_100730562 76
180 3300025914 Ga0207671_10281962 Ga0207671_102819622 76
181 3300025915 Ga0207693_10115612 Ga0207693_101156122 76
182 3300025921 Ga0207652_10039247 Ga0207652_100392474 76
183 3300025924 Ga0207694_10050280 Ga0207694_100502802 76
184 3300025924 Ga0207694_10361631 Ga0207694_103616312 76
185 3300025924 Ga0207694_11147127 Ga0207694_111471272 76
186 3300025932 Ga0207690_11586722 Ga0207690_115867221 76
187 3300025937 Ga0207669_10814320 Ga0207669_108143202 76
188 3300025938 Ga0207704_10528053 Ga0207704_105280533 76
189 3300025940 Ga0207691_10069067 Ga0207691_100690672 76
190 3300025940 Ga0207691_10271654 Ga0207691_102716542 76
191 3300025941 Ga0207711_10543155 Ga0207711_105431552 76
192 3300025945 Ga0207679_10142274 Ga0207679_101422743 76
193 3300025972 Ga0207668_10045606 Ga0207668_100456063 76
194 3300025972 Ga0207668_10132483 Ga0207668_101324833 76
195 3300025986 Ga0207658_10673984 Ga0207658_106739842 76
196 3300026035 Ga0207703_12283777 Ga0207703_122837771 76
197 3300026041 Ga0207639_10326040 Ga0207639_103260402 76
198 3300026041 Ga0207639_11043922 Ga0207639_110439222 76
199 3300026067 Ga0207678_10046189 Ga0207678_100461892 76
200 3300026067 Ga0207678_10196208 Ga0207678_101962082 76
201 3300026067 Ga0207678_10628178 Ga0207678_106281782 76
202 3300026067 Ga0207678_10628378 Ga0207678_106283781 76
203 3300026067 Ga0207678_11977380 Ga0207678_119773802 76
204 3300026075 Ga0207708_11667110 Ga0207708_116671102 76
205 3300026078 Ga0207702_10484655 Ga0207702_104846552 76
206 3300026088 Ga0207641_12303101 Ga0207641_123031012 76
207 3300026095 Ga0207676_10499052 Ga0207676_104990522 76
208 3300026118 Ga0207675_102435852 Ga0207675_1024358522 76
209 3300026121 Ga0207683_10555878 Ga0207683_105558782 76
210 3300026142 Ga0207698_10875311 Ga0207698_108753112 76
211 3300028379 Ga0268266_10018977 Ga0268266_100189774 76
212 3300028379 Ga0268266_10049269 Ga0268266_100492693 76
213 3300028379 Ga0268266_10169246 Ga0268266_101692463 76
214 3300028379 Ga0268266_10422628 Ga0268266_104226282 76
215 3300028379 Ga0268266_11026550 Ga0268266_110265502 76
216 3300028379 Ga0268266_11098736 Ga0268266_110987362 76
217 3300028379 Ga0268266_11758741 Ga0268266_117587412 76
218 3300028381 Ga0268264_10478706 Ga0268264_104787062 76
219 3300028786 Ga0307517_10173123 Ga0307517_101731232 76
220 3300031507 Ga0307509_10859531 Ga0307509_108595312 76
221 3300031901 Ga0307406_12133290 Ga0307406_121332902 76
222 3300031995 Ga0307409_101026142 Ga0307409_1010261422 76
223 3300033180 Ga0307510_10032730 Ga0307510_100327305 76
224 3300033180 Ga0307510_10318574 Ga0307510_103185742 76
225 3300035089 Ga0373944_0034261 Ga0373944_0034261_855_1097 76
226 3300035111 Ga0373923_0003954 Ga0373923_0003954_3605_3847 76
227 3300035691 Ga0373931_0955163 Ga0373931_0955163_19_258 76
228 3300035692 Ga0373935_0039187 Ga0373935_0039187_2601_2843 76
229 3300035695 Ga0373927_0022118 Ga0373927_0022118_2725_2967 76
230 3300037068 Ga0373925_0007949 Ga0373925_0007949_5932_6174 76
231 3300041486 Ga0451807_2464568 Ga0451807_2464568_163_402 76
232 3300041509 Ga0451843_0098124 Ga0451843_0098124_21_263 76
233 3300046454 Ga0495592_0679713 Ga0495592_0679713_372_611 76
234 3300046459 Ga0495629_0039402 Ga0495629_0039402_1007_1249 76
235 3300046460 Ga0495638_0014644 Ga0495638_0014644_4551_4793 76
236 3300046471 Ga0495650_0236519 Ga0495650_0236519_58_297 76
237 3300046472 Ga0495580_0138039 Ga0495580_0138039_629_871 76
238 3300046474 Ga0495605_0051546 Ga0495605_0051546_736_975 76
239 3300046475 Ga0495639_0040298 Ga0495639_0040298_893_1135 76
240 3300046477 Ga0495664_0892896 Ga0495664_0892896_13_255 76
241 3300046491 Ga0495584_0287706 Ga0495584_0287706_397_636 76
242 3300046492 Ga0495585_0064965 Ga0495585_0064965_1105_1344 76
243 3300046501 Ga0495607_0169161 Ga0495607_0169161_141_380 76
244 3300046501 Ga0495607_0465917 Ga0495607_0465917_259_501 76
245 3300046507 Ga0495606_0013709 Ga0495606_0013709_5258_5497 76
246 3300046507 Ga0495606_0386457 Ga0495606_0386457_67_309 76
247 3300046512 Ga0495610_0336126 Ga0495610_0336126_156_395 76
248 3300046513 Ga0495616_0285952 Ga0495616_0285952_32_271 76
249 3300046518 Ga0495631_0053603 Ga0495631_0053603_802_1041 76
250 3300046518 Ga0495631_0367513 Ga0495631_0367513_38_277 76
251 3300046519 Ga0495632_0456611 Ga0495632_0456611_273_515 76
252 3300046522 Ga0495643_0115080 Ga0495643_0115080_262_504 76
253 3300046523 Ga0495644_0202317 Ga0495644_0202317_434_676 76
254 3300046524 Ga0495648_0323829 Ga0495648_0323829_90_332 76
255 3300046524 Ga0495648_0408249 Ga0495648_0408249_185_424 76
256 3300046529 Ga0495652_0159818 Ga0495652_0159818_1454_1693 76
257 3300046533 Ga0495640_0036489 Ga0495640_0036489_1131_1373 76
258 3300046538 Ga0495609_0091139 Ga0495609_0091139_356_595 76
259 3300046538 Ga0495609_0135735 Ga0495609_0135735_650_889 76
260 3300046543 Ga0495645_0079316 Ga0495645_0079316_1462_1704 76
261 3300046557 Ga0495622_0120485 Ga0495622_0120485_191_430 76
262 3300046559 Ga0495667_0451317 Ga0495667_0451317_73_312 76
263 3300046559 Ga0495667_0688386 Ga0495667_0688386_338_580 76
264 3300046615 Ga0495656_0126404 Ga0495656_0126404_533_772 76
265 3300046616 Ga0495668_0619637 Ga0495668_0619637_87_329 76
266 3300046648 Ga0495611_0144128 Ga0495611_0144128_323_562 76
267 3300046660 Ga0495625_0449562 Ga0495625_0449562_498_740 76
268 3300046663 Ga0495635_0541447 Ga0495635_0541447_340_579 76
269 3300046665 Ga0495661_0110155 Ga0495661_0110155_210_449 76
270 3300046674 Ga0495588_0577139 Ga0495588_0577139_118_357 76
271 3300046689 Ga0495613_0168584 Ga0495613_0168584_803_1045 76
272 3300046690 Ga0495624_0030319 Ga0495624_0030319_1380_1622 76
273 3300046690 Ga0495624_0293604 Ga0495624_0293604_664_903 76
274 3300046691 Ga0495670_0076406 Ga0495670_0076406_356_595 76
275 3300046692 Ga0495671_0191911 Ga0495671_0191911_719_961 76
276 3300046692 Ga0495671_0202563 Ga0495671_0202563_517_756 76
277 3300046694 Ga0495649_0125484 Ga0495649_0125484_811_1053 76
278 3300046694 Ga0495649_0232633 Ga0495649_0232633_627_869 76
279 3300046794 Ga0495589_0150778 Ga0495589_0150778_714_953 76
280 3300046794 Ga0495589_0185677 Ga0495589_0185677_225_464 76
281 3300046794 Ga0495589_0495876 Ga0495589_0495876_259_501 76
282 3300046809 Ga0495600_0601715 Ga0495600_0601715_340_579 76
283 3300047315 Ga0495581_0252600 Ga0495581_0252600_112_354 76
284 3300047317 Ga0495604_0151962 Ga0495604_0151962_729_968 76
285 3300047318 Ga0495636_0019022 Ga0495636_0019022_1719_1958 76
286 3300047323 Ga0495683_0391077 Ga0495683_0391077_30_269 76
287 3300047469 Ga0495673_0062561 Ga0495673_0062561_507_746 76
288 3300047469 Ga0495673_0275995 Ga0495673_0275995_121_363 76
289 3300047472 Ga0495686_0049811 Ga0495686_0049811_933_1172 76
290 3300047472 Ga0495686_0084772 Ga0495686_0084772_797_1039 76
291 3300047472 Ga0495686_0165489 Ga0495686_0165489_291_533 76
292 3300047673 Ga0495593_0108364 Ga0495593_0108364_44_283 76
293 3300048090 Ga0495615_0023431 Ga0495615_0023431_1164_1403 76
294 3300048091 Ga0495626_0124557 Ga0495626_0124557_609_848 76
295 3300048903 Ga0496100_0308312 Ga0496100_0308312_908_1147 76
296 3300048904 Ga0496101_0015603 Ga0496101_0015603_155_394 76
297 3300048904 Ga0496101_0200192 Ga0496101_0200192_572_811 76
298 3300048904 Ga0496101_0994086 Ga0496101_0994086_86_325 76
299 3300048904 Ga0496101_1266610 Ga0496101_1266610_236_475 76
300 3300048905 Ga0496102_0010356 Ga0496102_0010356_4512_4751 76
301 3300048905 Ga0496102_0185775 Ga0496102_0185775_1087_1326 76
302 3300048905 Ga0496102_0307526 Ga0496102_0307526_782_1021 76
303 3300048907 Ga0496104_0304780 Ga0496104_0304780_600_839 76
304 3300048907 Ga0496104_0319554 Ga0496104_0319554_45_284 76
305 3300048908 Ga0496105_0230784 Ga0496105_0230784_60_299 76
306 3300048908 Ga0496105_0298179 Ga0496105_0298179_1018_1257 76
307 3300048909 Ga0496106_0464900 Ga0496106_0464900_538_777 76
308 3300048909 Ga0496106_1249988 Ga0496106_1249988_104_343 76
309 3300048910 Ga0496107_0025500 Ga0496107_0025500_3653_3892 76
310 3300048910 Ga0496107_0061446 Ga0496107_0061446_1032_1274 76
311 3300048911 Ga0496108_0094501 Ga0496108_0094501_759_998 76
312 3300048913 Ga0496110_0903764 Ga0496110_0903764_13_252 76
313 3300048913 Ga0496110_1786821 Ga0496110_1786821_243_482 76
314 3300048914 Ga0496111_0413295 Ga0496111_0413295_600_839 76
315 3300048915 Ga0496112_0489942 Ga0496112_0489942_795_1034 76
316 3300048915 Ga0496112_0637917 Ga0496112_0637917_602_841 76
317 3300048915 Ga0496112_0925186 Ga0496112_0925186_415_654 76
318 3300048915 Ga0496112_1591029 Ga0496112_1591029_132_371 76
