F492221
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1253 | 477 | 1252 | 80 |
Family's Representative Sequence
| Representative Sequence | 3300046499|Ga0495594_0647910|Ga0495594_0647910_114_434 |
| Length | 98 |
| Sequence | VSPTTVGNRFQDALPAKNAQRDGDAMSMLDLFAWLVLLILAIMAMLPGMIAKERKHPWAQAVTVAGWVTLLFGFVLWPVALVWAYVDVPQPKAGEITR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 11 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005507 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 104 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 107 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 125 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 126 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 127 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 128 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 209 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 210 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 211 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 221 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 222 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 223 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 225 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 226 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 227 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 234 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 235 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 236 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 237 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 238 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 239 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 243 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 245 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 249 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 251 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 253 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 254 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 255 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 256 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 257 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 258 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 259 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 262 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 266 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 358 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 359 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 360 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 361 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 362 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 363 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 364 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 365 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 366 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 367 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 368 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 369 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 370 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 371 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 372 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 373 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 374 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 375 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 376 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 377 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 404 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 405 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 414 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 415 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 416 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 417 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 424 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 427 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 431 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 432 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 433 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 434 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 435 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 436 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 437 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 438 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 439 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 440 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 441 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 442 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 443 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 444 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 445 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 446 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 447 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 448 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 449 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 450 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 451 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 452 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 453 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 454 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 455 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 456 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 457 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 458 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 459 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 460 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 461 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 462 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 463 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 464 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 466 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 467 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 468 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 469 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 470 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 471 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 472 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 473 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 474 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 476 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.92 |
| Metatranscriptomes | 0 |
| Isolates | 0.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.17 |
| Nodule | 0.4 |
| Rhizoplane | 8.22 |
| Rhizosphere | 73.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c007842 | 3300000041 | Bacteria | 905 |
| 2 | ARcpr5yngRDRAFT_c001352 | 3300000043 | Bacteria | 2703 |
| 3 | ARSoilOldRDRAFT_c002613 | 3300000044 | Bacteria | 1577 |
| 4 | JGI24737J22298_10099360 | 3300001990 | Bacteria | 862 |
| 5 | JGI25153J46596_10002368 | 3300003215 | Bacteria | 10912 |
| 6 | JGI25160J50197_1043164 | 3300003354 | Bacteria | 1018 |
| 7 | JGI25404J52841_10003878 | 3300003659 | Bacteria | 2997 |
| 8 | JGI25404J52841_10029094 | 3300003659 | Bacteria | 1185 |
| 9 | Ga0055526_1096513 | 3300003771 | Bacteria | 548 |
| 10 | JGI25405J52794_10013909 | 3300003911 | Unclassified | 1567 |
| 11 | JGI25405J52794_10037902 | 3300003911 | Unclassified | 1014 |
| 12 | Ga0055543_1021761 | 3300004625 | Bacteria | 1168 |
| 13 | Ga0065165_1000972 | 3300005262 | Bacteria | 35758 |
| 14 | Ga0065715_10183454 | 3300005293 | Bacteria | 1454 |
| 15 | Ga0065707_10585927 | 3300005295 | Bacteria | 698 |
| 16 | Ga0070658_11298986 | 3300005327 | Bacteria | 632 |
| 17 | Ga0070676_11303168 | 3300005328 | Bacteria | 555 |
| 18 | Ga0070683_100158241 | 3300005329 | Bacteria | 2149 |
| 19 | Ga0070690_100532591 | 3300005330 | Bacteria | 883 |
| 20 | Ga0070670_100059487 | 3300005331 | Bacteria | 3279 |
| 21 | Ga0070670_101812498 | 3300005331 | Bacteria | 562 |
| 22 | Ga0068869_100281133 | 3300005334 | Bacteria | 1338 |
| 23 | Ga0068869_101440171 | 3300005334 | Bacteria | 611 |
| 24 | Ga0070666_10012782 | 3300005335 | Bacteria | 5307 |
| 25 | Ga0070666_10682505 | 3300005335 | Bacteria | 752 |
| 26 | Ga0070666_11350868 | 3300005335 | Bacteria | 532 |
| 27 | Ga0070680_100045207 | 3300005336 | Bacteria | 3580 |
| 28 | Ga0070680_100099057 | 3300005336 | Bacteria | 2418 |
| 29 | Ga0070680_100246325 | 3300005336 | Bacteria | 1511 |
| 30 | Ga0070682_100022897 | 3300005337 | Bacteria | 3706 |
| 31 | Ga0070682_100035492 | 3300005337 | Bacteria | 3045 |
| 32 | Ga0070682_100731666 | 3300005337 | Bacteria | 796 |
| 33 | Ga0070682_101903069 | 3300005337 | Bacteria | 521 |
| 34 | Ga0068868_100385148 | 3300005338 | Bacteria | 1207 |
| 35 | Ga0068868_100880283 | 3300005338 | Bacteria | 813 |
| 36 | Ga0070660_100202332 | 3300005339 | Bacteria | 1611 |
| 37 | Ga0070660_101161094 | 3300005339 | Bacteria | 654 |
| 38 | Ga0070689_100046929 | 3300005340 | Bacteria | 3330 |
| 39 | Ga0070689_100172396 | 3300005340 | Bacteria | 1753 |
| 40 | Ga0070691_10510512 | 3300005341 | Bacteria | 696 |
| 41 | Ga0070691_10781627 | 3300005341 | Bacteria | 580 |
| 42 | Ga0070687_100166402 | 3300005343 | Bacteria | 1308 |
| 43 | Ga0070687_100471077 | 3300005343 | Bacteria | 839 |
| 44 | Ga0070687_100694339 | 3300005343 | Bacteria | 710 |
| 45 | Ga0070661_100191462 | 3300005344 | Bacteria | 1560 |
| 46 | Ga0070692_10028676 | 3300005345 | Bacteria | 2768 |
| 47 | Ga0070668_100005808 | 3300005347 | Bacteria | 9156 |
| 48 | Ga0070668_100194739 | 3300005347 | Bacteria | 1661 |
| 49 | Ga0070668_100212540 | 3300005347 | Bacteria | 1592 |
| 50 | Ga0070668_100810770 | 3300005347 | Bacteria | 832 |
| 51 | Ga0070668_100895881 | 3300005347 | Bacteria | 793 |
| 52 | Ga0070669_100775238 | 3300005353 | Bacteria | 814 |
| 53 | Ga0070669_101319339 | 3300005353 | Bacteria | 625 |
| 54 | Ga0070669_101586762 | 3300005353 | Bacteria | 570 |
| 55 | Ga0070675_100041049 | 3300005354 | Bacteria | 3779 |
| 56 | Ga0070671_100061772 | 3300005355 | Bacteria | 3120 |
| 57 | Ga0070671_100572906 | 3300005355 | Bacteria | 974 |
| 58 | Ga0070674_100031213 | 3300005356 | Bacteria | 3528 |
| 59 | Ga0070674_100203948 | 3300005356 | Bacteria | 1529 |
| 60 | Ga0070674_100437412 | 3300005356 | Bacteria | 1077 |
| 61 | Ga0070673_100094789 | 3300005364 | Bacteria | 2447 |
| 62 | Ga0070673_101517473 | 3300005364 | Bacteria | 632 |
| 63 | Ga0070688_100080154 | 3300005365 | Bacteria | 2111 |
| 64 | Ga0070688_100222245 | 3300005365 | Bacteria | 1331 |
| 65 | Ga0070688_101293051 | 3300005365 | Bacteria | 588 |
| 66 | Ga0070659_100353142 | 3300005366 | Bacteria | 1234 |
| 67 | Ga0070659_100477303 | 3300005366 | Bacteria | 1061 |
| 68 | Ga0070659_101508077 | 3300005366 | Bacteria | 599 |
| 69 | Ga0070667_100073874 | 3300005367 | Bacteria | 2908 |
| 70 | Ga0070667_100532053 | 3300005367 | Bacteria | 1079 |
| 71 | Ga0070667_101635616 | 3300005367 | Bacteria | 605 |
| 72 | Ga0070709_10009527 | 3300005434 | Bacteria | 5360 |
| 73 | Ga0070714_100036455 | 3300005435 | Bacteria | 4125 |
| 74 | Ga0070713_100003957 | 3300005436 | Bacteria | 9846 |
| 75 | Ga0070710_10140347 | 3300005437 | Bacteria | 1481 |
| 76 | Ga0070701_10154421 | 3300005438 | Bacteria | 1324 |
| 77 | Ga0070701_11285924 | 3300005438 | Bacteria | 522 |
| 78 | Ga0070711_100478200 | 3300005439 | Bacteria | 1023 |
| 79 | Ga0070705_100050366 | 3300005440 | Bacteria | 2423 |
| 80 | Ga0070705_100955155 | 3300005440 | Bacteria | 693 |
| 81 | Ga0070700_100161700 | 3300005441 | Bacteria | 1542 |
| 82 | Ga0070700_101198429 | 3300005441 | Bacteria | 634 |
| 83 | Ga0070694_100265391 | 3300005444 | Bacteria | 1304 |
| 84 | Ga0070694_100724769 | 3300005444 | Bacteria | 810 |
| 85 | Ga0070694_101151423 | 3300005444 | Bacteria | 648 |
| 86 | Ga0070663_100013331 | 3300005455 | Bacteria | 5237 |
| 87 | Ga0070663_100018956 | 3300005455 | Bacteria | 4524 |
| 88 | Ga0070663_100091272 | 3300005455 | Bacteria | 2257 |
| 89 | Ga0070663_100120186 | 3300005455 | Bacteria | 1983 |
| 90 | Ga0070663_100373757 | 3300005455 | Bacteria | 1159 |
| 91 | Ga0070663_100448902 | 3300005455 | Bacteria | 1062 |
| 92 | Ga0070678_100064462 | 3300005456 | Bacteria | 2716 |
| 93 | Ga0070678_100197182 | 3300005456 | Bacteria | 1659 |
| 94 | Ga0070678_100216450 | 3300005456 | Bacteria | 1590 |
| 95 | Ga0070678_100470064 | 3300005456 | Bacteria | 1105 |
| 96 | Ga0070678_100849457 | 3300005456 | Bacteria | 832 |
| 97 | Ga0070678_101289911 | 3300005456 | Bacteria | 679 |
| 98 | Ga0070662_100139925 | 3300005457 | Bacteria | 1874 |
| 99 | Ga0070662_100590717 | 3300005457 | Bacteria | 933 |
| 100 | Ga0070662_101349901 | 3300005457 | Bacteria | 614 |
| 101 | Ga0070681_10031833 | 3300005458 | Bacteria | 5294 |
| 102 | Ga0070681_10053505 | 3300005458 | Bacteria | 4023 |
| 103 | Ga0068867_100032452 | 3300005459 | Bacteria | 3777 |
| 104 | Ga0068867_100113282 | 3300005459 | Bacteria | 2086 |
| 105 | Ga0068867_100785675 | 3300005459 | Bacteria | 848 |
| 106 | Ga0070685_10077747 | 3300005466 | Bacteria | 1982 |
| 107 | Ga0070685_10182719 | 3300005466 | Bacteria | 1351 |
| 108 | Ga0070685_11053504 | 3300005466 | Bacteria | 612 |
| 109 | Ga0070706_100184868 | 3300005467 | Bacteria | 1947 |
| 110 | Ga0070707_100774472 | 3300005468 | Bacteria | 923 |
| 111 | Ga0074259_11290175 | 3300005507 | Bacteria | 673 |
| 112 | Ga0070679_100030768 | 3300005530 | Bacteria | 5302 |
| 113 | Ga0070679_100062268 | 3300005530 | Bacteria | 3719 |
| 114 | Ga0070679_100517890 | 3300005530 | Bacteria | 1137 |
| 115 | Ga0070684_100094549 | 3300005535 | Bacteria | 2662 |
| 116 | Ga0070684_100231267 | 3300005535 | Bacteria | 1688 |
| 117 | Ga0068853_100303907 | 3300005539 | Bacteria | 1475 |
| 118 | Ga0068853_100410778 | 3300005539 | Bacteria | 1268 |
| 119 | Ga0068853_100885211 | 3300005539 | Bacteria | 857 |
| 120 | Ga0070672_100129326 | 3300005543 | Bacteria | 2074 |
| 121 | Ga0070686_100183250 | 3300005544 | Bacteria | 1489 |
| 122 | Ga0070686_100456547 | 3300005544 | Bacteria | 983 |
| 123 | Ga0070686_100459796 | 3300005544 | Bacteria | 980 |
| 124 | Ga0070686_101252157 | 3300005544 | Bacteria | 618 |
| 125 | Ga0070695_100149169 | 3300005545 | Bacteria | 1630 |
| 126 | Ga0070695_101426307 | 3300005545 | Bacteria | 575 |
| 127 | Ga0070696_100016292 | 3300005546 | Bacteria | 5001 |
| 128 | Ga0070696_100288110 | 3300005546 | Bacteria | 1254 |
| 129 | Ga0070696_101047268 | 3300005546 | Bacteria | 684 |
| 130 | Ga0070693_100019995 | 3300005547 | Bacteria | 3523 |
| 131 | Ga0070693_100186090 | 3300005547 | Bacteria | 1340 |
| 132 | Ga0070693_100857264 | 3300005547 | Bacteria | 678 |
| 133 | Ga0070665_100011571 | 3300005548 | Bacteria | 8922 |
| 134 | Ga0070665_100020452 | 3300005548 | Bacteria | 6647 |
| 135 | Ga0070665_100040475 | 3300005548 | Bacteria | 4684 |
| 136 | Ga0070665_100134043 | 3300005548 | Bacteria | 2479 |
| 137 | Ga0070665_100155154 | 3300005548 | Bacteria | 2291 |
| 138 | Ga0070665_100195690 | 3300005548 | Bacteria | 2022 |
| 139 | Ga0070665_100423681 | 3300005548 | Bacteria | 1340 |
| 140 | Ga0070665_100561916 | 3300005548 | Bacteria | 1153 |
| 141 | Ga0070665_100805195 | 3300005548 | Bacteria | 953 |
| 142 | Ga0070665_101066909 | 3300005548 | Bacteria | 820 |
| 143 | Ga0070665_101892241 | 3300005548 | Bacteria | 602 |
| 144 | Ga0070704_100074081 | 3300005549 | Bacteria | 2482 |
| 145 | Ga0070664_100142524 | 3300005564 | Bacteria | 2111 |
| 146 | Ga0070664_100146153 | 3300005564 | Bacteria | 2085 |
| 147 | Ga0070664_100803504 | 3300005564 | Bacteria | 879 |
| 148 | Ga0068854_100994169 | 3300005578 | Bacteria | 742 |
| 149 | Ga0070702_100026321 | 3300005615 | Bacteria | 3125 |
| 150 | Ga0070702_101892678 | 3300005615 | Bacteria | 500 |
| 151 | Ga0068859_100099798 | 3300005617 | Bacteria | 2959 |
| 152 | Ga0068859_100120409 | 3300005617 | Bacteria | 2691 |
| 153 | Ga0068859_100696812 | 3300005617 | Bacteria | 1106 |
| 154 | Ga0068859_100699678 | 3300005617 | Bacteria | 1104 |
| 155 | Ga0068864_100471159 | 3300005618 | Bacteria | 1204 |
| 156 | Ga0068864_100558295 | 3300005618 | Bacteria | 1107 |
| 157 | Ga0068864_100601003 | 3300005618 | Bacteria | 1067 |
| 158 | Ga0068864_102656113 | 3300005618 | Bacteria | 506 |
| 159 | Ga0068866_10059988 | 3300005718 | Bacteria | 1970 |
| 160 | Ga0068866_10131341 | 3300005718 | Bacteria | 1425 |
| 161 | Ga0068866_10762796 | 3300005718 | Bacteria | 669 |
| 162 | Ga0068861_100080697 | 3300005719 | Bacteria | 2545 |
| 163 | Ga0068861_100219292 | 3300005719 | Bacteria | 1607 |
| 164 | Ga0068861_100272358 | 3300005719 | Bacteria | 1454 |
| 165 | Ga0068861_100898880 | 3300005719 | Bacteria | 838 |
| 166 | Ga0068870_10458936 | 3300005840 | Bacteria | 841 |
| 167 | Ga0068870_10479818 | 3300005840 | Bacteria | 825 |
| 168 | Ga0068863_100187832 | 3300005841 | Bacteria | 1985 |
| 169 | Ga0068863_100583063 | 3300005841 | Bacteria | 1106 |
| 170 | Ga0068863_101216087 | 3300005841 | Bacteria | 759 |
| 171 | Ga0068863_101510799 | 3300005841 | Bacteria | 680 |
| 172 | Ga0068863_101529367 | 3300005841 | Bacteria | 676 |
| 173 | Ga0068858_100093478 | 3300005842 | Bacteria | 2799 |
| 174 | Ga0068858_100471947 | 3300005842 | Bacteria | 1210 |
| 175 | Ga0068858_101223421 | 3300005842 | Bacteria | 738 |
| 176 | Ga0068860_100196329 | 3300005843 | Bacteria | 1954 |
| 177 | Ga0068860_100311033 | 3300005843 | Bacteria | 1545 |
| 178 | Ga0068860_100454918 | 3300005843 | Bacteria | 1273 |
| 179 | Ga0068860_101447303 | 3300005843 | Bacteria | 708 |
| 180 | Ga0068862_100036120 | 3300005844 | Bacteria | 4187 |
| 181 | Ga0068862_100048786 | 3300005844 | Bacteria | 3615 |
| 182 | Ga0068862_100116138 | 3300005844 | Bacteria | 2354 |
| 183 | Ga0068862_100254624 | 3300005844 | Bacteria | 1601 |
| 184 | Ga0068862_101097578 | 3300005844 | Bacteria | 791 |
| 185 | Ga0068862_102686321 | 3300005844 | Bacteria | 509 |
| 186 | Ga0081455_10016837 | 3300005937 | Bacteria | 7031 |
| 187 | Ga0081455_10021723 | 3300005937 | Bacteria | 6012 |
| 188 | Ga0081455_10042464 | 3300005937 | Bacteria | 3988 |
| 189 | Ga0081455_10073390 | 3300005937 | Bacteria | 2829 |
| 190 | Ga0081455_10129323 | 3300005937 | Bacteria | 1977 |
| 191 | Ga0081455_10185745 | 3300005937 | Bacteria | 1570 |
| 192 | Ga0081455_10198181 | 3300005937 | Bacteria | 1506 |
| 193 | Ga0081540_1004156 | 3300005983 | Bacteria | 11159 |
| 194 | Ga0081540_1007064 | 3300005983 | Bacteria | 8067 |
| 195 | Ga0081540_1011715 | 3300005983 | Bacteria | 5836 |
| 196 | Ga0081540_1011971 | 3300005983 | Bacteria | 5752 |
| 197 | Ga0081540_1024072 | 3300005983 | Bacteria | 3542 |
| 198 | Ga0081540_1031192 | 3300005983 | Bacteria | 2936 |
| 199 | Ga0081540_1042121 | 3300005983 | Bacteria | 2359 |
| 200 | Ga0081540_1058408 | 3300005983 | Bacteria | 1858 |
| 201 | Ga0081540_1189996 | 3300005983 | Bacteria | 758 |
| 202 | Ga0081540_1192669 | 3300005983 | Bacteria | 750 |
| 203 | Ga0081540_1222820 | 3300005983 | Bacteria | 670 |
| 204 | Ga0070717_10045340 | 3300006028 | Bacteria | 3594 |
| 205 | Ga0075365_10006317 | 3300006038 | Bacteria | 6507 |
| 206 | Ga0075365_10045720 | 3300006038 | Bacteria | 2873 |
| 207 | Ga0075365_10192420 | 3300006038 | Bacteria | 1428 |
| 208 | Ga0075365_10418385 | 3300006038 | Bacteria | 946 |
| 209 | Ga0075365_10563470 | 3300006038 | Bacteria | 806 |
| 210 | Ga0075368_10309163 | 3300006042 | Bacteria | 683 |
| 211 | Ga0075363_100000323 | 3300006048 | Bacteria | 14268 |
| 212 | Ga0075363_100039432 | 3300006048 | Bacteria | 2486 |
| 213 | Ga0075363_100372025 | 3300006048 | Bacteria | 837 |
| 214 | Ga0075364_10018097 | 3300006051 | Bacteria | 4408 |
| 215 | Ga0075364_11235509 | 3300006051 | Bacteria | 506 |
| 216 | Ga0070715_11012604 | 3300006163 | Bacteria | 518 |
| 217 | Ga0070716_100000563 | 3300006173 | Bacteria | 15469 |
| 218 | Ga0070716_100632194 | 3300006173 | Bacteria | 809 |
| 219 | Ga0070716_101120903 | 3300006173 | Bacteria | 628 |
| 220 | Ga0070712_100018194 | 3300006175 | Bacteria | 4560 |
| 221 | Ga0070712_100470633 | 3300006175 | Bacteria | 1049 |
| 222 | Ga0075362_10081571 | 3300006177 | Bacteria | 1491 |
| 223 | Ga0075367_10007063 | 3300006178 | Bacteria | 5723 |
| 224 | Ga0075367_10013426 | 3300006178 | Bacteria | 4402 |
| 225 | Ga0075369_10006062 | 3300006186 | Bacteria | 4555 |
| 226 | Ga0075369_10127205 | 3300006186 | Bacteria | 1156 |
| 227 | Ga0075369_10255534 | 3300006186 | Bacteria | 814 |
| 228 | Ga0075366_10311282 | 3300006195 | Bacteria | 964 |
| 229 | Ga0097621_100010097 | 3300006237 | Bacteria | 6888 |
| 230 | Ga0097621_100796628 | 3300006237 | Bacteria | 875 |
| 231 | Ga0075370_10009352 | 3300006353 | Bacteria | 5086 |
| 232 | Ga0075370_10010855 | 3300006353 | Bacteria | 4774 |
| 233 | Ga0068871_100122561 | 3300006358 | Bacteria | 2197 |
| 234 | Ga0068871_100140979 | 3300006358 | Bacteria | 2050 |
| 235 | Ga0068871_100646315 | 3300006358 | Bacteria | 965 |
| 236 | Ga0068871_101315770 | 3300006358 | Bacteria | 680 |
| 237 | Ga0075428_100974934 | 3300006844 | Bacteria | 898 |
| 238 | Ga0075433_10953790 | 3300006852 | Bacteria | 748 |
| 239 | Ga0075434_100096621 | 3300006871 | Bacteria | 2959 |
| 240 | Ga0075434_100194277 | 3300006871 | Bacteria | 2050 |
| 241 | Ga0075434_100507075 | 3300006871 | Bacteria | 1227 |
| 242 | Ga0075434_100688011 | 3300006871 | Bacteria | 1040 |
| 243 | Ga0075434_100871026 | 3300006871 | Bacteria | 916 |
| 244 | Ga0068865_100016598 | 3300006881 | Bacteria | 4716 |
| 245 | Ga0068865_100142283 | 3300006881 | Bacteria | 1810 |
| 246 | Ga0075436_100036272 | 3300006914 | Bacteria | 3403 |
| 247 | Ga0075436_100446597 | 3300006914 | Bacteria | 941 |
| 248 | Ga0075436_100817563 | 3300006914 | Bacteria | 694 |
| 249 | Ga0075436_101435460 | 3300006914 | Bacteria | 523 |