319 3300048917 Ga0496114_0300426 Ga0496114_0300426_1081_1320 76
320 3300048917 Ga0496114_0430074 Ga0496114_0430074_826_1065 76
321 3300048917 Ga0496114_1072588 Ga0496114_1072588_359_601 76
322 3300048918 Ga0496115_0026152 Ga0496115_0026152_3935_4174 76
323 3300048918 Ga0496115_0140718 Ga0496115_0140718_374_613 76
324 3300048920 Ga0496117_0122230 Ga0496117_0122230_756_995 76
325 3300048921 Ga0496118_0034470 Ga0496118_0034470_948_1187 76
326 3300048924 Ga0496121_0002100 Ga0496121_0002100_5011_5253 76
327 3300048924 Ga0496121_0184949 Ga0496121_0184949_20_259 76
328 3300048924 Ga0496121_0391228 Ga0496121_0391228_599_838 76
329 3300048927 Ga0496124_0276687 Ga0496124_0276687_92_331 76
330 3300048927 Ga0496124_0310303 Ga0496124_0310303_26_265 76
331 3300048928 Ga0496125_0680239 Ga0496125_0680239_34_273 76
332 3300048929 Ga0496126_0003493 Ga0496126_0003493_3711_3953 76
333 3300048929 Ga0496126_0040847 Ga0496126_0040847_2869_3108 76
334 3300048929 Ga0496126_0048775 Ga0496126_0048775_2834_3073 76
335 3300048929 Ga0496126_0099808 Ga0496126_0099808_1703_1945 76
336 3300048929 Ga0496126_0132257 Ga0496126_0132257_150_404 76
337 3300048929 Ga0496126_0154891 Ga0496126_0154891_1074_1316 76
338 3300048929 Ga0496126_0255447 Ga0496126_0255447_562_804 76
339 3300048929 Ga0496126_0283726 Ga0496126_0283726_332_571 76
340 3300048929 Ga0496126_0638987 Ga0496126_0638987_426_665 76
341 3300048929 Ga0496126_0870230 Ga0496126_0870230_295_534 76
342 3300049459 Ga0495678_157394 Ga0495678_157394_300_539 76
343 3300049460 Ga0495682_0332059 Ga0495682_0332059_108_347 76
344 3300049583 Ga0501067_0659106 Ga0501067_0659106_296_535 76
345 3300050489 nmdc:mga03683_61100_c1 nmdc:mga03683_61100_c1_61_303 76
346 3300050490 nmdc:mga03n38_25831_c1 nmdc:mga03n38_25831_c1_492_731 76
347 3300050490 nmdc:mga03n38_288638_c1 nmdc:mga03n38_288638_c1_182_424 76
348 3300050491 nmdc:mga00v17_1000904_c1 nmdc:mga00v17_1000904_c1_65_304 76
349 3300050492 nmdc:mga0yw44_1029325_c1 nmdc:mga0yw44_1029325_c1_173_412 76
350 3300050492 nmdc:mga0yw44_1874_c1 nmdc:mga0yw44_1874_c1_3766_4005 76
351 3300050492 nmdc:mga0yw44_235748_c1 nmdc:mga0yw44_235748_c1_470_709 76
352 3300050492 nmdc:mga0yw44_309953_c1 nmdc:mga0yw44_309953_c1_493_735 76
353 3300050492 nmdc:mga0yw44_746756_c1 nmdc:mga0yw44_746756_c1_165_407 76
354 3300050493 nmdc:mga0k408_231023_c1 nmdc:mga0k408_231023_c1_838_1077 76
355 3300050494 nmdc:mga06z11_184363_c1 nmdc:mga06z11_184363_c1_912_1151 76
356 3300050494 nmdc:mga06z11_40864_c1 nmdc:mga06z11_40864_c1_623_865 76
357 3300050496 nmdc:mga07m45_308415_c1 nmdc:mga07m45_308415_c1_464_703 76
358 3300050496 nmdc:mga07m45_40863_c1 nmdc:mga07m45_40863_c1_1648_1890 76
359 3300050496 nmdc:mga07m45_826852_c1 nmdc:mga07m45_826852_c1_86_325 76
360 3300050512 nmdc:mga0n895_5680_c1 nmdc:mga0n895_5680_c1_7674_7913 76
361 3300050512 nmdc:mga0n895_822307_c1 nmdc:mga0n895_822307_c1_574_813 76
362 3300050514 nmdc:mga08x19_401049_c1 nmdc:mga08x19_401049_c1_83_322 76
363 3300050516 nmdc:mga0sz30_1059_c3 nmdc:mga0sz30_1059_c3_2423_2662 76
364 3300050516 nmdc:mga0sz30_226114_c1 nmdc:mga0sz30_226114_c1_95_337 76
365 3300053078 Ga0495612_0015932 Ga0495612_0015932_29_271 76
366 3300053078 Ga0495612_0200620 Ga0495612_0200620_520_762 76
367 3300053086 Ga0500578_0277678 Ga0500578_0277678_650_892 76
368 3300053092 Ga0500583_0389583 Ga0500583_0389583_331_570 76
369 3300053094 Ga0500566_0001717 Ga0500566_0001717_9841_10080 76
370 3300053096 Ga0500641_0008115 Ga0500641_0008115_911_1153 76
371 3300053102 Ga0500554_037966 Ga0500554_037966_390_635 76
372 3300053104 Ga0500556_0241443 Ga0500556_0241443_447_689 76
373 3300053108 Ga0500562_001107 Ga0500562_001107_1670_1912 76
374 3300053130 Ga0500642_0003271 Ga0500642_0003271_4555_4794 76
375 3300053133 Ga0500655_028502 Ga0500655_028502_219_461 76
376 3300053134 Ga0500658_0272354 Ga0500658_0272354_402_644 76
377 3300053136 Ga0500559_0181486 Ga0500559_0181486_624_863 76
378 3300053142 Ga0500577_0085127 Ga0500577_0085127_642_884 76
379 3300053146 Ga0500588_0276755 Ga0500588_0276755_263_505 76
380 3300053153 Ga0500616_0047738 Ga0500616_0047738_750_992 76
381 3300053154 Ga0500619_288599 Ga0500619_288599_29_268 76
382 3300053156 Ga0500622_0191046 Ga0500622_0191046_540_782 76
383 3300053160 Ga0500633_0064998 Ga0500633_0064998_247_489 76
384 3300053178 Ga0500637_0209497 Ga0500637_0209497_347_592 76
385 3300053730 Ga0500645_197941 Ga0500645_197941_139_381 76
386 3300053736 Ga0500599_000207 Ga0500599_000207_1860_2102 76
387 3300055283 Ga0500661_004329 Ga0500661_004329_752_1045 76
388 3300055283 Ga0500661_010307 Ga0500661_010307_806_1045 76
389 3300003911 JGI25405J52794_10037902 JGI25405J52794_100379021 77
390 3300005330 Ga0070690_100532591 Ga0070690_1005325912 77
391 3300005335 Ga0070666_11350868 Ga0070666_113508681 77
392 3300005339 Ga0070660_101161094 Ga0070660_1011610942 77
393 3300005341 Ga0070691_10781627 Ga0070691_107816271 77
394 3300005343 Ga0070687_100166402 Ga0070687_1001664022 77
395 3300005343 Ga0070687_100694339 Ga0070687_1006943392 77
396 3300005347 Ga0070668_100005808 Ga0070668_1000058083 77
397 3300005347 Ga0070668_100194739 Ga0070668_1001947392 77
398 3300005347 Ga0070668_100212540 Ga0070668_1002125402 77
399 3300005353 Ga0070669_100775238 Ga0070669_1007752382 77
400 3300005356 Ga0070674_100031213 Ga0070674_1000312133 77
401 3300005356 Ga0070674_100437412 Ga0070674_1004374122 77
402 3300005364 Ga0070673_101517473 Ga0070673_1015174731 77
403 3300005365 Ga0070688_101293051 Ga0070688_1012930511 77
404 3300005366 Ga0070659_100477303 Ga0070659_1004773032 77
405 3300005367 Ga0070667_100073874 Ga0070667_1000738743 77
406 3300005435 Ga0070714_100036455 Ga0070714_1000364553 77
407 3300005438 Ga0070701_10154421 Ga0070701_101544212 77
408 3300005444 Ga0070694_100265391 Ga0070694_1002653912 77
409 3300005444 Ga0070694_100724769 Ga0070694_1007247692 77
410 3300005455 Ga0070663_100091272 Ga0070663_1000912722 77
411 3300005455 Ga0070663_100120186 Ga0070663_1001201862 77
412 3300005456 Ga0070678_100197182 Ga0070678_1001971822 77
413 3300005456 Ga0070678_101289911 Ga0070678_1012899112 77
414 3300005457 Ga0070662_101349901 Ga0070662_1013499012 77
415 3300005459 Ga0068867_100032452 Ga0068867_1000324523 77
416 3300005459 Ga0068867_100113282 Ga0068867_1001132823 77
417 3300005466 Ga0070685_10077747 Ga0070685_100777473 77
418 3300005467 Ga0070706_100184868 Ga0070706_1001848681 77
419 3300005468 Ga0070707_100774472 Ga0070707_1007744721 77
420 3300005543 Ga0070672_100129326 Ga0070672_1001293262 77
421 3300005544 Ga0070686_100183250 Ga0070686_1001832501 77
422 3300005544 Ga0070686_101252157 Ga0070686_1012521572 77
423 3300005548 Ga0070665_100805195 Ga0070665_1008051952 77
424 3300005615 Ga0070702_100026321 Ga0070702_1000263213 77
425 3300005615 Ga0070702_101892678 Ga0070702_1018926782 77
426 3300005617 Ga0068859_100696812 Ga0068859_1006968122 77
427 3300005718 Ga0068866_10131341 Ga0068866_101313412 77
428 3300005719 Ga0068861_100080697 Ga0068861_1000806972 77
429 3300005719 Ga0068861_100272358 Ga0068861_1002723582 77
430 3300005840 Ga0068870_10479818 Ga0068870_104798182 77
431 3300005841 Ga0068863_100187832 Ga0068863_1001878323 77
432 3300005842 Ga0068858_100471947 Ga0068858_1004719472 77
433 3300005843 Ga0068860_100454918 Ga0068860_1004549182 77
434 3300005844 Ga0068862_100036120 Ga0068862_1000361203 77
435 3300005844 Ga0068862_100254624 Ga0068862_1002546242 77
436 3300005844 Ga0068862_101097578 Ga0068862_1010975782 77
437 3300005844 Ga0068862_102686321 Ga0068862_1026863212 77
438 3300005937 Ga0081455_10016837 Ga0081455_100168372 77
439 3300005937 Ga0081455_10021723 Ga0081455_100217233 77
440 3300005937 Ga0081455_10198181 Ga0081455_101981812 77
441 3300005983 Ga0081540_1011715 Ga0081540_10117152 77
442 3300005983 Ga0081540_1011971 Ga0081540_10119714 77
443 3300006163 Ga0070715_11012604 Ga0070715_110126042 77
444 3300006177 Ga0075362_10081571 Ga0075362_100815712 77
445 3300006358 Ga0068871_100646315 Ga0068871_1006463152 77
446 3300006844 Ga0075428_100974934 Ga0075428_1009749342 77
447 3300006881 Ga0068865_100016598 Ga0068865_1000165982 77
448 3300006931 Ga0097620_100696784 Ga0097620_1006967842 77
449 3300007265 Ga0099794_10073505 Ga0099794_100735052 77
450 3300007788 Ga0099795_10031628 Ga0099795_100316283 77
451 3300007788 Ga0099795_10508302 Ga0099795_105083022 77
452 3300009094 Ga0111539_10123032 Ga0111539_101230322 77
453 3300009094 Ga0111539_10249985 Ga0111539_102499852 77
454 3300009098 Ga0105245_10202696 Ga0105245_102026963 77
455 3300009101 Ga0105247_10226896 Ga0105247_102268962 77
456 3300009148 Ga0105243_10015814 Ga0105243_100158146 77
457 3300009148 Ga0105243_10402274 Ga0105243_104022742 77
458 3300009148 Ga0105243_10700508 Ga0105243_107005082 77
459 3300009148 Ga0105243_12815504 Ga0105243_128155041 77
460 3300009174 Ga0105241_12570919 Ga0105241_125709192 77
461 3300009176 Ga0105242_10673523 Ga0105242_106735231 77
462 3300009177 Ga0105248_10435808 Ga0105248_104358082 77
463 3300009553 Ga0105249_10017611 Ga0105249_100176115 77
464 3300009553 Ga0105249_10145606 Ga0105249_101456061 77
465 3300010159 Ga0099796_10207317 Ga0099796_102073173 77
466 3300010375 Ga0105239_10187172 Ga0105239_101871722 77
467 3300010375 Ga0105239_10249047 Ga0105239_102490472 77
468 3300011119 Ga0105246_11234240 Ga0105246_112342401 77
469 3300012480 Ga0157346_1000549 Ga0157346_10005493 77
470 3300013297 Ga0157378_10859657 Ga0157378_108596572 77
471 3300013306 Ga0163162_10072411 Ga0163162_100724113 77
472 3300013306 Ga0163162_10614613 Ga0163162_106146132 77
473 3300013306 Ga0163162_10949391 Ga0163162_109493912 77
474 3300013306 Ga0163162_11246006 Ga0163162_112460062 77
475 3300013308 Ga0157375_10936020 Ga0157375_109360202 77
476 3300013308 Ga0157375_11145437 Ga0157375_111454372 77
477 3300013308 Ga0157375_12817263 Ga0157375_128172631 77
478 3300014326 Ga0157380_10041406 Ga0157380_100414063 77
479 3300014326 Ga0157380_10050663 Ga0157380_100506632 77
480 3300014326 Ga0157380_10133546 Ga0157380_101335463 77
481 3300014326 Ga0157380_10161378 Ga0157380_101613782 77
482 3300014968 Ga0157379_10935649 Ga0157379_109356492 77
483 3300014968 Ga0157379_12620311 Ga0157379_126203112 77
484 3300014969 Ga0157376_10331743 Ga0157376_103317432 77
485 3300017792 Ga0163161_10022389 Ga0163161_100223892 77
486 3300017792 Ga0163161_10065384 Ga0163161_100653843 77
487 3300025261 Ga0209233_1044369 Ga0209233_10443692 77
488 3300025315 Ga0207697_10153209 Ga0207697_101532092 77
489 3300025901 Ga0207688_10075210 Ga0207688_100752103 77
490 3300025901 Ga0207688_10176629 Ga0207688_101766292 77
491 3300025903 Ga0207680_10918689 Ga0207680_109186892 77
492 3300025907 Ga0207645_10666861 Ga0207645_106668612 77
493 3300025909 Ga0207705_10306961 Ga0207705_103069612 77
494 3300025916 Ga0207663_11546862 Ga0207663_115468622 77
495 3300025918 Ga0207662_10151602 Ga0207662_101516022 77
496 3300025918 Ga0207662_10703506 Ga0207662_107035062 77
497 3300025919 Ga0207657_10728268 Ga0207657_107282682 77
498 3300025922 Ga0207646_10615970 Ga0207646_106159703 77
499 3300025923 Ga0207681_10808178 Ga0207681_108081782 77
500 3300025923 Ga0207681_11222938 Ga0207681_112229381 77
501 3300025929 Ga0207664_10016924 Ga0207664_100169245 77
502 3300025931 Ga0207644_11059094 Ga0207644_110590942 77
503 3300025932 Ga0207690_10834586 Ga0207690_108345862 77
504 3300025934 Ga0207686_10467286 Ga0207686_104672862 77
505 3300025935 Ga0207709_10007487 Ga0207709_100074872 77
506 3300025935 Ga0207709_10215722 Ga0207709_102157222 77
507 3300025935 Ga0207709_11643478 Ga0207709_116434782 77
508 3300025935 Ga0207709_11800244 Ga0207709_118002442 77
509 3300025937 Ga0207669_10014385 Ga0207669_100143853 77
510 3300025937 Ga0207669_10049666 Ga0207669_100496662 77
511 3300025938 Ga0207704_10491864 Ga0207704_104918642 77
512 3300025938 Ga0207704_11662687 Ga0207704_116626872 77
513 3300025940 Ga0207691_10144454 Ga0207691_101444542 77
514 3300025941 Ga0207711_10267306 Ga0207711_102673062 77
515 3300025945 Ga0207679_11193750 Ga0207679_111937502 77
516 3300025960 Ga0207651_11299659 Ga0207651_112996592 77
517 3300025961 Ga0207712_10038289 Ga0207712_100382893 77
518 3300025961 Ga0207712_10047702 Ga0207712_100477022 77
519 3300025972 Ga0207668_10007777 Ga0207668_100077773 77
520 3300025972 Ga0207668_10015011 Ga0207668_100150113 77
521 3300025972 Ga0207668_10144188 Ga0207668_101441882 77
522 3300025981 Ga0207640_11704675 Ga0207640_117046751 77
523 3300026023 Ga0207677_11847223 Ga0207677_118472232 77
524 3300026041 Ga0207639_10519307 Ga0207639_105193072 77
525 3300026067 Ga0207678_10057323 Ga0207678_100573233 77
526 3300026067 Ga0207678_10111727 Ga0207678_101117272 77
527 3300026067 Ga0207678_10967068 Ga0207678_109670682 77
528 3300026088 Ga0207641_11487923 Ga0207641_114879232 77
529 3300026089 Ga0207648_10016432 Ga0207648_100164326 77
530 3300026089 Ga0207648_10075073 Ga0207648_100750732 77
531 3300026116 Ga0207674_10616628 Ga0207674_106166282 77
532 3300026118 Ga0207675_100306765 Ga0207675_1003067652 77
533 3300026121 Ga0207683_10259140 Ga0207683_102591402 77
534 3300026121 Ga0207683_10428652 Ga0207683_104286523 77
535 3300026121 Ga0207683_11070919 Ga0207683_110709192 77
536 3300026142 Ga0207698_12179178 Ga0207698_121791782 77
537 3300027512 Ga0209179_1027039 Ga0209179_10270393 77
538 3300027671 Ga0209588_1002310 Ga0209588_10023106 77
539 3300028379 Ga0268266_11274456 Ga0268266_112744562 77
540 3300028380 Ga0268265_10331432 Ga0268265_103314322 77
541 3300028380 Ga0268265_10678265 Ga0268265_106782652 77
542 3300028380 Ga0268265_11407338 Ga0268265_114073382 77
543 3300028381 Ga0268264_10270175 Ga0268264_102701753 77
544 3300028786 Ga0307517_10278060 Ga0307517_102780602 77
545 3300028794 Ga0307515_10489262 Ga0307515_104892621 77
546 3300028794 Ga0307515_10494632 Ga0307515_104946321 77
547 3300031456 Ga0307513_10147435 Ga0307513_101474353 77
548 3300031456 Ga0307513_10671147 Ga0307513_106711472 77
549 3300031507 Ga0307509_10065201 Ga0307509_100652013 77
550 3300031507 Ga0307509_10406868 Ga0307509_104068682 77
551 3300031616 Ga0307508_10523537 Ga0307508_105235372 77
552 3300031730 Ga0307516_10564519 Ga0307516_105645192 77
553 3300031901 Ga0307406_10413738 Ga0307406_104137382 77
554 3300031901 Ga0307406_10581586 Ga0307406_105815862 77
555 3300031911 Ga0307412_10265334 Ga0307412_102653343 77
556 3300031911 Ga0307412_10736290 Ga0307412_107362902 77
557 3300031911 Ga0307412_11973203 Ga0307412_119732032 77
558 3300031995 Ga0307409_100406447 Ga0307409_1004064472 77
559 3300032002 Ga0307416_100091922 Ga0307416_1000919222 77
560 3300033180 Ga0307510_10056715 Ga0307510_100567153 77
561 3300033545 Ga0316214_1008956 Ga0316214_10089562 77
562 3300035088 Ga0373940_0248480 Ga0373940_0248480_175_420 77
563 3300035113 Ga0373936_0094052 Ga0373936_0094052_885_1130 77
564 3300035116 Ga0373945_0044391 Ga0373945_0044391_611_856 77
565 3300035692 Ga0373935_0002324 Ga0373935_0002324_8459_8704 77
566 3300035695 Ga0373927_0008093 Ga0373927_0008093_5056_5301 77
567 3300035724 Ga0373933_0148920 Ga0373933_0148920_772_1017 77
568 3300035725 Ga0373947_0023756 Ga0373947_0023756_204_449 77
569 3300035725 Ga0373947_0646608 Ga0373947_0646608_437_694 77
570 3300036401 Ga0373937_0038440 Ga0373937_0038440_1514_1759 77
571 3300037068 Ga0373925_0009375 Ga0373925_0009375_6600_6845 77
572 3300041413 Ga0439465_0119163 Ga0439465_0119163_43_288 77
573 3300041459 Ga0451800_0559582 Ga0451800_0559582_268_525 77
574 3300041486 Ga0451807_1593632 Ga0451807_1593632_200_442 77
575 3300046454 Ga0495592_0023961 Ga0495592_0023961_1521_1766 77
576 3300046454 Ga0495592_0173537 Ga0495592_0173537_705_950 77
577 3300046455 Ga0495603_0001793 Ga0495603_0001793_1593_1838 77
578 3300046455 Ga0495603_0027624 Ga0495603_0027624_2378_2635 77
579 3300046457 Ga0495590_0041013 Ga0495590_0041013_416_661 77
580 3300046459 Ga0495629_0000539 Ga0495629_0000539_12723_12968 77
581 3300046460 Ga0495638_0001644 Ga0495638_0001644_8208_8453 77
582 3300046460 Ga0495638_0107170 Ga0495638_0107170_76_321 77
583 3300046460 Ga0495638_0118515 Ga0495638_0118515_1277_1522 77
584 3300046460 Ga0495638_0259646 Ga0495638_0259646_301_546 77
585 3300046461 Ga0495641_0005270 Ga0495641_0005270_2922_3167 77
586 3300046462 Ga0495651_0003588 Ga0495651_0003588_5079_5324 77
587 3300046463 Ga0495653_0095216 Ga0495653_0095216_602_847 77
588 3300046463 Ga0495653_0312381 Ga0495653_0312381_71_316 77
589 3300046463 Ga0495653_0823025 Ga0495653_0823025_34_279 77
590 3300046472 Ga0495580_0183038 Ga0495580_0183038_492_737 77
591 3300046472 Ga0495580_0748491 Ga0495580_0748491_124_381 77
592 3300046473 Ga0495582_0010926 Ga0495582_0010926_1688_1933 77
593 3300046473 Ga0495582_0688375 Ga0495582_0688375_279_542 77
594 3300046474 Ga0495605_0073761 Ga0495605_0073761_109_354 77
595 3300046474 Ga0495605_0208238 Ga0495605_0208238_504_749 77
596 3300046474 Ga0495605_0314600 Ga0495605_0314600_171_416 77
597 3300046475 Ga0495639_0000442 Ga0495639_0000442_17383_17628 77
598 3300046475 Ga0495639_0148784 Ga0495639_0148784_342_599 77