| 250 | Ga0097620_100099797 | 3300006931 | Bacteria | 2959 |
| 251 | Ga0097620_100120403 | 3300006931 | Bacteria | 2691 |
| 252 | Ga0097620_100696784 | 3300006931 | Bacteria | 1106 |
| 253 | Ga0097620_100699593 | 3300006931 | Bacteria | 1104 |
| 254 | Ga0099824_1011301 | 3300006942 | Bacteria | 10153 |
| 255 | Ga0099822_1009259 | 3300006943 | Bacteria | 12439 |
| 256 | Ga0075435_100812590 | 3300007076 | Bacteria | 814 |
| 257 | Ga0075435_100829339 | 3300007076 | Bacteria | 805 |
| 258 | Ga0099794_10073505 | 3300007265 | Bacteria | 1678 |
| 259 | Ga0099795_10031628 | 3300007788 | Bacteria | 1824 |
| 260 | Ga0099795_10508302 | 3300007788 | Bacteria | 563 |
| 261 | Ga0105251_10065493 | 3300009011 | Bacteria | 1700 |
| 262 | Ga0105250_10386012 | 3300009092 | Bacteria | 619 |
| 263 | Ga0105240_10202311 | 3300009093 | Bacteria | 2327 |
| 264 | Ga0111539_10123032 | 3300009094 | Bacteria | 3041 |
| 265 | Ga0111539_10249985 | 3300009094 | Bacteria | 2065 |
| 266 | Ga0111539_11423108 | 3300009094 | Unclassified | 804 |
| 267 | Ga0105245_10202696 | 3300009098 | Bacteria | 1906 |
| 268 | Ga0105245_10435988 | 3300009098 | Bacteria | 1316 |
| 269 | Ga0105247_10226896 | 3300009101 | Bacteria | 1267 |
| 270 | Ga0105247_10333711 | 3300009101 | Bacteria | 1061 |
| 271 | Ga0105247_10714208 | 3300009101 | Bacteria | 756 |
| 272 | Ga0105247_11507727 | 3300009101 | Bacteria | 548 |
| 273 | Ga0105243_10015814 | 3300009148 | Bacteria | 5707 |
| 274 | Ga0105243_10046627 | 3300009148 | Bacteria | 3410 |
| 275 | Ga0105243_10402274 | 3300009148 | Bacteria | 1272 |
| 276 | Ga0105243_10700508 | 3300009148 | Bacteria | 987 |
| 277 | Ga0105243_12471298 | 3300009148 | Unclassified | 558 |
| 278 | Ga0105243_12815504 | 3300009148 | Bacteria | 527 |
| 279 | Ga0105241_10195969 | 3300009174 | Bacteria | 1684 |
| 280 | Ga0105241_10457943 | 3300009174 | Bacteria | 1129 |
| 281 | Ga0105241_11461166 | 3300009174 | Bacteria | 657 |
| 282 | Ga0105241_11625912 | 3300009174 | Bacteria | 626 |
| 283 | Ga0105241_11818824 | 3300009174 | Bacteria | 595 |
| 284 | Ga0105241_12570919 | 3300009174 | Bacteria | 511 |
| 285 | Ga0105242_10088851 | 3300009176 | Bacteria | 2596 |
| 286 | Ga0105242_10673523 | 3300009176 | Bacteria | 1009 |
| 287 | Ga0105242_12002808 | 3300009176 | Bacteria | 621 |
| 288 | Ga0105248_10013026 | 3300009177 | Bacteria | 9166 |
| 289 | Ga0105248_10229690 | 3300009177 | Bacteria | 2089 |
| 290 | Ga0105248_10236486 | 3300009177 | Bacteria | 2056 |
| 291 | Ga0105248_10435808 | 3300009177 | Bacteria | 1476 |
| 292 | Ga0105248_11751108 | 3300009177 | Bacteria | 704 |
| 293 | Ga0105237_10141121 | 3300009545 | Bacteria | 2403 |
| 294 | Ga0105237_10254595 | 3300009545 | Bacteria | 1758 |
| 295 | Ga0105237_10439512 | 3300009545 | Bacteria | 1310 |
| 296 | Ga0105237_10911983 | 3300009545 | Bacteria | 886 |
| 297 | Ga0105237_11207269 | 3300009545 | Bacteria | 763 |
| 298 | Ga0105238_10037495 | 3300009551 | Bacteria | 4927 |
| 299 | Ga0105238_10069682 | 3300009551 | Bacteria | 3517 |
| 300 | Ga0105238_10157858 | 3300009551 | Bacteria | 2244 |
| 301 | Ga0105238_10268355 | 3300009551 | Bacteria | 1687 |
| 302 | Ga0105238_11047574 | 3300009551 | Bacteria | 837 |
| 303 | Ga0105238_11227494 | 3300009551 | Bacteria | 774 |
| 304 | Ga0105238_11446845 | 3300009551 | Bacteria | 715 |
| 305 | Ga0105238_12529864 | 3300009551 | Bacteria | 549 |
| 306 | Ga0105249_10017611 | 3300009553 | Bacteria | 6344 |
| 307 | Ga0105249_10145606 | 3300009553 | Bacteria | 2276 |
| 308 | Ga0105249_10956122 | 3300009553 | Bacteria | 925 |
| 309 | Ga0105249_12611099 | 3300009553 | Bacteria | 577 |
| 310 | Ga0099796_10207317 | 3300010159 | Bacteria | 798 |
| 311 | Ga0105239_10055225 | 3300010375 | Bacteria | 4356 |
| 312 | Ga0105239_10185479 | 3300010375 | Bacteria | 2328 |
| 313 | Ga0105239_10187172 | 3300010375 | Bacteria | 2317 |
| 314 | Ga0105239_10249047 | 3300010375 | Bacteria | 1995 |
| 315 | Ga0105239_10253881 | 3300010375 | Bacteria | 1975 |
| 316 | Ga0105239_10618369 | 3300010375 | Bacteria | 1236 |
| 317 | Ga0105239_12725864 | 3300010375 | Bacteria | 577 |
| 318 | Ga0105246_10035343 | 3300011119 | Bacteria | 3339 |
| 319 | Ga0105246_11045372 | 3300011119 | Bacteria | 742 |
| 320 | Ga0105246_11234240 | 3300011119 | Bacteria | 690 |
| 321 | Ga0105246_11680199 | 3300011119 | Bacteria | 603 |
| 322 | Ga0105246_12093803 | 3300011119 | Bacteria | 548 |
| 323 | Ga0157346_1000549 | 3300012480 | Bacteria | 1607 |
| 324 | Ga0157337_1010325 | 3300012483 | Bacteria | 720 |
| 325 | Ga0157322_1007198 | 3300012490 | Bacteria | 819 |
| 326 | Ga0157335_1011247 | 3300012492 | Bacteria | 731 |
| 327 | Ga0157339_1005873 | 3300012505 | Bacteria | 984 |
| 328 | Ga0157369_10462169 | 3300013105 | Bacteria | 1314 |
| 329 | Ga0157374_11303762 | 3300013296 | Bacteria | 748 |
| 330 | Ga0157374_12416185 | 3300013296 | Bacteria | 553 |
| 331 | Ga0157378_10025025 | 3300013297 | Bacteria | 5258 |
| 332 | Ga0157378_10630919 | 3300013297 | Bacteria | 1085 |
| 333 | Ga0157378_10859657 | 3300013297 | Bacteria | 936 |
| 334 | Ga0157378_11355380 | 3300013297 | Bacteria | 753 |
| 335 | Ga0157378_11372372 | 3300013297 | Bacteria | 749 |
| 336 | Ga0163162_10072411 | 3300013306 | Bacteria | 3501 |
| 337 | Ga0163162_10614613 | 3300013306 | Bacteria | 1212 |
| 338 | Ga0163162_10727460 | 3300013306 | Bacteria | 1113 |
| 339 | Ga0163162_10949391 | 3300013306 | Bacteria | 971 |
| 340 | Ga0163162_11246006 | 3300013306 | Bacteria | 845 |
| 341 | Ga0163162_12537606 | 3300013306 | Bacteria | 589 |
| 342 | Ga0157372_10383486 | 3300013307 | Bacteria | 1637 |
| 343 | Ga0157372_11213489 | 3300013307 | Bacteria | 871 |
| 344 | Ga0157372_11526840 | 3300013307 | Bacteria | 769 |
| 345 | Ga0157375_10504102 | 3300013308 | Bacteria | 1374 |
| 346 | Ga0157375_10936020 | 3300013308 | Bacteria | 1009 |
| 347 | Ga0157375_10981988 | 3300013308 | Bacteria | 985 |
| 348 | Ga0157375_11145437 | 3300013308 | Bacteria | 911 |
| 349 | Ga0157375_11801159 | 3300013308 | Bacteria | 726 |
| 350 | Ga0157375_12817263 | 3300013308 | Bacteria | 581 |
| 351 | Ga0157375_13548440 | 3300013308 | Bacteria | 519 |
| 352 | Ga0163163_10030831 | 3300014325 | Bacteria | 5171 |
| 353 | Ga0163163_10833908 | 3300014325 | Bacteria | 985 |
| 354 | Ga0163163_12446828 | 3300014325 | Bacteria | 580 |
| 355 | Ga0163163_12659441 | 3300014325 | Bacteria | 558 |
| 356 | Ga0157380_10041406 | 3300014326 | Bacteria | 3595 |
| 357 | Ga0157380_10050663 | 3300014326 | Bacteria | 3281 |
| 358 | Ga0157380_10133546 | 3300014326 | Bacteria | 2121 |
| 359 | Ga0157380_10149280 | 3300014326 | Bacteria | 2018 |
| 360 | Ga0157380_10161378 | 3300014326 | Bacteria | 1949 |
| 361 | Ga0157377_10381825 | 3300014745 | Bacteria | 954 |
| 362 | Ga0157377_10828728 | 3300014745 | Bacteria | 685 |
| 363 | Ga0157379_10380830 | 3300014968 | Bacteria | 1294 |
| 364 | Ga0157379_10935649 | 3300014968 | Bacteria | 824 |
| 365 | Ga0157379_11735797 | 3300014968 | Bacteria | 612 |
| 366 | Ga0157379_12620311 | 3300014968 | Bacteria | 505 |
| 367 | Ga0157376_10331743 | 3300014969 | Bacteria | 1450 |
| 368 | Ga0157376_10632865 | 3300014969 | Bacteria | 1068 |
| 369 | Ga0157376_10761670 | 3300014969 | Bacteria | 978 |
| 370 | Ga0157376_11382065 | 3300014969 | Bacteria | 735 |
| 371 | Ga0163161_10022389 | 3300017792 | Bacteria | 4450 |
| 372 | Ga0163161_10065384 | 3300017792 | Bacteria | 2654 |
| 373 | Ga0163161_10705973 | 3300017792 | Bacteria | 840 |
| 374 | Ga0209233_1044369 | 3300025261 | Bacteria | 941 |
| 375 | Ga0209564_1006259 | 3300025295 | Bacteria | 6491 |
| 376 | Ga0209758_1001191 | 3300025297 | Bacteria | 32851 |
| 377 | Ga0209758_1014873 | 3300025297 | Bacteria | 4089 |
| 378 | Ga0209758_1017637 | 3300025297 | Bacteria | 3541 |
| 379 | Ga0209758_1182116 | 3300025297 | Bacteria | 504 |
| 380 | Ga0209256_1000102 | 3300025299 | Bacteria | 199097 |
| 381 | Ga0209256_1099012 | 3300025299 | Bacteria | 607 |
| 382 | Ga0207426_1000598 | 3300025302 | Bacteria | 47559 |
| 383 | Ga0207697_10153209 | 3300025315 | Bacteria | 1003 |
| 384 | Ga0207692_10015582 | 3300025898 | Bacteria | 3348 |
| 385 | Ga0207642_10666116 | 3300025899 | Bacteria | 653 |
| 386 | Ga0207710_10243604 | 3300025900 | Bacteria | 897 |
| 387 | Ga0207688_10075210 | 3300025901 | Bacteria | 1922 |
| 388 | Ga0207688_10176629 | 3300025901 | Bacteria | 1272 |
| 389 | Ga0207680_10096262 | 3300025903 | Bacteria | 1893 |
| 390 | Ga0207680_10918689 | 3300025903 | Bacteria | 627 |
| 391 | Ga0207680_11230386 | 3300025903 | Unclassified | 534 |
| 392 | Ga0207647_10165890 | 3300025904 | Bacteria | 1287 |
| 393 | Ga0207685_10018544 | 3300025905 | Bacteria | 2274 |
| 394 | Ga0207685_10048080 | 3300025905 | Bacteria | 1632 |
| 395 | Ga0207699_10021882 | 3300025906 | Bacteria | 3455 |
| 396 | Ga0207645_10666861 | 3300025907 | Bacteria | 707 |
| 397 | Ga0207705_10306961 | 3300025909 | Bacteria | 1218 |
| 398 | Ga0207705_10436326 | 3300025909 | Bacteria | 1015 |
| 399 | Ga0207705_10722427 | 3300025909 | Bacteria | 774 |
| 400 | Ga0207654_10331804 | 3300025911 | Bacteria | 1043 |
| 401 | Ga0207654_10348526 | 3300025911 | Bacteria | 1019 |
| 402 | Ga0207654_10434633 | 3300025911 | Bacteria | 918 |
| 403 | Ga0207707_10923758 | 3300025912 | Bacteria | 720 |
| 404 | Ga0207695_10150989 | 3300025913 | Bacteria | 2262 |
| 405 | Ga0207671_10072995 | 3300025914 | Bacteria | 2562 |
| 406 | Ga0207671_10073056 | 3300025914 | Bacteria | 2561 |
| 407 | Ga0207671_10281962 | 3300025914 | Bacteria | 1310 |
| 408 | Ga0207671_10762931 | 3300025914 | Bacteria | 768 |
| 409 | Ga0207693_10005549 | 3300025915 | Bacteria | 10496 |
| 410 | Ga0207693_10115612 | 3300025915 | Bacteria | 2106 |
| 411 | Ga0207663_11546862 | 3300025916 | Bacteria | 534 |
| 412 | Ga0207660_10862612 | 3300025917 | Bacteria | 739 |
| 413 | Ga0207662_10003182 | 3300025918 | Bacteria | 8397 |
| 414 | Ga0207662_10151602 | 3300025918 | Bacteria | 1475 |
| 415 | Ga0207662_10703506 | 3300025918 | Bacteria | 708 |
| 416 | Ga0207657_10073973 | 3300025919 | Bacteria | 2878 |
| 417 | Ga0207657_10728268 | 3300025919 | Bacteria | 769 |
| 418 | Ga0207649_10479446 | 3300025920 | Bacteria | 943 |
| 419 | Ga0207652_10039247 | 3300025921 | Bacteria | 4018 |
| 420 | Ga0207652_10059294 | 3300025921 | Bacteria | 3299 |
| 421 | Ga0207646_10615970 | 3300025922 | Bacteria | 974 |
| 422 | Ga0207681_10284537 | 3300025923 | Bacteria | 1303 |
| 423 | Ga0207681_10808178 | 3300025923 | Bacteria | 783 |
| 424 | Ga0207681_11222938 | 3300025923 | Bacteria | 631 |
| 425 | Ga0207694_10050280 | 3300025924 | Bacteria | 3228 |
| 426 | Ga0207694_10361631 | 3300025924 | Bacteria | 1203 |
| 427 | Ga0207694_11147127 | 3300025924 | Bacteria | 658 |
| 428 | Ga0207650_10245466 | 3300025925 | Bacteria | 1448 |
| 429 | Ga0207659_10288665 | 3300025926 | Bacteria | 1343 |
| 430 | Ga0207659_11270808 | 3300025926 | Bacteria | 632 |
| 431 | Ga0207687_10042417 | 3300025927 | Bacteria | 3130 |
| 432 | Ga0207700_10002764 | 3300025928 | Bacteria | 10112 |
| 433 | Ga0207664_10016924 | 3300025929 | Bacteria | 5332 |
| 434 | Ga0207644_10130952 | 3300025931 | Bacteria | 1920 |
| 435 | Ga0207644_11059094 | 3300025931 | Bacteria | 681 |
| 436 | Ga0207644_11621711 | 3300025931 | Bacteria | 542 |
| 437 | Ga0207690_10050399 | 3300025932 | Bacteria | 2779 |
| 438 | Ga0207690_10834586 | 3300025932 | Bacteria | 762 |
| 439 | Ga0207690_11586722 | 3300025932 | Bacteria | 547 |
| 440 | Ga0207706_10012295 | 3300025933 | Bacteria | 7799 |
| 441 | Ga0207706_10050537 | 3300025933 | Bacteria | 3673 |
| 442 | Ga0207686_10030297 | 3300025934 | Bacteria | 3201 |
| 443 | Ga0207686_10467286 | 3300025934 | Bacteria | 973 |
| 444 | Ga0207709_10007487 | 3300025935 | Bacteria | 6076 |
| 445 | Ga0207709_10215722 | 3300025935 | Bacteria | 1380 |
| 446 | Ga0207709_11643478 | 3300025935 | Bacteria | 534 |
| 447 | Ga0207709_11800244 | 3300025935 | Bacteria | 509 |
| 448 | Ga0207670_10115693 | 3300025936 | Bacteria | 1940 |
| 449 | Ga0207669_10014385 | 3300025937 | Bacteria | 3964 |
| 450 | Ga0207669_10049666 | 3300025937 | Bacteria | 2502 |
| 451 | Ga0207669_10814320 | 3300025937 | Bacteria | 775 |
| 452 | Ga0207669_11088656 | 3300025937 | Bacteria | 674 |
| 453 | Ga0207704_10491864 | 3300025938 | Bacteria | 987 |
| 454 | Ga0207704_10528053 | 3300025938 | Bacteria | 955 |
| 455 | Ga0207704_10785212 | 3300025938 | Bacteria | 794 |
| 456 | Ga0207704_11662687 | 3300025938 | Bacteria | 549 |
| 457 | Ga0207665_10000555 | 3300025939 | Bacteria | 25158 |
| 458 | Ga0207665_10488952 | 3300025939 | Bacteria | 949 |
| 459 | Ga0207691_10069067 | 3300025940 | Bacteria | 3192 |
| 460 | Ga0207691_10105826 | 3300025940 | Bacteria | 2506 |
| 461 | Ga0207691_10144454 | 3300025940 | Bacteria | 2095 |
| 462 | Ga0207691_10271654 | 3300025940 | Bacteria | 1460 |
| 463 | Ga0207711_10026536 | 3300025941 | Bacteria | 4860 |
| 464 | Ga0207711_10267306 | 3300025941 | Bacteria | 1573 |
| 465 | Ga0207711_10543155 | 3300025941 | Bacteria | 1084 |
| 466 | Ga0207689_10402148 | 3300025942 | Bacteria | 1142 |
| 467 | Ga0207689_10489040 | 3300025942 | Bacteria | 1030 |
| 468 | Ga0207679_10142274 | 3300025945 | Bacteria | 1941 |
| 469 | Ga0207679_10207590 | 3300025945 | Bacteria | 1641 |
| 470 | Ga0207679_11193750 | 3300025945 | Bacteria | 698 |
| 471 | Ga0207679_11242434 | 3300025945 | Bacteria | 684 |
| 472 | Ga0207679_11435495 | 3300025945 | Bacteria | 633 |
| 473 | Ga0207667_10472108 | 3300025949 | Bacteria | 1274 |
| 474 | Ga0207651_10199829 | 3300025960 | Bacteria | 1601 |
| 475 | Ga0207651_11299659 | 3300025960 | Bacteria | 654 |
| 476 | Ga0207712_10038289 | 3300025961 | Bacteria | 3278 |
| 477 | Ga0207712_10047702 | 3300025961 | Bacteria | 2975 |
| 478 | Ga0207712_10634916 | 3300025961 | Bacteria | 927 |
| 479 | Ga0207668_10007777 | 3300025972 | Bacteria | 6377 |
| 480 | Ga0207668_10015011 | 3300025972 | Bacteria | 4806 |
| 481 | Ga0207668_10045606 | 3300025972 | Bacteria | 2991 |
| 482 | Ga0207668_10132483 | 3300025972 | Bacteria | 1905 |
| 483 | Ga0207668_10144188 | 3300025972 | Bacteria | 1835 |
| 484 | Ga0207668_10186843 | 3300025972 | Bacteria | 1639 |
| 485 | Ga0207640_11704675 | 3300025981 | Bacteria | 569 |
| 486 | Ga0207658_10673984 | 3300025986 | Bacteria | 933 |
| 487 | Ga0207658_10752002 | 3300025986 | Bacteria | 883 |
| 488 | Ga0207677_10426608 | 3300026023 | Bacteria | 1131 |
| 489 | Ga0207677_11847223 | 3300026023 | Bacteria | 561 |
| 490 | Ga0207703_10018417 | 3300026035 | Bacteria | 5453 |
| 491 | Ga0207703_12283777 | 3300026035 | Bacteria | 517 |
| 492 | Ga0207639_10211836 | 3300026041 | Bacteria | 1668 |
| 493 | Ga0207639_10326040 | 3300026041 | Bacteria | 1365 |
| 494 | Ga0207639_10519307 | 3300026041 | Bacteria | 1090 |
| 495 | Ga0207639_11043922 | 3300026041 | Bacteria | 766 |
| 496 | Ga0207678_10005293 | 3300026067 | Bacteria | 11554 |
| 497 | Ga0207678_10020358 | 3300026067 | Bacteria | 5821 |
| 498 | Ga0207678_10046189 | 3300026067 | Bacteria | 3766 |
| 499 | Ga0207678_10057323 | 3300026067 | Bacteria | 3352 |
| 500 | Ga0207678_10111727 | 3300026067 | Bacteria | 2331 |
| 501 | Ga0207678_10196208 | 3300026067 | Bacteria | 1725 |
| 502 | Ga0207678_10628178 | 3300026067 | Bacteria | 943 |
| 503 | Ga0207678_10628378 | 3300026067 | Bacteria | 943 |
| 504 | Ga0207678_10967068 | 3300026067 | Bacteria | 753 |
| 505 | Ga0207678_11977380 | 3300026067 | Bacteria | 508 |
| 506 | Ga0207708_10820760 | 3300026075 | Bacteria | 801 |
| 507 | Ga0207708_11667110 | 3300026075 | Bacteria | 560 |
| 508 | Ga0207702_10082103 | 3300026078 | Bacteria | 2802 |
| 509 | Ga0207702_10484655 | 3300026078 | Bacteria | 1204 |
| 510 | Ga0207641_10560464 | 3300026088 | Bacteria | 1115 |
| 511 | Ga0207641_10787587 | 3300026088 | Bacteria | 940 |
| 512 | Ga0207641_11487923 | 3300026088 | Bacteria | 679 |
| 513 | Ga0207641_12303101 | 3300026088 | Bacteria | 538 |
| 514 | Ga0207648_10016432 | 3300026089 | Bacteria | 6761 |
| 515 | Ga0207648_10075073 | 3300026089 | Bacteria | 2948 |
| 516 | Ga0207676_10080166 | 3300026095 | Bacteria | 2649 |
| 517 | Ga0207676_10462347 | 3300026095 | Bacteria | 1198 |
| 518 | Ga0207676_10499052 | 3300026095 | Bacteria | 1155 |
| 519 | Ga0207674_10616628 | 3300026116 | Bacteria | 1048 |
| 520 | Ga0207675_100156219 | 3300026118 | Bacteria | 2174 |
| 521 | Ga0207675_100306765 | 3300026118 | Bacteria | 1547 |
| 522 | Ga0207675_100648730 | 3300026118 | Bacteria | 1062 |
| 523 | Ga0207675_102435852 | 3300026118 | Bacteria | 535 |
| 524 | Ga0207683_10010070 | 3300026121 | Bacteria | 8064 |
| 525 | Ga0207683_10236218 | 3300026121 | Bacteria | 1667 |
| 526 | Ga0207683_10259140 | 3300026121 | Bacteria | 1588 |
| 527 | Ga0207683_10428652 | 3300026121 | Bacteria | 1218 |
| 528 | Ga0207683_10555878 | 3300026121 | Bacteria | 1061 |
| 529 | Ga0207683_11070919 | 3300026121 | Bacteria | 748 |
| 530 | Ga0207698_10875311 | 3300026142 | Bacteria | 904 |
| 531 | Ga0207698_12179178 | 3300026142 | Bacteria | 567 |
| 532 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 533 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 534 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 535 | Ga0209179_1027039 | 3300027512 | Bacteria | 1154 |
| 536 | Ga0209588_1002310 | 3300027671 | Bacteria | 5162 |
| 537 | Ga0209971_1032898 | 3300027682 | Bacteria | 1245 |
| 538 | Ga0209966_1009527 | 3300027695 | Bacteria | 1736 |
| 539 | Ga0209998_10002200 | 3300027717 | Bacteria | 4524 |
| 540 | Ga0209813_10377447 | 3300027866 | Bacteria | 567 |
| 541 | Ga0268266_10001258 | 3300028379 | Bacteria | 30968 |
| 542 | Ga0268266_10018977 | 3300028379 | Bacteria | 5858 |
| 543 | Ga0268266_10020213 | 3300028379 | Bacteria | 5676 |
| 544 | Ga0268266_10049269 | 3300028379 | Bacteria | 3612 |
| 545 | Ga0268266_10169246 | 3300028379 | Bacteria | 1982 |
| 546 | Ga0268266_10392288 | 3300028379 | Bacteria | 1311 |
| 547 | Ga0268266_10422628 | 3300028379 | Bacteria | 1263 |
| 548 | Ga0268266_10437610 | 3300028379 | Bacteria | 1241 |
| 549 | Ga0268266_11026550 | 3300028379 | Bacteria | 798 |
| 550 | Ga0268266_11098736 | 3300028379 | Bacteria | 769 |
| 551 | Ga0268266_11274456 | 3300028379 | Bacteria | 710 |
| 552 | Ga0268266_11758741 | 3300028379 | Bacteria | 595 |
| 553 | Ga0268265_10121807 | 3300028380 | Bacteria | 2150 |
| 554 | Ga0268265_10331432 | 3300028380 | Bacteria | 1382 |
| 555 | Ga0268265_10678265 | 3300028380 | Bacteria | 993 |
| 556 | Ga0268265_11407338 | 3300028380 | Bacteria | 699 |
| 557 | Ga0268264_10145554 | 3300028381 | Bacteria | 2118 |
| 558 | Ga0268264_10270175 | 3300028381 | Bacteria | 1588 |
| 559 | Ga0268264_10284493 | 3300028381 | Bacteria | 1550 |
| 560 | Ga0268264_10478706 | 3300028381 | Bacteria | 1211 |
| 561 | Ga0307517_10127283 | 3300028786 | Bacteria | 1852 |
| 562 | Ga0307517_10173123 | 3300028786 | Bacteria | 1414 |
| 563 | Ga0307517_10278060 | 3300028786 | Bacteria | 957 |
| 564 | Ga0307515_10489262 | 3300028794 | Bacteria | 842 |
| 565 | Ga0307515_10494632 | 3300028794 | Bacteria | 834 |
| 566 | Ga0307511_10435833 | 3300030521 | Bacteria | 524 |
| 567 | Ga0265332_10133785 | 3300031238 | Bacteria | 1040 |
| 568 | Ga0307513_10147435 | 3300031456 | Bacteria | 2269 |
| 569 | Ga0307513_10671147 | 3300031456 | Bacteria | 743 |
| 570 | Ga0307509_10065201 | 3300031507 | Bacteria | 3827 |
| 571 | Ga0307509_10406868 | 3300031507 | Bacteria | 1066 |
| 572 | Ga0307509_10859531 | 3300031507 | Bacteria | 572 |
| 573 | Ga0307508_10523537 | 3300031616 | Bacteria | 782 |
| 574 | Ga0307516_10564519 | 3300031730 | Bacteria | 792 |
| 575 | Ga0307406_10413738 | 3300031901 | Bacteria | 1072 |
| 576 | Ga0307406_10581586 | 3300031901 | Bacteria | 921 |
| 577 | Ga0307406_12133290 | 3300031901 | Bacteria | 502 |
| 578 | Ga0307412_10265334 | 3300031911 | Bacteria | 1341 |
| 579 | Ga0307412_10736290 | 3300031911 | Bacteria | 850 |
| 580 | Ga0307412_11973203 | 3300031911 | Bacteria | 540 |
| 581 | Ga0307409_100406447 | 3300031995 | Bacteria | 1302 |
| 582 | Ga0307409_101026142 | 3300031995 | Bacteria | 844 |
| 583 | Ga0307416_100091922 | 3300032002 | Bacteria | 2608 |
| 584 | Ga0307510_10032730 | 3300033180 | Bacteria | 5854 |
| 585 | Ga0307510_10056715 | 3300033180 | Bacteria | 4074 |
| 586 | Ga0307510_10212192 | 3300033180 | Bacteria | 1457 |
| 587 | Ga0307510_10318574 | 3300033180 | Bacteria | 1013 |
| 588 | Ga0307510_10345934 | 3300033180 | Bacteria | 938 |
| 589 | Ga0316214_1008956 | 3300033545 | Bacteria | 1350 |
| 590 | Ga0373930_0026702 | 3300034816 | Bacteria | 1166 |
| 591 | Ga0373930_0030034 | 3300034816 | Bacteria | 1114 |
| 592 | Ga0373950_0038362 | 3300034818 | Bacteria | 910 |
| 593 | Ga0373959_0004905 | 3300034820 | Bacteria | 2178 |
| 594 | Ga0373959_0106147 | 3300034820 | Bacteria | 673 |
| 595 | Ga0373938_0007189 | 3300034957 | Bacteria | 1952 |
| 596 | Ga0373928_0210574 | 3300035084 | Bacteria | 564 |
| 597 | Ga0373929_0089955 | 3300035085 | Bacteria | 760 |
| 598 | Ga0373940_0141332 | 3300035088 | Bacteria | 761 |
| 599 | Ga0373940_0248480 | 3300035088 | Bacteria | 599 |
| 600 | Ga0373940_0285668 | 3300035088 | Bacteria | 565 |
| 601 | Ga0373944_0034261 | 3300035089 | Bacteria | 1543 |
| 602 | Ga0373949_0145944 | 3300035090 | Bacteria | 681 |
| 603 | Ga0373951_0008447 | 3300035091 | Bacteria | 2326 |
| 604 | Ga0373951_0028742 | 3300035091 | Bacteria | 1304 |
| 605 | Ga0373951_0107841 | 3300035091 | Bacteria | 746 |
| 606 | Ga0373952_0005797 | 3300035092 | Bacteria | 2269 |
| 607 | Ga0373952_0087476 | 3300035092 | Unclassified | 804 |
| 608 | Ga0373923_0003954 | 3300035111 | Bacteria | 4841 |
| 609 | Ga0373923_0095710 | 3300035111 | Bacteria | 1304 |
| 610 | Ga0373932_0075461 | 3300035112 | Bacteria | 1054 |
| 611 | Ga0373936_0094052 | 3300035113 | Bacteria | 1259 |
| 612 | Ga0373936_0236583 | 3300035113 | Bacteria | 813 |
| 613 | Ga0373939_0006287 | 3300035114 | Bacteria | 2857 |
| 614 | Ga0373939_0009037 | 3300035114 | Bacteria | 2460 |
| 615 | Ga0373939_0175645 | 3300035114 | Bacteria | 796 |