599 3300046476 Ga0495662_0001304 Ga0495662_0001304_11733_11978 77
600 3300046477 Ga0495664_0012504 Ga0495664_0012504_3340_3585 77
601 3300046477 Ga0495664_0074683 Ga0495664_0074683_491_736 77
602 3300046491 Ga0495584_0189214 Ga0495584_0189214_747_992 77
603 3300046491 Ga0495584_0458111 Ga0495584_0458111_218_463 77
604 3300046492 Ga0495585_0087111 Ga0495585_0087111_461_706 77
605 3300046492 Ga0495585_0209978 Ga0495585_0209978_380_625 77
606 3300046499 Ga0495594_0000326 Ga0495594_0000326_4005_4250 77
607 3300046499 Ga0495594_0071264 Ga0495594_0071264_1042_1308 77
608 3300046499 Ga0495594_0454991 Ga0495594_0454991_100_345 77
609 3300046500 Ga0495596_0093580 Ga0495596_0093580_388_633 77
610 3300046506 Ga0495583_0359725 Ga0495583_0359725_231_476 77
611 3300046507 Ga0495606_0641863 Ga0495606_0641863_106_372 77
612 3300046511 Ga0495608_0019434 Ga0495608_0019434_1145_1390 77
613 3300046516 Ga0495628_0009768 Ga0495628_0009768_4823_5068 77
614 3300046517 Ga0495630_0110500 Ga0495630_0110500_271_516 77
615 3300046517 Ga0495630_0920200 Ga0495630_0920200_117_362 77
616 3300046519 Ga0495632_0298038 Ga0495632_0298038_106_351 77
617 3300046522 Ga0495643_0069219 Ga0495643_0069219_1429_1674 77
618 3300046523 Ga0495644_0249780 Ga0495644_0249780_103_348 77
619 3300046524 Ga0495648_0127215 Ga0495648_0127215_137_382 77
620 3300046526 Ga0495666_0141126 Ga0495666_0141126_212_457 77
621 3300046529 Ga0495652_0005812 Ga0495652_0005812_7661_7906 77
622 3300046529 Ga0495652_0478401 Ga0495652_0478401_107_352 77
623 3300046529 Ga0495652_0540482 Ga0495652_0540482_215_460 77
624 3300046530 Ga0495654_0332107 Ga0495654_0332107_16_261 77
625 3300046530 Ga0495654_0384822 Ga0495654_0384822_31_282 77
626 3300046531 Ga0495665_0003274 Ga0495665_0003274_2969_3214 77
627 3300046533 Ga0495640_0011752 Ga0495640_0011752_1965_2210 77
628 3300046533 Ga0495640_0171701 Ga0495640_0171701_239_484 77
629 3300046535 Ga0495586_0815581 Ga0495586_0815581_136_381 77
630 3300046536 Ga0495587_0006565 Ga0495587_0006565_3479_3724 77
631 3300046543 Ga0495645_0028962 Ga0495645_0028962_3402_3647 77
632 3300046557 Ga0495622_0019899 Ga0495622_0019899_2796_3041 77
633 3300046557 Ga0495622_0029021 Ga0495622_0029021_2103_2369 77
634 3300046559 Ga0495667_0005708 Ga0495667_0005708_3479_3724 77
635 3300046559 Ga0495667_0027140 Ga0495667_0027140_889_1134 77
636 3300046615 Ga0495656_0814770 Ga0495656_0814770_219_464 77
637 3300046616 Ga0495668_0264759 Ga0495668_0264759_677_922 77
638 3300046616 Ga0495668_0338591 Ga0495668_0338591_420_686 77
639 3300046642 Ga0495634_0001414 Ga0495634_0001414_12339_12584 77
640 3300046642 Ga0495634_0074278 Ga0495634_0074278_1188_1433 77
641 3300046642 Ga0495634_0661227 Ga0495634_0661227_129_374 77
642 3300046648 Ga0495611_0312798 Ga0495611_0312798_106_351 77
643 3300046660 Ga0495625_0495007 Ga0495625_0495007_263_508 77
644 3300046663 Ga0495635_0007761 Ga0495635_0007761_2364_2609 77
645 3300046663 Ga0495635_0541430 Ga0495635_0541430_491_736 77
646 3300046665 Ga0495661_0027351 Ga0495661_0027351_1026_1271 77
647 3300046675 Ga0495657_0006944 Ga0495657_0006944_8334_8579 77
648 3300046675 Ga0495657_0169994 Ga0495657_0169994_570_815 77
649 3300046675 Ga0495657_0732165 Ga0495657_0732165_58_303 77
650 3300046678 Ga0495599_0028210 Ga0495599_0028210_2129_2374 77
651 3300046678 Ga0495599_0374280 Ga0495599_0374280_586_831 77
652 3300046679 Ga0495623_0011888 Ga0495623_0011888_3583_3828 77
653 3300046679 Ga0495623_0624002 Ga0495623_0624002_285_530 77
654 3300046680 Ga0495646_0009638 Ga0495646_0009638_2780_3025 77
655 3300046680 Ga0495646_0015945 Ga0495646_0015945_3229_3474 77
656 3300046680 Ga0495646_0431458 Ga0495646_0431458_80_325 77
657 3300046681 Ga0495647_0032935 Ga0495647_0032935_1172_1417 77
658 3300046683 Ga0495658_0014805 Ga0495658_0014805_541_786 77
659 3300046684 Ga0495669_0002768 Ga0495669_0002768_3300_3545 77
660 3300046684 Ga0495669_0573594 Ga0495669_0573594_272_517 77
661 3300046689 Ga0495613_0130556 Ga0495613_0130556_932_1177 77
662 3300046690 Ga0495624_0007531 Ga0495624_0007531_2587_2832 77
663 3300046692 Ga0495671_0081664 Ga0495671_0081664_1206_1451 77
664 3300046794 Ga0495589_0051705 Ga0495589_0051705_1203_1448 77
665 3300046809 Ga0495600_0036783 Ga0495600_0036783_35_280 77
666 3300046809 Ga0495600_0068134 Ga0495600_0068134_1358_1603 77
667 3300046810 Ga0495660_0177798 Ga0495660_0177798_350_616 77
668 3300046810 Ga0495660_0191940 Ga0495660_0191940_36_281 77
669 3300047315 Ga0495581_0018644 Ga0495581_0018644_1656_1901 77
670 3300047317 Ga0495604_0005487 Ga0495604_0005487_6393_6638 77
671 3300047317 Ga0495604_0410472 Ga0495604_0410472_102_347 77
672 3300047319 Ga0495674_0000879 Ga0495674_0000879_3888_4133 77
673 3300047319 Ga0495674_0011383 Ga0495674_0011383_3526_3771 77
674 3300047320 Ga0495672_0083377 Ga0495672_0083377_546_791 77
675 3300047321 Ga0495676_0151694 Ga0495676_0151694_1227_1472 77
676 3300047322 Ga0495680_0005531 Ga0495680_0005531_8064_8309 77
677 3300047323 Ga0495683_0269676 Ga0495683_0269676_52_318 77
678 3300047323 Ga0495683_0285548 Ga0495683_0285548_347_592 77
679 3300047444 Ga0495675_0003412 Ga0495675_0003412_2686_2931 77
680 3300047444 Ga0495675_0611890 Ga0495675_0611890_42_287 77
681 3300047445 Ga0495677_0076022 Ga0495677_0076022_343_588 77
682 3300047445 Ga0495677_0155702 Ga0495677_0155702_59_304 77
683 3300047471 Ga0495684_0026792 Ga0495684_0026792_3794_4039 77
684 3300047472 Ga0495686_0067905 Ga0495686_0067905_524_766 77
685 3300047472 Ga0495686_0348129 Ga0495686_0348129_43_288 77
686 3300047472 Ga0495686_0552429 Ga0495686_0552429_216_461 77
687 3300047472 Ga0495686_0655070 Ga0495686_0655070_30_275 77
688 3300047673 Ga0495593_0001040 Ga0495593_0001040_282_527 77
689 3300048088 Ga0495602_0010182 Ga0495602_0010182_3320_3565 77
690 3300048088 Ga0495602_0148350 Ga0495602_0148350_777_1022 77
691 3300048089 Ga0495614_0081871 Ga0495614_0081871_968_1213 77
692 3300048090 Ga0495615_0013752 Ga0495615_0013752_696_941 77
693 3300048903 Ga0496100_0067588 Ga0496100_0067588_1499_1744 77
694 3300048904 Ga0496101_0456974 Ga0496101_0456974_171_416 77
695 3300048904 Ga0496101_0517466 Ga0496101_0517466_13_258 77
696 3300048904 Ga0496101_0555434 Ga0496101_0555434_589_846 77
697 3300048905 Ga0496102_0050249 Ga0496102_0050249_915_1160 77
698 3300048905 Ga0496102_1710853 Ga0496102_1710853_273_518 77
699 3300048909 Ga0496106_0600893 Ga0496106_0600893_514_759 77
700 3300048910 Ga0496107_0398248 Ga0496107_0398248_408_653 77
701 3300048910 Ga0496107_0578429 Ga0496107_0578429_404_649 77
702 3300048912 Ga0496109_0088443 Ga0496109_0088443_34_279 77
703 3300048917 Ga0496114_0587181 Ga0496114_0587181_661_906 77
704 3300048917 Ga0496114_1170964 Ga0496114_1170964_371_616 77
705 3300048918 Ga0496115_0101559 Ga0496115_0101559_1196_1441 77
706 3300048918 Ga0496115_0812618 Ga0496115_0812618_201_446 77
707 3300048920 Ga0496117_0057661 Ga0496117_0057661_368_613 77
708 3300048921 Ga0496118_0008710 Ga0496118_0008710_9498_9743 77
709 3300048921 Ga0496118_0154433 Ga0496118_0154433_920_1165 77
710 3300048924 Ga0496121_0000594 Ga0496121_0000594_36218_36460 77
711 3300048924 Ga0496121_0255336 Ga0496121_0255336_160_405 77
712 3300048924 Ga0496121_0422811 Ga0496121_0422811_488_730 77
713 3300048924 Ga0496121_0799455 Ga0496121_0799455_116_361 77
714 3300048928 Ga0496125_0013564 Ga0496125_0013564_4219_4464 77
715 3300048929 Ga0496126_0022745 Ga0496126_0022745_4112_4357 77
716 3300048929 Ga0496126_0598069 Ga0496126_0598069_442_687 77
717 3300048929 Ga0496126_0958984 Ga0496126_0958984_111_356 77
718 3300048929 Ga0496126_1253413 Ga0496126_1253413_141_386 77
719 3300048929 Ga0496126_1384260 Ga0496126_1384260_242_487 77
720 3300049460 Ga0495682_0360344 Ga0495682_0360344_31_276 77
721 3300049579 Ga0501043_0027235 Ga0501043_0027235_2102_2344 77
722 3300049579 Ga0501043_0116471 Ga0501043_0116471_1436_1681 77
723 3300050489 nmdc:mga03683_285846_c1 nmdc:mga03683_285846_c1_401_646 77
724 3300050511 nmdc:mga08y16_166453_c1 nmdc:mga08y16_166453_c1_1401_1646 77
725 3300053078 Ga0495612_0169295 Ga0495612_0169295_171_416 77
726 3300053078 Ga0495612_0499169 Ga0495612_0499169_290_535 77
727 3300053078 Ga0495612_0617592 Ga0495612_0617592_232_477 77
728 3300053083 Ga0495655_0106569 Ga0495655_0106569_528_773 77
729 3300053084 Ga0495595_0397832 Ga0495595_0397832_218_463 77
730 3300053087 Ga0500643_000707 Ga0500643_000707_9607_9852 77
731 3300053087 Ga0500643_028539 Ga0500643_028539_1112_1357 77
732 3300053087 Ga0500643_111515 Ga0500643_111515_18_263 77
733 3300053088 Ga0500644_0004606 Ga0500644_0004606_1697_1942 77
734 3300053090 Ga0500646_0008141 Ga0500646_0008141_13_261 77
735 3300053090 Ga0500646_0186287 Ga0500646_0186287_270_515 77
736 3300053090 Ga0500646_0215488 Ga0500646_0215488_314_559 77
737 3300053091 Ga0500647_0009309 Ga0500647_0009309_1517_1762 77
738 3300053092 Ga0500583_0051114 Ga0500583_0051114_671_916 77
739 3300053094 Ga0500566_0000007 Ga0500566_0000007_1088_1330 77
740 3300053094 Ga0500566_0047473 Ga0500566_0047473_1262_1507 77
741 3300053094 Ga0500566_0378002 Ga0500566_0378002_106_348 77
742 3300053098 Ga0500650_0138777 Ga0500650_0138777_59_304 77
743 3300053098 Ga0500650_0460751 Ga0500650_0460751_282_527 77
744 3300053103 Ga0500555_123674 Ga0500555_123674_281_526 77
745 3300053104 Ga0500556_0000058 Ga0500556_0000058_87190_87435 77
746 3300053104 Ga0500556_0027483 Ga0500556_0027483_732_977 77
747 3300053108 Ga0500562_001780 Ga0500562_001780_4596_4841 77
748 3300053108 Ga0500562_017167 Ga0500562_017167_1425_1670 77
749 3300053108 Ga0500562_124163 Ga0500562_124163_300_545 77
750 3300053109 Ga0500569_164372 Ga0500569_164372_424_669 77
751 3300053109 Ga0500569_209423 Ga0500569_209423_329_595 77
752 3300053119 Ga0500595_004598 Ga0500595_004598_1724_1966 77
753 3300053119 Ga0500595_026088 Ga0500595_026088_1087_1332 77
754 3300053119 Ga0500595_129538 Ga0500595_129538_85_327 77
755 3300053121 Ga0500607_094919 Ga0500607_094919_945_1190 77
756 3300053123 Ga0500614_073661 Ga0500614_073661_407_652 77
757 3300053130 Ga0500642_0087305 Ga0500642_0087305_640_885 77
758 3300053133 Ga0500655_040641 Ga0500655_040641_112_357 77
759 3300053134 Ga0500658_0007459 Ga0500658_0007459_1853_2098 77
760 3300053134 Ga0500658_0026987 Ga0500658_0026987_1847_2092 77
761 3300053134 Ga0500658_0405159 Ga0500658_0405159_243_485 77
762 3300053134 Ga0500658_0475436 Ga0500658_0475436_255_497 77
763 3300053136 Ga0500559_0122344 Ga0500559_0122344_82_327 77
764 3300053137 Ga0500561_0210326 Ga0500561_0210326_140_385 77
765 3300053139 Ga0500568_0346392 Ga0500568_0346392_216_464 77
766 3300053139 Ga0500568_0381028 Ga0500568_0381028_156_401 77
767 3300053142 Ga0500577_0000021 Ga0500577_0000021_4656_4910 77
768 3300053142 Ga0500577_0000172 Ga0500577_0000172_13496_13741 77
769 3300053142 Ga0500577_0355855 Ga0500577_0355855_247_492 77
770 3300053145 Ga0500586_001079 Ga0500586_001079_2276_2521 77
771 3300053146 Ga0500588_0396351 Ga0500588_0396351_137_382 77
772 3300053147 Ga0500589_060169 Ga0500589_060169_802_1095 77
773 3300053147 Ga0500589_237800 Ga0500589_237800_174_440 77
774 3300053148 Ga0500590_124874 Ga0500590_124874_93_338 77
775 3300053150 Ga0500603_015891 Ga0500603_015891_278_523 77
776 3300053151 Ga0500604_0012298 Ga0500604_0012298_1435_1683 77
777 3300053156 Ga0500622_0137146 Ga0500622_0137146_62_328 77
778 3300053160 Ga0500633_0117248 Ga0500633_0117248_544_789 77
779 3300053160 Ga0500633_0244914 Ga0500633_0244914_405_650 77
780 3300053161 Ga0500634_0374014 Ga0500634_0374014_233_478 77
781 3300053162 Ga0500638_182891 Ga0500638_182891_184_426 77
782 3300053163 Ga0500639_018849 Ga0500639_018849_1276_1521 77
783 3300053163 Ga0500639_030525 Ga0500639_030525_31_276 77
784 3300053178 Ga0500637_0000363 Ga0500637_0000363_12047_12292 77
785 3300053178 Ga0500637_0001156 Ga0500637_0001156_6258_6500 77
786 3300053178 Ga0500637_0314433 Ga0500637_0314433_301_567 77
787 3300053723 Ga0500567_073565 Ga0500567_073565_22_267 77
788 3300053730 Ga0500645_036556 Ga0500645_036556_510_755 77
789 3300053737 Ga0500601_023480 Ga0500601_023480_83_328 77
790 3300000041 ARcpr5oldR_c007842 ARcpr5oldR_0078422 78
791 3300000043 ARcpr5yngRDRAFT_c001352 ARcpr5yngRDRAFT_0013522 78
792 3300000044 ARSoilOldRDRAFT_c002613 ARSoilOldRDRAFT_0026133 78
793 3300001990 JGI24737J22298_10099360 JGI24737J22298_100993602 78
794 3300003911 JGI25405J52794_10013909 JGI25405J52794_100139092 78
795 3300005293 Ga0065715_10183454 Ga0065715_101834542 78
796 3300005295 Ga0065707_10585927 Ga0065707_105859271 78
797 3300005328 Ga0070676_11303168 Ga0070676_113031681 78
798 3300005329 Ga0070683_100158241 Ga0070683_1001582413 78
799 3300005331 Ga0070670_100059487 Ga0070670_1000594872 78
800 3300005331 Ga0070670_101812498 Ga0070670_1018124982 78
801 3300005334 Ga0068869_100281133 Ga0068869_1002811332 78
802 3300005334 Ga0068869_101440171 Ga0068869_1014401711 78
803 3300005335 Ga0070666_10012782 Ga0070666_100127824 78
804 3300005335 Ga0070666_10682505 Ga0070666_106825052 78
805 3300005336 Ga0070680_100045207 Ga0070680_1000452073 78
806 3300005336 Ga0070680_100099057 Ga0070680_1000990572 78
807 3300005337 Ga0070682_100022897 Ga0070682_1000228974 78
808 3300005337 Ga0070682_100035492 Ga0070682_1000354922 78
809 3300005337 Ga0070682_101903069 Ga0070682_1019030691 78
810 3300005338 Ga0068868_100385148 Ga0068868_1003851482 78
811 3300005338 Ga0068868_100880283 Ga0068868_1008802831 78
812 3300005339 Ga0070660_100202332 Ga0070660_1002023322 78
813 3300005340 Ga0070689_100046929 Ga0070689_1000469293 78
814 3300005340 Ga0070689_100172396 Ga0070689_1001723963 78
815 3300005341 Ga0070691_10510512 Ga0070691_105105121 78
816 3300005343 Ga0070687_100471077 Ga0070687_1004710772 78
817 3300005344 Ga0070661_100191462 Ga0070661_1001914622 78
818 3300005345 Ga0070692_10028676 Ga0070692_100286763 78
819 3300005347 Ga0070668_100810770 Ga0070668_1008107701 78
820 3300005347 Ga0070668_100895881 Ga0070668_1008958811 78
821 3300005353 Ga0070669_101586762 Ga0070669_1015867622 78
822 3300005354 Ga0070675_100041049 Ga0070675_1000410495 78
823 3300005355 Ga0070671_100061772 Ga0070671_1000617722 78
824 3300005355 Ga0070671_100572906 Ga0070671_1005729062 78
825 3300005356 Ga0070674_100203948 Ga0070674_1002039482 78
826 3300005364 Ga0070673_100094789 Ga0070673_1000947893 78
827 3300005365 Ga0070688_100080154 Ga0070688_1000801543 78
828 3300005365 Ga0070688_100222245 Ga0070688_1002222451 78
829 3300005366 Ga0070659_100353142 Ga0070659_1003531422 78
830 3300005367 Ga0070667_101635616 Ga0070667_1016356162 78
831 3300005434 Ga0070709_10009527 Ga0070709_100095275 78
832 3300005436 Ga0070713_100003957 Ga0070713_1000039573 78
833 3300005437 Ga0070710_10140347 Ga0070710_101403472 78
834 3300005438 Ga0070701_11285924 Ga0070701_112859241 78
835 3300005439 Ga0070711_100478200 Ga0070711_1004782001 78
836 3300005440 Ga0070705_100050366 Ga0070705_1000503663 78
837 3300005440 Ga0070705_100955155 Ga0070705_1009551552 78
838 3300005441 Ga0070700_101198429 Ga0070700_1011984292 78
839 3300005444 Ga0070694_101151423 Ga0070694_1011514231 78
840 3300005455 Ga0070663_100018956 Ga0070663_1000189564 78
841 3300005455 Ga0070663_100448902 Ga0070663_1004489021 78
842 3300005456 Ga0070678_100064462 Ga0070678_1000644623 78
843 3300005456 Ga0070678_100216450 Ga0070678_1002164502 78
844 3300005456 Ga0070678_100470064 Ga0070678_1004700642 78
845 3300005457 Ga0070662_100139925 Ga0070662_1001399252 78
846 3300005457 Ga0070662_100590717 Ga0070662_1005907171 78
847 3300005458 Ga0070681_10031833 Ga0070681_100318335 78
848 3300005466 Ga0070685_10182719 Ga0070685_101827192 78
849 3300005466 Ga0070685_11053504 Ga0070685_110535042 78
850 3300005507 Ga0074259_11290175 Ga0074259_112901752 78
851 3300005530 Ga0070679_100030768 Ga0070679_1000307683 78
852 3300005530 Ga0070679_100517890 Ga0070679_1005178902 78
853 3300005535 Ga0070684_100094549 Ga0070684_1000945492 78
854 3300005535 Ga0070684_100231267 Ga0070684_1002312672 78
855 3300005539 Ga0068853_100885211 Ga0068853_1008852112 78
856 3300005544 Ga0070686_100456547 Ga0070686_1004565472 78
857 3300005544 Ga0070686_100459796 Ga0070686_1004597962 78
858 3300005545 Ga0070695_100149169 Ga0070695_1001491692 78
859 3300005545 Ga0070695_101426307 Ga0070695_1014263071 78
860 3300005546 Ga0070696_100016292 Ga0070696_1000162922 78
861 3300005546 Ga0070696_100288110 Ga0070696_1002881102 78
862 3300005546 Ga0070696_101047268 Ga0070696_1010472682 78
863 3300005547 Ga0070693_100019995 Ga0070693_1000199952 78
864 3300005547 Ga0070693_100857264 Ga0070693_1008572642 78
865 3300005548 Ga0070665_100020452 Ga0070665_1000204524 78
866 3300005548 Ga0070665_100155154 Ga0070665_1001551543 78
867 3300005548 Ga0070665_100561916 Ga0070665_1005619162 78
868 3300005548 Ga0070665_101892241 Ga0070665_1018922411 78
869 3300005549 Ga0070704_100074081 Ga0070704_1000740814 78
870 3300005564 Ga0070664_100142524 Ga0070664_1001425242 78
871 3300005564 Ga0070664_100146153 Ga0070664_1001461533 78
872 3300005578 Ga0068854_100994169 Ga0068854_1009941692 78