| 616 | Ga0373941_0098228 | 3300035115 | Bacteria | 1015 |
| 617 | Ga0373945_0044391 | 3300035116 | Bacteria | 1616 |
| 618 | Ga0373942_0089317 | 3300035207 | Bacteria | 926 |
| 619 | Ga0373961_0014684 | 3300035241 | Bacteria | 1992 |
| 620 | Ga0373961_0408748 | 3300035241 | Bacteria | 522 |
| 621 | Ga0373962_0070868 | 3300035242 | Bacteria | 1041 |
| 622 | Ga0373931_0148141 | 3300035691 | Bacteria | 1366 |
| 623 | Ga0373931_0340359 | 3300035691 | Bacteria | 936 |
| 624 | Ga0373931_0955163 | 3300035691 | Bacteria | 578 |
| 625 | Ga0373935_0002324 | 3300035692 | Bacteria | 10853 |
| 626 | Ga0373935_0036584 | 3300035692 | Bacteria | 3070 |
| 627 | Ga0373935_0039187 | 3300035692 | Bacteria | 2970 |
| 628 | Ga0373935_0846979 | 3300035692 | Bacteria | 676 |
| 629 | Ga0373927_0008093 | 3300035695 | Bacteria | 7095 |
| 630 | Ga0373927_0022118 | 3300035695 | Bacteria | 4166 |
| 631 | Ga0373927_0085314 | 3300035695 | Bacteria | 2049 |
| 632 | Ga0373933_0148920 | 3300035724 | Bacteria | 1481 |
| 633 | Ga0373947_0023756 | 3300035725 | Bacteria | 3568 |
| 634 | Ga0373947_0646608 | 3300035725 | Bacteria | 721 |
| 635 | Ga0373937_0038440 | 3300036401 | Bacteria | 4360 |
| 636 | Ga0373925_0007949 | 3300037068 | Bacteria | 7723 |
| 637 | Ga0373925_0009375 | 3300037068 | Bacteria | 7126 |
| 638 | Ga0373925_0024726 | 3300037068 | Bacteria | 4386 |
| 639 | Ga0439465_0119163 | 3300041413 | Bacteria | 924 |
| 640 | Ga0451789_1216464 | 3300041443 | Bacteria | 541 |
| 641 | Ga0451800_0559582 | 3300041459 | Bacteria | 661 |
| 642 | Ga0451807_1593632 | 3300041486 | Bacteria | 671 |
| 643 | Ga0451807_2464568 | 3300041486 | Bacteria | 517 |
| 644 | Ga0451843_0098124 | 3300041509 | Bacteria | 591 |
| 645 | Ga0495592_0023961 | 3300046454 | Bacteria | 4642 |
| 646 | Ga0495592_0173537 | 3300046454 | Bacteria | 1474 |
| 647 | Ga0495592_0679713 | 3300046454 | Bacteria | 621 |
| 648 | Ga0495603_0001793 | 3300046455 | Bacteria | 12674 |
| 649 | Ga0495603_0011561 | 3300046455 | Bacteria | 5340 |
| 650 | Ga0495603_0027624 | 3300046455 | Bacteria | 3424 |
| 651 | Ga0495603_0039833 | 3300046455 | Bacteria | 2814 |
| 652 | Ga0495603_0047784 | 3300046455 | Bacteria | 2548 |
| 653 | Ga0495603_0102019 | 3300046455 | Bacteria | 1675 |
| 654 | Ga0495590_0037512 | 3300046457 | Bacteria | 1690 |
| 655 | Ga0495590_0041013 | 3300046457 | Bacteria | 1614 |
| 656 | Ga0495629_0000539 | 3300046459 | Bacteria | 31196 |
| 657 | Ga0495629_0000577 | 3300046459 | Bacteria | 29743 |
| 658 | Ga0495629_0039402 | 3300046459 | Bacteria | 3326 |
| 659 | Ga0495638_0001644 | 3300046460 | Bacteria | 19838 |
| 660 | Ga0495638_0014644 | 3300046460 | Bacteria | 5291 |
| 661 | Ga0495638_0016673 | 3300046460 | Bacteria | 4915 |
| 662 | Ga0495638_0054288 | 3300046460 | Bacteria | 2491 |
| 663 | Ga0495638_0107170 | 3300046460 | Bacteria | 1664 |
| 664 | Ga0495638_0118515 | 3300046460 | Bacteria | 1566 |
| 665 | Ga0495638_0182439 | 3300046460 | Bacteria | 1196 |
| 666 | Ga0495638_0259646 | 3300046460 | Bacteria | 953 |
| 667 | Ga0495641_0005270 | 3300046461 | Bacteria | 8794 |
| 668 | Ga0495651_0003588 | 3300046462 | Bacteria | 11903 |
| 669 | Ga0495653_0095216 | 3300046463 | Bacteria | 2168 |
| 670 | Ga0495653_0312381 | 3300046463 | Bacteria | 1021 |
| 671 | Ga0495653_0823025 | 3300046463 | Bacteria | 557 |
| 672 | Ga0495650_0236519 | 3300046471 | Bacteria | 625 |
| 673 | Ga0495580_0138039 | 3300046472 | Bacteria | 1690 |
| 674 | Ga0495580_0183038 | 3300046472 | Bacteria | 1446 |
| 675 | Ga0495580_0456669 | 3300046472 | Bacteria | 857 |
| 676 | Ga0495580_0748491 | 3300046472 | Bacteria | 637 |
| 677 | Ga0495582_0009685 | 3300046473 | Bacteria | 5308 |
| 678 | Ga0495582_0010926 | 3300046473 | Bacteria | 4997 |
| 679 | Ga0495582_0688375 | 3300046473 | Unclassified | 592 |
| 680 | Ga0495605_0051546 | 3300046474 | Bacteria | 2004 |
| 681 | Ga0495605_0073761 | 3300046474 | Bacteria | 1607 |
| 682 | Ga0495605_0208238 | 3300046474 | Bacteria | 850 |
| 683 | Ga0495605_0314600 | 3300046474 | Bacteria | 661 |
| 684 | Ga0495639_0000442 | 3300046475 | Bacteria | 19757 |
| 685 | Ga0495639_0040298 | 3300046475 | Bacteria | 2101 |
| 686 | Ga0495639_0148784 | 3300046475 | Bacteria | 1129 |
| 687 | Ga0495639_0594951 | 3300046475 | Bacteria | 568 |
| 688 | Ga0495662_0001304 | 3300046476 | Bacteria | 12336 |
| 689 | Ga0495664_0012504 | 3300046477 | Bacteria | 4808 |
| 690 | Ga0495664_0074683 | 3300046477 | Bacteria | 2028 |
| 691 | Ga0495664_0892896 | 3300046477 | Bacteria | 520 |
| 692 | Ga0495584_0011625 | 3300046491 | Bacteria | 4508 |
| 693 | Ga0495584_0189214 | 3300046491 | Bacteria | 1046 |
| 694 | Ga0495584_0273606 | 3300046491 | Bacteria | 858 |
| 695 | Ga0495584_0287706 | 3300046491 | Bacteria | 835 |
| 696 | Ga0495584_0458111 | 3300046491 | Bacteria | 649 |
| 697 | Ga0495585_0064965 | 3300046492 | Bacteria | 2000 |
| 698 | Ga0495585_0087111 | 3300046492 | Bacteria | 1686 |
| 699 | Ga0495585_0105752 | 3300046492 | Bacteria | 1501 |
| 700 | Ga0495585_0159898 | 3300046492 | Bacteria | 1169 |
| 701 | Ga0495585_0209978 | 3300046492 | Bacteria | 987 |
| 702 | Ga0495594_0000326 | 3300046499 | Bacteria | 23640 |
| 703 | Ga0495594_0071264 | 3300046499 | Bacteria | 1933 |
| 704 | Ga0495594_0454991 | 3300046499 | Bacteria | 728 |
| 705 | Ga0495594_0563463 | 3300046499 | Bacteria | 646 |
| 706 | Ga0495594_0647910 | 3300046499 | Unclassified | 598 |
| 707 | Ga0495596_0093580 | 3300046500 | Bacteria | 1167 |
| 708 | Ga0495607_0169161 | 3300046501 | Bacteria | 1105 |
| 709 | Ga0495607_0465917 | 3300046501 | Bacteria | 565 |
| 710 | Ga0495583_0359725 | 3300046506 | Bacteria | 574 |
| 711 | Ga0495606_0013709 | 3300046507 | Bacteria | 6382 |
| 712 | Ga0495606_0386457 | 3300046507 | Bacteria | 733 |
| 713 | Ga0495606_0641863 | 3300046507 | Bacteria | 515 |
| 714 | Ga0495608_0019434 | 3300046511 | Bacteria | 4675 |
| 715 | Ga0495610_0336126 | 3300046512 | Bacteria | 572 |
| 716 | Ga0495616_0123422 | 3300046513 | Bacteria | 1193 |
| 717 | Ga0495616_0285952 | 3300046513 | Bacteria | 700 |
| 718 | Ga0495628_0009768 | 3300046516 | Bacteria | 8178 |
| 719 | Ga0495630_0110500 | 3300046517 | Bacteria | 2082 |
| 720 | Ga0495630_0920200 | 3300046517 | Bacteria | 666 |
| 721 | Ga0495631_0053603 | 3300046518 | Bacteria | 1760 |
| 722 | Ga0495631_0367513 | 3300046518 | Bacteria | 612 |
| 723 | Ga0495632_0004170 | 3300046519 | Bacteria | 9902 |
| 724 | Ga0495632_0023131 | 3300046519 | Bacteria | 3322 |
| 725 | Ga0495632_0298038 | 3300046519 | Bacteria | 715 |
| 726 | Ga0495632_0456611 | 3300046519 | Bacteria | 554 |
| 727 | Ga0495643_0069219 | 3300046522 | Bacteria | 1855 |
| 728 | Ga0495643_0115080 | 3300046522 | Bacteria | 1364 |
| 729 | Ga0495644_0202317 | 3300046523 | Bacteria | 766 |
| 730 | Ga0495644_0249780 | 3300046523 | Bacteria | 689 |
| 731 | Ga0495648_0092234 | 3300046524 | Bacteria | 1692 |
| 732 | Ga0495648_0127215 | 3300046524 | Bacteria | 1360 |
| 733 | Ga0495648_0323829 | 3300046524 | Bacteria | 713 |
| 734 | Ga0495648_0408249 | 3300046524 | Bacteria | 605 |
| 735 | Ga0495663_0217047 | 3300046525 | Bacteria | 671 |
| 736 | Ga0495666_0141126 | 3300046526 | Bacteria | 1123 |
| 737 | Ga0495652_0005812 | 3300046529 | Bacteria | 11550 |
| 738 | Ga0495652_0159818 | 3300046529 | Bacteria | 1751 |
| 739 | Ga0495652_0478401 | 3300046529 | Bacteria | 867 |
| 740 | Ga0495652_0540482 | 3300046529 | Bacteria | 803 |
| 741 | Ga0495654_0332107 | 3300046530 | Bacteria | 615 |
| 742 | Ga0495654_0384822 | 3300046530 | Bacteria | 559 |
| 743 | Ga0495665_0003274 | 3300046531 | Bacteria | 8772 |
| 744 | Ga0495640_0011752 | 3300046533 | Bacteria | 6720 |
| 745 | Ga0495640_0036489 | 3300046533 | Bacteria | 3473 |
| 746 | Ga0495640_0171701 | 3300046533 | Bacteria | 1385 |
| 747 | Ga0495586_0815581 | 3300046535 | Bacteria | 538 |
| 748 | Ga0495587_0006565 | 3300046536 | Bacteria | 7574 |
| 749 | Ga0495598_0013064 | 3300046537 | Bacteria | 2051 |
| 750 | Ga0495609_0091139 | 3300046538 | Bacteria | 1326 |
| 751 | Ga0495609_0116238 | 3300046538 | Bacteria | 1152 |
| 752 | Ga0495609_0135735 | 3300046538 | Bacteria | 1052 |
| 753 | Ga0495621_0059383 | 3300046539 | Bacteria | 1385 |
| 754 | Ga0495645_0028962 | 3300046543 | Bacteria | 4025 |
| 755 | Ga0495645_0079316 | 3300046543 | Bacteria | 2358 |
| 756 | Ga0495622_0019899 | 3300046557 | Bacteria | 3124 |
| 757 | Ga0495622_0029021 | 3300046557 | Bacteria | 2585 |
| 758 | Ga0495622_0120485 | 3300046557 | Bacteria | 1198 |
| 759 | Ga0495633_0099765 | 3300046558 | Bacteria | 1348 |
| 760 | Ga0495667_0005708 | 3300046559 | Bacteria | 8424 |
| 761 | Ga0495667_0027140 | 3300046559 | Bacteria | 3860 |
| 762 | Ga0495667_0451317 | 3300046559 | Bacteria | 808 |
| 763 | Ga0495667_0688386 | 3300046559 | Bacteria | 634 |
| 764 | Ga0495656_0126404 | 3300046615 | Bacteria | 1212 |
| 765 | Ga0495656_0262440 | 3300046615 | Bacteria | 875 |
| 766 | Ga0495656_0814770 | 3300046615 | Bacteria | 505 |
| 767 | Ga0495668_0014912 | 3300046616 | Bacteria | 4547 |
| 768 | Ga0495668_0264759 | 3300046616 | Bacteria | 941 |
| 769 | Ga0495668_0338591 | 3300046616 | Unclassified | 825 |
| 770 | Ga0495668_0619637 | 3300046616 | Bacteria | 598 |
| 771 | Ga0495634_0001414 | 3300046642 | Bacteria | 21458 |
| 772 | Ga0495634_0074278 | 3300046642 | Bacteria | 2234 |
| 773 | Ga0495634_0578343 | 3300046642 | Bacteria | 653 |
| 774 | Ga0495634_0661227 | 3300046642 | Bacteria | 603 |
| 775 | Ga0495611_0018146 | 3300046648 | Bacteria | 3015 |
| 776 | Ga0495611_0144128 | 3300046648 | Bacteria | 1112 |
| 777 | Ga0495611_0312798 | 3300046648 | Bacteria | 723 |
| 778 | Ga0495625_0007793 | 3300046660 | Bacteria | 9241 |
| 779 | Ga0495625_0030003 | 3300046660 | Bacteria | 4060 |
| 780 | Ga0495625_0449562 | 3300046660 | Bacteria | 796 |
| 781 | Ga0495625_0495007 | 3300046660 | Bacteria | 748 |
| 782 | Ga0495635_0007761 | 3300046663 | Bacteria | 7491 |
| 783 | Ga0495635_0541430 | 3300046663 | Bacteria | 764 |
| 784 | Ga0495635_0541447 | 3300046663 | Bacteria | 764 |
| 785 | Ga0495659_0028885 | 3300046664 | Bacteria | 1922 |
| 786 | Ga0495661_0027351 | 3300046665 | Bacteria | 3663 |
| 787 | Ga0495661_0110155 | 3300046665 | Bacteria | 1536 |
| 788 | Ga0495588_0577139 | 3300046674 | Bacteria | 589 |
| 789 | Ga0495657_0006944 | 3300046675 | Bacteria | 8790 |
| 790 | Ga0495657_0169994 | 3300046675 | Bacteria | 1343 |
| 791 | Ga0495657_0732165 | 3300046675 | Bacteria | 567 |
| 792 | Ga0495599_0028210 | 3300046678 | Bacteria | 3518 |
| 793 | Ga0495599_0374280 | 3300046678 | Bacteria | 851 |
| 794 | Ga0495623_0011888 | 3300046679 | Bacteria | 5641 |
| 795 | Ga0495623_0624002 | 3300046679 | Bacteria | 558 |
| 796 | Ga0495646_0009638 | 3300046680 | Bacteria | 6132 |
| 797 | Ga0495646_0015945 | 3300046680 | Bacteria | 4769 |
| 798 | Ga0495646_0431458 | 3300046680 | Bacteria | 682 |
| 799 | Ga0495647_0032935 | 3300046681 | Bacteria | 1934 |
| 800 | Ga0495658_0000944 | 3300046683 | Bacteria | 15496 |
| 801 | Ga0495658_0014805 | 3300046683 | Bacteria | 3990 |
| 802 | Ga0495669_0002768 | 3300046684 | Bacteria | 7193 |
| 803 | Ga0495669_0573594 | 3300046684 | Bacteria | 549 |
| 804 | Ga0495613_0130556 | 3300046689 | Bacteria | 1799 |
| 805 | Ga0495613_0152652 | 3300046689 | Bacteria | 1646 |
| 806 | Ga0495613_0168584 | 3300046689 | Bacteria | 1555 |
| 807 | Ga0495624_0007531 | 3300046690 | Bacteria | 7639 |
| 808 | Ga0495624_0030319 | 3300046690 | Bacteria | 3524 |
| 809 | Ga0495624_0293604 | 3300046690 | Bacteria | 981 |
| 810 | Ga0495670_0076406 | 3300046691 | Bacteria | 1702 |
| 811 | Ga0495670_0437445 | 3300046691 | Bacteria | 708 |
| 812 | Ga0495671_0019101 | 3300046692 | Bacteria | 3627 |
| 813 | Ga0495671_0081664 | 3300046692 | Bacteria | 1584 |
| 814 | Ga0495671_0191911 | 3300046692 | Bacteria | 992 |
| 815 | Ga0495671_0202563 | 3300046692 | Bacteria | 962 |
| 816 | Ga0495649_0024522 | 3300046694 | Bacteria | 3364 |
| 817 | Ga0495649_0125484 | 3300046694 | Bacteria | 1356 |
| 818 | Ga0495649_0232633 | 3300046694 | Bacteria | 951 |
| 819 | Ga0495649_0469649 | 3300046694 | Bacteria | 627 |
| 820 | Ga0495589_0051705 | 3300046794 | Bacteria | 2031 |
| 821 | Ga0495589_0150778 | 3300046794 | Bacteria | 1110 |
| 822 | Ga0495589_0185677 | 3300046794 | Bacteria | 985 |
| 823 | Ga0495589_0348664 | 3300046794 | Bacteria | 682 |
| 824 | Ga0495589_0495876 | 3300046794 | Bacteria | 558 |
| 825 | Ga0495600_0036783 | 3300046809 | Bacteria | 3181 |
| 826 | Ga0495600_0068134 | 3300046809 | Bacteria | 2326 |
| 827 | Ga0495600_0601715 | 3300046809 | Bacteria | 668 |
| 828 | Ga0495660_0177798 | 3300046810 | Bacteria | 1032 |
| 829 | Ga0495660_0191940 | 3300046810 | Bacteria | 981 |
| 830 | Ga0495581_0014473 | 3300047315 | Bacteria | 4576 |
| 831 | Ga0495581_0018644 | 3300047315 | Bacteria | 4030 |
| 832 | Ga0495581_0252600 | 3300047315 | Bacteria | 1031 |
| 833 | Ga0495604_0005487 | 3300047317 | Bacteria | 10056 |
| 834 | Ga0495604_0151962 | 3300047317 | Bacteria | 1644 |
| 835 | Ga0495604_0410472 | 3300047317 | Bacteria | 890 |
| 836 | Ga0495636_0019022 | 3300047318 | Bacteria | 2758 |
| 837 | Ga0495636_0366581 | 3300047318 | Bacteria | 682 |
| 838 | Ga0495674_0000879 | 3300047319 | Bacteria | 28789 |
| 839 | Ga0495674_0011383 | 3300047319 | Bacteria | 8397 |
| 840 | Ga0495672_0019817 | 3300047320 | Bacteria | 4426 |
| 841 | Ga0495672_0083377 | 3300047320 | Bacteria | 1776 |
| 842 | Ga0495676_0151694 | 3300047321 | Bacteria | 1648 |
| 843 | Ga0495676_0443306 | 3300047321 | Bacteria | 857 |
| 844 | Ga0495680_0005531 | 3300047322 | Bacteria | 11860 |
| 845 | Ga0495683_0178678 | 3300047323 | Bacteria | 971 |
| 846 | Ga0495683_0269676 | 3300047323 | Unclassified | 740 |
| 847 | Ga0495683_0285548 | 3300047323 | Bacteria | 713 |
| 848 | Ga0495683_0391077 | 3300047323 | Bacteria | 580 |
| 849 | Ga0495675_0003412 | 3300047444 | Bacteria | 9573 |
| 850 | Ga0495675_0611890 | 3300047444 | Bacteria | 617 |
| 851 | Ga0495677_0076022 | 3300047445 | Bacteria | 1255 |
| 852 | Ga0495677_0155702 | 3300047445 | Bacteria | 881 |
| 853 | Ga0495673_0042897 | 3300047469 | Bacteria | 2027 |
| 854 | Ga0495673_0062561 | 3300047469 | Bacteria | 1589 |
| 855 | Ga0495673_0275995 | 3300047469 | Bacteria | 608 |
| 856 | Ga0495673_0359361 | 3300047469 | Bacteria | 513 |
| 857 | Ga0495684_0026792 | 3300047471 | Bacteria | 4430 |
| 858 | Ga0495686_0049811 | 3300047472 | Bacteria | 2634 |
| 859 | Ga0495686_0067905 | 3300047472 | Bacteria | 2200 |
| 860 | Ga0495686_0084772 | 3300047472 | Bacteria | 1931 |
| 861 | Ga0495686_0123655 | 3300047472 | Bacteria | 1540 |
| 862 | Ga0495686_0165489 | 3300047472 | Bacteria | 1289 |
| 863 | Ga0495686_0348129 | 3300047472 | Bacteria | 806 |
| 864 | Ga0495686_0552429 | 3300047472 | Bacteria | 601 |
| 865 | Ga0495686_0655070 | 3300047472 | Bacteria | 539 |
| 866 | Ga0495593_0001040 | 3300047673 | Bacteria | 16301 |
| 867 | Ga0495593_0049360 | 3300047673 | Bacteria | 2233 |
| 868 | Ga0495593_0108364 | 3300047673 | Bacteria | 1420 |
| 869 | Ga0495602_0010182 | 3300048088 | Bacteria | 9761 |
| 870 | Ga0495602_0148350 | 3300048088 | Bacteria | 1847 |
| 871 | Ga0495614_0081871 | 3300048089 | Bacteria | 1399 |
| 872 | Ga0495614_0188163 | 3300048089 | Bacteria | 931 |
| 873 | Ga0495615_0013752 | 3300048090 | Bacteria | 1697 |
| 874 | Ga0495615_0023431 | 3300048090 | Bacteria | 1415 |
| 875 | Ga0495615_0024238 | 3300048090 | Bacteria | 1398 |
| 876 | Ga0495626_0124557 | 3300048091 | Bacteria | 1105 |
| 877 | Ga0496100_0067588 | 3300048903 | Bacteria | 2374 |
| 878 | Ga0496100_0112857 | 3300048903 | Bacteria | 1891 |
| 879 | Ga0496100_0177351 | 3300048903 | Bacteria | 1539 |
| 880 | Ga0496100_0215194 | 3300048903 | Bacteria | 1407 |
| 881 | Ga0496100_0308312 | 3300048903 | Bacteria | 1186 |
| 882 | Ga0496100_0402640 | 3300048903 | Bacteria | 1042 |
| 883 | Ga0496101_0015603 | 3300048904 | Bacteria | 5124 |
| 884 | Ga0496101_0072428 | 3300048904 | Bacteria | 2529 |
| 885 | Ga0496101_0177683 | 3300048904 | Bacteria | 1638 |
| 886 | Ga0496101_0200192 | 3300048904 | Bacteria | 1544 |
| 887 | Ga0496101_0238268 | 3300048904 | Bacteria | 1415 |
| 888 | Ga0496101_0444724 | 3300048904 | Bacteria | 1022 |
| 889 | Ga0496101_0456974 | 3300048904 | Bacteria | 1008 |
| 890 | Ga0496101_0517466 | 3300048904 | Bacteria | 943 |
| 891 | Ga0496101_0555434 | 3300048904 | Bacteria | 908 |
| 892 | Ga0496101_0994086 | 3300048904 | Bacteria | 660 |
| 893 | Ga0496101_1266610 | 3300048904 | Bacteria | 577 |
| 894 | Ga0496102_0010356 | 3300048905 | Bacteria | 8020 |
| 895 | Ga0496102_0015547 | 3300048905 | Bacteria | 6632 |
| 896 | Ga0496102_0050249 | 3300048905 | Bacteria | 3796 |
| 897 | Ga0496102_0185775 | 3300048905 | Bacteria | 1959 |
| 898 | Ga0496102_0235439 | 3300048905 | Bacteria | 1726 |
| 899 | Ga0496102_0307526 | 3300048905 | Bacteria | 1494 |
| 900 | Ga0496102_0333102 | 3300048905 | Bacteria | 1429 |
| 901 | Ga0496102_1710853 | 3300048905 | Bacteria | 547 |
| 902 | Ga0496103_0005261 | 3300048906 | Bacteria | 7766 |
| 903 | Ga0496103_0218289 | 3300048906 | Bacteria | 1226 |
| 904 | Ga0496103_0677920 | 3300048906 | Bacteria | 654 |
| 905 | Ga0496104_0004592 | 3300048907 | Bacteria | 12036 |
| 906 | Ga0496104_0176863 | 3300048907 | Bacteria | 2044 |
| 907 | Ga0496104_0198630 | 3300048907 | Bacteria | 1917 |
| 908 | Ga0496104_0282867 | 3300048907 | Bacteria | 1571 |
| 909 | Ga0496104_0304780 | 3300048907 | Bacteria | 1505 |
| 910 | Ga0496104_0319554 | 3300048907 | Bacteria | 1465 |
| 911 | Ga0496104_0814694 | 3300048907 | Bacteria | 839 |
| 912 | Ga0496105_0004448 | 3300048908 | Bacteria | 10554 |
| 913 | Ga0496105_0140914 | 3300048908 | Bacteria | 1984 |
| 914 | Ga0496105_0230784 | 3300048908 | Bacteria | 1504 |
| 915 | Ga0496105_0298179 | 3300048908 | Bacteria | 1296 |
| 916 | Ga0496106_0016658 | 3300048909 | Bacteria | 5437 |
| 917 | Ga0496106_0343542 | 3300048909 | Bacteria | 1198 |
| 918 | Ga0496106_0464900 | 3300048909 | Bacteria | 1016 |
| 919 | Ga0496106_0600893 | 3300048909 | Bacteria | 881 |
| 920 | Ga0496106_1249988 | 3300048909 | Bacteria | 578 |
| 921 | Ga0496106_1532342 | 3300048909 | Bacteria | 512 |
| 922 | Ga0496107_0025500 | 3300048910 | Bacteria | 4186 |
| 923 | Ga0496107_0031966 | 3300048910 | Bacteria | 3758 |
| 924 | Ga0496107_0061446 | 3300048910 | Bacteria | 2720 |
| 925 | Ga0496107_0173666 | 3300048910 | Bacteria | 1599 |
| 926 | Ga0496107_0398134 | 3300048910 | Bacteria | 1024 |
| 927 | Ga0496107_0398248 | 3300048910 | Bacteria | 1024 |
| 928 | Ga0496107_0510522 | 3300048910 | Bacteria | 891 |
| 929 | Ga0496107_0578429 | 3300048910 | Bacteria | 831 |
| 930 | Ga0496108_0009122 | 3300048911 | Bacteria | 8029 |
| 931 | Ga0496108_0094501 | 3300048911 | Bacteria | 2545 |
| 932 | Ga0496108_0119119 | 3300048911 | Bacteria | 2263 |
| 933 | Ga0496108_1094298 | 3300048911 | Bacteria | 677 |
| 934 | Ga0496109_0000835 | 3300048912 | Bacteria | 25687 |
| 935 | Ga0496109_0084243 | 3300048912 | Bacteria | 2932 |
| 936 | Ga0496109_0088443 | 3300048912 | Bacteria | 2863 |
| 937 | Ga0496109_0113033 | 3300048912 | Bacteria | 2525 |
| 938 | Ga0496109_0349161 | 3300048912 | Bacteria | 1397 |
| 939 | Ga0496109_1974384 | 3300048912 | Bacteria | 516 |
| 940 | Ga0496110_0004806 | 3300048913 | Bacteria | 10522 |
| 941 | Ga0496110_0216053 | 3300048913 | Bacteria | 1743 |
| 942 | Ga0496110_0673905 | 3300048913 | Bacteria | 935 |
| 943 | Ga0496110_0903764 | 3300048913 | Bacteria | 789 |
| 944 | Ga0496110_1354619 | 3300048913 | Bacteria | 621 |
| 945 | Ga0496110_1786821 | 3300048913 | Bacteria | 525 |
| 946 | Ga0496111_0000843 | 3300048914 | Bacteria | 16552 |
| 947 | Ga0496111_0032370 | 3300048914 | Bacteria | 3727 |
| 948 | Ga0496111_0413295 | 3300048914 | Bacteria | 997 |
| 949 | Ga0496111_0798677 | 3300048914 | Bacteria | 683 |
| 950 | Ga0496112_0006451 | 3300048915 | Bacteria | 10297 |
| 951 | Ga0496112_0337525 | 3300048915 | Bacteria | 1450 |
| 952 | Ga0496112_0337528 | 3300048915 | Bacteria | 1450 |
| 953 | Ga0496112_0489942 | 3300048915 | Bacteria | 1165 |
| 954 | Ga0496112_0572890 | 3300048915 | Bacteria | 1062 |
| 955 | Ga0496112_0637917 | 3300048915 | Bacteria | 996 |
| 956 | Ga0496112_0925186 | 3300048915 | Bacteria | 793 |
| 957 | Ga0496112_1591029 | 3300048915 | Bacteria | 567 |
| 958 | Ga0496112_1693086 | 3300048915 | Bacteria | 545 |
| 959 | Ga0496113_0001943 | 3300048916 | Bacteria | 11836 |
| 960 | Ga0496113_0309389 | 3300048916 | Bacteria | 1265 |
| 961 | Ga0496113_1308100 | 3300048916 | Bacteria | 563 |
| 962 | Ga0496114_0062620 | 3300048917 | Bacteria | 3113 |
| 963 | Ga0496114_0300426 | 3300048917 | Bacteria | 1417 |
| 964 | Ga0496114_0430074 | 3300048917 | Bacteria | 1169 |
| 965 | Ga0496114_0587181 | 3300048917 | Bacteria | 983 |
| 966 | Ga0496114_1072588 | 3300048917 | Bacteria | 690 |
| 967 | Ga0496114_1170964 | 3300048917 | Bacteria | 654 |
| 968 | Ga0496115_0004407 | 3300048918 | Bacteria | 10195 |
| 969 | Ga0496115_0026152 | 3300048918 | Bacteria | 4552 |
| 970 | Ga0496115_0101559 | 3300048918 | Bacteria | 2358 |
| 971 | Ga0496115_0140718 | 3300048918 | Bacteria | 1991 |
| 972 | Ga0496115_0164323 | 3300048918 | Bacteria | 1835 |
| 973 | Ga0496115_0190776 | 3300048918 | Bacteria | 1693 |
| 974 | Ga0496115_0252855 | 3300048918 | Bacteria | 1450 |
| 975 | Ga0496115_0812618 | 3300048918 | Bacteria | 727 |
| 976 | Ga0496117_0057661 | 3300048920 | Bacteria | 2695 |
| 977 | Ga0496117_0122230 | 3300048920 | Bacteria | 1597 |
| 978 | Ga0496118_0008710 | 3300048921 | Bacteria | 10424 |
| 979 | Ga0496118_0034470 | 3300048921 | Bacteria | 4129 |
| 980 | Ga0496118_0154433 | 3300048921 | Bacteria | 1431 |
| 981 | Ga0496121_0000594 | 3300048924 | Bacteria | 67953 |
| 982 | Ga0496121_0002100 | 3300048924 | Bacteria | 31362 |
| 983 | Ga0496121_0184949 | 3300048924 | Bacteria | 1499 |
| 984 | Ga0496121_0255336 | 3300048924 | Bacteria | 1213 |
| 985 | Ga0496121_0391228 | 3300048924 | Bacteria | 913 |
| 986 | Ga0496121_0422811 | 3300048924 | Bacteria | 866 |
| 987 | Ga0496121_0799455 | 3300048924 | Bacteria | 554 |
| 988 | Ga0496124_0276687 | 3300048927 | Bacteria | 1226 |
| 989 | Ga0496124_0310303 | 3300048927 | Bacteria | 1135 |
| 990 | Ga0496125_0013564 | 3300048928 | Bacteria | 8004 |
| 991 | Ga0496125_0298594 | 3300048928 | Bacteria | 988 |
| 992 | Ga0496125_0680239 | 3300048928 | Bacteria | 549 |
| 993 | Ga0496126_0003493 | 3300048929 | Bacteria | 19836 |
| 994 | Ga0496126_0022745 | 3300048929 | Bacteria | 6089 |
| 995 | Ga0496126_0040847 | 3300048929 | Bacteria | 4298 |
| 996 | Ga0496126_0048775 | 3300048929 | Bacteria | 3868 |
| 997 | Ga0496126_0099808 | 3300048929 | Bacteria | 2542 |
| 998 | Ga0496126_0132257 | 3300048929 | Bacteria | 2155 |
| 999 | Ga0496126_0154891 | 3300048929 | Bacteria | 1962 |
| 1000 | Ga0496126_0255447 | 3300048929 | Bacteria | 1459 |
| 1001 | Ga0496126_0283726 | 3300048929 | Bacteria | 1371 |
| 1002 | Ga0496126_0583410 | 3300048929 | Bacteria | 883 |
| 1003 | Ga0496126_0598069 | 3300048929 | Bacteria | 869 |
| 1004 | Ga0496126_0638987 | 3300048929 | Bacteria | 834 |
| 1005 | Ga0496126_0870230 | 3300048929 | Bacteria | 686 |
| 1006 | Ga0496126_0958984 | 3300048929 | Bacteria | 644 |
| 1007 | Ga0496126_1253413 | 3300048929 | Bacteria | 542 |
| 1008 | Ga0496126_1384260 | 3300048929 | Bacteria | 508 |
| 1009 | Ga0495678_157394 | 3300049459 | Bacteria | 729 |
| 1010 | Ga0495682_0067000 | 3300049460 | Bacteria | 1294 |
| 1011 | Ga0495682_0109212 | 3300049460 | Bacteria | 991 |
| 1012 | Ga0495682_0332059 | 3300049460 | Bacteria | 536 |
| 1013 | Ga0495682_0360344 | 3300049460 | Bacteria | 512 |
| 1014 | Ga0501032_0050133 | 3300049569 | Bacteria | 2815 |
| 1015 | Ga0501032_0138768 | 3300049569 | Bacteria | 1601 |
| 1016 | Ga0501032_0219880 | 3300049569 | Bacteria | 1236 |
| 1017 | Ga0501033_0096488 | 3300049570 | Bacteria | 2160 |
| 1018 | Ga0501033_0236782 | 3300049570 | Bacteria | 1295 |
| 1019 | Ga0501033_0901072 | 3300049570 | Unclassified | 594 |
| 1020 | Ga0501034_0031515 | 3300049571 | Bacteria | 5384 |
| 1021 | Ga0501034_0100325 | 3300049571 | Bacteria | 2889 |
| 1022 | Ga0501034_0149236 | 3300049571 | Bacteria | 2314 |
| 1023 | Ga0501036_0032679 | 3300049572 | Bacteria | 4398 |
| 1024 | Ga0501036_0061151 | 3300049572 | Bacteria | 3190 |
| 1025 | Ga0501036_0296881 | 3300049572 | Bacteria | 1351 |
| 1026 | Ga0501037_0009457 | 3300049573 | Bacteria | 7155 |
| 1027 | Ga0501037_0257776 | 3300049573 | Bacteria | 1219 |
| 1028 | Ga0501037_0262473 | 3300049573 | Bacteria | 1206 |
| 1029 | Ga0501038_0025785 | 3300049574 | Bacteria | 5237 |
| 1030 | Ga0501038_0089046 | 3300049574 | Bacteria | 2590 |
| 1031 | Ga0501038_0178929 | 3300049574 | Bacteria | 1712 |
| 1032 | Ga0501039_0015343 | 3300049575 | Bacteria | 5864 |
| 1033 | Ga0501039_0034558 | 3300049575 | Bacteria | 3901 |
| 1034 | Ga0501040_0071467 | 3300049576 | Bacteria | 2396 |
| 1035 | Ga0501040_0331478 | 3300049576 | Bacteria | 1089 |
| 1036 | Ga0501042_0079676 | 3300049578 | Bacteria | 2347 |
| 1037 | Ga0501042_1448505 | 3300049578 | Bacteria | 501 |
| 1038 | Ga0501043_0006016 | 3300049579 | Bacteria | 9755 |
| 1039 | Ga0501043_0027235 | 3300049579 | Bacteria | 4488 |
| 1040 | Ga0501043_0106369 | 3300049579 | Bacteria | 2203 |
| 1041 | Ga0501043_0116471 | 3300049579 | Bacteria | 2097 |
| 1042 | Ga0501043_0282920 | 3300049579 | Bacteria | 1271 |
| 1043 | Ga0501046_0025626 | 3300049580 | Bacteria | 4825 |
| 1044 | Ga0501046_0103928 | 3300049580 | Bacteria | 2177 |
| 1045 | Ga0501047_0012665 | 3300049581 | Bacteria | 7990 |
| 1046 | Ga0501047_0142395 | 3300049581 | Bacteria | 2275 |
| 1047 | Ga0501047_0530447 | 3300049581 | Bacteria | 1002 |
| 1048 | Ga0501048_0175148 | 3300049582 | Bacteria | 1520 |
| 1049 | Ga0501048_0374886 | 3300049582 | Bacteria | 1016 |
| 1050 | Ga0501067_0113603 | 3300049583 | Bacteria | 1506 |
| 1051 | Ga0501067_0255980 | 3300049583 | Bacteria | 974 |
| 1052 | Ga0501067_0659106 | 3300049583 | Bacteria | 588 |
| 1053 | Ga0501068_0022897 | 3300049584 | Bacteria | 3657 |
| 1054 | Ga0501068_0090117 | 3300049584 | Bacteria | 1891 |
| 1055 | Ga0501069_0009123 | 3300049585 | Bacteria | 5235 |
| 1056 | Ga0501069_0143574 | 3300049585 | Bacteria | 1370 |
| 1057 | Ga0501069_0159772 | 3300049585 | Bacteria | 1297 |
| 1058 | Ga0501070_0013556 | 3300049586 | Bacteria | 6871 |
| 1059 | Ga0501070_0128551 | 3300049586 | Bacteria | 2093 |
| 1060 | Ga0501070_0288272 | 3300049586 | Bacteria | 1338 |
| 1061 | Ga0501070_0289767 | 3300049586 | Bacteria | 1334 |
| 1062 | Ga0501070_0359506 | 3300049586 | Bacteria | 1181 |
| 1063 | Ga0501070_0414301 | 3300049586 | Bacteria | 1088 |
| 1064 | Ga0501071_0025103 | 3300049587 | Bacteria | 4173 |
| 1065 | Ga0501071_0071942 | 3300049587 | Bacteria | 2521 |
| 1066 | Ga0501072_0019989 | 3300049588 | Bacteria | 5185 |
| 1067 | Ga0501072_0677639 | 3300049588 | Bacteria | 811 |
| 1068 | Ga0501072_0739585 | 3300049588 | Bacteria | 772 |
| 1069 | Ga0501073_0067179 | 3300049589 | Bacteria | 2499 |
| 1070 | Ga0501073_0279211 | 3300049589 | Bacteria | 1152 |
| 1071 | Ga0501073_0557656 | 3300049589 | Bacteria | 791 |
| 1072 | Ga0501074_0010334 | 3300049590 | Bacteria | 6771 |
| 1073 | Ga0501074_0033573 | 3300049590 | Bacteria | 3720 |
| 1074 | Ga0501074_0119841 | 3300049590 | Bacteria | 1882 |
| 1075 | Ga0501074_0177885 | 3300049590 | Bacteria | 1518 |
| 1076 | Ga0501076_0186970 | 3300049592 | Bacteria | 1690 |
| 1077 | Ga0501077_0203227 | 3300049593 | Bacteria | 1259 |
| 1078 | Ga0501079_0328381 | 3300049741 | Bacteria | 1198 |
| 1079 | Ga0501080_0104956 | 3300049742 | Bacteria | 2620 |
| 1080 | Ga0501080_0158095 | 3300049742 | Bacteria | 2093 |
| 1081 | Ga0501080_0267476 | 3300049742 | Bacteria | 1556 |
| 1082 | Ga0501080_0490721 | 3300049742 | Bacteria | 1098 |
| 1083 | Ga0501080_0710516 | 3300049742 | Bacteria | 886 |
| 1084 | Ga0501081_0578919 | 3300049743 | Bacteria | 840 |
| 1085 | Ga0501083_0086936 | 3300049744 | Bacteria | 2067 |
| 1086 | Ga0501083_0355793 | 3300049744 | Bacteria | 952 |
| 1087 | Ga0501035_0000418 | 3300049822 | Bacteria | 47993 |
| 1088 | Ga0501035_0028100 | 3300049822 | Bacteria | 5136 |
| 1089 | Ga0501035_0174749 | 3300049822 | Bacteria | 1853 |
| 1090 | Ga0501044_0226132 | 3300049823 | Bacteria | 1820 |
| 1091 | Ga0501044_0520939 | 3300049823 | Bacteria | 1088 |
| 1092 | Ga0501045_0275429 | 3300049824 | Bacteria | 1253 |
| 1093 | Ga0501045_0343561 | 3300049824 | Bacteria | 1111 |
| 1094 | Ga0501045_1421143 | 3300049824 | Bacteria | 504 |
| 1095 | nmdc:mga03683_285846_c1 | 3300050489 | Bacteria | 771 |
| 1096 | nmdc:mga03683_61100_c1 | 3300050489 | Bacteria | 1592 |
| 1097 | nmdc:mga03n38_1371_c1 | 3300050490 | Bacteria | 6913 |
| 1098 | nmdc:mga03n38_25831_c1 | 3300050490 | Bacteria | 2418 |
| 1099 | nmdc:mga03n38_288638_c1 | 3300050490 | Bacteria | 878 |
| 1100 | nmdc:mga03n38_545_c1 | 3300050490 | Bacteria | 9552 |
| 1101 | nmdc:mga00v17_1000904_c1 | 3300050491 | Bacteria | 526 |
| 1102 | nmdc:mga00v17_536794_c1 | 3300050491 | Bacteria | 757 |
| 1103 | nmdc:mga0yw44_1029325_c1 | 3300050492 | Bacteria | 557 |
| 1104 | nmdc:mga0yw44_15036_c1 | 3300050492 | Bacteria | 4132 |
| 1105 | nmdc:mga0yw44_1874_c1 | 3300050492 | Bacteria | 8651 |
| 1106 | nmdc:mga0yw44_235748_c1 | 3300050492 | Bacteria | 1215 |
| 1107 | nmdc:mga0yw44_309953_c1 | 3300050492 | Bacteria | 1059 |
| 1108 | nmdc:mga0yw44_746756_c1 | 3300050492 | Bacteria | 665 |
| 1109 | nmdc:mga0k408_231023_c1 | 3300050493 | Bacteria | 1104 |
| 1110 | nmdc:mga06z11_184363_c1 | 3300050494 | Bacteria | 1205 |
| 1111 | nmdc:mga06z11_40864_c1 | 3300050494 | Bacteria | 2317 |
| 1112 | nmdc:mga06z11_551_c1 | 3300050494 | Bacteria | 13729 |
| 1113 | nmdc:mga06z11_7326_c1 | 3300050494 | Bacteria | 4534 |
| 1114 | nmdc:mga04h51_627_c1 | 3300050495 | Bacteria | 8282 |
| 1115 | nmdc:mga07m45_24365_c1 | 3300050496 | Bacteria | 2299 |
| 1116 | nmdc:mga07m45_308415_c1 | 3300050496 | Bacteria | 920 |
| 1117 | nmdc:mga07m45_40863_c1 | 3300050496 | Bacteria | 2596 |
| 1118 | nmdc:mga07m45_826852_c1 | 3300050496 | Bacteria | 530 |
| 1119 | nmdc:mga05p37_5338_c1 | 3300050507 | Bacteria | 15091 |
| 1120 | nmdc:mga08y16_166453_c1 | 3300050511 | Bacteria | 2290 |
| 1121 | nmdc:mga08y16_516083_c1 | 3300050511 | Bacteria | 1212 |
| 1122 | nmdc:mga0n895_10845_c1 | 3300050512 | Bacteria | 8087 |
| 1123 | nmdc:mga0n895_210408_c1 | 3300050512 | Bacteria | 1975 |
| 1124 | nmdc:mga0n895_263341_c1 | 3300050512 | Bacteria | 1749 |
| 1125 | nmdc:mga0n895_5680_c1 | 3300050512 | Bacteria | 10457 |
| 1126 | nmdc:mga0n895_822307_c1 | 3300050512 | Bacteria | 918 |
| 1127 | nmdc:mga0rr50_228834_c1 | 3300050513 | Bacteria | 1538 |
| 1128 | nmdc:mga08x19_1145081_c1 | 3300050514 | Bacteria | 552 |
| 1129 | nmdc:mga08x19_1265291_c1 | 3300050514 | Bacteria | 523 |
| 1130 | nmdc:mga08x19_243156_c1 | 3300050514 | Bacteria | 1241 |
| 1131 | nmdc:mga08x19_401049_c1 | 3300050514 | Bacteria | 962 |
| 1132 | nmdc:mga0a205_6087_c1 | 3300050515 | Bacteria | 10880 |
| 1133 | nmdc:mga0sz30_1059_c3 | 3300050516 | Bacteria | 6768 |
| 1134 | nmdc:mga0sz30_152260_c1 | 3300050516 | Bacteria | 1023 |
| 1135 | nmdc:mga0sz30_226114_c1 | 3300050516 | Bacteria | 832 |
| 1136 | Ga0495601_0307059 | 3300053077 | Bacteria | 1033 |
| 1137 | Ga0495612_0015932 | 3300053078 | Bacteria | 3012 |
| 1138 | Ga0495612_0169295 | 3300053078 | Bacteria | 956 |
| 1139 | Ga0495612_0200620 | 3300053078 | Bacteria | 880 |
| 1140 | Ga0495612_0499169 | 3300053078 | Bacteria | 558 |
| 1141 | Ga0495612_0617592 | 3300053078 | Bacteria | 501 |
| 1142 | Ga0500635_0040778 | 3300053080 | Bacteria | 1550 |
| 1143 | Ga0500635_0065573 | 3300053080 | Bacteria | 1277 |
| 1144 | Ga0495655_0106569 | 3300053083 | Bacteria | 837 |
| 1145 | Ga0495595_0397832 | 3300053084 | Bacteria | 698 |
| 1146 | Ga0495619_0000687 | 3300053085 | Bacteria | 22137 |
| 1147 | Ga0500578_0277678 | 3300053086 | Bacteria | 1000 |
| 1148 | Ga0500643_000707 | 3300053087 | Bacteria | 22129 |
| 1149 | Ga0500643_028539 | 3300053087 | Bacteria | 1725 |
| 1150 | Ga0500643_111515 | 3300053087 | Bacteria | 739 |
| 1151 | Ga0500644_0004606 | 3300053088 | Bacteria | 3457 |
| 1152 | Ga0500644_0068996 | 3300053088 | Bacteria | 1268 |
| 1153 | Ga0500646_0008141 | 3300053090 | Bacteria | 2679 |
| 1154 | Ga0500646_0186287 | 3300053090 | Bacteria | 706 |
| 1155 | Ga0500646_0215488 | 3300053090 | Bacteria | 664 |
| 1156 | Ga0500647_0009309 | 3300053091 | Bacteria | 4305 |
| 1157 | Ga0500583_0051114 | 3300053092 | Bacteria | 1919 |
| 1158 | Ga0500583_0389583 | 3300053092 | Bacteria | 670 |
| 1159 | Ga0500651_0216118 | 3300053093 | Bacteria | 1126 |
| 1160 | Ga0500566_0000007 | 3300053094 | Bacteria | 144968 |
| 1161 | Ga0500566_0001717 | 3300053094 | Bacteria | 12864 |
| 1162 | Ga0500566_0047473 | 3300053094 | Bacteria | 2465 |
| 1163 | Ga0500566_0230177 | 3300053094 | Bacteria | 915 |
| 1164 | Ga0500566_0378002 | 3300053094 | Bacteria | 641 |
| 1165 | Ga0500641_0008115 | 3300053096 | Bacteria | 3741 |
| 1166 | Ga0500650_0072519 | 3300053098 | Bacteria | 1610 |
| 1167 | Ga0500650_0138777 | 3300053098 | Bacteria | 1128 |
| 1168 | Ga0500650_0419718 | 3300053098 | Bacteria | 577 |
| 1169 | Ga0500650_0460751 | 3300053098 | Bacteria | 544 |
| 1170 | Ga0500554_037966 | 3300053102 | Bacteria | 1463 |
| 1171 | Ga0500555_123674 | 3300053103 | Bacteria | 645 |
| 1172 | Ga0500556_0000058 | 3300053104 | Bacteria | 114257 |
| 1173 | Ga0500556_0027483 | 3300053104 | Bacteria | 1901 |
| 1174 | Ga0500556_0125073 | 3300053104 | Bacteria | 1005 |
| 1175 | Ga0500556_0241443 | 3300053104 | Bacteria | 711 |
| 1176 | Ga0500562_001107 | 3300053108 | Bacteria | 6624 |
| 1177 | Ga0500562_001780 | 3300053108 | Bacteria | 5384 |
| 1178 | Ga0500562_017167 | 3300053108 | Bacteria | 1864 |
| 1179 | Ga0500562_124163 | 3300053108 | Unclassified | 703 |
| 1180 | Ga0500569_164372 | 3300053109 | Bacteria | 751 |
| 1181 | Ga0500569_209423 | 3300053109 | Bacteria | 663 |
| 1182 | Ga0500595_000662 | 3300053119 | Bacteria | 20656 |
| 1183 | Ga0500595_004598 | 3300053119 | Bacteria | 6156 |
| 1184 | Ga0500595_026088 | 3300053119 | Bacteria | 2017 |
| 1185 | Ga0500595_129538 | 3300053119 | Bacteria | 710 |
| 1186 | Ga0500607_094919 | 3300053121 | Bacteria | 1493 |
| 1187 | Ga0500614_073661 | 3300053123 | Bacteria | 943 |
| 1188 | Ga0500642_0003271 | 3300053130 | Bacteria | 4874 |
| 1189 | Ga0500642_0087305 | 3300053130 | Bacteria | 1439 |
| 1190 | Ga0500655_028502 | 3300053133 | Bacteria | 1069 |
| 1191 | Ga0500655_040641 | 3300053133 | Bacteria | 912 |
| 1192 | Ga0500658_0007459 | 3300053134 | Bacteria | 4043 |
| 1193 | Ga0500658_0026987 | 3300053134 | Bacteria | 2217 |
| 1194 | Ga0500658_0233695 | 3300053134 | Bacteria | 844 |
| 1195 | Ga0500658_0272354 | 3300053134 | Bacteria | 778 |
| 1196 | Ga0500658_0405159 | 3300053134 | Bacteria | 624 |
| 1197 | Ga0500658_0475436 | 3300053134 | Bacteria | 567 |
| 1198 | Ga0500658_0584526 | 3300053134 | Bacteria | 500 |
| 1199 | Ga0500559_0122344 | 3300053136 | Bacteria | 1211 |
| 1200 | Ga0500559_0181486 | 3300053136 | Bacteria | 992 |
| 1201 | Ga0500561_0210326 | 3300053137 | Bacteria | 616 |
| 1202 | Ga0500568_0062587 | 3300053139 | Bacteria | 1437 |
| 1203 | Ga0500568_0346392 | 3300053139 | Bacteria | 539 |
| 1204 | Ga0500568_0381028 | 3300053139 | Bacteria | 511 |
| 1205 | Ga0500577_0000021 | 3300053142 | Bacteria | 43315 |
| 1206 | Ga0500577_0000172 | 3300053142 | Bacteria | 16529 |
| 1207 | Ga0500577_0085127 | 3300053142 | Bacteria | 1268 |
| 1208 | Ga0500577_0355855 | 3300053142 | Bacteria | 640 |
| 1209 | Ga0500586_001079 | 3300053145 | Bacteria | 5629 |
| 1210 | Ga0500588_0251320 | 3300053146 | Bacteria | 664 |
| 1211 | Ga0500588_0276755 | 3300053146 | Bacteria | 633 |
| 1212 | Ga0500588_0396351 | 3300053146 | Unclassified | 526 |
| 1213 | Ga0500589_060169 | 3300053147 | Bacteria | 1742 |
| 1214 | Ga0500589_237800 | 3300053147 | Bacteria | 676 |
| 1215 | Ga0500590_054911 | 3300053148 | Bacteria | 2016 |
| 1216 | Ga0500590_124874 | 3300053148 | Bacteria | 1200 |
| 1217 | Ga0500603_001079 | 3300053150 | Bacteria | 6423 |
| 1218 | Ga0500603_015891 | 3300053150 | Bacteria | 1778 |
| 1219 | Ga0500603_144887 | 3300053150 | Unclassified | 733 |
| 1220 | Ga0500604_0012298 | 3300053151 | Bacteria | 2310 |
| 1221 | Ga0500616_0011874 | 3300053153 | Bacteria | 5120 |
| 1222 | Ga0500616_0047738 | 3300053153 | Bacteria | 2272 |
| 1223 | Ga0500619_288599 | 3300053154 | Bacteria | 532 |
| 1224 | Ga0500622_0137146 | 3300053156 | Bacteria | 1171 |
| 1225 | Ga0500622_0191046 | 3300053156 | Bacteria | 938 |
| 1226 | Ga0500627_0432317 | 3300053158 | Bacteria | 556 |
| 1227 | Ga0500633_0064998 | 3300053160 | Bacteria | 1291 |
| 1228 | Ga0500633_0117248 | 3300053160 | Bacteria | 989 |
| 1229 | Ga0500633_0244914 | 3300053160 | Bacteria | 667 |
| 1230 | Ga0500634_0374014 | 3300053161 | Bacteria | 535 |
| 1231 | Ga0500638_182891 | 3300053162 | Bacteria | 903 |
| 1232 | Ga0500638_308239 | 3300053162 | Bacteria | 607 |
| 1233 | Ga0500639_018849 | 3300053163 | Bacteria | 3641 |
| 1234 | Ga0500639_030525 | 3300053163 | Bacteria | 2849 |
| 1235 | Ga0500639_147762 | 3300053163 | Bacteria | 1088 |
| 1236 | Ga0500637_0000363 | 3300053178 | Bacteria | 17196 |
| 1237 | Ga0500637_0000556 | 3300053178 | Bacteria | 14631 |
| 1238 | Ga0500637_0001156 | 3300053178 | Bacteria | 10943 |
| 1239 | Ga0500637_0209497 | 3300053178 | Bacteria | 1106 |
| 1240 | Ga0500637_0314433 | 3300053178 | Bacteria | 849 |
| 1241 | Ga0500567_073565 | 3300053723 | Bacteria | 1495 |
| 1242 | Ga0500645_036556 | 3300053730 | Bacteria | 1461 |
| 1243 | Ga0500645_197941 | 3300053730 | Bacteria | 543 |
| 1244 | Ga0500599_000207 | 3300053736 | Bacteria | 5486 |
| 1245 | Ga0500601_023480 | 3300053737 | Bacteria | 716 |
| 1246 | Ga0501084_0080061 | 3300054114 | Bacteria | 2739 |
| 1247 | Ga0501084_0081953 | 3300054114 | Bacteria | 2707 |
| 1248 | Ga0500661_004329 | 3300055283 | Bacteria | 2657 |
| 1249 | Ga0500661_010307 | 3300055283 | Bacteria | 1703 |
| 1250 | Ga0501082_0067703 | 3300060353 | Bacteria | 3075 |
| 1251 | Ga0501082_0088742 | 3300060353 | Bacteria | 2668 |
| 1252 | Ga0530510_0085419 | 3300061734 | Bacteria | 2299 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046472 | Ga0495580_0456669 | Ga0495580_0456669_350_670 | 69 |
| 2 | 3300046499 | Ga0495594_0647910 | Ga0495594_0647910_114_434 | 70 |
| 3 | iso_pu_bacteria | 2643221736 | 2644744060 | 73 |
| 4 | 3300006173 | Ga0070716_100632194 | Ga0070716_1006321942 | 75 |
| 5 | 3300006942 | Ga0099824_1011301 | Ga0099824_10113015 | 75 |
| 6 | 3300006943 | Ga0099822_1009259 | Ga0099822_10092593 | 75 |
| 7 | 3300013297 | Ga0157378_11355380 | Ga0157378_113553801 | 75 |
| 8 | 3300025939 | Ga0207665_10488952 | Ga0207665_104889522 | 75 |
| 9 | 3300027357 | Ga0209589_1000006 | Ga0209589_100000692 | 75 |
| 10 | 3300027361 | Ga0209489_100007 | Ga0209489_10000792 | 75 |
| 11 | 3300027363 | Ga0209700_100008 | Ga0209700_10000892 | 75 |
| 12 | 3300028786 | Ga0307517_10127283 | Ga0307517_101272832 | 75 |
| 13 | 3300030521 | Ga0307511_10435833 | Ga0307511_104358332 | 75 |
| 14 | 3300033180 | Ga0307510_10212192 | Ga0307510_102121922 | 75 |
| 15 | 3300033180 | Ga0307510_10345934 | Ga0307510_103459341 | 75 |
| 16 | 3300041443 | Ga0451789_1216464 | Ga0451789_1216464_164_400 | 75 |
| 17 | 3300046455 | Ga0495603_0011561 | Ga0495603_0011561_979_1221 | 75 |
| 18 | 3300046455 | Ga0495603_0047784 | Ga0495603_0047784_2036_2272 | 75 |
| 19 | 3300046457 | Ga0495590_0037512 | Ga0495590_0037512_553_789 | 75 |
| 20 | 3300046460 | Ga0495638_0016673 | Ga0495638_0016673_2624_2860 | 75 |
| 21 | 3300046460 | Ga0495638_0054288 | Ga0495638_0054288_1141_1377 | 75 |
| 22 | 3300046491 | Ga0495584_0011625 | Ga0495584_0011625_250_486 | 75 |
| 23 | 3300046491 | Ga0495584_0273606 | Ga0495584_0273606_250_486 | 75 |
| 24 | 3300046492 | Ga0495585_0105752 | Ga0495585_0105752_667_903 | 75 |
| 25 | 3300046492 | Ga0495585_0159898 | Ga0495585_0159898_135_371 | 75 |
| 26 | 3300046513 | Ga0495616_0123422 | Ga0495616_0123422_183_419 | 75 |
| 27 | 3300046519 | Ga0495632_0004170 | Ga0495632_0004170_3142_3378 | 75 |
| 28 | 3300046519 | Ga0495632_0023131 | Ga0495632_0023131_968_1204 | 75 |
| 29 | 3300046524 | Ga0495648_0092234 | Ga0495648_0092234_634_870 | 75 |
| 30 | 3300046525 | Ga0495663_0217047 | Ga0495663_0217047_405_641 | 75 |
| 31 | 3300046537 | Ga0495598_0013064 | Ga0495598_0013064_385_621 | 75 |
| 32 | 3300046538 | Ga0495609_0116238 | Ga0495609_0116238_202_438 | 75 |
| 33 | 3300046539 | Ga0495621_0059383 | Ga0495621_0059383_191_427 | 75 |
| 34 | 3300046558 | Ga0495633_0099765 | Ga0495633_0099765_667_903 | 75 |
| 35 | 3300046615 | Ga0495656_0262440 | Ga0495656_0262440_138_374 | 75 |
| 36 | 3300046616 | Ga0495668_0014912 | Ga0495668_0014912_3827_4063 | 75 |
| 37 | 3300046648 | Ga0495611_0018146 | Ga0495611_0018146_2087_2323 | 75 |
| 38 | 3300046660 | Ga0495625_0007793 | Ga0495625_0007793_3835_4071 | 75 |
| 39 | 3300046660 | Ga0495625_0030003 | Ga0495625_0030003_2609_2845 | 75 |
| 40 | 3300046664 | Ga0495659_0028885 | Ga0495659_0028885_643_879 | 75 |
| 41 | 3300046691 | Ga0495670_0437445 | Ga0495670_0437445_181_417 | 75 |
| 42 | 3300046692 | Ga0495671_0019101 | Ga0495671_0019101_2693_2929 | 75 |
| 43 | 3300046694 | Ga0495649_0024522 | Ga0495649_0024522_1340_1576 | 75 |
| 44 | 3300046694 | Ga0495649_0469649 | Ga0495649_0469649_74_310 | 75 |
| 45 | 3300046794 | Ga0495589_0348664 | Ga0495589_0348664_433_669 | 75 |
| 46 | 3300047318 | Ga0495636_0366581 | Ga0495636_0366581_400_636 | 75 |
| 47 | 3300047323 | Ga0495683_0178678 | Ga0495683_0178678_67_303 | 75 |
| 48 | 3300047469 | Ga0495673_0042897 | Ga0495673_0042897_1697_1933 | 75 |
| 49 | 3300047469 | Ga0495673_0359361 | Ga0495673_0359361_201_437 | 75 |
| 50 | 3300047472 | Ga0495686_0123655 | Ga0495686_0123655_839_1075 | 75 |
| 51 | 3300048090 | Ga0495615_0024238 | Ga0495615_0024238_715_951 | 75 |
| 52 | 3300049460 | Ga0495682_0067000 | Ga0495682_0067000_917_1153 | 75 |
| 53 | 3300049460 | Ga0495682_0109212 | Ga0495682_0109212_473_709 | 75 |
| 54 | 3300053080 | Ga0500635_0040778 | Ga0500635_0040778_991_1233 | 75 |
| 55 | 3300053080 | Ga0500635_0065573 | Ga0500635_0065573_258_494 | 75 |
| 56 | 3300053088 | Ga0500644_0068996 | Ga0500644_0068996_607_843 | 75 |
| 57 | 3300053093 | Ga0500651_0216118 | Ga0500651_0216118_722_958 | 75 |
| 58 | 3300053094 | Ga0500566_0230177 | Ga0500566_0230177_258_500 | 75 |
| 59 | 3300053098 | Ga0500650_0072519 | Ga0500650_0072519_949_1185 | 75 |
| 60 | 3300053134 | Ga0500658_0233695 | Ga0500658_0233695_595_831 | 75 |
| 61 | 3300053134 | Ga0500658_0584526 | Ga0500658_0584526_55_291 | 75 |
| 62 | 3300053146 | Ga0500588_0251320 | Ga0500588_0251320_239_475 | 75 |
| 63 | 3300053148 | Ga0500590_054911 | Ga0500590_054911_19_255 | 75 |
| 64 | 3300053150 | Ga0500603_001079 | Ga0500603_001079_2514_2756 | 75 |
| 65 | 3300053150 | Ga0500603_144887 | Ga0500603_144887_159_395 | 75 |
| 66 | 3300053158 | Ga0500627_0432317 | Ga0500627_0432317_146_382 | 75 |
| 67 | 3300053162 | Ga0500638_308239 | Ga0500638_308239_65_307 | 75 |
| 68 | 3300053163 | Ga0500639_147762 | Ga0500639_147762_93_329 | 75 |
| 69 | 3300053178 | Ga0500637_0000556 | Ga0500637_0000556_4312_4548 | 75 |
| 70 | 3300003215 | JGI25153J46596_10002368 | JGI25153J46596_100023686 | 76 |
| 71 | 3300003354 | JGI25160J50197_1043164 | JGI25160J50197_10431642 | 76 |
| 72 | 3300003659 | JGI25404J52841_10003878 | JGI25404J52841_100038782 | 76 |
| 73 | 3300003659 | JGI25404J52841_10029094 | JGI25404J52841_100290942 | 76 |
| 74 | 3300003771 | Ga0055526_1096513 | Ga0055526_10965131 | 76 |
| 75 | 3300004625 | Ga0055543_1021761 | Ga0055543_10217612 | 76 |
| 76 | 3300005262 | Ga0065165_1000972 | Ga0065165_100097217 | 76 |
| 77 | 3300005327 | Ga0070658_11298986 | Ga0070658_112989861 | 76 |
| 78 | 3300005336 | Ga0070680_100246325 | Ga0070680_1002463252 | 76 |
| 79 | 3300005337 | Ga0070682_100731666 | Ga0070682_1007316662 | 76 |
| 80 | 3300005353 | Ga0070669_101319339 | Ga0070669_1013193391 | 76 |