873 3300005617 Ga0068859_100099798 Ga0068859_1000997984 78
874 3300005617 Ga0068859_100120409 Ga0068859_1001204093 78
875 3300005618 Ga0068864_100471159 Ga0068864_1004711592 78
876 3300005618 Ga0068864_100601003 Ga0068864_1006010032 78
877 3300005718 Ga0068866_10059988 Ga0068866_100599881 78
878 3300005719 Ga0068861_100219292 Ga0068861_1002192922 78
879 3300005719 Ga0068861_100898880 Ga0068861_1008988802 78
880 3300005841 Ga0068863_100583063 Ga0068863_1005830632 78
881 3300005841 Ga0068863_101216087 Ga0068863_1012160871 78
882 3300005842 Ga0068858_100093478 Ga0068858_1000934782 78
883 3300005842 Ga0068858_101223421 Ga0068858_1012234211 78
884 3300005843 Ga0068860_100196329 Ga0068860_1001963293 78
885 3300005843 Ga0068860_101447303 Ga0068860_1014473032 78
886 3300005844 Ga0068862_100048786 Ga0068862_1000487863 78
887 3300005937 Ga0081455_10042464 Ga0081455_100424645 78
888 3300005937 Ga0081455_10185745 Ga0081455_101857452 78
889 3300006028 Ga0070717_10045340 Ga0070717_100453403 78
890 3300006038 Ga0075365_10192420 Ga0075365_101924202 78
891 3300006048 Ga0075363_100000323 Ga0075363_1000003232 78
892 3300006051 Ga0075364_10018097 Ga0075364_100180974 78
893 3300006173 Ga0070716_100000563 Ga0070716_10000056312 78
894 3300006173 Ga0070716_101120903 Ga0070716_1011209032 78
895 3300006175 Ga0070712_100018194 Ga0070712_1000181942 78
896 3300006175 Ga0070712_100470633 Ga0070712_1004706332 78
897 3300006178 Ga0075367_10007063 Ga0075367_100070634 78
898 3300006186 Ga0075369_10255534 Ga0075369_102555342 78
899 3300006237 Ga0097621_100010097 Ga0097621_1000100976 78
900 3300006237 Ga0097621_100796628 Ga0097621_1007966281 78
901 3300006353 Ga0075370_10009352 Ga0075370_100093524 78
902 3300006358 Ga0068871_100122561 Ga0068871_1001225613 78
903 3300006358 Ga0068871_100140979 Ga0068871_1001409793 78
904 3300006852 Ga0075433_10953790 Ga0075433_109537902 78
905 3300006871 Ga0075434_100194277 Ga0075434_1001942772 78
906 3300006871 Ga0075434_100507075 Ga0075434_1005070752 78
907 3300006871 Ga0075434_100688011 Ga0075434_1006880112 78
908 3300006881 Ga0068865_100142283 Ga0068865_1001422832 78
909 3300006914 Ga0075436_100036272 Ga0075436_1000362722 78
910 3300006914 Ga0075436_100817563 Ga0075436_1008175632 78
911 3300006914 Ga0075436_101435460 Ga0075436_1014354602 78
912 3300006931 Ga0097620_100099797 Ga0097620_1000997971 78
913 3300006931 Ga0097620_100120403 Ga0097620_1001204033 78
914 3300007076 Ga0075435_100829339 Ga0075435_1008293392 78
915 3300009011 Ga0105251_10065493 Ga0105251_100654931 78
916 3300009092 Ga0105250_10386012 Ga0105250_103860121 78
917 3300009094 Ga0111539_11423108 Ga0111539_114231082 78
918 3300009098 Ga0105245_10435988 Ga0105245_104359882 78
919 3300009101 Ga0105247_10333711 Ga0105247_103337112 78
920 3300009101 Ga0105247_10714208 Ga0105247_107142081 78
921 3300009101 Ga0105247_11507727 Ga0105247_115077271 78
922 3300009148 Ga0105243_10046627 Ga0105243_100466273 78
923 3300009148 Ga0105243_12471298 Ga0105243_124712982 78
924 3300009174 Ga0105241_10195969 Ga0105241_101959692 78
925 3300009174 Ga0105241_11461166 Ga0105241_114611662 78
926 3300009174 Ga0105241_11625912 Ga0105241_116259122 78
927 3300009176 Ga0105242_10088851 Ga0105242_100888513 78
928 3300009177 Ga0105248_10013026 Ga0105248_100130262 78
929 3300009177 Ga0105248_10236486 Ga0105248_102364862 78
930 3300009177 Ga0105248_11751108 Ga0105248_117511082 78
931 3300009545 Ga0105237_10141121 Ga0105237_101411212 78
932 3300009545 Ga0105237_10911983 Ga0105237_109119832 78
933 3300009551 Ga0105238_10037495 Ga0105238_100374951 78
934 3300009551 Ga0105238_11047574 Ga0105238_110475742 78
935 3300009553 Ga0105249_10956122 Ga0105249_109561222 78
936 3300009553 Ga0105249_12611099 Ga0105249_126110992 78
937 3300010375 Ga0105239_10185479 Ga0105239_101854792 78
938 3300010375 Ga0105239_12725864 Ga0105239_127258641 78
939 3300011119 Ga0105246_10035343 Ga0105246_100353433 78
940 3300011119 Ga0105246_11045372 Ga0105246_110453722 78
941 3300011119 Ga0105246_12093803 Ga0105246_120938032 78
942 3300012483 Ga0157337_1010325 Ga0157337_10103252 78
943 3300012490 Ga0157322_1007198 Ga0157322_10071982 78
944 3300012492 Ga0157335_1011247 Ga0157335_10112471 78
945 3300012505 Ga0157339_1005873 Ga0157339_10058732 78
946 3300013105 Ga0157369_10462169 Ga0157369_104621692 78
947 3300013296 Ga0157374_11303762 Ga0157374_113037622 78
948 3300013296 Ga0157374_12416185 Ga0157374_124161851 78
949 3300013297 Ga0157378_10025025 Ga0157378_100250255 78
950 3300013297 Ga0157378_10630919 Ga0157378_106309191 78
951 3300013306 Ga0163162_10727460 Ga0163162_107274602 78
952 3300013306 Ga0163162_12537606 Ga0163162_125376062 78
953 3300013307 Ga0157372_11213489 Ga0157372_112134892 78
954 3300013307 Ga0157372_11526840 Ga0157372_115268401 78
955 3300013308 Ga0157375_10504102 Ga0157375_105041022 78
956 3300013308 Ga0157375_10981988 Ga0157375_109819883 78
957 3300013308 Ga0157375_13548440 Ga0157375_135484402 78
958 3300014325 Ga0163163_10030831 Ga0163163_100308314 78
959 3300014325 Ga0163163_10833908 Ga0163163_108339082 78
960 3300014325 Ga0163163_12659441 Ga0163163_126594411 78
961 3300014326 Ga0157380_10149280 Ga0157380_101492803 78
962 3300014745 Ga0157377_10381825 Ga0157377_103818252 78
963 3300014968 Ga0157379_10380830 Ga0157379_103808302 78
964 3300014968 Ga0157379_11735797 Ga0157379_117357971 78
965 3300014969 Ga0157376_11382065 Ga0157376_113820652 78
966 3300017792 Ga0163161_10705973 Ga0163161_107059732 78
967 3300025299 Ga0209256_1000102 Ga0209256_1000102176 78
968 3300025898 Ga0207692_10015582 Ga0207692_100155824 78
969 3300025900 Ga0207710_10243604 Ga0207710_102436042 78
970 3300025903 Ga0207680_10096262 Ga0207680_100962622 78
971 3300025903 Ga0207680_11230386 Ga0207680_112303862 78
972 3300025904 Ga0207647_10165890 Ga0207647_101658902 78
973 3300025905 Ga0207685_10018544 Ga0207685_100185442 78
974 3300025906 Ga0207699_10021882 Ga0207699_100218824 78
975 3300025911 Ga0207654_10434633 Ga0207654_104346332 78
976 3300025914 Ga0207671_10072995 Ga0207671_100729952 78
977 3300025914 Ga0207671_10762931 Ga0207671_107629311 78
978 3300025915 Ga0207693_10005549 Ga0207693_100055495 78
979 3300025917 Ga0207660_10862612 Ga0207660_108626122 78
980 3300025918 Ga0207662_10003182 Ga0207662_100031822 78
981 3300025919 Ga0207657_10073973 Ga0207657_100739732 78
982 3300025920 Ga0207649_10479446 Ga0207649_104794462 78
983 3300025921 Ga0207652_10059294 Ga0207652_100592944 78
984 3300025923 Ga0207681_10284537 Ga0207681_102845372 78
985 3300025925 Ga0207650_10245466 Ga0207650_102454662 78
986 3300025926 Ga0207659_10288665 Ga0207659_102886652 78
987 3300025926 Ga0207659_11270808 Ga0207659_112708082 78
988 3300025927 Ga0207687_10042417 Ga0207687_100424174 78
989 3300025928 Ga0207700_10002764 Ga0207700_100027643 78
990 3300025931 Ga0207644_10130952 Ga0207644_101309523 78
991 3300025931 Ga0207644_11621711 Ga0207644_116217112 78
992 3300025932 Ga0207690_10050399 Ga0207690_100503993 78
993 3300025933 Ga0207706_10012295 Ga0207706_100122959 78
994 3300025933 Ga0207706_10050537 Ga0207706_100505374 78
995 3300025934 Ga0207686_10030297 Ga0207686_100302973 78
996 3300025936 Ga0207670_10115693 Ga0207670_101156932 78
997 3300025937 Ga0207669_11088656 Ga0207669_110886562 78
998 3300025938 Ga0207704_10785212 Ga0207704_107852122 78
999 3300025939 Ga0207665_10000555 Ga0207665_1000055511 78
1000 3300025940 Ga0207691_10105826 Ga0207691_101058263 78
1001 3300025941 Ga0207711_10026536 Ga0207711_100265363 78
1002 3300025942 Ga0207689_10402148 Ga0207689_104021481 78
1003 3300025942 Ga0207689_10489040 Ga0207689_104890402 78
1004 3300025945 Ga0207679_10207590 Ga0207679_102075902 78
1005 3300025945 Ga0207679_11242434 Ga0207679_112424342 78
1006 3300025945 Ga0207679_11435495 Ga0207679_114354951 78
1007 3300025949 Ga0207667_10472108 Ga0207667_104721082 78
1008 3300025960 Ga0207651_10199829 Ga0207651_101998292 78
1009 3300025961 Ga0207712_10634916 Ga0207712_106349161 78
1010 3300025972 Ga0207668_10186843 Ga0207668_101868433 78
1011 3300025986 Ga0207658_10752002 Ga0207658_107520022 78
1012 3300026023 Ga0207677_10426608 Ga0207677_104266082 78
1013 3300026035 Ga0207703_10018417 Ga0207703_100184172 78
1014 3300026041 Ga0207639_10211836 Ga0207639_102118362 78
1015 3300026067 Ga0207678_10005293 Ga0207678_1000529310 78
1016 3300026067 Ga0207678_10020358 Ga0207678_100203583 78
1017 3300026075 Ga0207708_10820760 Ga0207708_108207603 78
1018 3300026078 Ga0207702_10082103 Ga0207702_100821032 78
1019 3300026088 Ga0207641_10560464 Ga0207641_105604642 78