| 81 | 3300005366 | Ga0070659_101508077 | Ga0070659_1015080771 | 76 |
| 82 | 3300005367 | Ga0070667_100532053 | Ga0070667_1005320532 | 76 |
| 83 | 3300005441 | Ga0070700_100161700 | Ga0070700_1001617002 | 76 |
| 84 | 3300005455 | Ga0070663_100013331 | Ga0070663_1000133312 | 76 |
| 85 | 3300005455 | Ga0070663_100373757 | Ga0070663_1003737572 | 76 |
| 86 | 3300005456 | Ga0070678_100849457 | Ga0070678_1008494572 | 76 |
| 87 | 3300005458 | Ga0070681_10053505 | Ga0070681_100535054 | 76 |
| 88 | 3300005459 | Ga0068867_100785675 | Ga0068867_1007856752 | 76 |
| 89 | 3300005530 | Ga0070679_100062268 | Ga0070679_1000622683 | 76 |
| 90 | 3300005539 | Ga0068853_100303907 | Ga0068853_1003039072 | 76 |
| 91 | 3300005539 | Ga0068853_100410778 | Ga0068853_1004107782 | 76 |
| 92 | 3300005547 | Ga0070693_100186090 | Ga0070693_1001860902 | 76 |
| 93 | 3300005548 | Ga0070665_100011571 | Ga0070665_1000115714 | 76 |
| 94 | 3300005548 | Ga0070665_100040475 | Ga0070665_1000404755 | 76 |
| 95 | 3300005548 | Ga0070665_100134043 | Ga0070665_1001340432 | 76 |
| 96 | 3300005548 | Ga0070665_100195690 | Ga0070665_1001956903 | 76 |
| 97 | 3300005548 | Ga0070665_100423681 | Ga0070665_1004236812 | 76 |
| 98 | 3300005548 | Ga0070665_101066909 | Ga0070665_1010669092 | 76 |
| 99 | 3300005564 | Ga0070664_100803504 | Ga0070664_1008035042 | 76 |
| 100 | 3300005617 | Ga0068859_100699678 | Ga0068859_1006996782 | 76 |
| 101 | 3300005618 | Ga0068864_100558295 | Ga0068864_1005582952 | 76 |
| 102 | 3300005618 | Ga0068864_102656113 | Ga0068864_1026561132 | 76 |
| 103 | 3300005718 | Ga0068866_10762796 | Ga0068866_107627962 | 76 |
| 104 | 3300005840 | Ga0068870_10458936 | Ga0068870_104589362 | 76 |
| 105 | 3300005841 | Ga0068863_101510799 | Ga0068863_1015107991 | 76 |
| 106 | 3300005841 | Ga0068863_101529367 | Ga0068863_1015293672 | 76 |
| 107 | 3300005843 | Ga0068860_100311033 | Ga0068860_1003110333 | 76 |
| 108 | 3300005844 | Ga0068862_100116138 | Ga0068862_1001161382 | 76 |
| 109 | 3300005937 | Ga0081455_10073390 | Ga0081455_100733902 | 76 |
| 110 | 3300005937 | Ga0081455_10129323 | Ga0081455_101293232 | 76 |
| 111 | 3300005983 | Ga0081540_1004156 | Ga0081540_10041566 | 76 |
| 112 | 3300005983 | Ga0081540_1007064 | Ga0081540_10070645 | 76 |
| 113 | 3300005983 | Ga0081540_1024072 | Ga0081540_10240722 | 76 |
| 114 | 3300005983 | Ga0081540_1031192 | Ga0081540_10311924 | 76 |
| 115 | 3300005983 | Ga0081540_1042121 | Ga0081540_10421212 | 76 |
| 116 | 3300005983 | Ga0081540_1058408 | Ga0081540_10584082 | 76 |
| 117 | 3300005983 | Ga0081540_1189996 | Ga0081540_11899962 | 76 |
| 118 | 3300005983 | Ga0081540_1192669 | Ga0081540_11926692 | 76 |
| 119 | 3300005983 | Ga0081540_1222820 | Ga0081540_12228202 | 76 |
| 120 | 3300006038 | Ga0075365_10006317 | Ga0075365_100063175 | 76 |
| 121 | 3300006038 | Ga0075365_10045720 | Ga0075365_100457203 | 76 |
| 122 | 3300006038 | Ga0075365_10418385 | Ga0075365_104183852 | 76 |
| 123 | 3300006038 | Ga0075365_10563470 | Ga0075365_105634702 | 76 |
| 124 | 3300006042 | Ga0075368_10309163 | Ga0075368_103091632 | 76 |
| 125 | 3300006048 | Ga0075363_100039432 | Ga0075363_1000394323 | 76 |
| 126 | 3300006048 | Ga0075363_100372025 | Ga0075363_1003720252 | 76 |
| 127 | 3300006051 | Ga0075364_11235509 | Ga0075364_112355092 | 76 |
| 128 | 3300006178 | Ga0075367_10013426 | Ga0075367_100134262 | 76 |
| 129 | 3300006186 | Ga0075369_10006062 | Ga0075369_100060623 | 76 |
| 130 | 3300006186 | Ga0075369_10127205 | Ga0075369_101272051 | 76 |
| 131 | 3300006195 | Ga0075366_10311282 | Ga0075366_103112822 | 76 |
| 132 | 3300006353 | Ga0075370_10010855 | Ga0075370_100108557 | 76 |
| 133 | 3300006358 | Ga0068871_101315770 | Ga0068871_1013157702 | 76 |
| 134 | 3300006871 | Ga0075434_100096621 | Ga0075434_1000966212 | 76 |
| 135 | 3300006871 | Ga0075434_100871026 | Ga0075434_1008710262 | 76 |
| 136 | 3300006914 | Ga0075436_100446597 | Ga0075436_1004465972 | 76 |
| 137 | 3300006931 | Ga0097620_100699593 | Ga0097620_1006995932 | 76 |
| 138 | 3300007076 | Ga0075435_100812590 | Ga0075435_1008125902 | 76 |
| 139 | 3300009093 | Ga0105240_10202311 | Ga0105240_102023113 | 76 |
| 140 | 3300009174 | Ga0105241_10457943 | Ga0105241_104579431 | 76 |
| 141 | 3300009174 | Ga0105241_11818824 | Ga0105241_118188242 | 76 |
| 142 | 3300009176 | Ga0105242_12002808 | Ga0105242_120028081 | 76 |
| 143 | 3300009177 | Ga0105248_10229690 | Ga0105248_102296902 | 76 |
| 144 | 3300009545 | Ga0105237_10254595 | Ga0105237_102545952 | 76 |
| 145 | 3300009545 | Ga0105237_10439512 | Ga0105237_104395122 | 76 |
| 146 | 3300009545 | Ga0105237_11207269 | Ga0105237_112072691 | 76 |
| 147 | 3300009551 | Ga0105238_10069682 | Ga0105238_100696823 | 76 |
| 148 | 3300009551 | Ga0105238_10157858 | Ga0105238_101578582 | 76 |
| 149 | 3300009551 | Ga0105238_10268355 | Ga0105238_102683553 | 76 |
| 150 | 3300009551 | Ga0105238_11227494 | Ga0105238_112274942 | 76 |
| 151 | 3300009551 | Ga0105238_11446845 | Ga0105238_114468452 | 76 |
| 152 | 3300009551 | Ga0105238_12529864 | Ga0105238_125298642 | 76 |
| 153 | 3300010375 | Ga0105239_10055225 | Ga0105239_100552254 | 76 |
| 154 | 3300010375 | Ga0105239_10253881 | Ga0105239_102538813 | 76 |
| 155 | 3300010375 | Ga0105239_10618369 | Ga0105239_106183691 | 76 |
| 156 | 3300011119 | Ga0105246_11680199 | Ga0105246_116801991 | 76 |
| 157 | 3300013297 | Ga0157378_11372372 | Ga0157378_113723722 | 76 |
| 158 | 3300013307 | Ga0157372_10383486 | Ga0157372_103834862 | 76 |
| 159 | 3300013308 | Ga0157375_11801159 | Ga0157375_118011591 | 76 |
| 160 | 3300014325 | Ga0163163_12446828 | Ga0163163_124468282 | 76 |
| 161 | 3300014745 | Ga0157377_10828728 | Ga0157377_108287282 | 76 |
| 162 | 3300014969 | Ga0157376_10632865 | Ga0157376_106328653 | 76 |
| 163 | 3300014969 | Ga0157376_10761670 | Ga0157376_107616702 | 76 |
| 164 | 3300025295 | Ga0209564_1006259 | Ga0209564_10062593 | 76 |
| 165 | 3300025297 | Ga0209758_1001191 | Ga0209758_10011916 | 76 |
| 166 | 3300025297 | Ga0209758_1014873 | Ga0209758_10148734 | 76 |
| 167 | 3300025297 | Ga0209758_1017637 | Ga0209758_10176374 | 76 |
| 168 | 3300025297 | Ga0209758_1182116 | Ga0209758_11821162 | 76 |
| 169 | 3300025299 | Ga0209256_1099012 | Ga0209256_10990122 | 76 |
| 170 | 3300025302 | Ga0207426_1000598 | Ga0207426_100059827 | 76 |
| 171 | 3300025899 | Ga0207642_10666116 | Ga0207642_106661162 | 76 |
| 172 | 3300025905 | Ga0207685_10048080 | Ga0207685_100480802 | 76 |
| 173 | 3300025909 | Ga0207705_10436326 | Ga0207705_104363261 | 76 |
| 174 | 3300025909 | Ga0207705_10722427 | Ga0207705_107224272 | 76 |
| 175 | 3300025911 | Ga0207654_10331804 | Ga0207654_103318042 | 76 |
| 176 | 3300025911 | Ga0207654_10348526 | Ga0207654_103485261 | 76 |
| 177 | 3300025912 | Ga0207707_10923758 | Ga0207707_109237581 | 76 |
| 178 | 3300025913 | Ga0207695_10150989 | Ga0207695_101509892 | 76 |
| 179 | 3300025914 | Ga0207671_10073056 | Ga0207671_100730562 | 76 |
| 180 | 3300025914 | Ga0207671_10281962 | Ga0207671_102819622 | 76 |
| 181 | 3300025915 | Ga0207693_10115612 | Ga0207693_101156122 | 76 |
| 182 | 3300025921 | Ga0207652_10039247 | Ga0207652_100392474 | 76 |
| 183 | 3300025924 | Ga0207694_10050280 | Ga0207694_100502802 | 76 |
| 184 | 3300025924 | Ga0207694_10361631 | Ga0207694_103616312 | 76 |
| 185 | 3300025924 | Ga0207694_11147127 | Ga0207694_111471272 | 76 |
| 186 | 3300025932 | Ga0207690_11586722 | Ga0207690_115867221 | 76 |
| 187 | 3300025937 | Ga0207669_10814320 | Ga0207669_108143202 | 76 |
| 188 | 3300025938 | Ga0207704_10528053 | Ga0207704_105280533 | 76 |
| 189 | 3300025940 | Ga0207691_10069067 | Ga0207691_100690672 | 76 |
| 190 | 3300025940 | Ga0207691_10271654 | Ga0207691_102716542 | 76 |
| 191 | 3300025941 | Ga0207711_10543155 | Ga0207711_105431552 | 76 |
| 192 | 3300025945 | Ga0207679_10142274 | Ga0207679_101422743 | 76 |
| 193 | 3300025972 | Ga0207668_10045606 | Ga0207668_100456063 | 76 |
| 194 | 3300025972 | Ga0207668_10132483 | Ga0207668_101324833 | 76 |
| 195 | 3300025986 | Ga0207658_10673984 | Ga0207658_106739842 | 76 |
| 196 | 3300026035 | Ga0207703_12283777 | Ga0207703_122837771 | 76 |
| 197 | 3300026041 | Ga0207639_10326040 | Ga0207639_103260402 | 76 |
| 198 | 3300026041 | Ga0207639_11043922 | Ga0207639_110439222 | 76 |
| 199 | 3300026067 | Ga0207678_10046189 | Ga0207678_100461892 | 76 |
| 200 | 3300026067 | Ga0207678_10196208 | Ga0207678_101962082 | 76 |
| 201 | 3300026067 | Ga0207678_10628178 | Ga0207678_106281782 | 76 |
| 202 | 3300026067 | Ga0207678_10628378 | Ga0207678_106283781 | 76 |
| 203 | 3300026067 | Ga0207678_11977380 | Ga0207678_119773802 | 76 |
| 204 | 3300026075 | Ga0207708_11667110 | Ga0207708_116671102 | 76 |
| 205 | 3300026078 | Ga0207702_10484655 | Ga0207702_104846552 | 76 |
| 206 | 3300026088 | Ga0207641_12303101 | Ga0207641_123031012 | 76 |
| 207 | 3300026095 | Ga0207676_10499052 | Ga0207676_104990522 | 76 |
| 208 | 3300026118 | Ga0207675_102435852 | Ga0207675_1024358522 | 76 |
| 209 | 3300026121 | Ga0207683_10555878 | Ga0207683_105558782 | 76 |
| 210 | 3300026142 | Ga0207698_10875311 | Ga0207698_108753112 | 76 |
| 211 | 3300028379 | Ga0268266_10018977 | Ga0268266_100189774 | 76 |
| 212 | 3300028379 | Ga0268266_10049269 | Ga0268266_100492693 | 76 |
| 213 | 3300028379 | Ga0268266_10169246 | Ga0268266_101692463 | 76 |
| 214 | 3300028379 | Ga0268266_10422628 | Ga0268266_104226282 | 76 |
| 215 | 3300028379 | Ga0268266_11026550 | Ga0268266_110265502 | 76 |
| 216 | 3300028379 | Ga0268266_11098736 | Ga0268266_110987362 | 76 |
| 217 | 3300028379 | Ga0268266_11758741 | Ga0268266_117587412 | 76 |
| 218 | 3300028381 | Ga0268264_10478706 | Ga0268264_104787062 | 76 |
| 219 | 3300028786 | Ga0307517_10173123 | Ga0307517_101731232 | 76 |
| 220 | 3300031507 | Ga0307509_10859531 | Ga0307509_108595312 | 76 |
| 221 | 3300031901 | Ga0307406_12133290 | Ga0307406_121332902 | 76 |
| 222 | 3300031995 | Ga0307409_101026142 | Ga0307409_1010261422 | 76 |
| 223 | 3300033180 | Ga0307510_10032730 | Ga0307510_100327305 | 76 |
| 224 | 3300033180 | Ga0307510_10318574 | Ga0307510_103185742 | 76 |
| 225 | 3300035089 | Ga0373944_0034261 | Ga0373944_0034261_855_1097 | 76 |
| 226 | 3300035111 | Ga0373923_0003954 | Ga0373923_0003954_3605_3847 | 76 |
| 227 | 3300035691 | Ga0373931_0955163 | Ga0373931_0955163_19_258 | 76 |
| 228 | 3300035692 | Ga0373935_0039187 | Ga0373935_0039187_2601_2843 | 76 |
| 229 | 3300035695 | Ga0373927_0022118 | Ga0373927_0022118_2725_2967 | 76 |
| 230 | 3300037068 | Ga0373925_0007949 | Ga0373925_0007949_5932_6174 | 76 |
| 231 | 3300041486 | Ga0451807_2464568 | Ga0451807_2464568_163_402 | 76 |
| 232 | 3300041509 | Ga0451843_0098124 | Ga0451843_0098124_21_263 | 76 |
| 233 | 3300046454 | Ga0495592_0679713 | Ga0495592_0679713_372_611 | 76 |
| 234 | 3300046459 | Ga0495629_0039402 | Ga0495629_0039402_1007_1249 | 76 |
| 235 | 3300046460 | Ga0495638_0014644 | Ga0495638_0014644_4551_4793 | 76 |
| 236 | 3300046471 | Ga0495650_0236519 | Ga0495650_0236519_58_297 | 76 |
| 237 | 3300046472 | Ga0495580_0138039 | Ga0495580_0138039_629_871 | 76 |
| 238 | 3300046474 | Ga0495605_0051546 | Ga0495605_0051546_736_975 | 76 |
| 239 | 3300046475 | Ga0495639_0040298 | Ga0495639_0040298_893_1135 | 76 |
| 240 | 3300046477 | Ga0495664_0892896 | Ga0495664_0892896_13_255 | 76 |
| 241 | 3300046491 | Ga0495584_0287706 | Ga0495584_0287706_397_636 | 76 |
| 242 | 3300046492 | Ga0495585_0064965 | Ga0495585_0064965_1105_1344 | 76 |
| 243 | 3300046501 | Ga0495607_0169161 | Ga0495607_0169161_141_380 | 76 |
| 244 | 3300046501 | Ga0495607_0465917 | Ga0495607_0465917_259_501 | 76 |
| 245 | 3300046507 | Ga0495606_0013709 | Ga0495606_0013709_5258_5497 | 76 |
| 246 | 3300046507 | Ga0495606_0386457 | Ga0495606_0386457_67_309 | 76 |
| 247 | 3300046512 | Ga0495610_0336126 | Ga0495610_0336126_156_395 | 76 |
| 248 | 3300046513 | Ga0495616_0285952 | Ga0495616_0285952_32_271 | 76 |
| 249 | 3300046518 | Ga0495631_0053603 | Ga0495631_0053603_802_1041 | 76 |
| 250 | 3300046518 | Ga0495631_0367513 | Ga0495631_0367513_38_277 | 76 |
| 251 | 3300046519 | Ga0495632_0456611 | Ga0495632_0456611_273_515 | 76 |
| 252 | 3300046522 | Ga0495643_0115080 | Ga0495643_0115080_262_504 | 76 |
| 253 | 3300046523 | Ga0495644_0202317 | Ga0495644_0202317_434_676 | 76 |
| 254 | 3300046524 | Ga0495648_0323829 | Ga0495648_0323829_90_332 | 76 |
| 255 | 3300046524 | Ga0495648_0408249 | Ga0495648_0408249_185_424 | 76 |
| 256 | 3300046529 | Ga0495652_0159818 | Ga0495652_0159818_1454_1693 | 76 |
| 257 | 3300046533 | Ga0495640_0036489 | Ga0495640_0036489_1131_1373 | 76 |
| 258 | 3300046538 | Ga0495609_0091139 | Ga0495609_0091139_356_595 | 76 |
| 259 | 3300046538 | Ga0495609_0135735 | Ga0495609_0135735_650_889 | 76 |
| 260 | 3300046543 | Ga0495645_0079316 | Ga0495645_0079316_1462_1704 | 76 |
| 261 | 3300046557 | Ga0495622_0120485 | Ga0495622_0120485_191_430 | 76 |
| 262 | 3300046559 | Ga0495667_0451317 | Ga0495667_0451317_73_312 | 76 |
| 263 | 3300046559 | Ga0495667_0688386 | Ga0495667_0688386_338_580 | 76 |
| 264 | 3300046615 | Ga0495656_0126404 | Ga0495656_0126404_533_772 | 76 |
| 265 | 3300046616 | Ga0495668_0619637 | Ga0495668_0619637_87_329 | 76 |
| 266 | 3300046648 | Ga0495611_0144128 | Ga0495611_0144128_323_562 | 76 |
| 267 | 3300046660 | Ga0495625_0449562 | Ga0495625_0449562_498_740 | 76 |
| 268 | 3300046663 | Ga0495635_0541447 | Ga0495635_0541447_340_579 | 76 |
| 269 | 3300046665 | Ga0495661_0110155 | Ga0495661_0110155_210_449 | 76 |
| 270 | 3300046674 | Ga0495588_0577139 | Ga0495588_0577139_118_357 | 76 |
| 271 | 3300046689 | Ga0495613_0168584 | Ga0495613_0168584_803_1045 | 76 |
| 272 | 3300046690 | Ga0495624_0030319 | Ga0495624_0030319_1380_1622 | 76 |
| 273 | 3300046690 | Ga0495624_0293604 | Ga0495624_0293604_664_903 | 76 |
| 274 | 3300046691 | Ga0495670_0076406 | Ga0495670_0076406_356_595 | 76 |
| 275 | 3300046692 | Ga0495671_0191911 | Ga0495671_0191911_719_961 | 76 |
| 276 | 3300046692 | Ga0495671_0202563 | Ga0495671_0202563_517_756 | 76 |
| 277 | 3300046694 | Ga0495649_0125484 | Ga0495649_0125484_811_1053 | 76 |
| 278 | 3300046694 | Ga0495649_0232633 | Ga0495649_0232633_627_869 | 76 |
| 279 | 3300046794 | Ga0495589_0150778 | Ga0495589_0150778_714_953 | 76 |
| 280 | 3300046794 | Ga0495589_0185677 | Ga0495589_0185677_225_464 | 76 |
| 281 | 3300046794 | Ga0495589_0495876 | Ga0495589_0495876_259_501 | 76 |
| 282 | 3300046809 | Ga0495600_0601715 | Ga0495600_0601715_340_579 | 76 |
| 283 | 3300047315 | Ga0495581_0252600 | Ga0495581_0252600_112_354 | 76 |
| 284 | 3300047317 | Ga0495604_0151962 | Ga0495604_0151962_729_968 | 76 |
| 285 | 3300047318 | Ga0495636_0019022 | Ga0495636_0019022_1719_1958 | 76 |
| 286 | 3300047323 | Ga0495683_0391077 | Ga0495683_0391077_30_269 | 76 |
| 287 | 3300047469 | Ga0495673_0062561 | Ga0495673_0062561_507_746 | 76 |
| 288 | 3300047469 | Ga0495673_0275995 | Ga0495673_0275995_121_363 | 76 |
| 289 | 3300047472 | Ga0495686_0049811 | Ga0495686_0049811_933_1172 | 76 |
| 290 | 3300047472 | Ga0495686_0084772 | Ga0495686_0084772_797_1039 | 76 |
| 291 | 3300047472 | Ga0495686_0165489 | Ga0495686_0165489_291_533 | 76 |
| 292 | 3300047673 | Ga0495593_0108364 | Ga0495593_0108364_44_283 | 76 |
| 293 | 3300048090 | Ga0495615_0023431 | Ga0495615_0023431_1164_1403 | 76 |
| 294 | 3300048091 | Ga0495626_0124557 | Ga0495626_0124557_609_848 | 76 |
| 295 | 3300048903 | Ga0496100_0308312 | Ga0496100_0308312_908_1147 | 76 |
| 296 | 3300048904 | Ga0496101_0015603 | Ga0496101_0015603_155_394 | 76 |
| 297 | 3300048904 | Ga0496101_0200192 | Ga0496101_0200192_572_811 | 76 |
| 298 | 3300048904 | Ga0496101_0994086 | Ga0496101_0994086_86_325 | 76 |
| 299 | 3300048904 | Ga0496101_1266610 | Ga0496101_1266610_236_475 | 76 |
| 300 | 3300048905 | Ga0496102_0010356 | Ga0496102_0010356_4512_4751 | 76 |
| 301 | 3300048905 | Ga0496102_0185775 | Ga0496102_0185775_1087_1326 | 76 |
| 302 | 3300048905 | Ga0496102_0307526 | Ga0496102_0307526_782_1021 | 76 |
| 303 | 3300048907 | Ga0496104_0304780 | Ga0496104_0304780_600_839 | 76 |
| 304 | 3300048907 | Ga0496104_0319554 | Ga0496104_0319554_45_284 | 76 |
| 305 | 3300048908 | Ga0496105_0230784 | Ga0496105_0230784_60_299 | 76 |
| 306 | 3300048908 | Ga0496105_0298179 | Ga0496105_0298179_1018_1257 | 76 |
| 307 | 3300048909 | Ga0496106_0464900 | Ga0496106_0464900_538_777 | 76 |
| 308 | 3300048909 | Ga0496106_1249988 | Ga0496106_1249988_104_343 | 76 |
| 309 | 3300048910 | Ga0496107_0025500 | Ga0496107_0025500_3653_3892 | 76 |
| 310 | 3300048910 | Ga0496107_0061446 | Ga0496107_0061446_1032_1274 | 76 |
| 311 | 3300048911 | Ga0496108_0094501 | Ga0496108_0094501_759_998 | 76 |
| 312 | 3300048913 | Ga0496110_0903764 | Ga0496110_0903764_13_252 | 76 |
| 313 | 3300048913 | Ga0496110_1786821 | Ga0496110_1786821_243_482 | 76 |
| 314 | 3300048914 | Ga0496111_0413295 | Ga0496111_0413295_600_839 | 76 |
| 315 | 3300048915 | Ga0496112_0489942 | Ga0496112_0489942_795_1034 | 76 |
| 316 | 3300048915 | Ga0496112_0637917 | Ga0496112_0637917_602_841 | 76 |
| 317 | 3300048915 | Ga0496112_0925186 | Ga0496112_0925186_415_654 | 76 |
| 318 | 3300048915 | Ga0496112_1591029 | Ga0496112_1591029_132_371 | 76 |
| 319 | 3300048917 | Ga0496114_0300426 | Ga0496114_0300426_1081_1320 | 76 |
| 320 | 3300048917 | Ga0496114_0430074 | Ga0496114_0430074_826_1065 | 76 |
| 321 | 3300048917 | Ga0496114_1072588 | Ga0496114_1072588_359_601 | 76 |
| 322 | 3300048918 | Ga0496115_0026152 | Ga0496115_0026152_3935_4174 | 76 |
| 323 | 3300048918 | Ga0496115_0140718 | Ga0496115_0140718_374_613 | 76 |
| 324 | 3300048920 | Ga0496117_0122230 | Ga0496117_0122230_756_995 | 76 |
| 325 | 3300048921 | Ga0496118_0034470 | Ga0496118_0034470_948_1187 | 76 |
| 326 | 3300048924 | Ga0496121_0002100 | Ga0496121_0002100_5011_5253 | 76 |
| 327 | 3300048924 | Ga0496121_0184949 | Ga0496121_0184949_20_259 | 76 |
| 328 | 3300048924 | Ga0496121_0391228 | Ga0496121_0391228_599_838 | 76 |
| 329 | 3300048927 | Ga0496124_0276687 | Ga0496124_0276687_92_331 | 76 |
| 330 | 3300048927 | Ga0496124_0310303 | Ga0496124_0310303_26_265 | 76 |
| 331 | 3300048928 | Ga0496125_0680239 | Ga0496125_0680239_34_273 | 76 |
| 332 | 3300048929 | Ga0496126_0003493 | Ga0496126_0003493_3711_3953 | 76 |
| 333 | 3300048929 | Ga0496126_0040847 | Ga0496126_0040847_2869_3108 | 76 |
| 334 | 3300048929 | Ga0496126_0048775 | Ga0496126_0048775_2834_3073 | 76 |
| 335 | 3300048929 | Ga0496126_0099808 | Ga0496126_0099808_1703_1945 | 76 |
| 336 | 3300048929 | Ga0496126_0132257 | Ga0496126_0132257_150_404 | 76 |
| 337 | 3300048929 | Ga0496126_0154891 | Ga0496126_0154891_1074_1316 | 76 |
| 338 | 3300048929 | Ga0496126_0255447 | Ga0496126_0255447_562_804 | 76 |
| 339 | 3300048929 | Ga0496126_0283726 | Ga0496126_0283726_332_571 | 76 |
| 340 | 3300048929 | Ga0496126_0638987 | Ga0496126_0638987_426_665 | 76 |
| 341 | 3300048929 | Ga0496126_0870230 | Ga0496126_0870230_295_534 | 76 |
| 342 | 3300049459 | Ga0495678_157394 | Ga0495678_157394_300_539 | 76 |
| 343 | 3300049460 | Ga0495682_0332059 | Ga0495682_0332059_108_347 | 76 |
| 344 | 3300049583 | Ga0501067_0659106 | Ga0501067_0659106_296_535 | 76 |
| 345 | 3300050489 | nmdc:mga03683_61100_c1 | nmdc:mga03683_61100_c1_61_303 | 76 |
| 346 | 3300050490 | nmdc:mga03n38_25831_c1 | nmdc:mga03n38_25831_c1_492_731 | 76 |
| 347 | 3300050490 | nmdc:mga03n38_288638_c1 | nmdc:mga03n38_288638_c1_182_424 | 76 |
| 348 | 3300050491 | nmdc:mga00v17_1000904_c1 | nmdc:mga00v17_1000904_c1_65_304 | 76 |
| 349 | 3300050492 | nmdc:mga0yw44_1029325_c1 | nmdc:mga0yw44_1029325_c1_173_412 | 76 |
| 350 | 3300050492 | nmdc:mga0yw44_1874_c1 | nmdc:mga0yw44_1874_c1_3766_4005 | 76 |
| 351 | 3300050492 | nmdc:mga0yw44_235748_c1 | nmdc:mga0yw44_235748_c1_470_709 | 76 |
| 352 | 3300050492 | nmdc:mga0yw44_309953_c1 | nmdc:mga0yw44_309953_c1_493_735 | 76 |
| 353 | 3300050492 | nmdc:mga0yw44_746756_c1 | nmdc:mga0yw44_746756_c1_165_407 | 76 |
| 354 | 3300050493 | nmdc:mga0k408_231023_c1 | nmdc:mga0k408_231023_c1_838_1077 | 76 |
| 355 | 3300050494 | nmdc:mga06z11_184363_c1 | nmdc:mga06z11_184363_c1_912_1151 | 76 |
| 356 | 3300050494 | nmdc:mga06z11_40864_c1 | nmdc:mga06z11_40864_c1_623_865 | 76 |
| 357 | 3300050496 | nmdc:mga07m45_308415_c1 | nmdc:mga07m45_308415_c1_464_703 | 76 |
| 358 | 3300050496 | nmdc:mga07m45_40863_c1 | nmdc:mga07m45_40863_c1_1648_1890 | 76 |
| 359 | 3300050496 | nmdc:mga07m45_826852_c1 | nmdc:mga07m45_826852_c1_86_325 | 76 |
| 360 | 3300050512 | nmdc:mga0n895_5680_c1 | nmdc:mga0n895_5680_c1_7674_7913 | 76 |
| 361 | 3300050512 | nmdc:mga0n895_822307_c1 | nmdc:mga0n895_822307_c1_574_813 | 76 |
| 362 | 3300050514 | nmdc:mga08x19_401049_c1 | nmdc:mga08x19_401049_c1_83_322 | 76 |
| 363 | 3300050516 | nmdc:mga0sz30_1059_c3 | nmdc:mga0sz30_1059_c3_2423_2662 | 76 |
| 364 | 3300050516 | nmdc:mga0sz30_226114_c1 | nmdc:mga0sz30_226114_c1_95_337 | 76 |
| 365 | 3300053078 | Ga0495612_0015932 | Ga0495612_0015932_29_271 | 76 |
| 366 | 3300053078 | Ga0495612_0200620 | Ga0495612_0200620_520_762 | 76 |
| 367 | 3300053086 | Ga0500578_0277678 | Ga0500578_0277678_650_892 | 76 |
| 368 | 3300053092 | Ga0500583_0389583 | Ga0500583_0389583_331_570 | 76 |
| 369 | 3300053094 | Ga0500566_0001717 | Ga0500566_0001717_9841_10080 | 76 |
| 370 | 3300053096 | Ga0500641_0008115 | Ga0500641_0008115_911_1153 | 76 |
| 371 | 3300053102 | Ga0500554_037966 | Ga0500554_037966_390_635 | 76 |
| 372 | 3300053104 | Ga0500556_0241443 | Ga0500556_0241443_447_689 | 76 |
| 373 | 3300053108 | Ga0500562_001107 | Ga0500562_001107_1670_1912 | 76 |
| 374 | 3300053130 | Ga0500642_0003271 | Ga0500642_0003271_4555_4794 | 76 |
| 375 | 3300053133 | Ga0500655_028502 | Ga0500655_028502_219_461 | 76 |
| 376 | 3300053134 | Ga0500658_0272354 | Ga0500658_0272354_402_644 | 76 |
| 377 | 3300053136 | Ga0500559_0181486 | Ga0500559_0181486_624_863 | 76 |
| 378 | 3300053142 | Ga0500577_0085127 | Ga0500577_0085127_642_884 | 76 |
| 379 | 3300053146 | Ga0500588_0276755 | Ga0500588_0276755_263_505 | 76 |
| 380 | 3300053153 | Ga0500616_0047738 | Ga0500616_0047738_750_992 | 76 |
| 381 | 3300053154 | Ga0500619_288599 | Ga0500619_288599_29_268 | 76 |
| 382 | 3300053156 | Ga0500622_0191046 | Ga0500622_0191046_540_782 | 76 |
| 383 | 3300053160 | Ga0500633_0064998 | Ga0500633_0064998_247_489 | 76 |
| 384 | 3300053178 | Ga0500637_0209497 | Ga0500637_0209497_347_592 | 76 |
| 385 | 3300053730 | Ga0500645_197941 | Ga0500645_197941_139_381 | 76 |
| 386 | 3300053736 | Ga0500599_000207 | Ga0500599_000207_1860_2102 | 76 |
| 387 | 3300055283 | Ga0500661_004329 | Ga0500661_004329_752_1045 | 76 |
| 388 | 3300055283 | Ga0500661_010307 | Ga0500661_010307_806_1045 | 76 |
| 389 | 3300003911 | JGI25405J52794_10037902 | JGI25405J52794_100379021 | 77 |
| 390 | 3300005330 | Ga0070690_100532591 | Ga0070690_1005325912 | 77 |
| 391 | 3300005335 | Ga0070666_11350868 | Ga0070666_113508681 | 77 |
| 392 | 3300005339 | Ga0070660_101161094 | Ga0070660_1011610942 | 77 |
| 393 | 3300005341 | Ga0070691_10781627 | Ga0070691_107816271 | 77 |
| 394 | 3300005343 | Ga0070687_100166402 | Ga0070687_1001664022 | 77 |
| 395 | 3300005343 | Ga0070687_100694339 | Ga0070687_1006943392 | 77 |
| 396 | 3300005347 | Ga0070668_100005808 | Ga0070668_1000058083 | 77 |
| 397 | 3300005347 | Ga0070668_100194739 | Ga0070668_1001947392 | 77 |
| 398 | 3300005347 | Ga0070668_100212540 | Ga0070668_1002125402 | 77 |
| 399 | 3300005353 | Ga0070669_100775238 | Ga0070669_1007752382 | 77 |
| 400 | 3300005356 | Ga0070674_100031213 | Ga0070674_1000312133 | 77 |
| 401 | 3300005356 | Ga0070674_100437412 | Ga0070674_1004374122 | 77 |
| 402 | 3300005364 | Ga0070673_101517473 | Ga0070673_1015174731 | 77 |
| 403 | 3300005365 | Ga0070688_101293051 | Ga0070688_1012930511 | 77 |
| 404 | 3300005366 | Ga0070659_100477303 | Ga0070659_1004773032 | 77 |
| 405 | 3300005367 | Ga0070667_100073874 | Ga0070667_1000738743 | 77 |
| 406 | 3300005435 | Ga0070714_100036455 | Ga0070714_1000364553 | 77 |
| 407 | 3300005438 | Ga0070701_10154421 | Ga0070701_101544212 | 77 |
| 408 | 3300005444 | Ga0070694_100265391 | Ga0070694_1002653912 | 77 |
| 409 | 3300005444 | Ga0070694_100724769 | Ga0070694_1007247692 | 77 |
| 410 | 3300005455 | Ga0070663_100091272 | Ga0070663_1000912722 | 77 |
| 411 | 3300005455 | Ga0070663_100120186 | Ga0070663_1001201862 | 77 |
| 412 | 3300005456 | Ga0070678_100197182 | Ga0070678_1001971822 | 77 |
| 413 | 3300005456 | Ga0070678_101289911 | Ga0070678_1012899112 | 77 |
| 414 | 3300005457 | Ga0070662_101349901 | Ga0070662_1013499012 | 77 |
| 415 | 3300005459 | Ga0068867_100032452 | Ga0068867_1000324523 | 77 |
| 416 | 3300005459 | Ga0068867_100113282 | Ga0068867_1001132823 | 77 |
| 417 | 3300005466 | Ga0070685_10077747 | Ga0070685_100777473 | 77 |
| 418 | 3300005467 | Ga0070706_100184868 | Ga0070706_1001848681 | 77 |
| 419 | 3300005468 | Ga0070707_100774472 | Ga0070707_1007744721 | 77 |
| 420 | 3300005543 | Ga0070672_100129326 | Ga0070672_1001293262 | 77 |
| 421 | 3300005544 | Ga0070686_100183250 | Ga0070686_1001832501 | 77 |
| 422 | 3300005544 | Ga0070686_101252157 | Ga0070686_1012521572 | 77 |
| 423 | 3300005548 | Ga0070665_100805195 | Ga0070665_1008051952 | 77 |
| 424 | 3300005615 | Ga0070702_100026321 | Ga0070702_1000263213 | 77 |
| 425 | 3300005615 | Ga0070702_101892678 | Ga0070702_1018926782 | 77 |
| 426 | 3300005617 | Ga0068859_100696812 | Ga0068859_1006968122 | 77 |
| 427 | 3300005718 | Ga0068866_10131341 | Ga0068866_101313412 | 77 |
| 428 | 3300005719 | Ga0068861_100080697 | Ga0068861_1000806972 | 77 |
| 429 | 3300005719 | Ga0068861_100272358 | Ga0068861_1002723582 | 77 |
| 430 | 3300005840 | Ga0068870_10479818 | Ga0068870_104798182 | 77 |
| 431 | 3300005841 | Ga0068863_100187832 | Ga0068863_1001878323 | 77 |
| 432 | 3300005842 | Ga0068858_100471947 | Ga0068858_1004719472 | 77 |
| 433 | 3300005843 | Ga0068860_100454918 | Ga0068860_1004549182 | 77 |
| 434 | 3300005844 | Ga0068862_100036120 | Ga0068862_1000361203 | 77 |
| 435 | 3300005844 | Ga0068862_100254624 | Ga0068862_1002546242 | 77 |
| 436 | 3300005844 | Ga0068862_101097578 | Ga0068862_1010975782 | 77 |
| 437 | 3300005844 | Ga0068862_102686321 | Ga0068862_1026863212 | 77 |
| 438 | 3300005937 | Ga0081455_10016837 | Ga0081455_100168372 | 77 |
| 439 | 3300005937 | Ga0081455_10021723 | Ga0081455_100217233 | 77 |
| 440 | 3300005937 | Ga0081455_10198181 | Ga0081455_101981812 | 77 |
| 441 | 3300005983 | Ga0081540_1011715 | Ga0081540_10117152 | 77 |
| 442 | 3300005983 | Ga0081540_1011971 | Ga0081540_10119714 | 77 |
| 443 | 3300006163 | Ga0070715_11012604 | Ga0070715_110126042 | 77 |
| 444 | 3300006177 | Ga0075362_10081571 | Ga0075362_100815712 | 77 |
| 445 | 3300006358 | Ga0068871_100646315 | Ga0068871_1006463152 | 77 |
| 446 | 3300006844 | Ga0075428_100974934 | Ga0075428_1009749342 | 77 |
| 447 | 3300006881 | Ga0068865_100016598 | Ga0068865_1000165982 | 77 |
| 448 | 3300006931 | Ga0097620_100696784 | Ga0097620_1006967842 | 77 |
| 449 | 3300007265 | Ga0099794_10073505 | Ga0099794_100735052 | 77 |
| 450 | 3300007788 | Ga0099795_10031628 | Ga0099795_100316283 | 77 |
| 451 | 3300007788 | Ga0099795_10508302 | Ga0099795_105083022 | 77 |
| 452 | 3300009094 | Ga0111539_10123032 | Ga0111539_101230322 | 77 |
| 453 | 3300009094 | Ga0111539_10249985 | Ga0111539_102499852 | 77 |
| 454 | 3300009098 | Ga0105245_10202696 | Ga0105245_102026963 | 77 |
| 455 | 3300009101 | Ga0105247_10226896 | Ga0105247_102268962 | 77 |
| 456 | 3300009148 | Ga0105243_10015814 | Ga0105243_100158146 | 77 |
| 457 | 3300009148 | Ga0105243_10402274 | Ga0105243_104022742 | 77 |
| 458 | 3300009148 | Ga0105243_10700508 | Ga0105243_107005082 | 77 |
| 459 | 3300009148 | Ga0105243_12815504 | Ga0105243_128155041 | 77 |
| 460 | 3300009174 | Ga0105241_12570919 | Ga0105241_125709192 | 77 |
| 461 | 3300009176 | Ga0105242_10673523 | Ga0105242_106735231 | 77 |
| 462 | 3300009177 | Ga0105248_10435808 | Ga0105248_104358082 | 77 |
| 463 | 3300009553 | Ga0105249_10017611 | Ga0105249_100176115 | 77 |
| 464 | 3300009553 | Ga0105249_10145606 | Ga0105249_101456061 | 77 |
| 465 | 3300010159 | Ga0099796_10207317 | Ga0099796_102073173 | 77 |
| 466 | 3300010375 | Ga0105239_10187172 | Ga0105239_101871722 | 77 |
| 467 | 3300010375 | Ga0105239_10249047 | Ga0105239_102490472 | 77 |
| 468 | 3300011119 | Ga0105246_11234240 | Ga0105246_112342401 | 77 |
| 469 | 3300012480 | Ga0157346_1000549 | Ga0157346_10005493 | 77 |
| 470 | 3300013297 | Ga0157378_10859657 | Ga0157378_108596572 | 77 |
| 471 | 3300013306 | Ga0163162_10072411 | Ga0163162_100724113 | 77 |
| 472 | 3300013306 | Ga0163162_10614613 | Ga0163162_106146132 | 77 |
| 473 | 3300013306 | Ga0163162_10949391 | Ga0163162_109493912 | 77 |
| 474 | 3300013306 | Ga0163162_11246006 | Ga0163162_112460062 | 77 |
| 475 | 3300013308 | Ga0157375_10936020 | Ga0157375_109360202 | 77 |
| 476 | 3300013308 | Ga0157375_11145437 | Ga0157375_111454372 | 77 |
| 477 | 3300013308 | Ga0157375_12817263 | Ga0157375_128172631 | 77 |
| 478 | 3300014326 | Ga0157380_10041406 | Ga0157380_100414063 | 77 |
| 479 | 3300014326 | Ga0157380_10050663 | Ga0157380_100506632 | 77 |
| 480 | 3300014326 | Ga0157380_10133546 | Ga0157380_101335463 | 77 |
| 481 | 3300014326 | Ga0157380_10161378 | Ga0157380_101613782 | 77 |
| 482 | 3300014968 | Ga0157379_10935649 | Ga0157379_109356492 | 77 |
| 483 | 3300014968 | Ga0157379_12620311 | Ga0157379_126203112 | 77 |
| 484 | 3300014969 | Ga0157376_10331743 | Ga0157376_103317432 | 77 |
| 485 | 3300017792 | Ga0163161_10022389 | Ga0163161_100223892 | 77 |
| 486 | 3300017792 | Ga0163161_10065384 | Ga0163161_100653843 | 77 |
| 487 | 3300025261 | Ga0209233_1044369 | Ga0209233_10443692 | 77 |
| 488 | 3300025315 | Ga0207697_10153209 | Ga0207697_101532092 | 77 |
| 489 | 3300025901 | Ga0207688_10075210 | Ga0207688_100752103 | 77 |
| 490 | 3300025901 | Ga0207688_10176629 | Ga0207688_101766292 | 77 |
| 491 | 3300025903 | Ga0207680_10918689 | Ga0207680_109186892 | 77 |
| 492 | 3300025907 | Ga0207645_10666861 | Ga0207645_106668612 | 77 |
| 493 | 3300025909 | Ga0207705_10306961 | Ga0207705_103069612 | 77 |
| 494 | 3300025916 | Ga0207663_11546862 | Ga0207663_115468622 | 77 |
| 495 | 3300025918 | Ga0207662_10151602 | Ga0207662_101516022 | 77 |
| 496 | 3300025918 | Ga0207662_10703506 | Ga0207662_107035062 | 77 |
| 497 | 3300025919 | Ga0207657_10728268 | Ga0207657_107282682 | 77 |
| 498 | 3300025922 | Ga0207646_10615970 | Ga0207646_106159703 | 77 |
| 499 | 3300025923 | Ga0207681_10808178 | Ga0207681_108081782 | 77 |
| 500 | 3300025923 | Ga0207681_11222938 | Ga0207681_112229381 | 77 |
| 501 | 3300025929 | Ga0207664_10016924 | Ga0207664_100169245 | 77 |
| 502 | 3300025931 | Ga0207644_11059094 | Ga0207644_110590942 | 77 |
| 503 | 3300025932 | Ga0207690_10834586 | Ga0207690_108345862 | 77 |
| 504 | 3300025934 | Ga0207686_10467286 | Ga0207686_104672862 | 77 |
| 505 | 3300025935 | Ga0207709_10007487 | Ga0207709_100074872 | 77 |
| 506 | 3300025935 | Ga0207709_10215722 | Ga0207709_102157222 | 77 |
| 507 | 3300025935 | Ga0207709_11643478 | Ga0207709_116434782 | 77 |
| 508 | 3300025935 | Ga0207709_11800244 | Ga0207709_118002442 | 77 |
| 509 | 3300025937 | Ga0207669_10014385 | Ga0207669_100143853 | 77 |
| 510 | 3300025937 | Ga0207669_10049666 | Ga0207669_100496662 | 77 |
| 511 | 3300025938 | Ga0207704_10491864 | Ga0207704_104918642 | 77 |
| 512 | 3300025938 | Ga0207704_11662687 | Ga0207704_116626872 | 77 |
| 513 | 3300025940 | Ga0207691_10144454 | Ga0207691_101444542 | 77 |
| 514 | 3300025941 | Ga0207711_10267306 | Ga0207711_102673062 | 77 |
| 515 | 3300025945 | Ga0207679_11193750 | Ga0207679_111937502 | 77 |
| 516 | 3300025960 | Ga0207651_11299659 | Ga0207651_112996592 | 77 |
| 517 | 3300025961 | Ga0207712_10038289 | Ga0207712_100382893 | 77 |
| 518 | 3300025961 | Ga0207712_10047702 | Ga0207712_100477022 | 77 |
| 519 | 3300025972 | Ga0207668_10007777 | Ga0207668_100077773 | 77 |
| 520 | 3300025972 | Ga0207668_10015011 | Ga0207668_100150113 | 77 |
| 521 | 3300025972 | Ga0207668_10144188 | Ga0207668_101441882 | 77 |
| 522 | 3300025981 | Ga0207640_11704675 | Ga0207640_117046751 | 77 |
| 523 | 3300026023 | Ga0207677_11847223 | Ga0207677_118472232 | 77 |
| 524 | 3300026041 | Ga0207639_10519307 | Ga0207639_105193072 | 77 |
| 525 | 3300026067 | Ga0207678_10057323 | Ga0207678_100573233 | 77 |
| 526 | 3300026067 | Ga0207678_10111727 | Ga0207678_101117272 | 77 |
| 527 | 3300026067 | Ga0207678_10967068 | Ga0207678_109670682 | 77 |
| 528 | 3300026088 | Ga0207641_11487923 | Ga0207641_114879232 | 77 |
| 529 | 3300026089 | Ga0207648_10016432 | Ga0207648_100164326 | 77 |
| 530 | 3300026089 | Ga0207648_10075073 | Ga0207648_100750732 | 77 |
| 531 | 3300026116 | Ga0207674_10616628 | Ga0207674_106166282 | 77 |
| 532 | 3300026118 | Ga0207675_100306765 | Ga0207675_1003067652 | 77 |
| 533 | 3300026121 | Ga0207683_10259140 | Ga0207683_102591402 | 77 |
| 534 | 3300026121 | Ga0207683_10428652 | Ga0207683_104286523 | 77 |
| 535 | 3300026121 | Ga0207683_11070919 | Ga0207683_110709192 | 77 |
| 536 | 3300026142 | Ga0207698_12179178 | Ga0207698_121791782 | 77 |
| 537 | 3300027512 | Ga0209179_1027039 | Ga0209179_10270393 | 77 |
| 538 | 3300027671 | Ga0209588_1002310 | Ga0209588_10023106 | 77 |
| 539 | 3300028379 | Ga0268266_11274456 | Ga0268266_112744562 | 77 |
| 540 | 3300028380 | Ga0268265_10331432 | Ga0268265_103314322 | 77 |
| 541 | 3300028380 | Ga0268265_10678265 | Ga0268265_106782652 | 77 |
| 542 | 3300028380 | Ga0268265_11407338 | Ga0268265_114073382 | 77 |
| 543 | 3300028381 | Ga0268264_10270175 | Ga0268264_102701753 | 77 |
| 544 | 3300028786 | Ga0307517_10278060 | Ga0307517_102780602 | 77 |
| 545 | 3300028794 | Ga0307515_10489262 | Ga0307515_104892621 | 77 |
| 546 | 3300028794 | Ga0307515_10494632 | Ga0307515_104946321 | 77 |
| 547 | 3300031456 | Ga0307513_10147435 | Ga0307513_101474353 | 77 |
| 548 | 3300031456 | Ga0307513_10671147 | Ga0307513_106711472 | 77 |
| 549 | 3300031507 | Ga0307509_10065201 | Ga0307509_100652013 | 77 |
| 550 | 3300031507 | Ga0307509_10406868 | Ga0307509_104068682 | 77 |
| 551 | 3300031616 | Ga0307508_10523537 | Ga0307508_105235372 | 77 |
| 552 | 3300031730 | Ga0307516_10564519 | Ga0307516_105645192 | 77 |
| 553 | 3300031901 | Ga0307406_10413738 | Ga0307406_104137382 | 77 |
| 554 | 3300031901 | Ga0307406_10581586 | Ga0307406_105815862 | 77 |
| 555 | 3300031911 | Ga0307412_10265334 | Ga0307412_102653343 | 77 |
| 556 | 3300031911 | Ga0307412_10736290 | Ga0307412_107362902 | 77 |
| 557 | 3300031911 | Ga0307412_11973203 | Ga0307412_119732032 | 77 |
| 558 | 3300031995 | Ga0307409_100406447 | Ga0307409_1004064472 | 77 |
| 559 | 3300032002 | Ga0307416_100091922 | Ga0307416_1000919222 | 77 |
| 560 | 3300033180 | Ga0307510_10056715 | Ga0307510_100567153 | 77 |
| 561 | 3300033545 | Ga0316214_1008956 | Ga0316214_10089562 | 77 |
| 562 | 3300035088 | Ga0373940_0248480 | Ga0373940_0248480_175_420 | 77 |
| 563 | 3300035113 | Ga0373936_0094052 | Ga0373936_0094052_885_1130 | 77 |
| 564 | 3300035116 | Ga0373945_0044391 | Ga0373945_0044391_611_856 | 77 |
| 565 | 3300035692 | Ga0373935_0002324 | Ga0373935_0002324_8459_8704 | 77 |
| 566 | 3300035695 | Ga0373927_0008093 | Ga0373927_0008093_5056_5301 | 77 |
| 567 | 3300035724 | Ga0373933_0148920 | Ga0373933_0148920_772_1017 | 77 |
| 568 | 3300035725 | Ga0373947_0023756 | Ga0373947_0023756_204_449 | 77 |
| 569 | 3300035725 | Ga0373947_0646608 | Ga0373947_0646608_437_694 | 77 |
| 570 | 3300036401 | Ga0373937_0038440 | Ga0373937_0038440_1514_1759 | 77 |
| 571 | 3300037068 | Ga0373925_0009375 | Ga0373925_0009375_6600_6845 | 77 |
| 572 | 3300041413 | Ga0439465_0119163 | Ga0439465_0119163_43_288 | 77 |
| 573 | 3300041459 | Ga0451800_0559582 | Ga0451800_0559582_268_525 | 77 |
| 574 | 3300041486 | Ga0451807_1593632 | Ga0451807_1593632_200_442 | 77 |
| 575 | 3300046454 | Ga0495592_0023961 | Ga0495592_0023961_1521_1766 | 77 |
| 576 | 3300046454 | Ga0495592_0173537 | Ga0495592_0173537_705_950 | 77 |
| 577 | 3300046455 | Ga0495603_0001793 | Ga0495603_0001793_1593_1838 | 77 |
| 578 | 3300046455 | Ga0495603_0027624 | Ga0495603_0027624_2378_2635 | 77 |
| 579 | 3300046457 | Ga0495590_0041013 | Ga0495590_0041013_416_661 | 77 |
| 580 | 3300046459 | Ga0495629_0000539 | Ga0495629_0000539_12723_12968 | 77 |
| 581 | 3300046460 | Ga0495638_0001644 | Ga0495638_0001644_8208_8453 | 77 |
| 582 | 3300046460 | Ga0495638_0107170 | Ga0495638_0107170_76_321 | 77 |
| 583 | 3300046460 | Ga0495638_0118515 | Ga0495638_0118515_1277_1522 | 77 |
| 584 | 3300046460 | Ga0495638_0259646 | Ga0495638_0259646_301_546 | 77 |
| 585 | 3300046461 | Ga0495641_0005270 | Ga0495641_0005270_2922_3167 | 77 |
| 586 | 3300046462 | Ga0495651_0003588 | Ga0495651_0003588_5079_5324 | 77 |
| 587 | 3300046463 | Ga0495653_0095216 | Ga0495653_0095216_602_847 | 77 |
| 588 | 3300046463 | Ga0495653_0312381 | Ga0495653_0312381_71_316 | 77 |
| 589 | 3300046463 | Ga0495653_0823025 | Ga0495653_0823025_34_279 | 77 |
| 590 | 3300046472 | Ga0495580_0183038 | Ga0495580_0183038_492_737 | 77 |
| 591 | 3300046472 | Ga0495580_0748491 | Ga0495580_0748491_124_381 | 77 |
| 592 | 3300046473 | Ga0495582_0010926 | Ga0495582_0010926_1688_1933 | 77 |
| 593 | 3300046473 | Ga0495582_0688375 | Ga0495582_0688375_279_542 | 77 |
| 594 | 3300046474 | Ga0495605_0073761 | Ga0495605_0073761_109_354 | 77 |
| 595 | 3300046474 | Ga0495605_0208238 | Ga0495605_0208238_504_749 | 77 |
| 596 | 3300046474 | Ga0495605_0314600 | Ga0495605_0314600_171_416 | 77 |
| 597 | 3300046475 | Ga0495639_0000442 | Ga0495639_0000442_17383_17628 | 77 |
| 598 | 3300046475 | Ga0495639_0148784 | Ga0495639_0148784_342_599 | 77 |
| 599 | 3300046476 | Ga0495662_0001304 | Ga0495662_0001304_11733_11978 | 77 |
| 600 | 3300046477 | Ga0495664_0012504 | Ga0495664_0012504_3340_3585 | 77 |
| 601 | 3300046477 | Ga0495664_0074683 | Ga0495664_0074683_491_736 | 77 |
| 602 | 3300046491 | Ga0495584_0189214 | Ga0495584_0189214_747_992 | 77 |
| 603 | 3300046491 | Ga0495584_0458111 | Ga0495584_0458111_218_463 | 77 |
| 604 | 3300046492 | Ga0495585_0087111 | Ga0495585_0087111_461_706 | 77 |
| 605 | 3300046492 | Ga0495585_0209978 | Ga0495585_0209978_380_625 | 77 |
| 606 | 3300046499 | Ga0495594_0000326 | Ga0495594_0000326_4005_4250 | 77 |
| 607 | 3300046499 | Ga0495594_0071264 | Ga0495594_0071264_1042_1308 | 77 |
| 608 | 3300046499 | Ga0495594_0454991 | Ga0495594_0454991_100_345 | 77 |
| 609 | 3300046500 | Ga0495596_0093580 | Ga0495596_0093580_388_633 | 77 |
| 610 | 3300046506 | Ga0495583_0359725 | Ga0495583_0359725_231_476 | 77 |
| 611 | 3300046507 | Ga0495606_0641863 | Ga0495606_0641863_106_372 | 77 |
| 612 | 3300046511 | Ga0495608_0019434 | Ga0495608_0019434_1145_1390 | 77 |
| 613 | 3300046516 | Ga0495628_0009768 | Ga0495628_0009768_4823_5068 | 77 |
| 614 | 3300046517 | Ga0495630_0110500 | Ga0495630_0110500_271_516 | 77 |
| 615 | 3300046517 | Ga0495630_0920200 | Ga0495630_0920200_117_362 | 77 |
| 616 | 3300046519 | Ga0495632_0298038 | Ga0495632_0298038_106_351 | 77 |
| 617 | 3300046522 | Ga0495643_0069219 | Ga0495643_0069219_1429_1674 | 77 |
| 618 | 3300046523 | Ga0495644_0249780 | Ga0495644_0249780_103_348 | 77 |
| 619 | 3300046524 | Ga0495648_0127215 | Ga0495648_0127215_137_382 | 77 |
| 620 | 3300046526 | Ga0495666_0141126 | Ga0495666_0141126_212_457 | 77 |
| 621 | 3300046529 | Ga0495652_0005812 | Ga0495652_0005812_7661_7906 | 77 |
| 622 | 3300046529 | Ga0495652_0478401 | Ga0495652_0478401_107_352 | 77 |
| 623 | 3300046529 | Ga0495652_0540482 | Ga0495652_0540482_215_460 | 77 |
| 624 | 3300046530 | Ga0495654_0332107 | Ga0495654_0332107_16_261 | 77 |
| 625 | 3300046530 | Ga0495654_0384822 | Ga0495654_0384822_31_282 | 77 |
| 626 | 3300046531 | Ga0495665_0003274 | Ga0495665_0003274_2969_3214 | 77 |
| 627 | 3300046533 | Ga0495640_0011752 | Ga0495640_0011752_1965_2210 | 77 |
| 628 | 3300046533 | Ga0495640_0171701 | Ga0495640_0171701_239_484 | 77 |
| 629 | 3300046535 | Ga0495586_0815581 | Ga0495586_0815581_136_381 | 77 |
| 630 | 3300046536 | Ga0495587_0006565 | Ga0495587_0006565_3479_3724 | 77 |
| 631 | 3300046543 | Ga0495645_0028962 | Ga0495645_0028962_3402_3647 | 77 |
| 632 | 3300046557 | Ga0495622_0019899 | Ga0495622_0019899_2796_3041 | 77 |
| 633 | 3300046557 | Ga0495622_0029021 | Ga0495622_0029021_2103_2369 | 77 |
| 634 | 3300046559 | Ga0495667_0005708 | Ga0495667_0005708_3479_3724 | 77 |
| 635 | 3300046559 | Ga0495667_0027140 | Ga0495667_0027140_889_1134 | 77 |
| 636 | 3300046615 | Ga0495656_0814770 | Ga0495656_0814770_219_464 | 77 |
| 637 | 3300046616 | Ga0495668_0264759 | Ga0495668_0264759_677_922 | 77 |
| 638 | 3300046616 | Ga0495668_0338591 | Ga0495668_0338591_420_686 | 77 |
| 639 | 3300046642 | Ga0495634_0001414 | Ga0495634_0001414_12339_12584 | 77 |
| 640 | 3300046642 | Ga0495634_0074278 | Ga0495634_0074278_1188_1433 | 77 |
| 641 | 3300046642 | Ga0495634_0661227 | Ga0495634_0661227_129_374 | 77 |
| 642 | 3300046648 | Ga0495611_0312798 | Ga0495611_0312798_106_351 | 77 |
| 643 | 3300046660 | Ga0495625_0495007 | Ga0495625_0495007_263_508 | 77 |
| 644 | 3300046663 | Ga0495635_0007761 | Ga0495635_0007761_2364_2609 | 77 |
| 645 | 3300046663 | Ga0495635_0541430 | Ga0495635_0541430_491_736 | 77 |
| 646 | 3300046665 | Ga0495661_0027351 | Ga0495661_0027351_1026_1271 | 77 |
| 647 | 3300046675 | Ga0495657_0006944 | Ga0495657_0006944_8334_8579 | 77 |
| 648 | 3300046675 | Ga0495657_0169994 | Ga0495657_0169994_570_815 | 77 |
| 649 | 3300046675 | Ga0495657_0732165 | Ga0495657_0732165_58_303 | 77 |
| 650 | 3300046678 | Ga0495599_0028210 | Ga0495599_0028210_2129_2374 | 77 |
| 651 | 3300046678 | Ga0495599_0374280 | Ga0495599_0374280_586_831 | 77 |
| 652 | 3300046679 | Ga0495623_0011888 | Ga0495623_0011888_3583_3828 | 77 |
| 653 | 3300046679 | Ga0495623_0624002 | Ga0495623_0624002_285_530 | 77 |
| 654 | 3300046680 | Ga0495646_0009638 | Ga0495646_0009638_2780_3025 | 77 |
| 655 | 3300046680 | Ga0495646_0015945 | Ga0495646_0015945_3229_3474 | 77 |
| 656 | 3300046680 | Ga0495646_0431458 | Ga0495646_0431458_80_325 | 77 |
| 657 | 3300046681 | Ga0495647_0032935 | Ga0495647_0032935_1172_1417 | 77 |
| 658 | 3300046683 | Ga0495658_0014805 | Ga0495658_0014805_541_786 | 77 |
| 659 | 3300046684 | Ga0495669_0002768 | Ga0495669_0002768_3300_3545 | 77 |
| 660 | 3300046684 | Ga0495669_0573594 | Ga0495669_0573594_272_517 | 77 |
| 661 | 3300046689 | Ga0495613_0130556 | Ga0495613_0130556_932_1177 | 77 |
| 662 | 3300046690 | Ga0495624_0007531 | Ga0495624_0007531_2587_2832 | 77 |
| 663 | 3300046692 | Ga0495671_0081664 | Ga0495671_0081664_1206_1451 | 77 |
| 664 | 3300046794 | Ga0495589_0051705 | Ga0495589_0051705_1203_1448 | 77 |
| 665 | 3300046809 | Ga0495600_0036783 | Ga0495600_0036783_35_280 | 77 |
| 666 | 3300046809 | Ga0495600_0068134 | Ga0495600_0068134_1358_1603 | 77 |
| 667 | 3300046810 | Ga0495660_0177798 | Ga0495660_0177798_350_616 | 77 |
| 668 | 3300046810 | Ga0495660_0191940 | Ga0495660_0191940_36_281 | 77 |
| 669 | 3300047315 | Ga0495581_0018644 | Ga0495581_0018644_1656_1901 | 77 |
| 670 | 3300047317 | Ga0495604_0005487 | Ga0495604_0005487_6393_6638 | 77 |
| 671 | 3300047317 | Ga0495604_0410472 | Ga0495604_0410472_102_347 | 77 |
| 672 | 3300047319 | Ga0495674_0000879 | Ga0495674_0000879_3888_4133 | 77 |
| 673 | 3300047319 | Ga0495674_0011383 | Ga0495674_0011383_3526_3771 | 77 |
| 674 | 3300047320 | Ga0495672_0083377 | Ga0495672_0083377_546_791 | 77 |
| 675 | 3300047321 | Ga0495676_0151694 | Ga0495676_0151694_1227_1472 | 77 |
| 676 | 3300047322 | Ga0495680_0005531 | Ga0495680_0005531_8064_8309 | 77 |
| 677 | 3300047323 | Ga0495683_0269676 | Ga0495683_0269676_52_318 | 77 |
| 678 | 3300047323 | Ga0495683_0285548 | Ga0495683_0285548_347_592 | 77 |
| 679 | 3300047444 | Ga0495675_0003412 | Ga0495675_0003412_2686_2931 | 77 |
| 680 | 3300047444 | Ga0495675_0611890 | Ga0495675_0611890_42_287 | 77 |
| 681 | 3300047445 | Ga0495677_0076022 | Ga0495677_0076022_343_588 | 77 |
| 682 | 3300047445 | Ga0495677_0155702 | Ga0495677_0155702_59_304 | 77 |
| 683 | 3300047471 | Ga0495684_0026792 | Ga0495684_0026792_3794_4039 | 77 |
| 684 | 3300047472 | Ga0495686_0067905 | Ga0495686_0067905_524_766 | 77 |