1020 3300026088 Ga0207641_10787587 Ga0207641_107875872 78
1021 3300026095 Ga0207676_10080166 Ga0207676_100801663 78
1022 3300026095 Ga0207676_10462347 Ga0207676_104623472 78
1023 3300026118 Ga0207675_100156219 Ga0207675_1001562192 78
1024 3300026118 Ga0207675_100648730 Ga0207675_1006487302 78
1025 3300026121 Ga0207683_10010070 Ga0207683_100100704 78
1026 3300026121 Ga0207683_10236218 Ga0207683_102362182 78
1027 3300027682 Ga0209971_1032898 Ga0209971_10328982 78
1028 3300027695 Ga0209966_1009527 Ga0209966_10095272 78
1029 3300027717 Ga0209998_10002200 Ga0209998_100022006 78
1030 3300027866 Ga0209813_10377447 Ga0209813_103774471 78
1031 3300028379 Ga0268266_10001258 Ga0268266_1000125826 78
1032 3300028379 Ga0268266_10020213 Ga0268266_100202132 78
1033 3300028379 Ga0268266_10392288 Ga0268266_103922882 78
1034 3300028379 Ga0268266_10437610 Ga0268266_104376102 78
1035 3300028380 Ga0268265_10121807 Ga0268265_101218071 78
1036 3300028381 Ga0268264_10145554 Ga0268264_101455542 78
1037 3300028381 Ga0268264_10284493 Ga0268264_102844932 78
1038 3300031238 Ga0265332_10133785 Ga0265332_101337852 78
1039 3300034816 Ga0373930_0026702 Ga0373930_0026702_565_804 78
1040 3300034816 Ga0373930_0030034 Ga0373930_0030034_460_702 78
1041 3300034818 Ga0373950_0038362 Ga0373950_0038362_188_427 78
1042 3300034820 Ga0373959_0004905 Ga0373959_0004905_625_864 78
1043 3300034820 Ga0373959_0106147 Ga0373959_0106147_78_320 78
1044 3300034957 Ga0373938_0007189 Ga0373938_0007189_1168_1407 78
1045 3300035084 Ga0373928_0210574 Ga0373928_0210574_133_369 78
1046 3300035085 Ga0373929_0089955 Ga0373929_0089955_183_422 78
1047 3300035088 Ga0373940_0141332 Ga0373940_0141332_243_479 78
1048 3300035088 Ga0373940_0285668 Ga0373940_0285668_258_497 78
1049 3300035090 Ga0373949_0145944 Ga0373949_0145944_191_433 78
1050 3300035091 Ga0373951_0008447 Ga0373951_0008447_254_490 78
1051 3300035091 Ga0373951_0028742 Ga0373951_0028742_498_740 78
1052 3300035091 Ga0373951_0107841 Ga0373951_0107841_27_266 78
1053 3300035092 Ga0373952_0005797 Ga0373952_0005797_227_463 78
1054 3300035092 Ga0373952_0087476 Ga0373952_0087476_43_282 78
1055 3300035111 Ga0373923_0095710 Ga0373923_0095710_287_526 78
1056 3300035112 Ga0373932_0075461 Ga0373932_0075461_275_514 78
1057 3300035113 Ga0373936_0236583 Ga0373936_0236583_240_479 78
1058 3300035114 Ga0373939_0006287 Ga0373939_0006287_121_357 78
1059 3300035114 Ga0373939_0009037 Ga0373939_0009037_1792_2031 78
1060 3300035114 Ga0373939_0175645 Ga0373939_0175645_258_500 78
1061 3300035115 Ga0373941_0098228 Ga0373941_0098228_275_514 78
1062 3300035207 Ga0373942_0089317 Ga0373942_0089317_393_632 78
1063 3300035241 Ga0373961_0014684 Ga0373961_0014684_869_1108 78
1064 3300035241 Ga0373961_0408748 Ga0373961_0408748_60_296 78
1065 3300035242 Ga0373962_0070868 Ga0373962_0070868_338_574 78
1066 3300035691 Ga0373931_0148141 Ga0373931_0148141_323_568 78
1067 3300035691 Ga0373931_0340359 Ga0373931_0340359_364_600 78
1068 3300035692 Ga0373935_0036584 Ga0373935_0036584_1983_2222 78
1069 3300035692 Ga0373935_0846979 Ga0373935_0846979_54_296 78
1070 3300035695 Ga0373927_0085314 Ga0373927_0085314_309_548 78
1071 3300037068 Ga0373925_0024726 Ga0373925_0024726_3640_3879 78
1072 3300046455 Ga0495603_0039833 Ga0495603_0039833_2236_2475 78
1073 3300046455 Ga0495603_0102019 Ga0495603_0102019_138_383 78
1074 3300046459 Ga0495629_0000577 Ga0495629_0000577_26681_26920 78
1075 3300046460 Ga0495638_0182439 Ga0495638_0182439_17_262 78
1076 3300046473 Ga0495582_0009685 Ga0495582_0009685_2913_3152 78
1077 3300046475 Ga0495639_0594951 Ga0495639_0594951_57_296 78
1078 3300046499 Ga0495594_0563463 Ga0495594_0563463_349_588 78
1079 3300046642 Ga0495634_0578343 Ga0495634_0578343_59_298 78
1080 3300046683 Ga0495658_0000944 Ga0495658_0000944_14411_14650 78
1081 3300046689 Ga0495613_0152652 Ga0495613_0152652_912_1151 78
1082 3300047315 Ga0495581_0014473 Ga0495581_0014473_967_1206 78
1083 3300047320 Ga0495672_0019817 Ga0495672_0019817_741_986 78
1084 3300047321 Ga0495676_0443306 Ga0495676_0443306_437_676 78
1085 3300047673 Ga0495593_0049360 Ga0495593_0049360_1507_1746 78
1086 3300048089 Ga0495614_0188163 Ga0495614_0188163_672_911 78
1087 3300048903 Ga0496100_0112857 Ga0496100_0112857_1398_1640 78
1088 3300048903 Ga0496100_0177351 Ga0496100_0177351_1164_1409 78
1089 3300048903 Ga0496100_0215194 Ga0496100_0215194_662_901 78
1090 3300048903 Ga0496100_0402640 Ga0496100_0402640_557_796 78
1091 3300048904 Ga0496101_0072428 Ga0496101_0072428_2099_2344 78
1092 3300048904 Ga0496101_0177683 Ga0496101_0177683_1168_1410 78
1093 3300048904 Ga0496101_0238268 Ga0496101_0238268_930_1169 78
1094 3300048904 Ga0496101_0444724 Ga0496101_0444724_247_486 78
1095 3300048905 Ga0496102_0015547 Ga0496102_0015547_1297_1539 78
1096 3300048905 Ga0496102_0235439 Ga0496102_0235439_523_762 78
1097 3300048905 Ga0496102_0333102 Ga0496102_0333102_226_465 78
1098 3300048906 Ga0496103_0005261 Ga0496103_0005261_6563_6802 78
1099 3300048906 Ga0496103_0218289 Ga0496103_0218289_965_1204 78
1100 3300048906 Ga0496103_0677920 Ga0496103_0677920_240_482 78
1101 3300048907 Ga0496104_0004592 Ga0496104_0004592_9460_9705 78
1102 3300048907 Ga0496104_0176863 Ga0496104_0176863_846_1088 78
1103 3300048907 Ga0496104_0198630 Ga0496104_0198630_1413_1652 78
1104 3300048907 Ga0496104_0282867 Ga0496104_0282867_963_1202 78
1105 3300048907 Ga0496104_0814694 Ga0496104_0814694_523_762 78
1106 3300048908 Ga0496105_0004448 Ga0496105_0004448_8192_8437 78
1107 3300048908 Ga0496105_0140914 Ga0496105_0140914_1668_1907 78
1108 3300048909 Ga0496106_0016658 Ga0496106_0016658_2043_2282 78
1109 3300048909 Ga0496106_0343542 Ga0496106_0343542_915_1154 78
1110 3300048909 Ga0496106_1532342 Ga0496106_1532342_160_405 78
1111 3300048910 Ga0496107_0031966 Ga0496107_0031966_1724_1963 78
1112 3300048910 Ga0496107_0173666 Ga0496107_0173666_1300_1539 78
1113 3300048910 Ga0496107_0398134 Ga0496107_0398134_626_862 78
1114 3300048910 Ga0496107_0510522 Ga0496107_0510522_210_452 78
1115 3300048911 Ga0496108_0009122 Ga0496108_0009122_6510_6755 78
1116 3300048911 Ga0496108_0119119 Ga0496108_0119119_1003_1242 78
1117 3300048911 Ga0496108_1094298 Ga0496108_1094298_219_458 78
1118 3300048912 Ga0496109_0000835 Ga0496109_0000835_24351_24611 78
1119 3300048912 Ga0496109_0084243 Ga0496109_0084243_1403_1642 78
1120 3300048912 Ga0496109_0113033 Ga0496109_0113033_987_1226 78
1121 3300048912 Ga0496109_0349161 Ga0496109_0349161_912_1151 78
1122 3300048912 Ga0496109_1974384 Ga0496109_1974384_120_365 78
1123 3300048913 Ga0496110_0004806 Ga0496110_0004806_7336_7581 78
1124 3300048913 Ga0496110_0216053 Ga0496110_0216053_247_486 78
1125 3300048913 Ga0496110_0673905 Ga0496110_0673905_389_634 78
1126 3300048913 Ga0496110_1354619 Ga0496110_1354619_97_333 78
1127 3300048914 Ga0496111_0000843 Ga0496111_0000843_8965_9210 78
1128 3300048914 Ga0496111_0032370 Ga0496111_0032370_1049_1288 78
1129 3300048914 Ga0496111_0798677 Ga0496111_0798677_389_625 78
1130 3300048915 Ga0496112_0006451 Ga0496112_0006451_5049_5294 78
1131 3300048915 Ga0496112_0337525 Ga0496112_0337525_247_486 78
1132 3300048915 Ga0496112_0337528 Ga0496112_0337528_965_1204 78
1133 3300048915 Ga0496112_0572890 Ga0496112_0572890_606_851 78
1134 3300048915 Ga0496112_1693086 Ga0496112_1693086_186_428 78
1135 3300048916 Ga0496113_0001943 Ga0496113_0001943_9070_9315 78
1136 3300048916 Ga0496113_0309389 Ga0496113_0309389_247_486 78
1137 3300048916 Ga0496113_1308100 Ga0496113_1308100_78_317 78
1138 3300048917 Ga0496114_0062620 Ga0496114_0062620_2515_2754 78
1139 3300048918 Ga0496115_0004407 Ga0496115_0004407_4541_4783 78
1140 3300048918 Ga0496115_0164323 Ga0496115_0164323_1561_1800 78
1141 3300048918 Ga0496115_0190776 Ga0496115_0190776_1088_1333 78
1142 3300048918 Ga0496115_0252855 Ga0496115_0252855_247_486 78
1143 3300048928 Ga0496125_0298594 Ga0496125_0298594_258_497 78
1144 3300048929 Ga0496126_0583410 Ga0496126_0583410_558_809 78
1145 3300049569 Ga0501032_0050133 Ga0501032_0050133_1555_1800 78
1146 3300049569 Ga0501032_0138768 Ga0501032_0138768_814_1059 78
1147 3300049569 Ga0501032_0219880 Ga0501032_0219880_694_939 78
1148 3300049570 Ga0501033_0096488 Ga0501033_0096488_883_1128 78
1149 3300049570 Ga0501033_0236782 Ga0501033_0236782_504_749 78
1150 3300049570 Ga0501033_0901072 Ga0501033_0901072_276_521 78
1151 3300049571 Ga0501034_0031515 Ga0501034_0031515_4590_4835 78
1152 3300049571 Ga0501034_0100325 Ga0501034_0100325_2095_2340 78
1153 3300049571 Ga0501034_0149236 Ga0501034_0149236_683_922 78
1154 3300049572 Ga0501036_0032679 Ga0501036_0032679_1043_1288 78
1155 3300049572 Ga0501036_0061151 Ga0501036_0061151_1726_1971 78
1156 3300049572 Ga0501036_0296881 Ga0501036_0296881_717_962 78
1157 3300049573 Ga0501037_0009457 Ga0501037_0009457_6361_6606 78
1158 3300049573 Ga0501037_0257776 Ga0501037_0257776_125_370 78
1159 3300049573 Ga0501037_0262473 Ga0501037_0262473_713_958 78
1160 3300049574 Ga0501038_0025785 Ga0501038_0025785_4443_4688 78
1161 3300049574 Ga0501038_0089046 Ga0501038_0089046_1901_2146 78
1162 3300049574 Ga0501038_0178929 Ga0501038_0178929_918_1163 78
1163 3300049575 Ga0501039_0015343 Ga0501039_0015343_500_745 78
1164 3300049575 Ga0501039_0034558 Ga0501039_0034558_1349_1594 78
1165 3300049576 Ga0501040_0071467 Ga0501040_0071467_1914_2159 78
1166 3300049576 Ga0501040_0331478 Ga0501040_0331478_574_819 78
1167 3300049578 Ga0501042_0079676 Ga0501042_0079676_2046_2291 78
1168 3300049578 Ga0501042_1448505 Ga0501042_1448505_242_487 78
1169 3300049579 Ga0501043_0006016 Ga0501043_0006016_7091_7336 78
1170 3300049579 Ga0501043_0106369 Ga0501043_0106369_1837_2082 78
1171 3300049579 Ga0501043_0282920 Ga0501043_0282920_959_1204 78
1172 3300049580 Ga0501046_0025626 Ga0501046_0025626_2094_2339 78
1173 3300049580 Ga0501046_0103928 Ga0501046_0103928_535_780 78
1174 3300049581 Ga0501047_0012665 Ga0501047_0012665_5304_5549 78
1175 3300049581 Ga0501047_0142395 Ga0501047_0142395_530_775 78
1176 3300049581 Ga0501047_0530447 Ga0501047_0530447_717_962 78
1177 3300049582 Ga0501048_0175148 Ga0501048_0175148_754_999 78
1178 3300049582 Ga0501048_0374886 Ga0501048_0374886_561_806 78
1179 3300049583 Ga0501067_0113603 Ga0501067_0113603_451_696 78
1180 3300049583 Ga0501067_0255980 Ga0501067_0255980_518_763 78
1181 3300049584 Ga0501068_0022897 Ga0501068_0022897_1035_1280 78
1182 3300049584 Ga0501068_0090117 Ga0501068_0090117_1111_1356 78
1183 3300049585 Ga0501069_0009123 Ga0501069_0009123_548_793 78
1184 3300049585 Ga0501069_0143574 Ga0501069_0143574_1073_1318 78
1185 3300049585 Ga0501069_0159772 Ga0501069_0159772_518_763 78
1186 3300049586 Ga0501070_0013556 Ga0501070_0013556_4366_4611 78
1187 3300049586 Ga0501070_0128551 Ga0501070_0128551_550_795 78
1188 3300049586 Ga0501070_0288272 Ga0501070_0288272_1029_1274 78
1189 3300049586 Ga0501070_0289767 Ga0501070_0289767_463_702 78
1190 3300049586 Ga0501070_0359506 Ga0501070_0359506_348_593 78
1191 3300049586 Ga0501070_0414301 Ga0501070_0414301_550_795 78
1192 3300049587 Ga0501071_0025103 Ga0501071_0025103_1794_2039 78
1193 3300049587 Ga0501071_0071942 Ga0501071_0071942_510_755 78
1194 3300049588 Ga0501072_0019989 Ga0501072_0019989_2010_2255 78
1195 3300049588 Ga0501072_0677639 Ga0501072_0677639_231_476 78
1196 3300049588 Ga0501072_0739585 Ga0501072_0739585_86_331 78
1197 3300049589 Ga0501073_0067179 Ga0501073_0067179_1519_1764 78
1198 3300049589 Ga0501073_0279211 Ga0501073_0279211_422_667 78
1199 3300049589 Ga0501073_0557656 Ga0501073_0557656_25_270 78
1200 3300049590 Ga0501074_0010334 Ga0501074_0010334_538_783 78
1201 3300049590 Ga0501074_0033573 Ga0501074_0033573_649_894 78
1202 3300049590 Ga0501074_0119841 Ga0501074_0119841_899_1144 78
1203 3300049590 Ga0501074_0177885 Ga0501074_0177885_174_419 78
1204 3300049592 Ga0501076_0186970 Ga0501076_0186970_286_531 78
1205 3300049593 Ga0501077_0203227 Ga0501077_0203227_16_261 78
1206 3300049741 Ga0501079_0328381 Ga0501079_0328381_443_688 78
1207 3300049742 Ga0501080_0104956 Ga0501080_0104956_59_304 78
1208 3300049742 Ga0501080_0158095 Ga0501080_0158095_550_795 78
1209 3300049742 Ga0501080_0267476 Ga0501080_0267476_550_795 78
1210 3300049742 Ga0501080_0490721 Ga0501080_0490721_434_673 78
1211 3300049742 Ga0501080_0710516 Ga0501080_0710516_235_480 78
1212 3300049743 Ga0501081_0578919 Ga0501081_0578919_400_645 78
1213 3300049744 Ga0501083_0086936 Ga0501083_0086936_606_851 78
1214 3300049744 Ga0501083_0355793 Ga0501083_0355793_453_698 78
1215 3300049822 Ga0501035_0000418 Ga0501035_0000418_41520_41765 78
1216 3300049822 Ga0501035_0028100 Ga0501035_0028100_3663_3908 78
1217 3300049822 Ga0501035_0174749 Ga0501035_0174749_1506_1751 78
1218 3300049823 Ga0501044_0226132 Ga0501044_0226132_1026_1271 78
1219 3300049823 Ga0501044_0520939 Ga0501044_0520939_294_539 78
1220 3300049824 Ga0501045_0275429 Ga0501045_0275429_916_1161 78
1221 3300049824 Ga0501045_0343561 Ga0501045_0343561_272_517 78
1222 3300049824 Ga0501045_1421143 Ga0501045_1421143_27_272 78
1223 3300050490 nmdc:mga03n38_1371_c1 nmdc:mga03n38_1371_c1_3935_4249 78
1224 3300050490 nmdc:mga03n38_545_c1 nmdc:mga03n38_545_c1_5164_5409 78
1225 3300050491 nmdc:mga00v17_536794_c1 nmdc:mga00v17_536794_c1_146_391 78
1226 3300050492 nmdc:mga0yw44_15036_c1 nmdc:mga0yw44_15036_c1_1763_2008 78
1227 3300050494 nmdc:mga06z11_551_c1 nmdc:mga06z11_551_c1_7160_7474 78
1228 3300050494 nmdc:mga06z11_7326_c1 nmdc:mga06z11_7326_c1_638_883 78
1229 3300050495 nmdc:mga04h51_627_c1 nmdc:mga04h51_627_c1_7170_7484 78
1230 3300050496 nmdc:mga07m45_24365_c1 nmdc:mga07m45_24365_c1_853_1098 78
1231 3300050507 nmdc:mga05p37_5338_c1 nmdc:mga05p37_5338_c1_1325_1612 78
1232 3300050511 nmdc:mga08y16_516083_c1 nmdc:mga08y16_516083_c1_314_553 78
1233 3300050512 nmdc:mga0n895_10845_c1 nmdc:mga0n895_10845_c1_6256_6543 78
1234 3300050512 nmdc:mga0n895_210408_c1 nmdc:mga0n895_210408_c1_804_1043 78
1235 3300050512 nmdc:mga0n895_263341_c1 nmdc:mga0n895_263341_c1_1160_1402 78
1236 3300050513 nmdc:mga0rr50_228834_c1 nmdc:mga0rr50_228834_c1_731_970 78
1237 3300050514 nmdc:mga08x19_1145081_c1 nmdc:mga08x19_1145081_c1_146_388 78
1238 3300050514 nmdc:mga08x19_1265291_c1 nmdc:mga08x19_1265291_c1_189_428 78
1239 3300050514 nmdc:mga08x19_243156_c1 nmdc:mga08x19_243156_c1_690_929 78
1240 3300050515 nmdc:mga0a205_6087_c1 nmdc:mga0a205_6087_c1_2433_2720 78
1241 3300050516 nmdc:mga0sz30_152260_c1 nmdc:mga0sz30_152260_c1_132_377 78
1242 3300053077 Ga0495601_0307059 Ga0495601_0307059_600_839 78
1243 3300053085 Ga0495619_0000687 Ga0495619_0000687_11275_11514 78
1244 3300053098 Ga0500650_0419718 Ga0500650_0419718_211_456 78
1245 3300053104 Ga0500556_0125073 Ga0500556_0125073_507_752 78
1246 3300053119 Ga0500595_000662 Ga0500595_000662_17901_18146 78
1247 3300053139 Ga0500568_0062587 Ga0500568_0062587_780_1025 78
1248 3300053153 Ga0500616_0011874 Ga0500616_0011874_3109_3357 78
1249 3300054114 Ga0501084_0080061 Ga0501084_0080061_1670_1915 78
1250 3300054114 Ga0501084_0081953 Ga0501084_0081953_221_466 78
1251 3300060353 Ga0501082_0067703 Ga0501082_0067703_2677_2922 78
1252 3300060353 Ga0501082_0088742 Ga0501082_0088742_2246_2491 78
1253 3300061734 Ga0530510_0085419 Ga0530510_0085419_1387_1632 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11742

DUF3302

Protein of unknown function (DUF3302)

22

96

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7agx-assembly1.cif.gz_1J apo-state type 3 secretion system export apparatus complex from salmonella enterica typhimurium 0.5693 4 67
6pep-assembly1.cif.gz_8 focussed refinement of invgn0n1:spapqr:prgij from the salmonella spi-1 injectisome needle complex 0.5485 1 67
6tzc-assembly1.cif.gz_B crystal structure of african swine fever virus a179l with the autophagy regulator beclin 0.5343 18 69
6rwy-assembly1.cif.gz_h export apparatus core and inner rod of the shigella type 3 secretion system 0.5116 1 67
7agx-assembly1.cif.gz_1J apo-state type 3 secretion system export apparatus complex from salmonella enterica typhimurium 0.491 4 67
ID Description Score Start End Superfamily
af_Q0DQQ3_146_306_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5629 21 72 1.20.1250.20
af_Q54M31_129_224_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5432 15 75 1.20.1280.290
af_A0A0R0I6A5_242_405_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5208 14 69 1.20.1250.20
af_O17165_1_236_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.5205 21 56 3.80.10.10
2qgsB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like 0.4888 16 70 1.10.472.50
ID Description Score Start End GO Terms
AF-A0A327JKU5-F1-model_v4 DUF3302 domain-containing protein 0.671 2 78 GO:0016020
AF-A0A327JKU5-F1-model_v4 DUF3302 domain-containing protein 0.6547 2 78 GO:0016020
AF-A0A0F9L3X8-F1-model_v4 Uncharacterized protein 0.5896 10 64 GO:0016020
AF-A0A7Z7IB02-F1-model_v4 Inner membrane protein YiaW 0.5844 1 68 GO:0016020
AF-A0A1H3MCF3-F1-model_v4 Phospholipase_D-nuclease N-terminal 0.5765 7 78 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.74 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map