| 685 | 3300047472 | Ga0495686_0348129 | Ga0495686_0348129_43_288 | 77 |
| 686 | 3300047472 | Ga0495686_0552429 | Ga0495686_0552429_216_461 | 77 |
| 687 | 3300047472 | Ga0495686_0655070 | Ga0495686_0655070_30_275 | 77 |
| 688 | 3300047673 | Ga0495593_0001040 | Ga0495593_0001040_282_527 | 77 |
| 689 | 3300048088 | Ga0495602_0010182 | Ga0495602_0010182_3320_3565 | 77 |
| 690 | 3300048088 | Ga0495602_0148350 | Ga0495602_0148350_777_1022 | 77 |
| 691 | 3300048089 | Ga0495614_0081871 | Ga0495614_0081871_968_1213 | 77 |
| 692 | 3300048090 | Ga0495615_0013752 | Ga0495615_0013752_696_941 | 77 |
| 693 | 3300048903 | Ga0496100_0067588 | Ga0496100_0067588_1499_1744 | 77 |
| 694 | 3300048904 | Ga0496101_0456974 | Ga0496101_0456974_171_416 | 77 |
| 695 | 3300048904 | Ga0496101_0517466 | Ga0496101_0517466_13_258 | 77 |
| 696 | 3300048904 | Ga0496101_0555434 | Ga0496101_0555434_589_846 | 77 |
| 697 | 3300048905 | Ga0496102_0050249 | Ga0496102_0050249_915_1160 | 77 |
| 698 | 3300048905 | Ga0496102_1710853 | Ga0496102_1710853_273_518 | 77 |
| 699 | 3300048909 | Ga0496106_0600893 | Ga0496106_0600893_514_759 | 77 |
| 700 | 3300048910 | Ga0496107_0398248 | Ga0496107_0398248_408_653 | 77 |
| 701 | 3300048910 | Ga0496107_0578429 | Ga0496107_0578429_404_649 | 77 |
| 702 | 3300048912 | Ga0496109_0088443 | Ga0496109_0088443_34_279 | 77 |
| 703 | 3300048917 | Ga0496114_0587181 | Ga0496114_0587181_661_906 | 77 |
| 704 | 3300048917 | Ga0496114_1170964 | Ga0496114_1170964_371_616 | 77 |
| 705 | 3300048918 | Ga0496115_0101559 | Ga0496115_0101559_1196_1441 | 77 |
| 706 | 3300048918 | Ga0496115_0812618 | Ga0496115_0812618_201_446 | 77 |
| 707 | 3300048920 | Ga0496117_0057661 | Ga0496117_0057661_368_613 | 77 |
| 708 | 3300048921 | Ga0496118_0008710 | Ga0496118_0008710_9498_9743 | 77 |
| 709 | 3300048921 | Ga0496118_0154433 | Ga0496118_0154433_920_1165 | 77 |
| 710 | 3300048924 | Ga0496121_0000594 | Ga0496121_0000594_36218_36460 | 77 |
| 711 | 3300048924 | Ga0496121_0255336 | Ga0496121_0255336_160_405 | 77 |
| 712 | 3300048924 | Ga0496121_0422811 | Ga0496121_0422811_488_730 | 77 |
| 713 | 3300048924 | Ga0496121_0799455 | Ga0496121_0799455_116_361 | 77 |
| 714 | 3300048928 | Ga0496125_0013564 | Ga0496125_0013564_4219_4464 | 77 |
| 715 | 3300048929 | Ga0496126_0022745 | Ga0496126_0022745_4112_4357 | 77 |
| 716 | 3300048929 | Ga0496126_0598069 | Ga0496126_0598069_442_687 | 77 |
| 717 | 3300048929 | Ga0496126_0958984 | Ga0496126_0958984_111_356 | 77 |
| 718 | 3300048929 | Ga0496126_1253413 | Ga0496126_1253413_141_386 | 77 |
| 719 | 3300048929 | Ga0496126_1384260 | Ga0496126_1384260_242_487 | 77 |
| 720 | 3300049460 | Ga0495682_0360344 | Ga0495682_0360344_31_276 | 77 |
| 721 | 3300049579 | Ga0501043_0027235 | Ga0501043_0027235_2102_2344 | 77 |
| 722 | 3300049579 | Ga0501043_0116471 | Ga0501043_0116471_1436_1681 | 77 |
| 723 | 3300050489 | nmdc:mga03683_285846_c1 | nmdc:mga03683_285846_c1_401_646 | 77 |
| 724 | 3300050511 | nmdc:mga08y16_166453_c1 | nmdc:mga08y16_166453_c1_1401_1646 | 77 |
| 725 | 3300053078 | Ga0495612_0169295 | Ga0495612_0169295_171_416 | 77 |
| 726 | 3300053078 | Ga0495612_0499169 | Ga0495612_0499169_290_535 | 77 |
| 727 | 3300053078 | Ga0495612_0617592 | Ga0495612_0617592_232_477 | 77 |
| 728 | 3300053083 | Ga0495655_0106569 | Ga0495655_0106569_528_773 | 77 |
| 729 | 3300053084 | Ga0495595_0397832 | Ga0495595_0397832_218_463 | 77 |
| 730 | 3300053087 | Ga0500643_000707 | Ga0500643_000707_9607_9852 | 77 |
| 731 | 3300053087 | Ga0500643_028539 | Ga0500643_028539_1112_1357 | 77 |
| 732 | 3300053087 | Ga0500643_111515 | Ga0500643_111515_18_263 | 77 |
| 733 | 3300053088 | Ga0500644_0004606 | Ga0500644_0004606_1697_1942 | 77 |
| 734 | 3300053090 | Ga0500646_0008141 | Ga0500646_0008141_13_261 | 77 |
| 735 | 3300053090 | Ga0500646_0186287 | Ga0500646_0186287_270_515 | 77 |
| 736 | 3300053090 | Ga0500646_0215488 | Ga0500646_0215488_314_559 | 77 |
| 737 | 3300053091 | Ga0500647_0009309 | Ga0500647_0009309_1517_1762 | 77 |
| 738 | 3300053092 | Ga0500583_0051114 | Ga0500583_0051114_671_916 | 77 |
| 739 | 3300053094 | Ga0500566_0000007 | Ga0500566_0000007_1088_1330 | 77 |
| 740 | 3300053094 | Ga0500566_0047473 | Ga0500566_0047473_1262_1507 | 77 |
| 741 | 3300053094 | Ga0500566_0378002 | Ga0500566_0378002_106_348 | 77 |
| 742 | 3300053098 | Ga0500650_0138777 | Ga0500650_0138777_59_304 | 77 |
| 743 | 3300053098 | Ga0500650_0460751 | Ga0500650_0460751_282_527 | 77 |
| 744 | 3300053103 | Ga0500555_123674 | Ga0500555_123674_281_526 | 77 |
| 745 | 3300053104 | Ga0500556_0000058 | Ga0500556_0000058_87190_87435 | 77 |
| 746 | 3300053104 | Ga0500556_0027483 | Ga0500556_0027483_732_977 | 77 |
| 747 | 3300053108 | Ga0500562_001780 | Ga0500562_001780_4596_4841 | 77 |
| 748 | 3300053108 | Ga0500562_017167 | Ga0500562_017167_1425_1670 | 77 |
| 749 | 3300053108 | Ga0500562_124163 | Ga0500562_124163_300_545 | 77 |
| 750 | 3300053109 | Ga0500569_164372 | Ga0500569_164372_424_669 | 77 |
| 751 | 3300053109 | Ga0500569_209423 | Ga0500569_209423_329_595 | 77 |
| 752 | 3300053119 | Ga0500595_004598 | Ga0500595_004598_1724_1966 | 77 |
| 753 | 3300053119 | Ga0500595_026088 | Ga0500595_026088_1087_1332 | 77 |
| 754 | 3300053119 | Ga0500595_129538 | Ga0500595_129538_85_327 | 77 |
| 755 | 3300053121 | Ga0500607_094919 | Ga0500607_094919_945_1190 | 77 |
| 756 | 3300053123 | Ga0500614_073661 | Ga0500614_073661_407_652 | 77 |
| 757 | 3300053130 | Ga0500642_0087305 | Ga0500642_0087305_640_885 | 77 |
| 758 | 3300053133 | Ga0500655_040641 | Ga0500655_040641_112_357 | 77 |
| 759 | 3300053134 | Ga0500658_0007459 | Ga0500658_0007459_1853_2098 | 77 |
| 760 | 3300053134 | Ga0500658_0026987 | Ga0500658_0026987_1847_2092 | 77 |
| 761 | 3300053134 | Ga0500658_0405159 | Ga0500658_0405159_243_485 | 77 |
| 762 | 3300053134 | Ga0500658_0475436 | Ga0500658_0475436_255_497 | 77 |
| 763 | 3300053136 | Ga0500559_0122344 | Ga0500559_0122344_82_327 | 77 |
| 764 | 3300053137 | Ga0500561_0210326 | Ga0500561_0210326_140_385 | 77 |
| 765 | 3300053139 | Ga0500568_0346392 | Ga0500568_0346392_216_464 | 77 |
| 766 | 3300053139 | Ga0500568_0381028 | Ga0500568_0381028_156_401 | 77 |
| 767 | 3300053142 | Ga0500577_0000021 | Ga0500577_0000021_4656_4910 | 77 |
| 768 | 3300053142 | Ga0500577_0000172 | Ga0500577_0000172_13496_13741 | 77 |
| 769 | 3300053142 | Ga0500577_0355855 | Ga0500577_0355855_247_492 | 77 |
| 770 | 3300053145 | Ga0500586_001079 | Ga0500586_001079_2276_2521 | 77 |
| 771 | 3300053146 | Ga0500588_0396351 | Ga0500588_0396351_137_382 | 77 |
| 772 | 3300053147 | Ga0500589_060169 | Ga0500589_060169_802_1095 | 77 |
| 773 | 3300053147 | Ga0500589_237800 | Ga0500589_237800_174_440 | 77 |
| 774 | 3300053148 | Ga0500590_124874 | Ga0500590_124874_93_338 | 77 |
| 775 | 3300053150 | Ga0500603_015891 | Ga0500603_015891_278_523 | 77 |
| 776 | 3300053151 | Ga0500604_0012298 | Ga0500604_0012298_1435_1683 | 77 |
| 777 | 3300053156 | Ga0500622_0137146 | Ga0500622_0137146_62_328 | 77 |
| 778 | 3300053160 | Ga0500633_0117248 | Ga0500633_0117248_544_789 | 77 |
| 779 | 3300053160 | Ga0500633_0244914 | Ga0500633_0244914_405_650 | 77 |
| 780 | 3300053161 | Ga0500634_0374014 | Ga0500634_0374014_233_478 | 77 |
| 781 | 3300053162 | Ga0500638_182891 | Ga0500638_182891_184_426 | 77 |
| 782 | 3300053163 | Ga0500639_018849 | Ga0500639_018849_1276_1521 | 77 |
| 783 | 3300053163 | Ga0500639_030525 | Ga0500639_030525_31_276 | 77 |
| 784 | 3300053178 | Ga0500637_0000363 | Ga0500637_0000363_12047_12292 | 77 |
| 785 | 3300053178 | Ga0500637_0001156 | Ga0500637_0001156_6258_6500 | 77 |
| 786 | 3300053178 | Ga0500637_0314433 | Ga0500637_0314433_301_567 | 77 |
| 787 | 3300053723 | Ga0500567_073565 | Ga0500567_073565_22_267 | 77 |
| 788 | 3300053730 | Ga0500645_036556 | Ga0500645_036556_510_755 | 77 |
| 789 | 3300053737 | Ga0500601_023480 | Ga0500601_023480_83_328 | 77 |
| 790 | 3300000041 | ARcpr5oldR_c007842 | ARcpr5oldR_0078422 | 78 |
| 791 | 3300000043 | ARcpr5yngRDRAFT_c001352 | ARcpr5yngRDRAFT_0013522 | 78 |
| 792 | 3300000044 | ARSoilOldRDRAFT_c002613 | ARSoilOldRDRAFT_0026133 | 78 |
| 793 | 3300001990 | JGI24737J22298_10099360 | JGI24737J22298_100993602 | 78 |
| 794 | 3300003911 | JGI25405J52794_10013909 | JGI25405J52794_100139092 | 78 |
| 795 | 3300005293 | Ga0065715_10183454 | Ga0065715_101834542 | 78 |
| 796 | 3300005295 | Ga0065707_10585927 | Ga0065707_105859271 | 78 |
| 797 | 3300005328 | Ga0070676_11303168 | Ga0070676_113031681 | 78 |
| 798 | 3300005329 | Ga0070683_100158241 | Ga0070683_1001582413 | 78 |
| 799 | 3300005331 | Ga0070670_100059487 | Ga0070670_1000594872 | 78 |
| 800 | 3300005331 | Ga0070670_101812498 | Ga0070670_1018124982 | 78 |
| 801 | 3300005334 | Ga0068869_100281133 | Ga0068869_1002811332 | 78 |
| 802 | 3300005334 | Ga0068869_101440171 | Ga0068869_1014401711 | 78 |
| 803 | 3300005335 | Ga0070666_10012782 | Ga0070666_100127824 | 78 |
| 804 | 3300005335 | Ga0070666_10682505 | Ga0070666_106825052 | 78 |
| 805 | 3300005336 | Ga0070680_100045207 | Ga0070680_1000452073 | 78 |
| 806 | 3300005336 | Ga0070680_100099057 | Ga0070680_1000990572 | 78 |
| 807 | 3300005337 | Ga0070682_100022897 | Ga0070682_1000228974 | 78 |
| 808 | 3300005337 | Ga0070682_100035492 | Ga0070682_1000354922 | 78 |
| 809 | 3300005337 | Ga0070682_101903069 | Ga0070682_1019030691 | 78 |
| 810 | 3300005338 | Ga0068868_100385148 | Ga0068868_1003851482 | 78 |
| 811 | 3300005338 | Ga0068868_100880283 | Ga0068868_1008802831 | 78 |
| 812 | 3300005339 | Ga0070660_100202332 | Ga0070660_1002023322 | 78 |
| 813 | 3300005340 | Ga0070689_100046929 | Ga0070689_1000469293 | 78 |
| 814 | 3300005340 | Ga0070689_100172396 | Ga0070689_1001723963 | 78 |
| 815 | 3300005341 | Ga0070691_10510512 | Ga0070691_105105121 | 78 |
| 816 | 3300005343 | Ga0070687_100471077 | Ga0070687_1004710772 | 78 |
| 817 | 3300005344 | Ga0070661_100191462 | Ga0070661_1001914622 | 78 |
| 818 | 3300005345 | Ga0070692_10028676 | Ga0070692_100286763 | 78 |
| 819 | 3300005347 | Ga0070668_100810770 | Ga0070668_1008107701 | 78 |
| 820 | 3300005347 | Ga0070668_100895881 | Ga0070668_1008958811 | 78 |
| 821 | 3300005353 | Ga0070669_101586762 | Ga0070669_1015867622 | 78 |
| 822 | 3300005354 | Ga0070675_100041049 | Ga0070675_1000410495 | 78 |
| 823 | 3300005355 | Ga0070671_100061772 | Ga0070671_1000617722 | 78 |
| 824 | 3300005355 | Ga0070671_100572906 | Ga0070671_1005729062 | 78 |
| 825 | 3300005356 | Ga0070674_100203948 | Ga0070674_1002039482 | 78 |
| 826 | 3300005364 | Ga0070673_100094789 | Ga0070673_1000947893 | 78 |
| 827 | 3300005365 | Ga0070688_100080154 | Ga0070688_1000801543 | 78 |
| 828 | 3300005365 | Ga0070688_100222245 | Ga0070688_1002222451 | 78 |
| 829 | 3300005366 | Ga0070659_100353142 | Ga0070659_1003531422 | 78 |
| 830 | 3300005367 | Ga0070667_101635616 | Ga0070667_1016356162 | 78 |
| 831 | 3300005434 | Ga0070709_10009527 | Ga0070709_100095275 | 78 |
| 832 | 3300005436 | Ga0070713_100003957 | Ga0070713_1000039573 | 78 |
| 833 | 3300005437 | Ga0070710_10140347 | Ga0070710_101403472 | 78 |
| 834 | 3300005438 | Ga0070701_11285924 | Ga0070701_112859241 | 78 |
| 835 | 3300005439 | Ga0070711_100478200 | Ga0070711_1004782001 | 78 |
| 836 | 3300005440 | Ga0070705_100050366 | Ga0070705_1000503663 | 78 |
| 837 | 3300005440 | Ga0070705_100955155 | Ga0070705_1009551552 | 78 |
| 838 | 3300005441 | Ga0070700_101198429 | Ga0070700_1011984292 | 78 |
| 839 | 3300005444 | Ga0070694_101151423 | Ga0070694_1011514231 | 78 |
| 840 | 3300005455 | Ga0070663_100018956 | Ga0070663_1000189564 | 78 |
| 841 | 3300005455 | Ga0070663_100448902 | Ga0070663_1004489021 | 78 |
| 842 | 3300005456 | Ga0070678_100064462 | Ga0070678_1000644623 | 78 |
| 843 | 3300005456 | Ga0070678_100216450 | Ga0070678_1002164502 | 78 |
| 844 | 3300005456 | Ga0070678_100470064 | Ga0070678_1004700642 | 78 |
| 845 | 3300005457 | Ga0070662_100139925 | Ga0070662_1001399252 | 78 |
| 846 | 3300005457 | Ga0070662_100590717 | Ga0070662_1005907171 | 78 |
| 847 | 3300005458 | Ga0070681_10031833 | Ga0070681_100318335 | 78 |
| 848 | 3300005466 | Ga0070685_10182719 | Ga0070685_101827192 | 78 |
| 849 | 3300005466 | Ga0070685_11053504 | Ga0070685_110535042 | 78 |
| 850 | 3300005507 | Ga0074259_11290175 | Ga0074259_112901752 | 78 |
| 851 | 3300005530 | Ga0070679_100030768 | Ga0070679_1000307683 | 78 |
| 852 | 3300005530 | Ga0070679_100517890 | Ga0070679_1005178902 | 78 |
| 853 | 3300005535 | Ga0070684_100094549 | Ga0070684_1000945492 | 78 |
| 854 | 3300005535 | Ga0070684_100231267 | Ga0070684_1002312672 | 78 |
| 855 | 3300005539 | Ga0068853_100885211 | Ga0068853_1008852112 | 78 |
| 856 | 3300005544 | Ga0070686_100456547 | Ga0070686_1004565472 | 78 |
| 857 | 3300005544 | Ga0070686_100459796 | Ga0070686_1004597962 | 78 |
| 858 | 3300005545 | Ga0070695_100149169 | Ga0070695_1001491692 | 78 |
| 859 | 3300005545 | Ga0070695_101426307 | Ga0070695_1014263071 | 78 |
| 860 | 3300005546 | Ga0070696_100016292 | Ga0070696_1000162922 | 78 |
| 861 | 3300005546 | Ga0070696_100288110 | Ga0070696_1002881102 | 78 |
| 862 | 3300005546 | Ga0070696_101047268 | Ga0070696_1010472682 | 78 |
| 863 | 3300005547 | Ga0070693_100019995 | Ga0070693_1000199952 | 78 |
| 864 | 3300005547 | Ga0070693_100857264 | Ga0070693_1008572642 | 78 |
| 865 | 3300005548 | Ga0070665_100020452 | Ga0070665_1000204524 | 78 |
| 866 | 3300005548 | Ga0070665_100155154 | Ga0070665_1001551543 | 78 |
| 867 | 3300005548 | Ga0070665_100561916 | Ga0070665_1005619162 | 78 |
| 868 | 3300005548 | Ga0070665_101892241 | Ga0070665_1018922411 | 78 |
| 869 | 3300005549 | Ga0070704_100074081 | Ga0070704_1000740814 | 78 |
| 870 | 3300005564 | Ga0070664_100142524 | Ga0070664_1001425242 | 78 |
| 871 | 3300005564 | Ga0070664_100146153 | Ga0070664_1001461533 | 78 |
| 872 | 3300005578 | Ga0068854_100994169 | Ga0068854_1009941692 | 78 |
| 873 | 3300005617 | Ga0068859_100099798 | Ga0068859_1000997984 | 78 |
| 874 | 3300005617 | Ga0068859_100120409 | Ga0068859_1001204093 | 78 |
| 875 | 3300005618 | Ga0068864_100471159 | Ga0068864_1004711592 | 78 |
| 876 | 3300005618 | Ga0068864_100601003 | Ga0068864_1006010032 | 78 |
| 877 | 3300005718 | Ga0068866_10059988 | Ga0068866_100599881 | 78 |
| 878 | 3300005719 | Ga0068861_100219292 | Ga0068861_1002192922 | 78 |
| 879 | 3300005719 | Ga0068861_100898880 | Ga0068861_1008988802 | 78 |
| 880 | 3300005841 | Ga0068863_100583063 | Ga0068863_1005830632 | 78 |
| 881 | 3300005841 | Ga0068863_101216087 | Ga0068863_1012160871 | 78 |
| 882 | 3300005842 | Ga0068858_100093478 | Ga0068858_1000934782 | 78 |
| 883 | 3300005842 | Ga0068858_101223421 | Ga0068858_1012234211 | 78 |
| 884 | 3300005843 | Ga0068860_100196329 | Ga0068860_1001963293 | 78 |
| 885 | 3300005843 | Ga0068860_101447303 | Ga0068860_1014473032 | 78 |
| 886 | 3300005844 | Ga0068862_100048786 | Ga0068862_1000487863 | 78 |
| 887 | 3300005937 | Ga0081455_10042464 | Ga0081455_100424645 | 78 |
| 888 | 3300005937 | Ga0081455_10185745 | Ga0081455_101857452 | 78 |
| 889 | 3300006028 | Ga0070717_10045340 | Ga0070717_100453403 | 78 |
| 890 | 3300006038 | Ga0075365_10192420 | Ga0075365_101924202 | 78 |
| 891 | 3300006048 | Ga0075363_100000323 | Ga0075363_1000003232 | 78 |
| 892 | 3300006051 | Ga0075364_10018097 | Ga0075364_100180974 | 78 |
| 893 | 3300006173 | Ga0070716_100000563 | Ga0070716_10000056312 | 78 |
| 894 | 3300006173 | Ga0070716_101120903 | Ga0070716_1011209032 | 78 |
| 895 | 3300006175 | Ga0070712_100018194 | Ga0070712_1000181942 | 78 |
| 896 | 3300006175 | Ga0070712_100470633 | Ga0070712_1004706332 | 78 |
| 897 | 3300006178 | Ga0075367_10007063 | Ga0075367_100070634 | 78 |
| 898 | 3300006186 | Ga0075369_10255534 | Ga0075369_102555342 | 78 |
| 899 | 3300006237 | Ga0097621_100010097 | Ga0097621_1000100976 | 78 |
| 900 | 3300006237 | Ga0097621_100796628 | Ga0097621_1007966281 | 78 |
| 901 | 3300006353 | Ga0075370_10009352 | Ga0075370_100093524 | 78 |
| 902 | 3300006358 | Ga0068871_100122561 | Ga0068871_1001225613 | 78 |
| 903 | 3300006358 | Ga0068871_100140979 | Ga0068871_1001409793 | 78 |
| 904 | 3300006852 | Ga0075433_10953790 | Ga0075433_109537902 | 78 |
| 905 | 3300006871 | Ga0075434_100194277 | Ga0075434_1001942772 | 78 |
| 906 | 3300006871 | Ga0075434_100507075 | Ga0075434_1005070752 | 78 |
| 907 | 3300006871 | Ga0075434_100688011 | Ga0075434_1006880112 | 78 |
| 908 | 3300006881 | Ga0068865_100142283 | Ga0068865_1001422832 | 78 |
| 909 | 3300006914 | Ga0075436_100036272 | Ga0075436_1000362722 | 78 |
| 910 | 3300006914 | Ga0075436_100817563 | Ga0075436_1008175632 | 78 |
| 911 | 3300006914 | Ga0075436_101435460 | Ga0075436_1014354602 | 78 |
| 912 | 3300006931 | Ga0097620_100099797 | Ga0097620_1000997971 | 78 |
| 913 | 3300006931 | Ga0097620_100120403 | Ga0097620_1001204033 | 78 |
| 914 | 3300007076 | Ga0075435_100829339 | Ga0075435_1008293392 | 78 |
| 915 | 3300009011 | Ga0105251_10065493 | Ga0105251_100654931 | 78 |
| 916 | 3300009092 | Ga0105250_10386012 | Ga0105250_103860121 | 78 |
| 917 | 3300009094 | Ga0111539_11423108 | Ga0111539_114231082 | 78 |
| 918 | 3300009098 | Ga0105245_10435988 | Ga0105245_104359882 | 78 |
| 919 | 3300009101 | Ga0105247_10333711 | Ga0105247_103337112 | 78 |
| 920 | 3300009101 | Ga0105247_10714208 | Ga0105247_107142081 | 78 |
| 921 | 3300009101 | Ga0105247_11507727 | Ga0105247_115077271 | 78 |
| 922 | 3300009148 | Ga0105243_10046627 | Ga0105243_100466273 | 78 |
| 923 | 3300009148 | Ga0105243_12471298 | Ga0105243_124712982 | 78 |
| 924 | 3300009174 | Ga0105241_10195969 | Ga0105241_101959692 | 78 |
| 925 | 3300009174 | Ga0105241_11461166 | Ga0105241_114611662 | 78 |
| 926 | 3300009174 | Ga0105241_11625912 | Ga0105241_116259122 | 78 |
| 927 | 3300009176 | Ga0105242_10088851 | Ga0105242_100888513 | 78 |
| 928 | 3300009177 | Ga0105248_10013026 | Ga0105248_100130262 | 78 |
| 929 | 3300009177 | Ga0105248_10236486 | Ga0105248_102364862 | 78 |
| 930 | 3300009177 | Ga0105248_11751108 | Ga0105248_117511082 | 78 |
| 931 | 3300009545 | Ga0105237_10141121 | Ga0105237_101411212 | 78 |
| 932 | 3300009545 | Ga0105237_10911983 | Ga0105237_109119832 | 78 |
| 933 | 3300009551 | Ga0105238_10037495 | Ga0105238_100374951 | 78 |
| 934 | 3300009551 | Ga0105238_11047574 | Ga0105238_110475742 | 78 |
| 935 | 3300009553 | Ga0105249_10956122 | Ga0105249_109561222 | 78 |
| 936 | 3300009553 | Ga0105249_12611099 | Ga0105249_126110992 | 78 |
| 937 | 3300010375 | Ga0105239_10185479 | Ga0105239_101854792 | 78 |
| 938 | 3300010375 | Ga0105239_12725864 | Ga0105239_127258641 | 78 |
| 939 | 3300011119 | Ga0105246_10035343 | Ga0105246_100353433 | 78 |
| 940 | 3300011119 | Ga0105246_11045372 | Ga0105246_110453722 | 78 |
| 941 | 3300011119 | Ga0105246_12093803 | Ga0105246_120938032 | 78 |
| 942 | 3300012483 | Ga0157337_1010325 | Ga0157337_10103252 | 78 |
| 943 | 3300012490 | Ga0157322_1007198 | Ga0157322_10071982 | 78 |
| 944 | 3300012492 | Ga0157335_1011247 | Ga0157335_10112471 | 78 |
| 945 | 3300012505 | Ga0157339_1005873 | Ga0157339_10058732 | 78 |
| 946 | 3300013105 | Ga0157369_10462169 | Ga0157369_104621692 | 78 |
| 947 | 3300013296 | Ga0157374_11303762 | Ga0157374_113037622 | 78 |
| 948 | 3300013296 | Ga0157374_12416185 | Ga0157374_124161851 | 78 |
| 949 | 3300013297 | Ga0157378_10025025 | Ga0157378_100250255 | 78 |
| 950 | 3300013297 | Ga0157378_10630919 | Ga0157378_106309191 | 78 |
| 951 | 3300013306 | Ga0163162_10727460 | Ga0163162_107274602 | 78 |
| 952 | 3300013306 | Ga0163162_12537606 | Ga0163162_125376062 | 78 |
| 953 | 3300013307 | Ga0157372_11213489 | Ga0157372_112134892 | 78 |
| 954 | 3300013307 | Ga0157372_11526840 | Ga0157372_115268401 | 78 |
| 955 | 3300013308 | Ga0157375_10504102 | Ga0157375_105041022 | 78 |
| 956 | 3300013308 | Ga0157375_10981988 | Ga0157375_109819883 | 78 |
| 957 | 3300013308 | Ga0157375_13548440 | Ga0157375_135484402 | 78 |
| 958 | 3300014325 | Ga0163163_10030831 | Ga0163163_100308314 | 78 |
| 959 | 3300014325 | Ga0163163_10833908 | Ga0163163_108339082 | 78 |
| 960 | 3300014325 | Ga0163163_12659441 | Ga0163163_126594411 | 78 |
| 961 | 3300014326 | Ga0157380_10149280 | Ga0157380_101492803 | 78 |
| 962 | 3300014745 | Ga0157377_10381825 | Ga0157377_103818252 | 78 |
| 963 | 3300014968 | Ga0157379_10380830 | Ga0157379_103808302 | 78 |
| 964 | 3300014968 | Ga0157379_11735797 | Ga0157379_117357971 | 78 |
| 965 | 3300014969 | Ga0157376_11382065 | Ga0157376_113820652 | 78 |
| 966 | 3300017792 | Ga0163161_10705973 | Ga0163161_107059732 | 78 |
| 967 | 3300025299 | Ga0209256_1000102 | Ga0209256_1000102176 | 78 |
| 968 | 3300025898 | Ga0207692_10015582 | Ga0207692_100155824 | 78 |
| 969 | 3300025900 | Ga0207710_10243604 | Ga0207710_102436042 | 78 |
| 970 | 3300025903 | Ga0207680_10096262 | Ga0207680_100962622 | 78 |
| 971 | 3300025903 | Ga0207680_11230386 | Ga0207680_112303862 | 78 |
| 972 | 3300025904 | Ga0207647_10165890 | Ga0207647_101658902 | 78 |
| 973 | 3300025905 | Ga0207685_10018544 | Ga0207685_100185442 | 78 |
| 974 | 3300025906 | Ga0207699_10021882 | Ga0207699_100218824 | 78 |
| 975 | 3300025911 | Ga0207654_10434633 | Ga0207654_104346332 | 78 |
| 976 | 3300025914 | Ga0207671_10072995 | Ga0207671_100729952 | 78 |
| 977 | 3300025914 | Ga0207671_10762931 | Ga0207671_107629311 | 78 |
| 978 | 3300025915 | Ga0207693_10005549 | Ga0207693_100055495 | 78 |
| 979 | 3300025917 | Ga0207660_10862612 | Ga0207660_108626122 | 78 |
| 980 | 3300025918 | Ga0207662_10003182 | Ga0207662_100031822 | 78 |
| 981 | 3300025919 | Ga0207657_10073973 | Ga0207657_100739732 | 78 |
| 982 | 3300025920 | Ga0207649_10479446 | Ga0207649_104794462 | 78 |
| 983 | 3300025921 | Ga0207652_10059294 | Ga0207652_100592944 | 78 |
| 984 | 3300025923 | Ga0207681_10284537 | Ga0207681_102845372 | 78 |
| 985 | 3300025925 | Ga0207650_10245466 | Ga0207650_102454662 | 78 |
| 986 | 3300025926 | Ga0207659_10288665 | Ga0207659_102886652 | 78 |
| 987 | 3300025926 | Ga0207659_11270808 | Ga0207659_112708082 | 78 |
| 988 | 3300025927 | Ga0207687_10042417 | Ga0207687_100424174 | 78 |
| 989 | 3300025928 | Ga0207700_10002764 | Ga0207700_100027643 | 78 |
| 990 | 3300025931 | Ga0207644_10130952 | Ga0207644_101309523 | 78 |
| 991 | 3300025931 | Ga0207644_11621711 | Ga0207644_116217112 | 78 |
| 992 | 3300025932 | Ga0207690_10050399 | Ga0207690_100503993 | 78 |
| 993 | 3300025933 | Ga0207706_10012295 | Ga0207706_100122959 | 78 |
| 994 | 3300025933 | Ga0207706_10050537 | Ga0207706_100505374 | 78 |
| 995 | 3300025934 | Ga0207686_10030297 | Ga0207686_100302973 | 78 |
| 996 | 3300025936 | Ga0207670_10115693 | Ga0207670_101156932 | 78 |
| 997 | 3300025937 | Ga0207669_11088656 | Ga0207669_110886562 | 78 |
| 998 | 3300025938 | Ga0207704_10785212 | Ga0207704_107852122 | 78 |
| 999 | 3300025939 | Ga0207665_10000555 | Ga0207665_1000055511 | 78 |
| 1000 | 3300025940 | Ga0207691_10105826 | Ga0207691_101058263 | 78 |
| 1001 | 3300025941 | Ga0207711_10026536 | Ga0207711_100265363 | 78 |
| 1002 | 3300025942 | Ga0207689_10402148 | Ga0207689_104021481 | 78 |
| 1003 | 3300025942 | Ga0207689_10489040 | Ga0207689_104890402 | 78 |
| 1004 | 3300025945 | Ga0207679_10207590 | Ga0207679_102075902 | 78 |
| 1005 | 3300025945 | Ga0207679_11242434 | Ga0207679_112424342 | 78 |
| 1006 | 3300025945 | Ga0207679_11435495 | Ga0207679_114354951 | 78 |
| 1007 | 3300025949 | Ga0207667_10472108 | Ga0207667_104721082 | 78 |
| 1008 | 3300025960 | Ga0207651_10199829 | Ga0207651_101998292 | 78 |
| 1009 | 3300025961 | Ga0207712_10634916 | Ga0207712_106349161 | 78 |
| 1010 | 3300025972 | Ga0207668_10186843 | Ga0207668_101868433 | 78 |
| 1011 | 3300025986 | Ga0207658_10752002 | Ga0207658_107520022 | 78 |
| 1012 | 3300026023 | Ga0207677_10426608 | Ga0207677_104266082 | 78 |
| 1013 | 3300026035 | Ga0207703_10018417 | Ga0207703_100184172 | 78 |
| 1014 | 3300026041 | Ga0207639_10211836 | Ga0207639_102118362 | 78 |
| 1015 | 3300026067 | Ga0207678_10005293 | Ga0207678_1000529310 | 78 |
| 1016 | 3300026067 | Ga0207678_10020358 | Ga0207678_100203583 | 78 |
| 1017 | 3300026075 | Ga0207708_10820760 | Ga0207708_108207603 | 78 |
| 1018 | 3300026078 | Ga0207702_10082103 | Ga0207702_100821032 | 78 |
| 1019 | 3300026088 | Ga0207641_10560464 | Ga0207641_105604642 | 78 |
| 1020 | 3300026088 | Ga0207641_10787587 | Ga0207641_107875872 | 78 |
| 1021 | 3300026095 | Ga0207676_10080166 | Ga0207676_100801663 | 78 |
| 1022 | 3300026095 | Ga0207676_10462347 | Ga0207676_104623472 | 78 |
| 1023 | 3300026118 | Ga0207675_100156219 | Ga0207675_1001562192 | 78 |
| 1024 | 3300026118 | Ga0207675_100648730 | Ga0207675_1006487302 | 78 |
| 1025 | 3300026121 | Ga0207683_10010070 | Ga0207683_100100704 | 78 |
| 1026 | 3300026121 | Ga0207683_10236218 | Ga0207683_102362182 | 78 |
| 1027 | 3300027682 | Ga0209971_1032898 | Ga0209971_10328982 | 78 |
| 1028 | 3300027695 | Ga0209966_1009527 | Ga0209966_10095272 | 78 |
| 1029 | 3300027717 | Ga0209998_10002200 | Ga0209998_100022006 | 78 |
| 1030 | 3300027866 | Ga0209813_10377447 | Ga0209813_103774471 | 78 |
| 1031 | 3300028379 | Ga0268266_10001258 | Ga0268266_1000125826 | 78 |
| 1032 | 3300028379 | Ga0268266_10020213 | Ga0268266_100202132 | 78 |
| 1033 | 3300028379 | Ga0268266_10392288 | Ga0268266_103922882 | 78 |
| 1034 | 3300028379 | Ga0268266_10437610 | Ga0268266_104376102 | 78 |
| 1035 | 3300028380 | Ga0268265_10121807 | Ga0268265_101218071 | 78 |
| 1036 | 3300028381 | Ga0268264_10145554 | Ga0268264_101455542 | 78 |
| 1037 | 3300028381 | Ga0268264_10284493 | Ga0268264_102844932 | 78 |
| 1038 | 3300031238 | Ga0265332_10133785 | Ga0265332_101337852 | 78 |
| 1039 | 3300034816 | Ga0373930_0026702 | Ga0373930_0026702_565_804 | 78 |
| 1040 | 3300034816 | Ga0373930_0030034 | Ga0373930_0030034_460_702 | 78 |
| 1041 | 3300034818 | Ga0373950_0038362 | Ga0373950_0038362_188_427 | 78 |
| 1042 | 3300034820 | Ga0373959_0004905 | Ga0373959_0004905_625_864 | 78 |
| 1043 | 3300034820 | Ga0373959_0106147 | Ga0373959_0106147_78_320 | 78 |
| 1044 | 3300034957 | Ga0373938_0007189 | Ga0373938_0007189_1168_1407 | 78 |
| 1045 | 3300035084 | Ga0373928_0210574 | Ga0373928_0210574_133_369 | 78 |
| 1046 | 3300035085 | Ga0373929_0089955 | Ga0373929_0089955_183_422 | 78 |
| 1047 | 3300035088 | Ga0373940_0141332 | Ga0373940_0141332_243_479 | 78 |
| 1048 | 3300035088 | Ga0373940_0285668 | Ga0373940_0285668_258_497 | 78 |
| 1049 | 3300035090 | Ga0373949_0145944 | Ga0373949_0145944_191_433 | 78 |
| 1050 | 3300035091 | Ga0373951_0008447 | Ga0373951_0008447_254_490 | 78 |
| 1051 | 3300035091 | Ga0373951_0028742 | Ga0373951_0028742_498_740 | 78 |
| 1052 | 3300035091 | Ga0373951_0107841 | Ga0373951_0107841_27_266 | 78 |
| 1053 | 3300035092 | Ga0373952_0005797 | Ga0373952_0005797_227_463 | 78 |
| 1054 | 3300035092 | Ga0373952_0087476 | Ga0373952_0087476_43_282 | 78 |
| 1055 | 3300035111 | Ga0373923_0095710 | Ga0373923_0095710_287_526 | 78 |
| 1056 | 3300035112 | Ga0373932_0075461 | Ga0373932_0075461_275_514 | 78 |
| 1057 | 3300035113 | Ga0373936_0236583 | Ga0373936_0236583_240_479 | 78 |
| 1058 | 3300035114 | Ga0373939_0006287 | Ga0373939_0006287_121_357 | 78 |
| 1059 | 3300035114 | Ga0373939_0009037 | Ga0373939_0009037_1792_2031 | 78 |
| 1060 | 3300035114 | Ga0373939_0175645 | Ga0373939_0175645_258_500 | 78 |
| 1061 | 3300035115 | Ga0373941_0098228 | Ga0373941_0098228_275_514 | 78 |
| 1062 | 3300035207 | Ga0373942_0089317 | Ga0373942_0089317_393_632 | 78 |
| 1063 | 3300035241 | Ga0373961_0014684 | Ga0373961_0014684_869_1108 | 78 |
| 1064 | 3300035241 | Ga0373961_0408748 | Ga0373961_0408748_60_296 | 78 |
| 1065 | 3300035242 | Ga0373962_0070868 | Ga0373962_0070868_338_574 | 78 |
| 1066 | 3300035691 | Ga0373931_0148141 | Ga0373931_0148141_323_568 | 78 |
| 1067 | 3300035691 | Ga0373931_0340359 | Ga0373931_0340359_364_600 | 78 |
| 1068 | 3300035692 | Ga0373935_0036584 | Ga0373935_0036584_1983_2222 | 78 |
| 1069 | 3300035692 | Ga0373935_0846979 | Ga0373935_0846979_54_296 | 78 |
| 1070 | 3300035695 | Ga0373927_0085314 | Ga0373927_0085314_309_548 | 78 |
| 1071 | 3300037068 | Ga0373925_0024726 | Ga0373925_0024726_3640_3879 | 78 |
| 1072 | 3300046455 | Ga0495603_0039833 | Ga0495603_0039833_2236_2475 | 78 |
| 1073 | 3300046455 | Ga0495603_0102019 | Ga0495603_0102019_138_383 | 78 |
| 1074 | 3300046459 | Ga0495629_0000577 | Ga0495629_0000577_26681_26920 | 78 |
| 1075 | 3300046460 | Ga0495638_0182439 | Ga0495638_0182439_17_262 | 78 |
| 1076 | 3300046473 | Ga0495582_0009685 | Ga0495582_0009685_2913_3152 | 78 |
| 1077 | 3300046475 | Ga0495639_0594951 | Ga0495639_0594951_57_296 | 78 |
| 1078 | 3300046499 | Ga0495594_0563463 | Ga0495594_0563463_349_588 | 78 |
| 1079 | 3300046642 | Ga0495634_0578343 | Ga0495634_0578343_59_298 | 78 |
| 1080 | 3300046683 | Ga0495658_0000944 | Ga0495658_0000944_14411_14650 | 78 |
| 1081 | 3300046689 | Ga0495613_0152652 | Ga0495613_0152652_912_1151 | 78 |
| 1082 | 3300047315 | Ga0495581_0014473 | Ga0495581_0014473_967_1206 | 78 |
| 1083 | 3300047320 | Ga0495672_0019817 | Ga0495672_0019817_741_986 | 78 |
| 1084 | 3300047321 | Ga0495676_0443306 | Ga0495676_0443306_437_676 | 78 |
| 1085 | 3300047673 | Ga0495593_0049360 | Ga0495593_0049360_1507_1746 | 78 |
| 1086 | 3300048089 | Ga0495614_0188163 | Ga0495614_0188163_672_911 | 78 |
| 1087 | 3300048903 | Ga0496100_0112857 | Ga0496100_0112857_1398_1640 | 78 |
| 1088 | 3300048903 | Ga0496100_0177351 | Ga0496100_0177351_1164_1409 | 78 |
| 1089 | 3300048903 | Ga0496100_0215194 | Ga0496100_0215194_662_901 | 78 |
| 1090 | 3300048903 | Ga0496100_0402640 | Ga0496100_0402640_557_796 | 78 |
| 1091 | 3300048904 | Ga0496101_0072428 | Ga0496101_0072428_2099_2344 | 78 |
| 1092 | 3300048904 | Ga0496101_0177683 | Ga0496101_0177683_1168_1410 | 78 |
| 1093 | 3300048904 | Ga0496101_0238268 | Ga0496101_0238268_930_1169 | 78 |
| 1094 | 3300048904 | Ga0496101_0444724 | Ga0496101_0444724_247_486 | 78 |
| 1095 | 3300048905 | Ga0496102_0015547 | Ga0496102_0015547_1297_1539 | 78 |
| 1096 | 3300048905 | Ga0496102_0235439 | Ga0496102_0235439_523_762 | 78 |
| 1097 | 3300048905 | Ga0496102_0333102 | Ga0496102_0333102_226_465 | 78 |
| 1098 | 3300048906 | Ga0496103_0005261 | Ga0496103_0005261_6563_6802 | 78 |
| 1099 | 3300048906 | Ga0496103_0218289 | Ga0496103_0218289_965_1204 | 78 |
| 1100 | 3300048906 | Ga0496103_0677920 | Ga0496103_0677920_240_482 | 78 |
| 1101 | 3300048907 | Ga0496104_0004592 | Ga0496104_0004592_9460_9705 | 78 |
| 1102 | 3300048907 | Ga0496104_0176863 | Ga0496104_0176863_846_1088 | 78 |
| 1103 | 3300048907 | Ga0496104_0198630 | Ga0496104_0198630_1413_1652 | 78 |
| 1104 | 3300048907 | Ga0496104_0282867 | Ga0496104_0282867_963_1202 | 78 |
| 1105 | 3300048907 | Ga0496104_0814694 | Ga0496104_0814694_523_762 | 78 |
| 1106 | 3300048908 | Ga0496105_0004448 | Ga0496105_0004448_8192_8437 | 78 |
| 1107 | 3300048908 | Ga0496105_0140914 | Ga0496105_0140914_1668_1907 | 78 |
| 1108 | 3300048909 | Ga0496106_0016658 | Ga0496106_0016658_2043_2282 | 78 |
| 1109 | 3300048909 | Ga0496106_0343542 | Ga0496106_0343542_915_1154 | 78 |
| 1110 | 3300048909 | Ga0496106_1532342 | Ga0496106_1532342_160_405 | 78 |
| 1111 | 3300048910 | Ga0496107_0031966 | Ga0496107_0031966_1724_1963 | 78 |
| 1112 | 3300048910 | Ga0496107_0173666 | Ga0496107_0173666_1300_1539 | 78 |
| 1113 | 3300048910 | Ga0496107_0398134 | Ga0496107_0398134_626_862 | 78 |
| 1114 | 3300048910 | Ga0496107_0510522 | Ga0496107_0510522_210_452 | 78 |
| 1115 | 3300048911 | Ga0496108_0009122 | Ga0496108_0009122_6510_6755 | 78 |
| 1116 | 3300048911 | Ga0496108_0119119 | Ga0496108_0119119_1003_1242 | 78 |
| 1117 | 3300048911 | Ga0496108_1094298 | Ga0496108_1094298_219_458 | 78 |
| 1118 | 3300048912 | Ga0496109_0000835 | Ga0496109_0000835_24351_24611 | 78 |
| 1119 | 3300048912 | Ga0496109_0084243 | Ga0496109_0084243_1403_1642 | 78 |
| 1120 | 3300048912 | Ga0496109_0113033 | Ga0496109_0113033_987_1226 | 78 |
| 1121 | 3300048912 | Ga0496109_0349161 | Ga0496109_0349161_912_1151 | 78 |
| 1122 | 3300048912 | Ga0496109_1974384 | Ga0496109_1974384_120_365 | 78 |
| 1123 | 3300048913 | Ga0496110_0004806 | Ga0496110_0004806_7336_7581 | 78 |
| 1124 | 3300048913 | Ga0496110_0216053 | Ga0496110_0216053_247_486 | 78 |
| 1125 | 3300048913 | Ga0496110_0673905 | Ga0496110_0673905_389_634 | 78 |
| 1126 | 3300048913 | Ga0496110_1354619 | Ga0496110_1354619_97_333 | 78 |
| 1127 | 3300048914 | Ga0496111_0000843 | Ga0496111_0000843_8965_9210 | 78 |
| 1128 | 3300048914 | Ga0496111_0032370 | Ga0496111_0032370_1049_1288 | 78 |
| 1129 | 3300048914 | Ga0496111_0798677 | Ga0496111_0798677_389_625 | 78 |
| 1130 | 3300048915 | Ga0496112_0006451 | Ga0496112_0006451_5049_5294 | 78 |
| 1131 | 3300048915 | Ga0496112_0337525 | Ga0496112_0337525_247_486 | 78 |
| 1132 | 3300048915 | Ga0496112_0337528 | Ga0496112_0337528_965_1204 | 78 |
| 1133 | 3300048915 | Ga0496112_0572890 | Ga0496112_0572890_606_851 | 78 |
| 1134 | 3300048915 | Ga0496112_1693086 | Ga0496112_1693086_186_428 | 78 |
| 1135 | 3300048916 | Ga0496113_0001943 | Ga0496113_0001943_9070_9315 | 78 |
| 1136 | 3300048916 | Ga0496113_0309389 | Ga0496113_0309389_247_486 | 78 |
| 1137 | 3300048916 | Ga0496113_1308100 | Ga0496113_1308100_78_317 | 78 |
| 1138 | 3300048917 | Ga0496114_0062620 | Ga0496114_0062620_2515_2754 | 78 |
| 1139 | 3300048918 | Ga0496115_0004407 | Ga0496115_0004407_4541_4783 | 78 |
| 1140 | 3300048918 | Ga0496115_0164323 | Ga0496115_0164323_1561_1800 | 78 |
| 1141 | 3300048918 | Ga0496115_0190776 | Ga0496115_0190776_1088_1333 | 78 |
| 1142 | 3300048918 | Ga0496115_0252855 | Ga0496115_0252855_247_486 | 78 |
| 1143 | 3300048928 | Ga0496125_0298594 | Ga0496125_0298594_258_497 | 78 |
| 1144 | 3300048929 | Ga0496126_0583410 | Ga0496126_0583410_558_809 | 78 |
| 1145 | 3300049569 | Ga0501032_0050133 | Ga0501032_0050133_1555_1800 | 78 |
| 1146 | 3300049569 | Ga0501032_0138768 | Ga0501032_0138768_814_1059 | 78 |
| 1147 | 3300049569 | Ga0501032_0219880 | Ga0501032_0219880_694_939 | 78 |
| 1148 | 3300049570 | Ga0501033_0096488 | Ga0501033_0096488_883_1128 | 78 |
| 1149 | 3300049570 | Ga0501033_0236782 | Ga0501033_0236782_504_749 | 78 |
| 1150 | 3300049570 | Ga0501033_0901072 | Ga0501033_0901072_276_521 | 78 |
| 1151 | 3300049571 | Ga0501034_0031515 | Ga0501034_0031515_4590_4835 | 78 |
| 1152 | 3300049571 | Ga0501034_0100325 | Ga0501034_0100325_2095_2340 | 78 |
| 1153 | 3300049571 | Ga0501034_0149236 | Ga0501034_0149236_683_922 | 78 |
| 1154 | 3300049572 | Ga0501036_0032679 | Ga0501036_0032679_1043_1288 | 78 |
| 1155 | 3300049572 | Ga0501036_0061151 | Ga0501036_0061151_1726_1971 | 78 |
| 1156 | 3300049572 | Ga0501036_0296881 | Ga0501036_0296881_717_962 | 78 |
| 1157 | 3300049573 | Ga0501037_0009457 | Ga0501037_0009457_6361_6606 | 78 |
| 1158 | 3300049573 | Ga0501037_0257776 | Ga0501037_0257776_125_370 | 78 |
| 1159 | 3300049573 | Ga0501037_0262473 | Ga0501037_0262473_713_958 | 78 |
| 1160 | 3300049574 | Ga0501038_0025785 | Ga0501038_0025785_4443_4688 | 78 |
| 1161 | 3300049574 | Ga0501038_0089046 | Ga0501038_0089046_1901_2146 | 78 |
| 1162 | 3300049574 | Ga0501038_0178929 | Ga0501038_0178929_918_1163 | 78 |
| 1163 | 3300049575 | Ga0501039_0015343 | Ga0501039_0015343_500_745 | 78 |
| 1164 | 3300049575 | Ga0501039_0034558 | Ga0501039_0034558_1349_1594 | 78 |
| 1165 | 3300049576 | Ga0501040_0071467 | Ga0501040_0071467_1914_2159 | 78 |
| 1166 | 3300049576 | Ga0501040_0331478 | Ga0501040_0331478_574_819 | 78 |
| 1167 | 3300049578 | Ga0501042_0079676 | Ga0501042_0079676_2046_2291 | 78 |
| 1168 | 3300049578 | Ga0501042_1448505 | Ga0501042_1448505_242_487 | 78 |
| 1169 | 3300049579 | Ga0501043_0006016 | Ga0501043_0006016_7091_7336 | 78 |
| 1170 | 3300049579 | Ga0501043_0106369 | Ga0501043_0106369_1837_2082 | 78 |
| 1171 | 3300049579 | Ga0501043_0282920 | Ga0501043_0282920_959_1204 | 78 |
| 1172 | 3300049580 | Ga0501046_0025626 | Ga0501046_0025626_2094_2339 | 78 |
| 1173 | 3300049580 | Ga0501046_0103928 | Ga0501046_0103928_535_780 | 78 |
| 1174 | 3300049581 | Ga0501047_0012665 | Ga0501047_0012665_5304_5549 | 78 |
| 1175 | 3300049581 | Ga0501047_0142395 | Ga0501047_0142395_530_775 | 78 |
| 1176 | 3300049581 | Ga0501047_0530447 | Ga0501047_0530447_717_962 | 78 |
| 1177 | 3300049582 | Ga0501048_0175148 | Ga0501048_0175148_754_999 | 78 |
| 1178 | 3300049582 | Ga0501048_0374886 | Ga0501048_0374886_561_806 | 78 |
| 1179 | 3300049583 | Ga0501067_0113603 | Ga0501067_0113603_451_696 | 78 |
| 1180 | 3300049583 | Ga0501067_0255980 | Ga0501067_0255980_518_763 | 78 |
| 1181 | 3300049584 | Ga0501068_0022897 | Ga0501068_0022897_1035_1280 | 78 |
| 1182 | 3300049584 | Ga0501068_0090117 | Ga0501068_0090117_1111_1356 | 78 |
| 1183 | 3300049585 | Ga0501069_0009123 | Ga0501069_0009123_548_793 | 78 |
| 1184 | 3300049585 | Ga0501069_0143574 | Ga0501069_0143574_1073_1318 | 78 |
| 1185 | 3300049585 | Ga0501069_0159772 | Ga0501069_0159772_518_763 | 78 |
| 1186 | 3300049586 | Ga0501070_0013556 | Ga0501070_0013556_4366_4611 | 78 |
| 1187 | 3300049586 | Ga0501070_0128551 | Ga0501070_0128551_550_795 | 78 |
| 1188 | 3300049586 | Ga0501070_0288272 | Ga0501070_0288272_1029_1274 | 78 |
| 1189 | 3300049586 | Ga0501070_0289767 | Ga0501070_0289767_463_702 | 78 |
| 1190 | 3300049586 | Ga0501070_0359506 | Ga0501070_0359506_348_593 | 78 |
| 1191 | 3300049586 | Ga0501070_0414301 | Ga0501070_0414301_550_795 | 78 |
| 1192 | 3300049587 | Ga0501071_0025103 | Ga0501071_0025103_1794_2039 | 78 |
| 1193 | 3300049587 | Ga0501071_0071942 | Ga0501071_0071942_510_755 | 78 |
| 1194 | 3300049588 | Ga0501072_0019989 | Ga0501072_0019989_2010_2255 | 78 |
| 1195 | 3300049588 | Ga0501072_0677639 | Ga0501072_0677639_231_476 | 78 |
| 1196 | 3300049588 | Ga0501072_0739585 | Ga0501072_0739585_86_331 | 78 |
| 1197 | 3300049589 | Ga0501073_0067179 | Ga0501073_0067179_1519_1764 | 78 |
| 1198 | 3300049589 | Ga0501073_0279211 | Ga0501073_0279211_422_667 | 78 |
| 1199 | 3300049589 | Ga0501073_0557656 | Ga0501073_0557656_25_270 | 78 |
| 1200 | 3300049590 | Ga0501074_0010334 | Ga0501074_0010334_538_783 | 78 |
| 1201 | 3300049590 | Ga0501074_0033573 | Ga0501074_0033573_649_894 | 78 |
| 1202 | 3300049590 | Ga0501074_0119841 | Ga0501074_0119841_899_1144 | 78 |
| 1203 | 3300049590 | Ga0501074_0177885 | Ga0501074_0177885_174_419 | 78 |
| 1204 | 3300049592 | Ga0501076_0186970 | Ga0501076_0186970_286_531 | 78 |
| 1205 | 3300049593 | Ga0501077_0203227 | Ga0501077_0203227_16_261 | 78 |
| 1206 | 3300049741 | Ga0501079_0328381 | Ga0501079_0328381_443_688 | 78 |
| 1207 | 3300049742 | Ga0501080_0104956 | Ga0501080_0104956_59_304 | 78 |
| 1208 | 3300049742 | Ga0501080_0158095 | Ga0501080_0158095_550_795 | 78 |
| 1209 | 3300049742 | Ga0501080_0267476 | Ga0501080_0267476_550_795 | 78 |
| 1210 | 3300049742 | Ga0501080_0490721 | Ga0501080_0490721_434_673 | 78 |
| 1211 | 3300049742 | Ga0501080_0710516 | Ga0501080_0710516_235_480 | 78 |
| 1212 | 3300049743 | Ga0501081_0578919 | Ga0501081_0578919_400_645 | 78 |
| 1213 | 3300049744 | Ga0501083_0086936 | Ga0501083_0086936_606_851 | 78 |
| 1214 | 3300049744 | Ga0501083_0355793 | Ga0501083_0355793_453_698 | 78 |
| 1215 | 3300049822 | Ga0501035_0000418 | Ga0501035_0000418_41520_41765 | 78 |
| 1216 | 3300049822 | Ga0501035_0028100 | Ga0501035_0028100_3663_3908 | 78 |
| 1217 | 3300049822 | Ga0501035_0174749 | Ga0501035_0174749_1506_1751 | 78 |
| 1218 | 3300049823 | Ga0501044_0226132 | Ga0501044_0226132_1026_1271 | 78 |
| 1219 | 3300049823 | Ga0501044_0520939 | Ga0501044_0520939_294_539 | 78 |
| 1220 | 3300049824 | Ga0501045_0275429 | Ga0501045_0275429_916_1161 | 78 |
| 1221 | 3300049824 | Ga0501045_0343561 | Ga0501045_0343561_272_517 | 78 |
| 1222 | 3300049824 | Ga0501045_1421143 | Ga0501045_1421143_27_272 | 78 |
| 1223 | 3300050490 | nmdc:mga03n38_1371_c1 | nmdc:mga03n38_1371_c1_3935_4249 | 78 |
| 1224 | 3300050490 | nmdc:mga03n38_545_c1 | nmdc:mga03n38_545_c1_5164_5409 | 78 |
| 1225 | 3300050491 | nmdc:mga00v17_536794_c1 | nmdc:mga00v17_536794_c1_146_391 | 78 |
| 1226 | 3300050492 | nmdc:mga0yw44_15036_c1 | nmdc:mga0yw44_15036_c1_1763_2008 | 78 |
| 1227 | 3300050494 | nmdc:mga06z11_551_c1 | nmdc:mga06z11_551_c1_7160_7474 | 78 |
| 1228 | 3300050494 | nmdc:mga06z11_7326_c1 | nmdc:mga06z11_7326_c1_638_883 | 78 |
| 1229 | 3300050495 | nmdc:mga04h51_627_c1 | nmdc:mga04h51_627_c1_7170_7484 | 78 |
| 1230 | 3300050496 | nmdc:mga07m45_24365_c1 | nmdc:mga07m45_24365_c1_853_1098 | 78 |
| 1231 | 3300050507 | nmdc:mga05p37_5338_c1 | nmdc:mga05p37_5338_c1_1325_1612 | 78 |
| 1232 | 3300050511 | nmdc:mga08y16_516083_c1 | nmdc:mga08y16_516083_c1_314_553 | 78 |
| 1233 | 3300050512 | nmdc:mga0n895_10845_c1 | nmdc:mga0n895_10845_c1_6256_6543 | 78 |
| 1234 | 3300050512 | nmdc:mga0n895_210408_c1 | nmdc:mga0n895_210408_c1_804_1043 | 78 |
| 1235 | 3300050512 | nmdc:mga0n895_263341_c1 | nmdc:mga0n895_263341_c1_1160_1402 | 78 |
| 1236 | 3300050513 | nmdc:mga0rr50_228834_c1 | nmdc:mga0rr50_228834_c1_731_970 | 78 |
| 1237 | 3300050514 | nmdc:mga08x19_1145081_c1 | nmdc:mga08x19_1145081_c1_146_388 | 78 |
| 1238 | 3300050514 | nmdc:mga08x19_1265291_c1 | nmdc:mga08x19_1265291_c1_189_428 | 78 |
| 1239 | 3300050514 | nmdc:mga08x19_243156_c1 | nmdc:mga08x19_243156_c1_690_929 | 78 |
| 1240 | 3300050515 | nmdc:mga0a205_6087_c1 | nmdc:mga0a205_6087_c1_2433_2720 | 78 |
| 1241 | 3300050516 | nmdc:mga0sz30_152260_c1 | nmdc:mga0sz30_152260_c1_132_377 | 78 |
| 1242 | 3300053077 | Ga0495601_0307059 | Ga0495601_0307059_600_839 | 78 |
| 1243 | 3300053085 | Ga0495619_0000687 | Ga0495619_0000687_11275_11514 | 78 |
| 1244 | 3300053098 | Ga0500650_0419718 | Ga0500650_0419718_211_456 | 78 |
| 1245 | 3300053104 | Ga0500556_0125073 | Ga0500556_0125073_507_752 | 78 |
| 1246 | 3300053119 | Ga0500595_000662 | Ga0500595_000662_17901_18146 | 78 |
| 1247 | 3300053139 | Ga0500568_0062587 | Ga0500568_0062587_780_1025 | 78 |
| 1248 | 3300053153 | Ga0500616_0011874 | Ga0500616_0011874_3109_3357 | 78 |
| 1249 | 3300054114 | Ga0501084_0080061 | Ga0501084_0080061_1670_1915 | 78 |
| 1250 | 3300054114 | Ga0501084_0081953 | Ga0501084_0081953_221_466 | 78 |
| 1251 | 3300060353 | Ga0501082_0067703 | Ga0501082_0067703_2677_2922 | 78 |
| 1252 | 3300060353 | Ga0501082_0088742 | Ga0501082_0088742_2246_2491 | 78 |
| 1253 | 3300061734 | Ga0530510_0085419 | Ga0530510_0085419_1387_1632 | 78 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7agx-assembly1.cif.gz_1J | apo-state type 3 secretion system export apparatus complex from salmonella enterica typhimurium | 0.5693 | 4 | 67 |
| 6pep-assembly1.cif.gz_8 | focussed refinement of invgn0n1:spapqr:prgij from the salmonella spi-1 injectisome needle complex | 0.5485 | 1 | 67 |
| 6tzc-assembly1.cif.gz_B | crystal structure of african swine fever virus a179l with the autophagy regulator beclin | 0.5343 | 18 | 69 |
| 6rwy-assembly1.cif.gz_h | export apparatus core and inner rod of the shigella type 3 secretion system | 0.5116 | 1 | 67 |
| 7agx-assembly1.cif.gz_1J | apo-state type 3 secretion system export apparatus complex from salmonella enterica typhimurium | 0.491 | 4 | 67 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q0DQQ3_146_306_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5629 | 21 | 72 | 1.20.1250.20 |
| af_Q54M31_129_224_1.20.1280.290 | Mainly Alpha;Up-down Bundle;Monooxygenase; | 0.5432 | 15 | 75 | 1.20.1280.290 |
| af_A0A0R0I6A5_242_405_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.5208 | 14 | 69 | 1.20.1250.20 |
| af_O17165_1_236_3.80.10.10 | Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor | 0.5205 | 21 | 56 | 3.80.10.10 |
| 2qgsB01 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;HD-domain/PDEase-like | 0.4888 | 16 | 70 | 1.10.472.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A327JKU5-F1-model_v4 | DUF3302 domain-containing protein | 0.671 | 2 | 78 |
GO:0016020
|
| AF-A0A327JKU5-F1-model_v4 | DUF3302 domain-containing protein | 0.6547 | 2 | 78 |
GO:0016020
|
| AF-A0A0F9L3X8-F1-model_v4 | Uncharacterized protein | 0.5896 | 10 | 64 |
GO:0016020
|
| AF-A0A7Z7IB02-F1-model_v4 | Inner membrane protein YiaW | 0.5844 | 1 | 68 |
GO:0016020
|
| AF-A0A1H3MCF3-F1-model_v4 | Phospholipase_D-nuclease N-terminal | 0.5765 | 7 | 78 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar