F492194

General Info

Members Datasets Scaffolds Average Seq Length
1251 369 2502 98

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10127147|Ga0070658_101271472
Length 117
Sequence MGMDAHTIRVELPAHLRTLAGVSGHEVPVEVQGTPTVRSVLDALEAKFPMLCGTIRDHHTLERRAFLRFFACMQDISHDPTDAPLPEAVTAGREPLIVLGAVAGGSERRGSIELTEG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
82 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
83 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
201 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
212 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
213 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
216 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
231 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
237 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
238 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
239 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
240 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
241 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
242 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
243 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
244 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
245 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
248 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
251 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
252 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
253 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
254 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
271 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
292 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
293 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
294 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
295 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
296 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
297 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
298 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
299 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
312 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
318 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
319 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
320 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
321 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
322 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
323 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
324 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
325 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
326 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
327 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
328 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
329 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
330 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
331 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
332 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
333 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
334 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
335 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
336 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
337 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
338 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
339 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
340 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
341 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
342 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
343 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
344 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
345 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
346 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
347 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
351 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
352 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
353 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
354 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
355 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
356 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
357 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
358 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
359 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
360 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
361 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 2501939600 Micromonospora sp. L5 Isolate Unclassified
367 2855683550 Micromonospora sp. RP3T Isolate Unclassified
368 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
369 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.24
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.32
Nodule 0
Rhizoplane 2.32
Rhizosphere 96.56
Stem 0
Stem Tuber 0
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10127147 3300005327 Bacteria 2122
2 SwRhRL2b_contig_2050774 2162886007 Bacteria 1516
3 MBSR1b_contig_1387742 2162886012 Bacteria 4064
4 MBSR1b_contig_6355838 2162886012 Bacteria 4134
5 CNAas_1000357 3300000532 Bacteria 4386
6 JGI24737J22298_10018220 3300001990 Bacteria 2255
7 JGI24751J29686_10000120 3300002459 Bacteria 39900
8 JGI25406J46586_10007505 3300003203 Bacteria 4972
9 rootH1_10369606 3300003323 Bacteria 1579
10 Ga0058863_11944606 3300004799 Bacteria 1483
11 Ga0065714_10064428 3300005288 Bacteria 144890
12 Ga0065704_10001277 3300005289 Bacteria 9704
13 Ga0065704_10108277 3300005289 Bacteria 2033
14 Ga0065704_10161295 3300005289 Bacteria 1350
15 Ga0065704_10226908 3300005289 Bacteria 1055
16 Ga0065704_10282907 3300005289 Bacteria 919
17 Ga0065712_10000115 3300005290 Bacteria 144502
18 Ga0065712_10028699 3300005290 Bacteria 1129
19 Ga0065712_10070131 3300005290 Bacteria 6302
20 Ga0065712_10170636 3300005290 Bacteria 1246
21 Ga0065715_10004566 3300005293 Bacteria 5572
22 Ga0065715_10013167 3300005293 Bacteria 2063
23 Ga0065715_10089908 3300005293 Bacteria 8159
24 Ga0065715_10107769 3300005293 Bacteria 2754
25 Ga0065715_10128590 3300005293 Bacteria 2063
26 Ga0065715_10180787 3300005293 Bacteria 1478
27 Ga0065715_10194902 3300005293 Bacteria 1393
28 Ga0065715_10233674 3300005293 Bacteria 1224
29 Ga0065715_10252767 3300005293 Bacteria 1162
30 Ga0065715_10542671 3300005293 Bacteria 747
31 Ga0065707_10001190 3300005295 Bacteria 10559
32 Ga0065707_10002996 3300005295 Bacteria 12944
33 Ga0065707_10008524 3300005295 Bacteria 2161
34 Ga0065707_10048628 3300005295 Bacteria 796
35 Ga0065707_10064844 3300005295 Unclassified 507
36 Ga0065707_10103437 3300005295 Bacteria 2748
37 Ga0065707_10344888 3300005295 Bacteria 927
38 Ga0065707_10942951 3300005295 Bacteria 554
39 Ga0070676_10029180 3300005328 Bacteria 3137
40 Ga0070676_10706662 3300005328 Bacteria 737
41 Ga0070676_10867720 3300005328 Bacteria 670
42 Ga0070676_11261997 3300005328 Bacteria 563
43 Ga0070683_100844715 3300005329 Bacteria 878
44 Ga0070690_100007430 3300005330 Bacteria 6279
45 Ga0070690_100321417 3300005330 Bacteria 1115
46 Ga0070690_100581294 3300005330 Bacteria 848
47 Ga0070670_100000043 3300005331 Bacteria 141622
48 Ga0070670_100049421 3300005331 Bacteria 3616
49 Ga0070670_100192525 3300005331 Bacteria 1772
50 Ga0070670_100716643 3300005331 Bacteria 900
51 Ga0070670_100763025 3300005331 Bacteria 872
52 Ga0070670_101008832 3300005331 Bacteria 757
53 Ga0070670_102138023 3300005331 Unclassified 516
54 Ga0070677_10076058 3300005333 Bacteria 1425
55 Ga0068869_100007983 3300005334 Bacteria 6801
56 Ga0068869_100036220 3300005334 Bacteria 3502
57 Ga0068869_100171168 3300005334 Bacteria 1697
58 Ga0068869_100524149 3300005334 Bacteria 992
59 Ga0068869_101597753 3300005334 Unclassified 581
60 Ga0068869_101675972 3300005334 Unclassified 567
61 Ga0070666_10011769 3300005335 Bacteria 5501
62 Ga0070666_10050059 3300005335 Bacteria 2810
63 Ga0070666_10732442 3300005335 Bacteria 726
64 Ga0070680_100000115 3300005336 Bacteria 46887
65 Ga0070680_100113510 3300005336 Bacteria 2257
66 Ga0070680_100467895 3300005336 Unclassified 1077
67 Ga0070682_100037579 3300005337 Bacteria 2965
68 Ga0068868_100074350 3300005338 Bacteria 2714
69 Ga0068868_100576798 3300005338 Bacteria 994
70 Ga0068868_101297978 3300005338 Bacteria 676
71 Ga0068868_101804022 3300005338 Bacteria 578
72 Ga0068868_102154525 3300005338 Bacteria 531
73 Ga0070660_101005916 3300005339 Bacteria 704
74 Ga0070660_101468295 3300005339 Bacteria 580
75 Ga0070689_100009107 3300005340 Bacteria 7029
76 Ga0070689_100082889 3300005340 Bacteria 2520
77 Ga0070689_100162053 3300005340 Bacteria 1808
78 Ga0070687_100046395 3300005343 Bacteria 2224
79 Ga0070687_100145273 3300005343 Bacteria 1386
80 Ga0070687_100218843 3300005343 Bacteria 1165
81 Ga0070687_101073213 3300005343 Unclassified 587
82 Ga0070661_101098303 3300005344 Unclassified 663
83 Ga0070661_101127485 3300005344 Unclassified 654
84 Ga0070661_101178359 3300005344 Bacteria 640
85 Ga0070692_10003160 3300005345 Bacteria 6614
86 Ga0070692_10016597 3300005345 Bacteria 3503
87 Ga0070692_10096097 3300005345 Bacteria 1618
88 Ga0070692_10240469 3300005345 Bacteria 1079
89 Ga0070692_10521428 3300005345 Bacteria 774
90 Ga0070668_100529882 3300005347 Bacteria 1023
91 Ga0070668_100581177 3300005347 Bacteria 978
92 Ga0070669_100015211 3300005353 Bacteria 5480
93 Ga0070669_100107014 3300005353 Bacteria 2118
94 Ga0070669_100218924 3300005353 Unclassified 1505
95 Ga0070669_100451480 3300005353 Bacteria 1060
96 Ga0070669_100648580 3300005353 Bacteria 888
97 Ga0070669_100860414 3300005353 Bacteria 773
98 Ga0070675_100409659 3300005354 Bacteria 1211
99 Ga0070675_100429211 3300005354 Bacteria 1183
100 Ga0070675_100537850 3300005354 Bacteria 1055
101 Ga0070675_100667070 3300005354 Bacteria 946
102 Ga0070675_100796529 3300005354 Bacteria 864
103 Ga0070675_101408305 3300005354 Unclassified 643
104 Ga0070675_102207653 3300005354 Bacteria 507
105 Ga0070671_100009235 3300005355 Bacteria 7920
106 Ga0070671_100315513 3300005355 Bacteria 1332
107 Ga0070674_100136766 3300005356 Bacteria 1834
108 Ga0070674_100292903 3300005356 Bacteria 1294
109 Ga0070674_100495988 3300005356 Bacteria 1016
110 Ga0070674_102078299 3300005356 Bacteria 518
111 Ga0070673_100043035 3300005364 Bacteria 3486
112 Ga0070673_100189022 3300005364 Bacteria 1768
113 Ga0070673_100283945 3300005364 Bacteria 1453
114 Ga0070673_100691450 3300005364 Bacteria 936
115 Ga0070688_100687876 3300005365 Bacteria 791
116 Ga0070688_101007897 3300005365 Bacteria 662
117 Ga0070659_100076626 3300005366 Bacteria 2666
118 Ga0070659_100162473 3300005366 Bacteria 1827
119 Ga0070659_100394025 3300005366 Bacteria 1168
120 Ga0070667_100109883 3300005367 Bacteria 2390
121 Ga0070667_100183531 3300005367 Bacteria 1851
122 Ga0070667_102195833 3300005367 Unclassified 520
123 Ga0070703_10010129 3300005406 Bacteria 2659
124 Ga0070709_10013266 3300005434 Bacteria 4626
125 Ga0070709_11159364 3300005434 Unclassified 620
126 Ga0070714_100057881 3300005435 Bacteria 3318
127 Ga0070713_100943326 3300005436 Bacteria 831
128 Ga0070713_102390349 3300005436 Unclassified 511
129 Ga0070701_10190435 3300005438 Bacteria 1206
130 Ga0070701_10508549 3300005438 Bacteria 783
131 Ga0070701_10700815 3300005438 Bacteria 681
132 Ga0070701_11079321 3300005438 Bacteria 564
133 Ga0070711_100000098 3300005439 Bacteria 46357
134 Ga0070705_100002460 3300005440 Bacteria 9316
135 Ga0070705_100021022 3300005440 Bacteria 3465
136 Ga0070705_100225746 3300005440 Bacteria 1300
137 Ga0070705_100325079 3300005440 Bacteria 1112
138 Ga0070705_100341312 3300005440 Bacteria 1089
139 Ga0070705_100391468 3300005440 Bacteria 1026
140 Ga0070700_100013133 3300005441 Bacteria 4646
141 Ga0070700_100149362 3300005441 Bacteria 1596
142 Ga0070700_100151131 3300005441 Bacteria 1588
143 Ga0070700_100222914 3300005441 Bacteria 1337
144 Ga0070700_100300759 3300005441 Bacteria 1171
145 Ga0070700_100380766 3300005441 Bacteria 1055
146 Ga0070700_100565444 3300005441 Bacteria 886
147 Ga0070700_100628890 3300005441 Bacteria 845
148 Ga0070700_100630485 3300005441 Bacteria 844
149 Ga0070694_100004994 3300005444 Bacteria 7999
150 Ga0070694_100020047 3300005444 Bacteria 4258
151 Ga0070694_100026086 3300005444 Bacteria 3785
152 Ga0070694_100028424 3300005444 Bacteria 3639
153 Ga0070694_100053574 3300005444 Bacteria 2731
154 Ga0070694_100122831 3300005444 Bacteria 1865
155 Ga0070694_100132840 3300005444 Bacteria 1800
156 Ga0070694_100135494 3300005444 Bacteria 1784
157 Ga0070694_100178147 3300005444 Bacteria 1571
158 Ga0070694_100204049 3300005444 Bacteria 1475
159 Ga0070694_100215203 3300005444 Bacteria 1439
160 Ga0070694_100221920 3300005444 Bacteria 1418
161 Ga0070694_100224987 3300005444 Bacteria 1409
162 Ga0070694_100793980 3300005444 Bacteria 776
163 Ga0070694_100954262 3300005444 Bacteria 710
164 Ga0070708_100001033 3300005445 Bacteria 21195
165 Ga0070708_100037466 3300005445 Bacteria 4231
166 Ga0070708_100093744 3300005445 Bacteria 2738
167 Ga0070708_100274820 3300005445 Bacteria 1585
168 Ga0070708_100478794 3300005445 Bacteria 1174
169 Ga0070708_100581514 3300005445 Bacteria 1056
170 Ga0070708_101075120 3300005445 Bacteria 754
171 Ga0070708_101142174 3300005445 Unclassified 729
172 Ga0070708_101596627 3300005445 Bacteria 607
173 Ga0070708_102012352 3300005445 Unclassified 535
174 Ga0070678_100183234 3300005456 Bacteria 1716
175 Ga0070678_100612483 3300005456 Bacteria 973
176 Ga0070662_100245250 3300005457 Bacteria 1438
177 Ga0070662_100298900 3300005457 Bacteria 1307
178 Ga0070662_100692501 3300005457 Bacteria 862
179 Ga0070662_100900075 3300005457 Bacteria 755
180 Ga0070681_10000336 3300005458 Bacteria 38138
181 Ga0070681_10008460 3300005458 Bacteria 10070
182 Ga0070681_10046107 3300005458 Bacteria 4358
183 Ga0070681_10101418 3300005458 Bacteria 2824
184 Ga0070681_10102309 3300005458 Bacteria 2810
185 Ga0070681_10108052 3300005458 Bacteria 2722
186 Ga0070681_11541689 3300005458 Unclassified 589
187 Ga0070681_12045686 3300005458 Bacteria 501
188 Ga0068867_100009686 3300005459 Bacteria 6792
189 Ga0068867_100019586 3300005459 Bacteria 4821
190 Ga0068867_100171388 3300005459 Bacteria 1719
191 Ga0068867_100436077 3300005459 Unclassified 1113
192 Ga0068867_100546968 3300005459 Bacteria 1002
193 Ga0068867_100789295 3300005459 Bacteria 846
194 Ga0068867_101105103 3300005459 Unclassified 724
195 Ga0068867_101610990 3300005459 Bacteria 607
196 Ga0068867_101717120 3300005459 Bacteria 589
197 Ga0068867_101964273 3300005459 Bacteria 552
198 Ga0070685_10002868 3300005466 Bacteria 8816
199 Ga0070685_10467130 3300005466 Bacteria 887
200 Ga0070706_100020581 3300005467 Bacteria 6079
201 Ga0070706_100055938 3300005467 Bacteria 3641
202 Ga0070706_100074951 3300005467 Bacteria 3131
203 Ga0070706_100160090 3300005467 Bacteria 2102
204 Ga0070706_100180855 3300005467 Bacteria 1969
205 Ga0070706_100334262 3300005467 Bacteria 1413
206 Ga0070706_100790287 3300005467 Unclassified 879
207 Ga0070706_100803445 3300005467 Bacteria 871
208 Ga0070706_101213318 3300005467 Bacteria 693
209 Ga0070707_100008243 3300005468 Bacteria 9669
210 Ga0070707_100027250 3300005468 Bacteria 5435
211 Ga0070707_100191005 3300005468 Bacteria 1997
212 Ga0070707_100236793 3300005468 Bacteria 1777
213 Ga0070707_100691753 3300005468 Bacteria 982
214 Ga0070707_100843993 3300005468 Bacteria 880
215 Ga0070707_101151774 3300005468 Bacteria 741
216 Ga0070698_100013422 3300005471 Bacteria 8672
217 Ga0070698_100025018 3300005471 Bacteria 6223
218 Ga0070698_100068642 3300005471 Bacteria 3561
219 Ga0070698_100599743 3300005471 Bacteria 1042
220 Ga0070698_100850959 3300005471 Bacteria 857
221 Ga0070699_100003267 3300005518 Bacteria 14346
222 Ga0070699_100009322 3300005518 Bacteria 8501
223 Ga0070699_100023706 3300005518 Bacteria 5287
224 Ga0070699_100049756 3300005518 Bacteria 3627
225 Ga0070699_100054525 3300005518 Bacteria 3460
226 Ga0070699_100282035 3300005518 Bacteria 1488
227 Ga0070699_100636989 3300005518 Bacteria 973
228 Ga0070699_100688051 3300005518 Unclassified 934
229 Ga0070699_100944807 3300005518 Bacteria 790
230 Ga0070699_101183789 3300005518 Bacteria 701
231 Ga0070699_101260008 3300005518 Unclassified 678
232 Ga0070679_100000256 3300005530 Bacteria 44524
233 Ga0070679_100437561 3300005530 Bacteria 1253
234 Ga0070684_100535491 3300005535 Bacteria 1086
235 Ga0070697_100000334 3300005536 Bacteria 37096
236 Ga0070697_100000654 3300005536 Bacteria 26101
237 Ga0070697_100011415 3300005536 Bacteria 6944
238 Ga0070697_100048201 3300005536 Bacteria 3454
239 Ga0070697_100089940 3300005536 Bacteria 2537
240 Ga0070697_101371142 3300005536 Bacteria 631
241 Ga0070697_101618039 3300005536 Bacteria 579
242 Ga0070697_101641503 3300005536 Unclassified 575
243 Ga0070697_102146121 3300005536 Bacteria 500
244 Ga0068853_100015390 3300005539 Bacteria 6283
245 Ga0068853_100181514 3300005539 Bacteria 1909
246 Ga0068853_100414911 3300005539 Bacteria 1262
247 Ga0068853_100435256 3300005539 Bacteria 1232
248 Ga0068853_100471597 3300005539 Unclassified 1182
249 Ga0068853_100621752 3300005539 Bacteria 1027
250 Ga0068853_101303566 3300005539 Bacteria 702
251 Ga0070672_100031427 3300005543 Bacteria 3996
252 Ga0070672_100896587 3300005543 Unclassified 783
253 Ga0070686_100003256 3300005544 Bacteria 8885
254 Ga0070686_100285082 3300005544 Bacteria 1220
255 Ga0070686_101068975 3300005544 Unclassified 665
256 Ga0070686_101644016 3300005544 Bacteria 544
257 Ga0070695_100033029 3300005545 Bacteria 3237
258 Ga0070695_100053047 3300005545 Bacteria 2607
259 Ga0070695_100083952 3300005545 Bacteria 2112
260 Ga0070695_100237074 3300005545 Bacteria 1322
261 Ga0070695_100395788 3300005545 Bacteria 1046
262 Ga0070695_100450834 3300005545 Bacteria 986
263 Ga0070695_100753906 3300005545 Bacteria 777
264 Ga0070695_101304526 3300005545 Bacteria 600
265 Ga0070695_101792520 3300005545 Unclassified 515
266 Ga0070696_100040118 3300005546 Bacteria 3232
267 Ga0070696_100104869 3300005546 Bacteria 2030
268 Ga0070696_100251285 3300005546 Bacteria 1337
269 Ga0070696_100503672 3300005546 Bacteria 964
270 Ga0070696_101094581 3300005546 Bacteria 669
271 Ga0070696_101139996 3300005546 Unclassified 657
272 Ga0070696_101673819 3300005546 Unclassified 548
273 Ga0070696_102025993 3300005546 Unclassified 500
274 Ga0070693_100010226 3300005547 Bacteria 4693
275 Ga0070693_100022088 3300005547 Bacteria 3378
276 Ga0070693_100025235 3300005547 Bacteria 3197
277 Ga0070693_100161404 3300005547 Bacteria 1428
278 Ga0070693_100266965 3300005547 Bacteria 1141
279 Ga0070693_100317932 3300005547 Bacteria 1055
280 Ga0070693_100412858 3300005547 Unclassified 939
281 Ga0070693_100464779 3300005547 Bacteria 891
282 Ga0070693_101481376 3300005547 Bacteria 530
283 Ga0070665_100023642 3300005548 Bacteria 6187
284 Ga0070665_100118976 3300005548 Bacteria 2644
285 Ga0070704_100014009 3300005549 Bacteria 4997
286 Ga0070704_100030966 3300005549 Unclassified 3592
287 Ga0070704_100045581 3300005549 Bacteria 3052
288 Ga0070704_100111775 3300005549 Unclassified 2080
289 Ga0070704_100252392 3300005549 Bacteria 1449
290 Ga0070704_100256036 3300005549 Bacteria 1440
291 Ga0070704_100431538 3300005549 Bacteria 1130
292 Ga0070704_100453195 3300005549 Bacteria 1105
293 Ga0070704_101773243 3300005549 Bacteria 571
294 Ga0068855_100409893 3300005563 Bacteria 1484
295 Ga0068855_100468347 3300005563 Bacteria 1373
296 Ga0068855_100647845 3300005563 Bacteria 1135
297 Ga0068855_101118175 3300005563 Bacteria 823
298 Ga0068855_101428993 3300005563 Unclassified 712
299 Ga0068855_101623788 3300005563 Unclassified 661
300 Ga0068855_102551209 3300005563 Bacteria 508
301 Ga0070664_100063126 3300005564 Bacteria 3158
302 Ga0070664_100098729 3300005564 Bacteria 2537
303 Ga0070664_100424989 3300005564 Bacteria 1217
304 Ga0070664_100618645 3300005564 Bacteria 1005
305 Ga0068857_100065063 3300005577 Bacteria 3241
306 Ga0068857_100161268 3300005577 Bacteria 2035
307 Ga0068857_100170834 3300005577 Bacteria 1976
308 Ga0068857_100204668 3300005577 Bacteria 1800
309 Ga0068857_100391121 3300005577 Bacteria 1293
310 Ga0068857_100609933 3300005577 Bacteria 1032
311 Ga0068857_100802434 3300005577 Bacteria 899
312 Ga0068857_100995859 3300005577 Unclassified 807
313 Ga0068854_100070662 3300005578 Bacteria 2552
314 Ga0068854_100091363 3300005578 Bacteria 2265
315 Ga0068854_100108794 3300005578 Bacteria 2088
316 Ga0068854_100226741 3300005578 Bacteria 1481
317 Ga0068854_100267629 3300005578 Bacteria 1371
318 Ga0068854_100309528 3300005578 Bacteria 1281
319 Ga0068854_100429312 3300005578 Bacteria 1099
320 Ga0068854_100535567 3300005578 Bacteria 991
321 Ga0068854_100786849 3300005578 Bacteria 828
322 Ga0068854_101397484 3300005578 Bacteria 633
323 Ga0068854_101975584 3300005578 Bacteria 537
324 Ga0068856_100010370 3300005614 Bacteria 9050
325 Ga0068856_101434294 3300005614 Unclassified 705
326 Ga0070702_100008658 3300005615 Bacteria 4940
327 Ga0070702_100012549 3300005615 Bacteria 4250
328 Ga0070702_100020512 3300005615 Bacteria 3464
329 Ga0070702_100193382 3300005615 Bacteria 1340
330 Ga0070702_100274927 3300005615 Bacteria 1154
331 Ga0070702_100307843 3300005615 Bacteria 1099
332 Ga0070702_100682317 3300005615 Bacteria 781
333 Ga0070702_101491887 3300005615 Bacteria 556
334 Ga0068852_100032769 3300005616 Bacteria 4305
335 Ga0068852_100051861 3300005616 Bacteria 3524
336 Ga0068852_100328987 3300005616 Bacteria 1486
337 Ga0068852_100381423 3300005616 Bacteria 1383
338 Ga0068852_100585385 3300005616 Bacteria 1119
339 Ga0068852_100646344 3300005616 Bacteria 1065
340 Ga0068852_101020956 3300005616 Bacteria 846
341 Ga0068852_101382535 3300005616 Bacteria 726
342 Ga0068859_100022464 3300005617 Bacteria 6325
343 Ga0068859_100032177 3300005617 Bacteria 5268
344 Ga0068859_100034121 3300005617 Bacteria 5108
345 Ga0068859_100040493 3300005617 Bacteria 4677
346 Ga0068859_100073611 3300005617 Bacteria 3455
347 Ga0068859_100074038 3300005617 Bacteria 3444
348 Ga0068859_100122618 3300005617 Bacteria 2666
349 Ga0068859_100128127 3300005617 Bacteria 2609
350 Ga0068859_100138393 3300005617 Bacteria 2508
351 Ga0068859_100256725 3300005617 Bacteria 1838
352 Ga0068859_100384775 3300005617 Bacteria 1498
353 Ga0068859_100457211 3300005617 Bacteria 1373
354 Ga0068859_100571387 3300005617 Bacteria 1224
355 Ga0068859_100630180 3300005617 Unclassified 1165
356 Ga0068859_101031649 3300005617 Bacteria 904
357 Ga0068859_101355453 3300005617 Unclassified 784
358 Ga0068859_101952124 3300005617 Bacteria 648
359 Ga0068859_102779375 3300005617 Unclassified 537
360 Ga0068864_100038939 3300005618 Unclassified 4062
361 Ga0068864_100045449 3300005618 Bacteria 3767
362 Ga0068864_100147610 3300005618 Bacteria 2127
363 Ga0068864_100626472 3300005618 Bacteria 1046
364 Ga0068864_100796499 3300005618 Bacteria 928
365 Ga0068864_101915930 3300005618 Unclassified 598
366 Ga0068864_102041413 3300005618 Unclassified 580
367 Ga0068864_102220189 3300005618 Bacteria 555
368 Ga0068866_10085236 3300005718 Bacteria 1707
369 Ga0068861_100004428 3300005719 Bacteria 9421
370 Ga0068861_100024430 3300005719 Bacteria 4370
371 Ga0068861_100045601 3300005719 Bacteria 3302
372 Ga0068861_100063185 3300005719 Bacteria 2846
373 Ga0068861_100207349 3300005719 Bacteria 1649
374 Ga0068861_100244988 3300005719 Bacteria 1526
375 Ga0068861_101713753 3300005719 Unclassified 622
376 Ga0068851_10003914 3300005834 Bacteria 6667
377 Ga0068851_10318516 3300005834 Bacteria 898
378 Ga0068870_10066331 3300005840 Bacteria 1955
379 Ga0068870_10095548 3300005840 Bacteria 1670
380 Ga0068870_10231858 3300005840 Bacteria 1135
381 Ga0068870_10414312 3300005840 Bacteria 880
382 Ga0068870_10449849 3300005840 Bacteria 849
383 Ga0068870_10467403 3300005840 Bacteria 834
384 Ga0068870_11133277 3300005840 Bacteria 564
385 Ga0068870_11195274 3300005840 Unclassified 550
386 Ga0068863_100010788 3300005841 Bacteria 8864
387 Ga0068863_100147216 3300005841 Bacteria 2253
388 Ga0068863_100349517 3300005841 Bacteria 1439
389 Ga0068863_100390418 3300005841 Bacteria 1360
390 Ga0068863_101503478 3300005841 Unclassified 682
391 Ga0068863_101710990 3300005841 Bacteria 638
392 Ga0068863_102074425 3300005841 Bacteria 579
393 Ga0068863_102220985 3300005841 Unclassified 559
394 Ga0068858_100023110 3300005842 Bacteria 5798
395 Ga0068858_100038381 3300005842 Bacteria 4442
396 Ga0068858_100082917 3300005842 Bacteria 2981
397 Ga0068858_100119168 3300005842 Bacteria 2467
398 Ga0068858_100187743 3300005842 Bacteria 1952
399 Ga0068858_100190029 3300005842 Bacteria 1940
400 Ga0068858_100561418 3300005842 Bacteria 1105
401 Ga0068858_100586100 3300005842 Bacteria 1081
402 Ga0068858_100615268 3300005842 Unclassified 1054
403 Ga0068858_100685702 3300005842 Bacteria 996
404 Ga0068858_100808592 3300005842 Bacteria 915
405 Ga0068858_101974565 3300005842 Bacteria 577
406 Ga0068860_100016293 3300005843 Bacteria 7248
407 Ga0068860_100073846 3300005843 Bacteria 3242
408 Ga0068860_100075090 3300005843 Bacteria 3215
409 Ga0068860_100079452 3300005843 Bacteria 3119
410 Ga0068860_100081617 3300005843 Bacteria 3075
411 Ga0068860_100142023 3300005843 Bacteria 2308
412 Ga0068860_100285691 3300005843 Bacteria 1613
413 Ga0068860_100460095 3300005843 Bacteria 1266
414 Ga0068860_100520897 3300005843 Bacteria 1189
415 Ga0068860_100817648 3300005843 Bacteria 946
416 Ga0068860_100973613 3300005843 Bacteria 866
417 Ga0068860_101020263 3300005843 Bacteria 846
418 Ga0068860_102243629 3300005843 Bacteria 567
419 Ga0068862_100013791 3300005844 Bacteria 6698
420 Ga0068862_100072625 3300005844 Bacteria 2973
421 Ga0068862_100173643 3300005844 Bacteria 1930
422 Ga0068862_100290720 3300005844 Bacteria 1501
423 Ga0068862_100389504 3300005844 Bacteria 1301
424 Ga0068862_100640898 3300005844 Bacteria 1024
425 Ga0068862_101254713 3300005844 Bacteria 741
426 Ga0068862_102600573 3300005844 Unclassified 518
427 Ga0081455_10870032 3300005937 Bacteria 562
428 Ga0081539_10000605 3300005985 Bacteria 72953
429 Ga0081539_10005677 3300005985 Bacteria 12520
430 Ga0070717_10390453 3300006028 Bacteria 1249
431 Ga0075432_10288781 3300006058 Unclassified 677
432 Ga0070715_10032814 3300006163 Bacteria 2118
433 Ga0070716_100205845 3300006173 Bacteria 1311
434 Ga0070712_100580350 3300006175 Bacteria 947
435 Ga0097621_100005847 3300006237 Bacteria 8689
436 Ga0097621_100010558 3300006237 Bacteria 6765
437 Ga0097621_100011269 3300006237 Bacteria 6582
438 Ga0097621_100030890 3300006237 Bacteria 4244
439 Ga0068871_100008533 3300006358 Bacteria 7365
440 Ga0068871_100020248 3300006358 Bacteria 5094
441 Ga0068871_100146665 3300006358 Bacteria 2010
442 Ga0068871_100335291 3300006358 Bacteria 1335
443 Ga0068871_100462543 3300006358 Bacteria 1139
444 Ga0075428_100642820 3300006844 Bacteria 1132
445 Ga0075428_100743000 3300006844 Bacteria 1044
446 Ga0075428_100768592 3300006844 Bacteria 1025
447 Ga0075430_100185577 3300006846 Bacteria 1729
448 Ga0075430_100586075 3300006846 Bacteria 920
449 Ga0075430_101238248 3300006846 Bacteria 614
450 Ga0075431_100360839 3300006847 Bacteria 1459
451 Ga0075431_101349880 3300006847 Unclassified 673
452 Ga0075433_10027116 3300006852 Bacteria 4857
453 Ga0075433_10041458 3300006852 Bacteria 3989
454 Ga0075433_10067016 3300006852 Bacteria 3150
455 Ga0075433_10068409 3300006852 Bacteria 3118
456 Ga0075433_10081503 3300006852 Bacteria 2853
457 Ga0075433_10088901 3300006852 Bacteria 2730
458 Ga0075433_10093016 3300006852 Bacteria 2667
459 Ga0075433_10104311 3300006852 Bacteria 2512
460 Ga0075433_10251040 3300006852 Bacteria 1570
461 Ga0075433_11293989 3300006852 Bacteria 632
462 Ga0075434_100105959 3300006871 Bacteria 2821
463 Ga0075434_100202037 3300006871 Bacteria 2007
464 Ga0075434_100269289 3300006871 Bacteria 1723
465 Ga0075434_100293988 3300006871 Bacteria 1644
466 Ga0075434_100328990 3300006871 Bacteria 1549
467 Ga0075434_100424393 3300006871 Bacteria 1351
468 Ga0075434_100720469 3300006871 Bacteria 1015
469 Ga0075434_101085448 3300006871 Bacteria 814
470 Ga0075434_101574281 3300006871 Bacteria 666
471 Ga0075429_100041045 3300006880 Bacteria 4029
472 Ga0075429_100048835 3300006880 Bacteria 3680
473 Ga0075429_100693449 3300006880 Bacteria 892
474 Ga0075429_101104447 3300006880 Bacteria 693
475 Ga0068865_100019124 3300006881 Bacteria 4430
476 Ga0068865_100046238 3300006881 Bacteria 2986
477 Ga0068865_101148184 3300006881 Bacteria 686
478 Ga0068865_101773829 3300006881 Bacteria 557
479 Ga0075436_100052968 3300006914 Bacteria 2801
480 Ga0075436_100064812 3300006914 Bacteria 2526
481 Ga0075436_100073539 3300006914 Bacteria 2366
482 Ga0075436_100441362 3300006914 Bacteria 947
483 Ga0075436_100976926 3300006914 Bacteria 635
484 Ga0097620_100022465 3300006931 Bacteria 6325
485 Ga0097620_100032177 3300006931 Bacteria 5268
486 Ga0097620_100034123 3300006931 Bacteria 5108
487 Ga0097620_100040493 3300006931 Bacteria 4677
488 Ga0097620_100073606 3300006931 Bacteria 3455
489 Ga0097620_100074035 3300006931 Bacteria 3444
490 Ga0097620_100122624 3300006931 Bacteria 2666
491 Ga0097620_100128129 3300006931 Bacteria 2609
492 Ga0097620_100138389 3300006931 Bacteria 2508
493 Ga0097620_100256716 3300006931 Bacteria 1838
494 Ga0097620_100384786 3300006931 Bacteria 1498
495 Ga0097620_100457198 3300006931 Bacteria 1373
496 Ga0097620_100571387 3300006931 Bacteria 1224
497 Ga0097620_100630181 3300006931 Unclassified 1165
498 Ga0097620_101031507 3300006931 Bacteria 904
499 Ga0097620_101355698 3300006931 Unclassified 784
500 Ga0097620_101952044 3300006931 Bacteria 648
501 Ga0097620_102779302 3300006931 Unclassified 537
502 Ga0075435_100195399 3300007076 Bacteria 1713
503 Ga0075435_100583918 3300007076 Bacteria 968
504 Ga0075435_100687028 3300007076 Bacteria 889
505 Ga0105251_10102350 3300009011 Bacteria 1308
506 Ga0105240_10186452 3300009093 Bacteria 2443
507 Ga0105240_10280026 3300009093 Bacteria 1916
508 Ga0105240_11552071 3300009093 Unclassified 693
509 Ga0105240_12345603 3300009093 Unclassified 553
510 Ga0111539_10075074 3300009094 Bacteria 3983
511 Ga0111539_10109061 3300009094 Bacteria 3249
512 Ga0111539_10170580 3300009094 Bacteria 2542
513 Ga0111539_10264487 3300009094 Bacteria 2002
514 Ga0111539_10284937 3300009094 Bacteria 1923
515 Ga0111539_10546295 3300009094 Bacteria 1350
516 Ga0111539_10825441 3300009094 Bacteria 1079
517 Ga0111539_11958004 3300009094 Bacteria 680
518 Ga0105245_10287938 3300009098 Bacteria 1608
519 Ga0105245_10292655 3300009098 Bacteria 1595
520 Ga0105245_10481344 3300009098 Bacteria 1255
521 Ga0105245_10492885 3300009098 Unclassified 1240
522 Ga0105245_11253267 3300009098 Unclassified 790
523 Ga0105245_11681144 3300009098 Bacteria 687
524 Ga0105245_12641000 3300009098 Bacteria 555
525 Ga0105247_10000394 3300009101 Bacteria 37073
526 Ga0105247_10216777 3300009101 Bacteria 1294
527 Ga0105247_10337629 3300009101 Bacteria 1056
528 Ga0105247_10613123 3300009101 Bacteria 808
529 Ga0114129_10003214 3300009147 Bacteria 22932
530 Ga0114129_10058535 3300009147 Bacteria 5390
531 Ga0114129_10076671 3300009147 Bacteria 4653
532 Ga0114129_10195602 3300009147 Bacteria 2742
533 Ga0114129_10411131 3300009147 Bacteria 1781
534 Ga0114129_10748906 3300009147 Bacteria 1251
535 Ga0114129_10782071 3300009147 Bacteria 1219
536 Ga0114129_10797320 3300009147 Bacteria 1205
537 Ga0114129_10815028 3300009147 Bacteria 1190
538 Ga0114129_11267085 3300009147 Bacteria 915
539 Ga0114129_11610393 3300009147 Bacteria 795
540 Ga0105243_10012524 3300009148 Bacteria 6414
541 Ga0105243_10068448 3300009148 Bacteria 2861
542 Ga0105243_10089378 3300009148 Bacteria 2532
543 Ga0105243_10356231 3300009148 Bacteria 1345
544 Ga0105243_10377139 3300009148 Bacteria 1311
545 Ga0105243_10533805 3300009148 Bacteria 1118
546 Ga0105243_10628464 3300009148 Bacteria 1038
547 Ga0105243_10724996 3300009148 Unclassified 972
548 Ga0105243_10847385 3300009148 Bacteria 905
549 Ga0105243_11193197 3300009148 Unclassified 774
550 Ga0105243_11504760 3300009148 Bacteria 697
551 Ga0105243_11801056 3300009148 Bacteria 643
552 Ga0105243_11848883 3300009148 Bacteria 636
553 Ga0105243_12269588 3300009148 Bacteria 580
554 Ga0105243_12318436 3300009148 Bacteria 574
555 Ga0105241_10110457 3300009174 Bacteria 2200
556 Ga0105241_10129138 3300009174 Bacteria 2044
557 Ga0105241_10178309 3300009174 Bacteria 1760
558 Ga0105241_10369248 3300009174 Bacteria 1251
559 Ga0105241_10416996 3300009174 Bacteria 1181
560 Ga0105241_10791893 3300009174 Bacteria 873
561 Ga0105241_11234303 3300009174 Bacteria 709
562 Ga0105241_11249312 3300009174 Bacteria 705
563 Ga0105241_11484881 3300009174 Bacteria 652
564 Ga0105241_11862473 3300009174 Unclassified 589
565 Ga0105241_12088275 3300009174 Bacteria 560
566 Ga0105241_12398992 3300009174 Bacteria 526
567 Ga0105242_10015791 3300009176 Bacteria 5866
568 Ga0105242_10124047 3300009176 Bacteria 2221
569 Ga0105242_10167510 3300009176 Bacteria 1928
570 Ga0105242_10362372 3300009176 Bacteria 1342
571 Ga0105242_11207244 3300009176 Bacteria 776
572 Ga0105242_11410247 3300009176 Unclassified 724
573 Ga0105242_12205020 3300009176 Bacteria 596
574 Ga0105248_10035586 3300009177 Bacteria 5571
575 Ga0105248_10049924 3300009177 Bacteria 4691
576 Ga0105248_10093438 3300009177 Bacteria 3387
577 Ga0105248_10099339 3300009177 Bacteria 3280
578 Ga0105248_10108660 3300009177 Bacteria 3127
579 Ga0105248_10150238 3300009177 Bacteria 2628
580 Ga0105248_10870674 3300009177 Bacteria 1017
581 Ga0105248_10908532 3300009177 Bacteria 994
582 Ga0105248_11157302 3300009177 Bacteria 874
583 Ga0105248_11527635 3300009177 Unclassified 756
584 Ga0105248_12294734 3300009177 Bacteria 614
585 Ga0105248_12975163 3300009177 Bacteria 540
586 Ga0105248_13241211 3300009177 Bacteria 518
587 Ga0105237_10004306 3300009545 Bacteria 16505
588 Ga0105237_10044968 3300009545 Bacteria 4446
589 Ga0105237_10239719 3300009545 Bacteria 1815
590 Ga0105237_10875924 3300009545 Bacteria 905
591 Ga0105238_10003297 3300009551 Bacteria 16117
592 Ga0105238_10424538 3300009551 Bacteria 1324
593 Ga0105238_11782439 3300009551 Bacteria 647
594 Ga0105238_12055213 3300009551 Bacteria 605
595 Ga0105249_10037634 3300009553 Bacteria 4390
596 Ga0105249_10163791 3300009553 Bacteria 2151
597 Ga0105249_10454160 3300009553 Bacteria 1320
598 Ga0105249_10658831 3300009553 Bacteria 1105
599 Ga0105249_10699259 3300009553 Bacteria 1074
600 Ga0105249_11051676 3300009553 Bacteria 884
601 Ga0105239_10299679 3300010375 Bacteria 1810
602 Ga0105239_10311137 3300010375 Bacteria 1775
603 Ga0105239_10624274 3300010375 Bacteria 1230
604 Ga0105239_10697433 3300010375 Bacteria 1161
605 Ga0105239_11767867 3300010375 Bacteria 716
606 Ga0105239_11996332 3300010375 Bacteria 673
607 Ga0105246_10092379 3300011119 Bacteria 2184
608 Ga0105246_10733277 3300011119 Bacteria 870
609 Ga0105246_12084166 3300011119 Bacteria 549
610 Ga0157373_10007007 3300013100 Bacteria 8397
611 Ga0157373_10025983 3300013100 Bacteria 4231
612 Ga0157373_10158461 3300013100 Bacteria 1593
613 Ga0157373_10703787 3300013100 Bacteria 740
614 Ga0157373_11414465 3300013100 Unclassified 529
615 Ga0157373_11539703 3300013100 Bacteria 508
616 Ga0157370_10131857 3300013104 Bacteria 2331
617 Ga0157370_11076845 3300013104 Bacteria 727
618 Ga0157369_10015993 3300013105 Bacteria 8443
619 Ga0157374_10814543 3300013296 Bacteria 950
620 Ga0157374_11516292 3300013296 Unclassified 694
621 Ga0157374_11539768 3300013296 Bacteria 688
622 Ga0157374_12011054 3300013296 Bacteria 604
623 Ga0157374_12294404 3300013296 Unclassified 567
624 Ga0157378_10014873 3300013297 Bacteria 6809
625 Ga0157378_10017648 3300013297 Bacteria 6266
626 Ga0157378_10027967 3300013297 Bacteria 4972
627 Ga0157378_10114803 3300013297 Bacteria 2474
628 Ga0157378_11048199 3300013297 Bacteria 851
629 Ga0157378_11548651 3300013297 Bacteria 708
630 Ga0157378_12598168 3300013297 Unclassified 559
631 Ga0163162_10003633 3300013306 Bacteria 14788
632 Ga0163162_10023107 3300013306 Bacteria 6134
633 Ga0163162_10084808 3300013306 Bacteria 3244
634 Ga0163162_10301179 3300013306 Bacteria 1735
635 Ga0163162_10342554 3300013306 Bacteria 1627
636 Ga0163162_10761684 3300013306 Bacteria 1087
637 Ga0163162_11220779 3300013306 Bacteria 853
638 Ga0163162_11341869 3300013306 Bacteria 813
639 Ga0163162_11504930 3300013306 Unclassified 767
640 Ga0157372_10005777 3300013307 Bacteria 13181
641 Ga0157372_10233437 3300013307 Unclassified 2133
642 Ga0157372_10323681 3300013307 Bacteria 1795
643 Ga0157372_11291257 3300013307 Bacteria 842
644 Ga0157372_12124919 3300013307 Unclassified 645
645 Ga0157375_10027606 3300013308 Bacteria 5308
646 Ga0157375_10060759 3300013308 Bacteria 3750
647 Ga0157375_10211232 3300013308 Bacteria 2098
648 Ga0157375_10319248 3300013308 Unclassified 1718
649 Ga0157375_10436127 3300013308 Bacteria 1476
650 Ga0157375_10525025 3300013308 Unclassified 1347
651 Ga0157375_11387992 3300013308 Bacteria 827
652 Ga0157375_11412148 3300013308 Bacteria 820
653 Ga0157375_12187160 3300013308 Bacteria 659
654 Ga0157375_12268379 3300013308 Unclassified 647
655 Ga0157375_12429523 3300013308 Unclassified 625
656 Ga0163163_10004578 3300014325 Bacteria 11806
657 Ga0163163_10052639 3300014325 Bacteria 4017
658 Ga0163163_10084106 3300014325 Unclassified 3187
659 Ga0163163_10155317 3300014325 Bacteria 2332
660 Ga0163163_10174551 3300014325 Bacteria 2196
661 Ga0163163_10191480 3300014325 Bacteria 2094
662 Ga0163163_10219593 3300014325 Bacteria 1949
663 Ga0163163_10240078 3300014325 Bacteria 1862
664 Ga0163163_10328927 3300014325 Bacteria 1582
665 Ga0163163_10455081 3300014325 Bacteria 1340
666 Ga0163163_10566580 3300014325 Bacteria 1199
667 Ga0157380_10000337 3300014326 Bacteria 27979
668 Ga0157380_10050546 3300014326 Bacteria 3284
669 Ga0157380_10059845 3300014326 Bacteria 3041
670 Ga0157380_10409808 3300014326 Bacteria 1289
671 Ga0157380_10487582 3300014326 Bacteria 1194
672 Ga0157380_10618354 3300014326 Bacteria 1075
673 Ga0157380_10827805 3300014326 Bacteria 945
674 Ga0157377_10244401 3300014745 Bacteria 1160
675 Ga0157377_10279158 3300014745 Bacteria 1094
676 Ga0157377_10310104 3300014745 Bacteria 1045
677 Ga0157377_11076652 3300014745 Bacteria 614
678 Ga0157379_10059969 3300014968 Bacteria 3402
679 Ga0157379_10347231 3300014968 Unclassified 1358
680 Ga0157379_10917919 3300014968 Bacteria 831
681 Ga0157379_12326847 3300014968 Unclassified 534
682 Ga0157376_10097803 3300014969 Bacteria 2557
683 Ga0157376_10128112 3300014969 Bacteria 2261
684 Ga0157376_10275535 3300014969 Bacteria 1582
685 Ga0157376_10495707 3300014969 Bacteria 1199
686 Ga0163161_10108568 3300017792 Bacteria 2072
687 Ga0163161_10273944 3300017792 Bacteria 1321
688 Ga0163161_11364661 3300017792 Bacteria 618
689 Ga0213872_10099986 3300021361 Bacteria 1293
690 Ga0207697_10024591 3300025315 Bacteria 2465
691 Ga0207656_10006657 3300025321 Bacteria 4172
692 Ga0207653_10005402 3300025885 Bacteria 3996
693 Ga0207653_10094646 3300025885 Bacteria 1050
694 Ga0207653_10102916 3300025885 Bacteria 1012
695 Ga0207653_10115088 3300025885 Bacteria 963
696 Ga0207710_10002034 3300025900 Bacteria 9616
697 Ga0207710_10103367 3300025900 Bacteria 1346
698 Ga0207688_10096385 3300025901 Unclassified 1704
699 Ga0207688_10194048 3300025901 Bacteria 1216
700 Ga0207680_10021939 3300025903 Bacteria 3464
701 Ga0207647_10013511 3300025904 Bacteria 5654
702 Ga0207647_10023758 3300025904 Bacteria 4050
703 Ga0207647_10091834 3300025904 Bacteria 1810
704 Ga0207699_10035963 3300025906 Bacteria 2821
705 Ga0207645_10366934 3300025907 Unclassified 965
706 Ga0207643_10032078 3300025908 Bacteria 2932
707 Ga0207643_10057020 3300025908 Bacteria 2223
708 Ga0207643_10344905 3300025908 Bacteria 934
709 Ga0207643_10405823 3300025908 Bacteria 862
710 Ga0207705_10138161 3300025909 Bacteria 1818
711 Ga0207684_10088536 3300025910 Bacteria 2638
712 Ga0207684_10134751 3300025910 Bacteria 2120
713 Ga0207684_10182117 3300025910 Bacteria 1812
714 Ga0207684_10328169 3300025910 Bacteria 1318
715 Ga0207684_10462449 3300025910 Bacteria 1089
716 Ga0207654_10056055 3300025911 Bacteria 2285
717 Ga0207654_10252739 3300025911 Unclassified 1182
718 Ga0207654_10274072 3300025911 Bacteria 1139
719 Ga0207654_10395116 3300025911 Bacteria 960
720 Ga0207654_10615965 3300025911 Bacteria 775
721 Ga0207654_10660668 3300025911 Bacteria 749
722 Ga0207654_10775836 3300025911 Bacteria 691
723 Ga0207707_10000190 3300025912 Bacteria 64802
724 Ga0207707_10019589 3300025912 Bacteria 5905
725 Ga0207707_10161872 3300025912 Bacteria 1956
726 Ga0207707_10258385 3300025912 Bacteria 1512
727 Ga0207707_10501361 3300025912 Bacteria 1035
728 Ga0207695_10162096 3300025913 Bacteria 2167
729 Ga0207695_10198322 3300025913 Bacteria 1922
730 Ga0207671_10000894 3300025914 Bacteria 37708
731 Ga0207671_11499212 3300025914 Unclassified 521
732 Ga0207663_10000080 3300025916 Bacteria 46340
733 Ga0207660_10000117 3300025917 Bacteria 46029
734 Ga0207660_10111327 3300025917 Bacteria 2061
735 Ga0207660_10437744 3300025917 Bacteria 1056
736 Ga0207660_11064721 3300025917 Bacteria 659
737 Ga0207662_10064702 3300025918 Bacteria 2201
738 Ga0207662_10103932 3300025918 Bacteria 1763
739 Ga0207662_10266337 3300025918 Bacteria 1129
740 Ga0207662_10549920 3300025918 Bacteria 799
741 Ga0207662_10727504 3300025918 Bacteria 697
742 Ga0207657_10823452 3300025919 Bacteria 717
743 Ga0207657_11325935 3300025919 Bacteria 543
744 Ga0207649_11351527 3300025920 Unclassified 564
745 Ga0207652_10000028 3300025921 Bacteria 150429
746 Ga0207652_10492142 3300025921 Bacteria 1104
747 Ga0207646_10001826 3300025922 Bacteria 25702
748 Ga0207646_10204892 3300025922 Bacteria 1782
749 Ga0207646_10238694 3300025922 Bacteria 1642
750 Ga0207646_10428683 3300025922 Bacteria 1193
751 Ga0207646_10922308 3300025922 Unclassified 774
752 Ga0207646_11066098 3300025922 Bacteria 712
753 Ga0207681_10069022 3300025923 Bacteria 2457
754 Ga0207681_10449482 3300025923 Bacteria 1048
755 Ga0207681_10511846 3300025923 Bacteria 984
756 Ga0207681_10617494 3300025923 Bacteria 897
757 Ga0207681_10955963 3300025923 Bacteria 718
758 Ga0207681_11488424 3300025923 Unclassified 568
759 Ga0207694_10001250 3300025924 Bacteria 21954
760 Ga0207694_10269461 3300025924 Bacteria 1397
761 Ga0207650_10000009 3300025925 Bacteria 483583
762 Ga0207650_10032369 3300025925 Bacteria 3782
763 Ga0207650_10260717 3300025925 Bacteria 1406
764 Ga0207650_10405764 3300025925 Bacteria 1129
765 Ga0207650_10643398 3300025925 Bacteria 893
766 Ga0207650_10892696 3300025925 Unclassified 755
767 Ga0207650_11268245 3300025925 Bacteria 627
768 Ga0207650_11550905 3300025925 Bacteria 563
769 Ga0207659_10066620 3300025926 Bacteria 2614
770 Ga0207659_10109868 3300025926 Bacteria 2094
771 Ga0207659_10266119 3300025926 Bacteria 1397
772 Ga0207659_10700383 3300025926 Bacteria 867
773 Ga0207687_10597166 3300025927 Bacteria 930
774 Ga0207664_10386217 3300025929 Bacteria 1243
775 Ga0207664_10800505 3300025929 Bacteria 848
776 Ga0207644_10018151 3300025931 Bacteria 4757
777 Ga0207644_10349784 3300025931 Bacteria 1200
778 Ga0207690_10090969 3300025932 Bacteria 2156
779 Ga0207690_10407380 3300025932 Bacteria 1085
780 Ga0207690_10994912 3300025932 Bacteria 697
781 Ga0207690_11469875 3300025932 Unclassified 570
782 Ga0207706_10309362 3300025933 Bacteria 1376
783 Ga0207706_10323950 3300025933 Bacteria 1341
784 Ga0207706_10647330 3300025933 Bacteria 905
785 Ga0207706_11128341 3300025933 Bacteria 654
786 Ga0207686_10122559 3300025934 Bacteria 1771
787 Ga0207686_10249154 3300025934 Bacteria 1297
788 Ga0207686_10417003 3300025934 Bacteria 1026
789 Ga0207709_10004977 3300025935 Bacteria 7604
790 Ga0207709_10006800 3300025935 Bacteria 6398
791 Ga0207709_10271713 3300025935 Bacteria 1248
792 Ga0207709_11156236 3300025935 Bacteria 637
793 Ga0207709_11232270 3300025935 Bacteria 617
794 Ga0207709_11785659 3300025935 Unclassified 512
795 Ga0207670_10010469 3300025936 Bacteria 5347
796 Ga0207670_10204002 3300025936 Bacteria 1504
797 Ga0207670_10333018 3300025936 Bacteria 1197
798 Ga0207670_10883703 3300025936 Bacteria 748
799 Ga0207670_11948154 3300025936 Bacteria 500
800 Ga0207669_10490372 3300025937 Bacteria 981
801 Ga0207669_10725064 3300025937 Bacteria 819
802 Ga0207669_10881071 3300025937 Bacteria 747
803 Ga0207704_10147764 3300025938 Bacteria 1654
804 Ga0207704_10648731 3300025938 Bacteria 869
805 Ga0207704_10813645 3300025938 Bacteria 781
806 Ga0207704_10870124 3300025938 Bacteria 756
807 Ga0207704_11171902 3300025938 Bacteria 654
808 Ga0207665_10048039 3300025939 Bacteria 2863
809 Ga0207665_10056712 3300025939 Bacteria 2645
810 Ga0207665_10369804 3300025939 Bacteria 1086
811 Ga0207665_10479861 3300025939 Bacteria 958
812 Ga0207691_10007812 3300025940 Bacteria 10298
813 Ga0207691_10103418 3300025940 Bacteria 2540
814 Ga0207691_10421896 3300025940 Bacteria 1137
815 Ga0207691_10454060 3300025940 Unclassified 1090
816 Ga0207691_10912083 3300025940 Bacteria 735
817 Ga0207711_10022693 3300025941 Bacteria 5250
818 Ga0207711_10044349 3300025941 Bacteria 3796
819 Ga0207711_10075155 3300025941 Bacteria 2940
820 Ga0207711_10099190 3300025941 Bacteria 2574
821 Ga0207711_10103321 3300025941 Bacteria 2523
822 Ga0207711_10327447 3300025941 Bacteria 1416
823 Ga0207711_10557207 3300025941 Bacteria 1069
824 Ga0207711_11250004 3300025941 Bacteria 684
825 Ga0207689_10006841 3300025942 Bacteria 10028
826 Ga0207689_10051707 3300025942 Bacteria 3387
827 Ga0207689_10168758 3300025942 Bacteria 1803
828 Ga0207689_10187239 3300025942 Bacteria 1707
829 Ga0207689_10215027 3300025942 Bacteria 1588
830 Ga0207689_10308364 3300025942 Bacteria 1312
831 Ga0207689_10503452 3300025942 Bacteria 1015
832 Ga0207689_10602988 3300025942 Bacteria 924
833 Ga0207661_12104860 3300025944 Bacteria 510
834 Ga0207679_10111912 3300025945 Bacteria 2156
835 Ga0207679_10115492 3300025945 Bacteria 2127
836 Ga0207679_10239242 3300025945 Bacteria 1537
837 Ga0207679_10393430 3300025945 Bacteria 1218
838 Ga0207679_11028658 3300025945 Bacteria 755
839 Ga0207679_11659381 3300025945 Bacteria 585
840 Ga0207667_10237178 3300025949 Bacteria 1867
841 Ga0207667_10845714 3300025949 Bacteria 909
842 Ga0207667_10853300 3300025949 Bacteria 905
843 Ga0207651_10143291 3300025960 Bacteria 1849
844 Ga0207651_10232578 3300025960 Bacteria 1497
845 Ga0207651_10538629 3300025960 Bacteria 1014
846 Ga0207712_10260872 3300025961 Bacteria 1405
847 Ga0207712_10955289 3300025961 Bacteria 759
848 Ga0207712_11200078 3300025961 Bacteria 677
849 Ga0207640_10175384 3300025981 Bacteria 1602
850 Ga0207640_10314947 3300025981 Bacteria 1243
851 Ga0207640_10405098 3300025981 Bacteria 1112
852 Ga0207640_10419614 3300025981 Bacteria 1095
853 Ga0207640_10478919 3300025981 Unclassified 1032
854 Ga0207640_11649541 3300025981 Bacteria 578
855 Ga0207658_10060382 3300025986 Unclassified 2829
856 Ga0207658_10606199 3300025986 Bacteria 984
857 Ga0207677_10280571 3300026023 Bacteria 1367
858 Ga0207677_10891540 3300026023 Bacteria 801
859 Ga0207677_11461051 3300026023 Unclassified 631
860 Ga0207703_10053627 3300026035 Bacteria 3278
861 Ga0207703_10098485 3300026035 Bacteria 2473
862 Ga0207703_10110581 3300026035 Bacteria 2344
863 Ga0207703_10255679 3300026035 Bacteria 1581
864 Ga0207703_10284299 3300026035 Bacteria 1503
865 Ga0207703_10412601 3300026035 Bacteria 1255
866 Ga0207703_10465333 3300026035 Bacteria 1183
867 Ga0207703_10544919 3300026035 Bacteria 1093
868 Ga0207703_10668763 3300026035 Unclassified 986
869 Ga0207703_11023707 3300026035 Unclassified 792
870 Ga0207703_11346875 3300026035 Bacteria 686
871 Ga0207703_11352715 3300026035 Bacteria 685
872 Ga0207639_10019268 3300026041 Bacteria 4864
873 Ga0207639_10116585 3300026041 Bacteria 2187
874 Ga0207639_10331000 3300026041 Bacteria 1355
875 Ga0207639_10409020 3300026041 Bacteria 1224
876 Ga0207639_10487087 3300026041 Bacteria 1125
877 Ga0207639_10540045 3300026041 Bacteria 1069
878 Ga0207639_11532820 3300026041 Unclassified 625
879 Ga0207678_10382116 3300026067 Bacteria 1217
880 Ga0207708_10013327 3300026075 Bacteria 6141
881 Ga0207708_10016142 3300026075 Bacteria 5610
882 Ga0207708_10019307 3300026075 Bacteria 5136
883 Ga0207708_10170959 3300026075 Bacteria 1721
884 Ga0207708_10326294 3300026075 Bacteria 1254
885 Ga0207708_10338823 3300026075 Bacteria 1231
886 Ga0207702_10061727 3300026078 Bacteria 3198
887 Ga0207641_10039757 3300026088 Bacteria 3935
888 Ga0207641_10176728 3300026088 Bacteria 1952
889 Ga0207641_10256655 3300026088 Bacteria 1635
890 Ga0207641_10374392 3300026088 Bacteria 1362
891 Ga0207641_10794521 3300026088 Bacteria 936
892 Ga0207641_11097480 3300026088 Bacteria 794
893 Ga0207648_10015715 3300026089 Bacteria 6947
894 Ga0207648_10054288 3300026089 Bacteria 3500
895 Ga0207648_10238904 3300026089 Bacteria 1617
896 Ga0207648_10894496 3300026089 Bacteria 829
897 Ga0207648_11153912 3300026089 Unclassified 727
898 Ga0207648_11203174 3300026089 Unclassified 712
899 Ga0207648_11460838 3300026089 Bacteria 643
900 Ga0207676_10003828 3300026095 Bacteria 10630
901 Ga0207676_10013877 3300026095 Bacteria 5784
902 Ga0207676_10028017 3300026095 Bacteria 4203
903 Ga0207676_10168745 3300026095 Bacteria 1904
904 Ga0207676_10227096 3300026095 Bacteria 1666
905 Ga0207676_10384601 3300026095 Bacteria 1307
906 Ga0207676_10828853 3300026095 Bacteria 904
907 Ga0207676_11310252 3300026095 Unclassified 719
908 Ga0207676_11899933 3300026095 Bacteria 594
909 Ga0207676_12132535 3300026095 Bacteria 559
910 Ga0207676_12425642 3300026095 Bacteria 521
911 Ga0207676_12542069 3300026095 Bacteria 508
912 Ga0207674_10041619 3300026116 Bacteria 4750
913 Ga0207674_10048470 3300026116 Bacteria 4348
914 Ga0207674_10068065 3300026116 Bacteria 3584
915 Ga0207674_10079994 3300026116 Bacteria 3272
916 Ga0207674_10098132 3300026116 Bacteria 2913
917 Ga0207674_10303764 3300026116 Bacteria 1545
918 Ga0207674_10434648 3300026116 Bacteria 1268
919 Ga0207674_10908345 3300026116 Bacteria 849
920 Ga0207674_11504251 3300026116 Bacteria 642
921 Ga0207675_100002429 3300026118 Bacteria 18455
922 Ga0207675_100007971 3300026118 Bacteria 9988
923 Ga0207675_100036053 3300026118 Bacteria 4613
924 Ga0207675_100052340 3300026118 Bacteria 3810
925 Ga0207675_100067150 3300026118 Bacteria 3352
926 Ga0207675_100120399 3300026118 Bacteria 2483
927 Ga0207675_100506168 3300026118 Unclassified 1203
928 Ga0207675_100634941 3300026118 Unclassified 1073
929 Ga0207675_101361573 3300026118 Bacteria 730
930 Ga0207675_101403141 3300026118 Bacteria 719
931 Ga0207683_10044049 3300026121 Unclassified 3901
932 Ga0207683_10153677 3300026121 Bacteria 2078
933 Ga0207683_10643323 3300026121 Bacteria 982
934 Ga0207683_10910945 3300026121 Bacteria 816
935 Ga0207698_10038495 3300026142 Bacteria 3534
936 Ga0207698_10057186 3300026142 Bacteria 3016
937 Ga0207698_10313639 3300026142 Unclassified 1466
938 Ga0207698_10598242 3300026142 Bacteria 1087
939 Ga0207698_10699549 3300026142 Bacteria 1008
940 Ga0207698_11421093 3300026142 Bacteria 709
941 Ga0207428_10030722 3300027907 Bacteria 4439
942 Ga0207428_10069947 3300027907 Bacteria 2760
943 Ga0207428_10091373 3300027907 Bacteria 2363
944 Ga0207428_10259595 3300027907 Bacteria 1294
945 Ga0268266_10190358 3300028379 Bacteria 1873
946 Ga0268265_10054238 3300028380 Bacteria 3041
947 Ga0268265_10106366 3300028380 Bacteria 2279
948 Ga0268265_10303004 3300028380 Bacteria 1440
949 Ga0268265_10429844 3300028380 Bacteria 1228
950 Ga0268265_10472998 3300028380 Bacteria 1175
951 Ga0268265_10625247 3300028380 Bacteria 1032
952 Ga0268265_11156340 3300028380 Bacteria 770
953 Ga0268265_11301539 3300028380 Bacteria 727
954 Ga0268265_12721929 3300028380 Bacteria 500
955 Ga0268264_10014751 3300028381 Bacteria 6418
956 Ga0268264_10059468 3300028381 Bacteria 3202
957 Ga0268264_10223272 3300028381 Bacteria 1735
958 Ga0268264_10235219 3300028381 Bacteria 1694
959 Ga0268264_10488861 3300028381 Bacteria 1198
960 Ga0268264_10503600 3300028381 Bacteria 1181
961 Ga0268264_10634210 3300028381 Bacteria 1056
962 Ga0268264_10661887 3300028381 Bacteria 1034
963 Ga0268264_10764701 3300028381 Bacteria 963
964 Ga0268264_11019775 3300028381 Unclassified 834
965 Ga0268264_12479667 3300028381 Bacteria 524
966 Ga0314311_1036646 3300030733 Bacteria 1471
967 Ga0265340_10239304 3300031247 Bacteria 810
968 Ga0265331_10367724 3300031250 Bacteria 644
969 Ga0307408_100274994 3300031548 Bacteria 1400
970 Ga0307408_101043134 3300031548 Bacteria 756
971 Ga0307408_102489185 3300031548 Unclassified 503
972 Ga0265314_10208017 3300031711 Bacteria 1151
973 Ga0307405_10809626 3300031731 Unclassified 785
974 Ga0307413_11546305 3300031824 Unclassified 588
975 Ga0307410_10248168 3300031852 Bacteria 1383
976 Ga0307407_10537983 3300031903 Bacteria 862
977 Ga0307416_101670612 3300032002 Bacteria 742
978 Ga0307416_101949611 3300032002 Bacteria 690
979 Ga0307416_102855615 3300032002 Bacteria 578
980 Ga0307416_103040854 3300032002 Bacteria 561
981 Ga0307411_11763760 3300032005 Bacteria 574
982 Ga0316583_10303011 3300032133 Unclassified 553
983 Ga0373944_0431579 3300035089 Bacteria 511
984 Ga0373949_0013761 3300035090 Bacteria 1797
985 Ga0373951_0001056 3300035091 Bacteria 7400
986 Ga0373952_0082505 3300035092 Bacteria 823
987 Ga0373952_0204747 3300035092 Unclassified 580
988 Ga0373941_0017898 3300035115 Bacteria 1949
989 Ga0373941_0100224 3300035115 Unclassified 1007
990 Ga0373941_0255946 3300035115 Bacteria 685
991 Ga0373954_0316192 3300035118 Bacteria 771
992 Ga0373957_0117921 3300035120 Bacteria 1073
993 Ga0373955_0110391 3300035172 Bacteria 1590
994 Ga0373955_0839608 3300035172 Bacteria 565
995 Ga0373942_0059558 3300035207 Bacteria 1091
996 Ga0373924_0346349 3300035410 Bacteria 662
997 Ga0373931_0051874 3300035691 Bacteria 2186
998 Ga0373931_0571167 3300035691 Bacteria 737
999 Ga0373931_0732801 3300035691 Bacteria 655
1000 Ga0373933_1117653 3300035724 Unclassified 519
1001 Ga0373937_0624948 3300036401 Bacteria 1022
1002 Ga0373937_0721872 3300036401 Bacteria 943
1003 Ga0395900_0042794 3300037418 Bacteria 4666
1004 Ga0395900_0212470 3300037418 Bacteria 1953
1005 Ga0395900_1347273 3300037418 Bacteria 627
1006 Ga0395898_0162373 3300037466 Bacteria 2137
1007 Ga0395898_0171057 3300037466 Bacteria 2077
1008 Ga0395898_0279053 3300037466 Bacteria 1594
1009 Ga0395898_0467814 3300037466 Bacteria 1200
1010 Ga0395898_1311127 3300037466 Bacteria 653
1011 Ga0395898_1648339 3300037466 Unclassified 565
1012 Ga0395905_0088694 3300037471 Unclassified 2899
1013 Ga0395905_1179823 3300037471 Unclassified 669
1014 Ga0395905_1556621 3300037471 Unclassified 566
1015 Ga0436364_0394521 3300037853 Bacteria 1964
1016 Ga0395901_0084143 3300038443 Bacteria 3325
1017 Ga0395901_0226065 3300038443 Bacteria 1955
1018 Ga0395901_0276750 3300038443 Bacteria 1745
1019 Ga0395901_0845363 3300038443 Bacteria 901
1020 Ga0395901_1917458 3300038443 Bacteria 540
1021 Ga0242422_07548 3300038699 Bacteria 641
1022 Ga0242420_008443 3300038996 Bacteria 1671
1023 Ga0242420_045950 3300038996 Bacteria 844
1024 Ga0436365_0592662 3300039437 Bacteria 3849
1025 Ga0436360_1147962 3300039438 Bacteria 1819
1026 Ga0436363_1074598 3300039450 Bacteria 882
1027 Ga0436362_0731184 3300039453 Bacteria 524
1028 Ga0436362_1178460 3300039453 Bacteria 1683
1029 Ga0451791_0271950 3300041451 Bacteria 2407
1030 Ga0451839_0004775 3300041496 Bacteria 517
1031 Ga0451845_0275633 3300041501 Bacteria 583
1032 Ga0439433_0101396 3300041999 Bacteria 715
1033 Ga0439448_0059846 3300042005 Bacteria 1258
1034 Ga0439448_0071378 3300042005 Bacteria 1157
1035 Ga0439451_083280 3300042009 Bacteria 643
1036 Ga0439455_0043550 3300042012 Unclassified 1156
1037 Ga0439455_0222023 3300042012 Bacteria 550
1038 Ga0450914_023954 3300042118 Unclassified 698
1039 Ga0439446_0173899 3300042156 Bacteria 717
1040 Ga0439446_0229329 3300042156 Bacteria 635
1041 Ga0439458_0013440 3300042157 Bacteria 1841
1042 Ga0451577_0086067 3300042876 Bacteria 2804
1043 Ga0451577_0092149 3300042876 Bacteria 2706
1044 Ga0439440_0033176 3300042993 Bacteria 1229
1045 Ga0453683_0014187 3300044673 Bacteria 5179
1046 Ga0453683_0031893 3300044673 Bacteria 3327
1047 Ga0453683_1129375 3300044673 Unclassified 523
1048 Ga0466966_0362748 3300044684 Bacteria 870
1049 Ga0466963_0263725 3300044694 Bacteria 1210
1050 Ga0466963_0401483 3300044694 Bacteria 966
1051 Ga0453684_0009087 3300044712 Bacteria 17521
1052 Ga0453684_0191143 3300044712 Bacteria 2395
1053 Ga0466968_0261712 3300044735 Bacteria 824
1054 Ga0466957_0323145 3300044842 Bacteria 1042
1055 Ga0466957_0411039 3300044842 Bacteria 927
1056 Ga0466960_0025115 3300044901 Bacteria 2694
1057 Ga0451576_0010166 3300045051 Bacteria 10826
1058 Ga0451576_0137816 3300045051 Bacteria 2545
1059 Ga0451576_0220673 3300045051 Bacteria 1979
1060 Ga0451576_1966133 3300045051 Bacteria 603
1061 Ga0451576_2008069 3300045051 Bacteria 596
1062 Ga0451576_2192811 3300045051 Bacteria 567
1063 Ga0451576_2423857 3300045051 Bacteria 537
1064 Ga0451576_2440648 3300045051 Unclassified 535
1065 Ga0466958_0392240 3300045836 Bacteria 896
1066 Ga0466967_0405252 3300045976 Unclassified 1327
1067 Ga0466967_2168322 3300045976 Bacteria 552
1068 Ga0495592_0769933 3300046454 Unclassified 574
1069 Ga0495592_0927788 3300046454 Unclassified 510
1070 Ga0495603_0192595 3300046455 Bacteria 1179
1071 Ga0495629_0537005 3300046459 Bacteria 786
1072 Ga0495651_0006432 3300046462 Bacteria 8987
1073 Ga0495653_0731533 3300046463 Bacteria 599
1074 Ga0495584_0551794 3300046491 Bacteria 587
1075 Ga0495608_0132642 3300046511 Bacteria 1593
1076 Ga0495630_0432849 3300046517 Bacteria 1008
1077 Ga0495652_0111393 3300046529 Bacteria 2201
1078 Ga0495598_0055992 3300046537 Bacteria 1203
1079 Ga0495621_0092657 3300046539 Bacteria 1140
1080 Ga0495597_0302174 3300046542 Bacteria 621
1081 Ga0495656_0483971 3300046615 Unclassified 655
1082 Ga0495635_1011851 3300046663 Bacteria 529
1083 Ga0495657_0088825 3300046675 Bacteria 1986
1084 Ga0495599_0558382 3300046678 Bacteria 670
1085 Ga0495623_0148159 3300046679 Bacteria 1390
1086 Ga0495647_0072109 3300046681 Bacteria 1385
1087 Ga0495613_0591978 3300046689 Bacteria 739
1088 Ga0495674_1227907 3300047319 Bacteria 565
1089 Ga0495680_0524926 3300047322 Unclassified 801
1090 Ga0495684_0000552 3300047471 Bacteria 30354
1091 Ga0495684_0367066 3300047471 Bacteria 1018
1092 Ga0496103_0162645 3300048906 Bacteria 1432
1093 Ga0496104_0030518 3300048907 Bacteria 5010
1094 Ga0496104_1541675 3300048907 Unclassified 567
1095 Ga0496106_0053387 3300048909 Bacteria 3052
1096 Ga0496106_0358906 3300048909 Bacteria 1171
1097 Ga0496106_0365652 3300048909 Bacteria 1159
1098 Ga0496106_0404936 3300048909 Bacteria 1096
1099 Ga0496107_0335640 3300048910 Bacteria 1125
1100 Ga0496107_1131639 3300048910 Bacteria 565
1101 Ga0496108_0229739 3300048911 Bacteria 1613
1102 Ga0496108_0842727 3300048911 Unclassified 789
1103 Ga0496108_1079404 3300048911 Bacteria 683
1104 Ga0496109_0402064 3300048912 Bacteria 1294
1105 Ga0496110_0170462 3300048913 Bacteria 1975
1106 Ga0496110_0518305 3300048913 Bacteria 1085
1107 Ga0496110_1695334 3300048913 Unclassified 542
1108 Ga0496111_0803424 3300048914 Bacteria 681
1109 Ga0496112_0234516 3300048915 Bacteria 1789
1110 Ga0496112_0498819 3300048915 Bacteria 1153
1111 Ga0496112_0738083 3300048915 Bacteria 911
1112 Ga0496112_1121096 3300048915 Bacteria 705
1113 Ga0496112_1179079 3300048915 Bacteria 683
1114 Ga0496113_0038277 3300048916 Bacteria 3526
1115 Ga0496113_0471869 3300048916 Bacteria 1008
1116 Ga0496113_0716453 3300048916 Bacteria 798
1117 Ga0496113_0783931 3300048916 Bacteria 758
1118 Ga0496113_0994275 3300048916 Bacteria 661
1119 Ga0496115_0274203 3300048918 Bacteria 1385
1120 Ga0501291_036551 3300049514 Bacteria 849
1121 Ga0501292_003696 3300049515 Bacteria 2057
1122 Ga0501292_048580 3300049515 Bacteria 747
1123 Ga0501293_018048 3300049516 Bacteria 670
1124 Ga0501295_031242 3300049518 Bacteria 1052
1125 Ga0501297_014073 3300049520 Bacteria 945
1126 Ga0501298_001069 3300049521 Bacteria 3924
1127 Ga0501298_012138 3300049521 Bacteria 1506
1128 Ga0501299_026071 3300049522 Bacteria 1101
1129 Ga0501300_091597 3300049523 Unclassified 510
1130 Ga0501301_036220 3300049524 Bacteria 543
1131 Ga0501033_0605179 3300049570 Bacteria 751
1132 Ga0501036_0284479 3300049572 Bacteria 1384
1133 Ga0501036_0930725 3300049572 Bacteria 713
1134 Ga0501038_1342304 3300049574 Unclassified 515
1135 Ga0501040_0444725 3300049576 Bacteria 933
1136 Ga0501041_0827991 3300049577 Bacteria 594
1137 Ga0501042_0139472 3300049578 Bacteria 1748
1138 Ga0501042_0303697 3300049578 Bacteria 1153
1139 Ga0501043_0217118 3300049579 Bacteria 1481
1140 Ga0501046_0286214 3300049580 Bacteria 1206
1141 Ga0501046_1185179 3300049580 Bacteria 525
1142 Ga0501067_0621836 3300049583 Unclassified 606
1143 Ga0501069_0998879 3300049585 Bacteria 511
1144 Ga0501070_0134440 3300049586 Bacteria 2042
1145 Ga0501071_0122191 3300049587 Bacteria 1931
1146 Ga0501072_0775491 3300049588 Bacteria 752
1147 Ga0501074_1039519 3300049590 Bacteria 576
1148 Ga0501074_1294574 3300049590 Bacteria 511
1149 Ga0501075_0078134 3300049591 Bacteria 2505
1150 Ga0501076_0343517 3300049592 Unclassified 1225
1151 Ga0501076_0437058 3300049592 Bacteria 1077
1152 Ga0501077_0604314 3300049593 Bacteria 704
1153 Ga0501198_007781 3300049649 Bacteria 1546
1154 Ga0501198_035120 3300049649 Bacteria 851
1155 Ga0501201_011936 3300049651 Bacteria 862
1156 Ga0501202_010786 3300049652 Bacteria 1701
1157 Ga0501216_000310 3300049660 Bacteria 5459
1158 Ga0501216_003751 3300049660 Bacteria 2233
1159 Ga0501216_056853 3300049660 Bacteria 781
1160 Ga0501216_092422 3300049660 Unclassified 656
1161 Ga0501217_012689 3300049661 Bacteria 1880
1162 Ga0501223_002190 3300049663 Bacteria 4383
1163 Ga0501223_014720 3300049663 Bacteria 1551
1164 Ga0501227_021814 3300049665 Bacteria 1477
1165 Ga0501227_194219 3300049665 Unclassified 573
1166 Ga0501233_019893 3300049668 Bacteria 1427
1167 Ga0501235_005492 3300049669 Bacteria 2760
1168 Ga0501236_015545 3300049670 Bacteria 1068
1169 Ga0501243_008856 3300049675 Bacteria 1558
1170 Ga0501246_032138 3300049676 Bacteria 595
1171 Ga0501247_008433 3300049677 Bacteria 1203
1172 Ga0501247_019847 3300049677 Bacteria 867
1173 Ga0501249_002614 3300049679 Bacteria 3629
1174 Ga0501249_010924 3300049679 Bacteria 1903
1175 Ga0501253_012188 3300049683 Bacteria 1341
1176 Ga0501256_037122 3300049685 Bacteria 568
1177 Ga0501257_054830 3300049686 Bacteria 999
1178 Ga0501258_044808 3300049687 Bacteria 601
1179 Ga0501221_007563 3300049704 Bacteria 1868
1180 Ga0501225_0029786 3300049705 Bacteria 1500
1181 Ga0501234_032613 3300049707 Bacteria 843
1182 Ga0501245_002004 3300049708 Bacteria 2693
1183 Ga0501079_0522523 3300049741 Unclassified 933
1184 Ga0501079_0559960 3300049741 Bacteria 899
1185 Ga0501081_0209570 3300049743 Bacteria 1415
1186 Ga0501081_0493561 3300049743 Bacteria 912
1187 Ga0501081_0648121 3300049743 Bacteria 792
1188 Ga0501081_1552637 3300049743 Bacteria 503
1189 Ga0501267_027634 3300049764 Unclassified 655
1190 Ga0501268_007100 3300049765 Bacteria 1664
1191 Ga0501273_004926 3300049770 Bacteria 1489
1192 Ga0501279_044556 3300049775 Bacteria 689
1193 Ga0501282_012055 3300049778 Bacteria 933
1194 Ga0501283_016015 3300049779 Unclassified 1159
1195 Ga0501283_017973 3300049779 Unclassified 1109
1196 Ga0501283_021171 3300049779 Bacteria 1041
1197 Ga0501045_0621958 3300049824 Bacteria 799
1198 Ga0501204_005190 3300049850 Bacteria 1420
1199 nmdc:mga05p37_108420_c1 3300050507 Bacteria 3416
1200 nmdc:mga05p37_1590774_c1 3300050507 Bacteria 644
1201 nmdc:mga05p37_753744_c1 3300050507 Bacteria 1073
1202 nmdc:mga05p37_794467_c1 3300050507 Bacteria 1036
1203 nmdc:mga05p37_960394_c1 3300050507 Bacteria 913
1204 nmdc:mga09592_621928_c1 3300050508 Bacteria 924
1205 nmdc:mga0qj67_287055_c1 3300050509 Bacteria 1334
1206 nmdc:mga06r32_1196332_c1 3300050510 Unclassified 706
1207 nmdc:mga06r32_1600802_c1 3300050510 Bacteria 590
1208 nmdc:mga06r32_301603_c1 3300050510 Bacteria 1588
1209 nmdc:mga08y16_1378084_c1 3300050511 Unclassified 669
1210 nmdc:mga08y16_1877511_c1 3300050511 Unclassified 550
1211 nmdc:mga08y16_340703_c1 3300050511 Bacteria 1541
1212 nmdc:mga08y16_406941_c1 3300050511 Bacteria 1392
1213 nmdc:mga08y16_61917_c1 3300050511 Bacteria 3908
1214 nmdc:mga0n895_108330_c1 3300050512 Bacteria 2792
1215 nmdc:mga0n895_1386906_c1 3300050512 Unclassified 672
1216 nmdc:mga0n895_1662504_c1 3300050512 Bacteria 602
1217 nmdc:mga0n895_172394_c1 3300050512 Bacteria 2195
1218 nmdc:mga0n895_232858_c1 3300050512 Bacteria 1869
1219 nmdc:mga0n895_405292_c1 3300050512 Bacteria 1379
1220 nmdc:mga0n895_440957_c1 3300050512 Bacteria 1315
1221 nmdc:mga0n895_651977_c1 3300050512 Bacteria 1051
1222 nmdc:mga0n895_69768_c1 3300050512 Bacteria 3483
1223 nmdc:mga0n895_72164_c1 3300050512 Bacteria 3425
1224 nmdc:mga0rr50_106659_c1 3300050513 Bacteria 2211
1225 nmdc:mga0rr50_612331_c1 3300050513 Bacteria 929
1226 nmdc:mga08x19_13846_c1 3300050514 Bacteria 4886
1227 nmdc:mga08x19_4513_c1 3300050514 Bacteria 8249
1228 nmdc:mga0a205_168508_c1 3300050515 Bacteria 2086
1229 nmdc:mga0a205_185363_c1 3300050515 Bacteria 1974
1230 nmdc:mga0a205_258516_c1 3300050515 Bacteria 1619
1231 nmdc:mga0a205_29807_c1 3300050515 Bacteria 5221
1232 nmdc:mga0a205_310384_c1 3300050515 Bacteria 1449
1233 nmdc:mga0a205_32680_c1 3300050515 Bacteria 4988
1234 nmdc:mga0a205_47462_c1 3300050515 Bacteria 4144
1235 nmdc:mga0a205_491664_c1 3300050515 Unclassified 1084
1236 nmdc:mga0a205_60747_c1 3300050515 Bacteria 3650
1237 nmdc:mga0a205_740380_c1 3300050515 Bacteria 832
1238 Ga0500635_0237704 3300053080 Bacteria 713
1239 Ga0500642_0176354 3300053130 Bacteria 1000
1240 Ga0500645_030122 3300053730 Bacteria 1635
1241 Ga0500587_056397 3300053739 Unclassified 593
1242 Ga0501084_0453292 3300054114 Bacteria 1084
1243 Ga0501084_1510754 3300054114 Bacteria 562
1244 Ga0587085_040814 3300059506 Unclassified 808
1245 Ga0587107_006237 3300059652 Bacteria 1298
1246 Ga0501082_0836480 3300060353 Unclassified 805
1247 Ga0501082_1560519 3300060353 Bacteria 576
1248 2501940645 2501939600 Bacteria 6907073
1249 2855683750 2855683550 Bacteria 7134265
1250 2856862730 2856858025 Bacteria 7255264
1251 649815493 649633069 Bacteria 6962533
1252 Ga0070658_10127147
1253 SwRhRL2b_contig_2050774
1254 MBSR1b_contig_1387742
1255 MBSR1b_contig_6355838
1256 CNAas_1000357
1257 JGI24737J22298_10018220
1258 JGI24751J29686_10000120
1259 JGI25406J46586_10007505
1260 rootH1_10369606
1261 Ga0058863_11944606
1262 Ga0065714_10064428
1263 Ga0065704_10001277
1264 Ga0065704_10108277
1265 Ga0065704_10161295
1266 Ga0065704_10226908
1267 Ga0065704_10282907
1268 Ga0065712_10000115
1269 Ga0065712_10028699
1270 Ga0065712_10070131
1271 Ga0065712_10170636
1272 Ga0065715_10004566
1273 Ga0065715_10013167
1274 Ga0065715_10089908
1275 Ga0065715_10107769
1276 Ga0065715_10128590
1277 Ga0065715_10180787
1278 Ga0065715_10194902
1279 Ga0065715_10233674
1280 Ga0065715_10252767
1281 Ga0065715_10542671
1282 Ga0065707_10001190
1283 Ga0065707_10002996
1284 Ga0065707_10008524
1285 Ga0065707_10048628
1286 Ga0065707_10064844
1287 Ga0065707_10103437
1288 Ga0065707_10344888
1289 Ga0065707_10942951
1290 Ga0070676_10029180
1291 Ga0070676_10706662
1292 Ga0070676_10867720
1293 Ga0070676_11261997
1294 Ga0070683_100844715
1295 Ga0070690_100007430
1296 Ga0070690_100321417
1297 Ga0070690_100581294
1298 Ga0070670_100000043
1299 Ga0070670_100049421
1300 Ga0070670_100192525
1301 Ga0070670_100716643
1302 Ga0070670_100763025
1303 Ga0070670_101008832
1304 Ga0070670_102138023
1305 Ga0070677_10076058
1306 Ga0068869_100007983
1307 Ga0068869_100036220
1308 Ga0068869_100171168
1309 Ga0068869_100524149
1310 Ga0068869_101597753
1311 Ga0068869_101675972
1312 Ga0070666_10011769
1313 Ga0070666_10050059
1314 Ga0070666_10732442
1315 Ga0070680_100000115
1316 Ga0070680_100113510
1317 Ga0070680_100467895
1318 Ga0070682_100037579
1319 Ga0068868_100074350
1320 Ga0068868_100576798
1321 Ga0068868_101297978
1322 Ga0068868_101804022
1323 Ga0068868_102154525
1324 Ga0070660_101005916
1325 Ga0070660_101468295
1326 Ga0070689_100009107
1327 Ga0070689_100082889
1328 Ga0070689_100162053
1329 Ga0070687_100046395
1330 Ga0070687_100145273
1331 Ga0070687_100218843
1332 Ga0070687_101073213
1333 Ga0070661_101098303
1334 Ga0070661_101127485
1335 Ga0070661_101178359
1336 Ga0070692_10003160
1337 Ga0070692_10016597
1338 Ga0070692_10096097
1339 Ga0070692_10240469
1340 Ga0070692_10521428
1341 Ga0070668_100529882
1342 Ga0070668_100581177
1343 Ga0070669_100015211
1344 Ga0070669_100107014
1345 Ga0070669_100218924
1346 Ga0070669_100451480
1347 Ga0070669_100648580
1348 Ga0070669_100860414
1349 Ga0070675_100409659
1350 Ga0070675_100429211
1351 Ga0070675_100537850
1352 Ga0070675_100667070
1353 Ga0070675_100796529
1354 Ga0070675_101408305
1355 Ga0070675_102207653
1356 Ga0070671_100009235
1357 Ga0070671_100315513
1358 Ga0070674_100136766
1359 Ga0070674_100292903
1360 Ga0070674_100495988
1361 Ga0070674_102078299
1362 Ga0070673_100043035
1363 Ga0070673_100189022
1364 Ga0070673_100283945
1365 Ga0070673_100691450
1366 Ga0070688_100687876
1367 Ga0070688_101007897
1368 Ga0070659_100076626
1369 Ga0070659_100162473
1370 Ga0070659_100394025
1371 Ga0070667_100109883
1372 Ga0070667_100183531
1373 Ga0070667_102195833
1374 Ga0070703_10010129
1375 Ga0070709_10013266
1376 Ga0070709_11159364
1377 Ga0070714_100057881
1378 Ga0070713_100943326
1379 Ga0070713_102390349
1380 Ga0070701_10190435
1381 Ga0070701_10508549
1382 Ga0070701_10700815
1383 Ga0070701_11079321
1384 Ga0070711_100000098
1385 Ga0070705_100002460
1386 Ga0070705_100021022
1387 Ga0070705_100225746
1388 Ga0070705_100325079
1389 Ga0070705_100341312
1390 Ga0070705_100391468
1391 Ga0070700_100013133
1392 Ga0070700_100149362
1393 Ga0070700_100151131
1394 Ga0070700_100222914
1395 Ga0070700_100300759
1396 Ga0070700_100380766
1397 Ga0070700_100565444
1398 Ga0070700_100628890
1399 Ga0070700_100630485
1400 Ga0070694_100004994
1401 Ga0070694_100020047
1402 Ga0070694_100026086
1403 Ga0070694_100028424
1404 Ga0070694_100053574
1405 Ga0070694_100122831
1406 Ga0070694_100132840
1407 Ga0070694_100135494
1408 Ga0070694_100178147
1409 Ga0070694_100204049
1410 Ga0070694_100215203
1411 Ga0070694_100221920
1412 Ga0070694_100224987
1413 Ga0070694_100793980
1414 Ga0070694_100954262
1415 Ga0070708_100001033
1416 Ga0070708_100037466
1417 Ga0070708_100093744
1418 Ga0070708_100274820
1419 Ga0070708_100478794
1420 Ga0070708_100581514
1421 Ga0070708_101075120
1422 Ga0070708_101142174
1423 Ga0070708_101596627
1424 Ga0070708_102012352
1425 Ga0070678_100183234
1426 Ga0070678_100612483
1427 Ga0070662_100245250
1428 Ga0070662_100298900
1429 Ga0070662_100692501
1430 Ga0070662_100900075
1431 Ga0070681_10000336
1432 Ga0070681_10008460
1433 Ga0070681_10046107
1434 Ga0070681_10101418
1435 Ga0070681_10102309
1436 Ga0070681_10108052
1437 Ga0070681_11541689
1438 Ga0070681_12045686
1439 Ga0068867_100009686
1440 Ga0068867_100019586
1441 Ga0068867_100171388
1442 Ga0068867_100436077
1443 Ga0068867_100546968
1444 Ga0068867_100789295
1445 Ga0068867_101105103
1446 Ga0068867_101610990
1447 Ga0068867_101717120
1448 Ga0068867_101964273
1449 Ga0070685_10002868
1450 Ga0070685_10467130
1451 Ga0070706_100020581
1452 Ga0070706_100055938
1453 Ga0070706_100074951
1454 Ga0070706_100160090
1455 Ga0070706_100180855
1456 Ga0070706_100334262
1457 Ga0070706_100790287
1458 Ga0070706_100803445
1459 Ga0070706_101213318
1460 Ga0070707_100008243
1461 Ga0070707_100027250
1462 Ga0070707_100191005
1463 Ga0070707_100236793
1464 Ga0070707_100691753
1465 Ga0070707_100843993
1466 Ga0070707_101151774
1467 Ga0070698_100013422
1468 Ga0070698_100025018
1469 Ga0070698_100068642
1470 Ga0070698_100599743
1471 Ga0070698_100850959
1472 Ga0070699_100003267
1473 Ga0070699_100009322
1474 Ga0070699_100023706
1475 Ga0070699_100049756
1476 Ga0070699_100054525
1477 Ga0070699_100282035
1478 Ga0070699_100636989
1479 Ga0070699_100688051
1480 Ga0070699_100944807
1481 Ga0070699_101183789
1482 Ga0070699_101260008
1483 Ga0070679_100000256
1484 Ga0070679_100437561
1485 Ga0070684_100535491
1486 Ga0070697_100000334
1487 Ga0070697_100000654
1488 Ga0070697_100011415
1489 Ga0070697_100048201
1490 Ga0070697_100089940
1491 Ga0070697_101371142
1492 Ga0070697_101618039
1493 Ga0070697_101641503
1494 Ga0070697_102146121
1495 Ga0068853_100015390
1496 Ga0068853_100181514
1497 Ga0068853_100414911
1498 Ga0068853_100435256
1499 Ga0068853_100471597
1500 Ga0068853_100621752
1501 Ga0068853_101303566
1502 Ga0070672_100031427
1503 Ga0070672_100896587
1504 Ga0070686_100003256
1505 Ga0070686_100285082
1506 Ga0070686_101068975
1507 Ga0070686_101644016
1508 Ga0070695_100033029
1509 Ga0070695_100053047
1510 Ga0070695_100083952
1511 Ga0070695_100237074
1512 Ga0070695_100395788
1513 Ga0070695_100450834
1514 Ga0070695_100753906
1515 Ga0070695_101304526
1516 Ga0070695_101792520
1517 Ga0070696_100040118
1518 Ga0070696_100104869
1519 Ga0070696_100251285
1520 Ga0070696_100503672
1521 Ga0070696_101094581
1522 Ga0070696_101139996
1523 Ga0070696_101673819
1524 Ga0070696_102025993
1525 Ga0070693_100010226
1526 Ga0070693_100022088
1527 Ga0070693_100025235
1528 Ga0070693_100161404
1529 Ga0070693_100266965
1530 Ga0070693_100317932
1531 Ga0070693_100412858
1532 Ga0070693_100464779
1533 Ga0070693_101481376
1534 Ga0070665_100023642
1535 Ga0070665_100118976
1536 Ga0070704_100014009
1537 Ga0070704_100030966
1538 Ga0070704_100045581
1539 Ga0070704_100111775
1540 Ga0070704_100252392
1541 Ga0070704_100256036
1542 Ga0070704_100431538
1543 Ga0070704_100453195
1544 Ga0070704_101773243
1545 Ga0068855_100409893
1546 Ga0068855_100468347
1547 Ga0068855_100647845
1548 Ga0068855_101118175
1549 Ga0068855_101428993
1550 Ga0068855_101623788
1551 Ga0068855_102551209
1552 Ga0070664_100063126
1553 Ga0070664_100098729
1554 Ga0070664_100424989
1555 Ga0070664_100618645
1556 Ga0068857_100065063
1557 Ga0068857_100161268
1558 Ga0068857_100170834
1559 Ga0068857_100204668
1560 Ga0068857_100391121
1561 Ga0068857_100609933
1562 Ga0068857_100802434
1563 Ga0068857_100995859
1564 Ga0068854_100070662
1565 Ga0068854_100091363
1566 Ga0068854_100108794
1567 Ga0068854_100226741
1568 Ga0068854_100267629
1569 Ga0068854_100309528
1570 Ga0068854_100429312
1571 Ga0068854_100535567
1572 Ga0068854_100786849
1573 Ga0068854_101397484
1574 Ga0068854_101975584
1575 Ga0068856_100010370
1576 Ga0068856_101434294
1577 Ga0070702_100008658
1578 Ga0070702_100012549
1579 Ga0070702_100020512
1580 Ga0070702_100193382
1581 Ga0070702_100274927
1582 Ga0070702_100307843
1583 Ga0070702_100682317
1584 Ga0070702_101491887
1585 Ga0068852_100032769
1586 Ga0068852_100051861
1587 Ga0068852_100328987
1588 Ga0068852_100381423
1589 Ga0068852_100585385
1590 Ga0068852_100646344
1591 Ga0068852_101020956
1592 Ga0068852_101382535
1593 Ga0068859_100022464
1594 Ga0068859_100032177
1595 Ga0068859_100034121
1596 Ga0068859_100040493
1597 Ga0068859_100073611
1598 Ga0068859_100074038
1599 Ga0068859_100122618
1600 Ga0068859_100128127
1601 Ga0068859_100138393
1602 Ga0068859_100256725
1603 Ga0068859_100384775
1604 Ga0068859_100457211
1605 Ga0068859_100571387
1606 Ga0068859_100630180
1607 Ga0068859_101031649
1608 Ga0068859_101355453
1609 Ga0068859_101952124
1610 Ga0068859_102779375
1611 Ga0068864_100038939
1612 Ga0068864_100045449
1613 Ga0068864_100147610
1614 Ga0068864_100626472
1615 Ga0068864_100796499
1616 Ga0068864_101915930
1617 Ga0068864_102041413
1618 Ga0068864_102220189
1619 Ga0068866_10085236
1620 Ga0068861_100004428
1621 Ga0068861_100024430
1622 Ga0068861_100045601
1623 Ga0068861_100063185
1624 Ga0068861_100207349
1625 Ga0068861_100244988
1626 Ga0068861_101713753
1627 Ga0068851_10003914
1628 Ga0068851_10318516
1629 Ga0068870_10066331
1630 Ga0068870_10095548
1631 Ga0068870_10231858
1632 Ga0068870_10414312
1633 Ga0068870_10449849
1634 Ga0068870_10467403
1635 Ga0068870_11133277
1636 Ga0068870_11195274
1637 Ga0068863_100010788
1638 Ga0068863_100147216
1639 Ga0068863_100349517
1640 Ga0068863_100390418
1641 Ga0068863_101503478
1642 Ga0068863_101710990
1643 Ga0068863_102074425
1644 Ga0068863_102220985
1645 Ga0068858_100023110
1646 Ga0068858_100038381
1647 Ga0068858_100082917
1648 Ga0068858_100119168
1649 Ga0068858_100187743
1650 Ga0068858_100190029
1651 Ga0068858_100561418
1652 Ga0068858_100586100
1653 Ga0068858_100615268
1654 Ga0068858_100685702
1655 Ga0068858_100808592
1656 Ga0068858_101974565
1657 Ga0068860_100016293
1658 Ga0068860_100073846
1659 Ga0068860_100075090
1660 Ga0068860_100079452
1661 Ga0068860_100081617
1662 Ga0068860_100142023
1663 Ga0068860_100285691
1664 Ga0068860_100460095
1665 Ga0068860_100520897
1666 Ga0068860_100817648
1667 Ga0068860_100973613
1668 Ga0068860_101020263
1669 Ga0068860_102243629
1670 Ga0068862_100013791
1671 Ga0068862_100072625
1672 Ga0068862_100173643
1673 Ga0068862_100290720
1674 Ga0068862_100389504
1675 Ga0068862_100640898
1676 Ga0068862_101254713
1677 Ga0068862_102600573
1678 Ga0081455_10870032
1679 Ga0081539_10000605
1680 Ga0081539_10005677
1681 Ga0070717_10390453
1682 Ga0075432_10288781
1683 Ga0070715_10032814
1684 Ga0070716_100205845
1685 Ga0070712_100580350
1686 Ga0097621_100005847
1687 Ga0097621_100010558
1688 Ga0097621_100011269
1689 Ga0097621_100030890
1690 Ga0068871_100008533
1691 Ga0068871_100020248
1692 Ga0068871_100146665
1693 Ga0068871_100335291
1694 Ga0068871_100462543
1695 Ga0075428_100642820
1696 Ga0075428_100743000
1697 Ga0075428_100768592
1698 Ga0075430_100185577
1699 Ga0075430_100586075
1700 Ga0075430_101238248
1701 Ga0075431_100360839
1702 Ga0075431_101349880
1703 Ga0075433_10027116
1704 Ga0075433_10041458
1705 Ga0075433_10067016
1706 Ga0075433_10068409
1707 Ga0075433_10081503
1708 Ga0075433_10088901
1709 Ga0075433_10093016
1710 Ga0075433_10104311
1711 Ga0075433_10251040
1712 Ga0075433_11293989
1713 Ga0075434_100105959
1714 Ga0075434_100202037
1715 Ga0075434_100269289
1716 Ga0075434_100293988
1717 Ga0075434_100328990
1718 Ga0075434_100424393
1719 Ga0075434_100720469
1720 Ga0075434_101085448
1721 Ga0075434_101574281
1722 Ga0075429_100041045
1723 Ga0075429_100048835
1724 Ga0075429_100693449
1725 Ga0075429_101104447
1726 Ga0068865_100019124
1727 Ga0068865_100046238
1728 Ga0068865_101148184
1729 Ga0068865_101773829
1730 Ga0075436_100052968
1731 Ga0075436_100064812
1732 Ga0075436_100073539
1733 Ga0075436_100441362
1734 Ga0075436_100976926
1735 Ga0097620_100022465
1736 Ga0097620_100032177
1737 Ga0097620_100034123
1738 Ga0097620_100040493
1739 Ga0097620_100073606
1740 Ga0097620_100074035
1741 Ga0097620_100122624
1742 Ga0097620_100128129
1743 Ga0097620_100138389
1744 Ga0097620_100256716
1745 Ga0097620_100384786
1746 Ga0097620_100457198
1747 Ga0097620_100571387
1748 Ga0097620_100630181
1749 Ga0097620_101031507
1750 Ga0097620_101355698
1751 Ga0097620_101952044
1752 Ga0097620_102779302
1753 Ga0075435_100195399
1754 Ga0075435_100583918
1755 Ga0075435_100687028
1756 Ga0105251_10102350
1757 Ga0105240_10186452
1758 Ga0105240_10280026
1759 Ga0105240_11552071
1760 Ga0105240_12345603
1761 Ga0111539_10075074
1762 Ga0111539_10109061
1763 Ga0111539_10170580
1764 Ga0111539_10264487
1765 Ga0111539_10284937
1766 Ga0111539_10546295
1767 Ga0111539_10825441
1768 Ga0111539_11958004
1769 Ga0105245_10287938
1770 Ga0105245_10292655
1771 Ga0105245_10481344
1772 Ga0105245_10492885
1773 Ga0105245_11253267
1774 Ga0105245_11681144
1775 Ga0105245_12641000
1776 Ga0105247_10000394
1777 Ga0105247_10216777
1778 Ga0105247_10337629
1779 Ga0105247_10613123
1780 Ga0114129_10003214
1781 Ga0114129_10058535
1782 Ga0114129_10076671
1783 Ga0114129_10195602
1784 Ga0114129_10411131
1785 Ga0114129_10748906
1786 Ga0114129_10782071
1787 Ga0114129_10797320
1788 Ga0114129_10815028
1789 Ga0114129_11267085
1790 Ga0114129_11610393
1791 Ga0105243_10012524
1792 Ga0105243_10068448
1793 Ga0105243_10089378
1794 Ga0105243_10356231
1795 Ga0105243_10377139
1796 Ga0105243_10533805
1797 Ga0105243_10628464
1798 Ga0105243_10724996
1799 Ga0105243_10847385
1800 Ga0105243_11193197
1801 Ga0105243_11504760
1802 Ga0105243_11801056
1803 Ga0105243_11848883
1804 Ga0105243_12269588
1805 Ga0105243_12318436
1806 Ga0105241_10110457
1807 Ga0105241_10129138
1808 Ga0105241_10178309
1809 Ga0105241_10369248
1810 Ga0105241_10416996
1811 Ga0105241_10791893
1812 Ga0105241_11234303
1813 Ga0105241_11249312
1814 Ga0105241_11484881
1815 Ga0105241_11862473
1816 Ga0105241_12088275
1817 Ga0105241_12398992
1818 Ga0105242_10015791
1819 Ga0105242_10124047
1820 Ga0105242_10167510
1821 Ga0105242_10362372
1822 Ga0105242_11207244
1823 Ga0105242_11410247
1824 Ga0105242_12205020
1825 Ga0105248_10035586
1826 Ga0105248_10049924
1827 Ga0105248_10093438
1828 Ga0105248_10099339
1829 Ga0105248_10108660
1830 Ga0105248_10150238
1831 Ga0105248_10870674
1832 Ga0105248_10908532
1833 Ga0105248_11157302
1834 Ga0105248_11527635
1835 Ga0105248_12294734
1836 Ga0105248_12975163
1837 Ga0105248_13241211
1838 Ga0105237_10004306
1839 Ga0105237_10044968
1840 Ga0105237_10239719
1841 Ga0105237_10875924
1842 Ga0105238_10003297
1843 Ga0105238_10424538
1844 Ga0105238_11782439
1845 Ga0105238_12055213
1846 Ga0105249_10037634
1847 Ga0105249_10163791
1848 Ga0105249_10454160
1849 Ga0105249_10658831
1850 Ga0105249_10699259
1851 Ga0105249_11051676
1852 Ga0105239_10299679
1853 Ga0105239_10311137
1854 Ga0105239_10624274
1855 Ga0105239_10697433
1856 Ga0105239_11767867
1857 Ga0105239_11996332
1858 Ga0105246_10092379
1859 Ga0105246_10733277
1860 Ga0105246_12084166
1861 Ga0157373_10007007
1862 Ga0157373_10025983
1863 Ga0157373_10158461
1864 Ga0157373_10703787
1865 Ga0157373_11414465
1866 Ga0157373_11539703
1867 Ga0157370_10131857
1868 Ga0157370_11076845
1869 Ga0157369_10015993
1870 Ga0157374_10814543
1871 Ga0157374_11516292
1872 Ga0157374_11539768
1873 Ga0157374_12011054
1874 Ga0157374_12294404
1875 Ga0157378_10014873
1876 Ga0157378_10017648
1877 Ga0157378_10027967
1878 Ga0157378_10114803
1879 Ga0157378_11048199
1880 Ga0157378_11548651
1881 Ga0157378_12598168
1882 Ga0163162_10003633
1883 Ga0163162_10023107
1884 Ga0163162_10084808
1885 Ga0163162_10301179
1886 Ga0163162_10342554
1887 Ga0163162_10761684
1888 Ga0163162_11220779
1889 Ga0163162_11341869
1890 Ga0163162_11504930
1891 Ga0157372_10005777
1892 Ga0157372_10233437
1893 Ga0157372_10323681
1894 Ga0157372_11291257
1895 Ga0157372_12124919
1896 Ga0157375_10027606
1897 Ga0157375_10060759
1898 Ga0157375_10211232
1899 Ga0157375_10319248
1900 Ga0157375_10436127
1901 Ga0157375_10525025
1902 Ga0157375_11387992
1903 Ga0157375_11412148
1904 Ga0157375_12187160
1905 Ga0157375_12268379
1906 Ga0157375_12429523
1907 Ga0163163_10004578
1908 Ga0163163_10052639
1909 Ga0163163_10084106
1910 Ga0163163_10155317
1911 Ga0163163_10174551
1912 Ga0163163_10191480
1913 Ga0163163_10219593
1914 Ga0163163_10240078
1915 Ga0163163_10328927
1916 Ga0163163_10455081
1917 Ga0163163_10566580
1918 Ga0157380_10000337
1919 Ga0157380_10050546
1920 Ga0157380_10059845
1921 Ga0157380_10409808
1922 Ga0157380_10487582
1923 Ga0157380_10618354
1924 Ga0157380_10827805
1925 Ga0157377_10244401
1926 Ga0157377_10279158
1927 Ga0157377_10310104
1928 Ga0157377_11076652
1929 Ga0157379_10059969
1930 Ga0157379_10347231
1931 Ga0157379_10917919
1932 Ga0157379_12326847
1933 Ga0157376_10097803
1934 Ga0157376_10128112
1935 Ga0157376_10275535
1936 Ga0157376_10495707
1937 Ga0163161_10108568
1938 Ga0163161_10273944
1939 Ga0163161_11364661
1940 Ga0213872_10099986
1941 Ga0207697_10024591
1942 Ga0207656_10006657
1943 Ga0207653_10005402
1944 Ga0207653_10094646
1945 Ga0207653_10102916
1946 Ga0207653_10115088
1947 Ga0207710_10002034
1948 Ga0207710_10103367
1949 Ga0207688_10096385
1950 Ga0207688_10194048
1951 Ga0207680_10021939
1952 Ga0207647_10013511
1953 Ga0207647_10023758
1954 Ga0207647_10091834
1955 Ga0207699_10035963
1956 Ga0207645_10366934
1957 Ga0207643_10032078
1958 Ga0207643_10057020
1959 Ga0207643_10344905
1960 Ga0207643_10405823
1961 Ga0207705_10138161
1962 Ga0207684_10088536
1963 Ga0207684_10134751
1964 Ga0207684_10182117
1965 Ga0207684_10328169
1966 Ga0207684_10462449
1967 Ga0207654_10056055
1968 Ga0207654_10252739
1969 Ga0207654_10274072
1970 Ga0207654_10395116
1971 Ga0207654_10615965
1972 Ga0207654_10660668
1973 Ga0207654_10775836
1974 Ga0207707_10000190
1975 Ga0207707_10019589
1976 Ga0207707_10161872
1977 Ga0207707_10258385
1978 Ga0207707_10501361
1979 Ga0207695_10162096
1980 Ga0207695_10198322
1981 Ga0207671_10000894
1982 Ga0207671_11499212
1983 Ga0207663_10000080
1984 Ga0207660_10000117
1985 Ga0207660_10111327
1986 Ga0207660_10437744
1987 Ga0207660_11064721
1988 Ga0207662_10064702
1989 Ga0207662_10103932
1990 Ga0207662_10266337
1991 Ga0207662_10549920
1992 Ga0207662_10727504
1993 Ga0207657_10823452
1994 Ga0207657_11325935
1995 Ga0207649_11351527
1996 Ga0207652_10000028
1997 Ga0207652_10492142
1998 Ga0207646_10001826
1999 Ga0207646_10204892
2000 Ga0207646_10238694
2001 Ga0207646_10428683
2002 Ga0207646_10922308
2003 Ga0207646_11066098
2004 Ga0207681_10069022
2005 Ga0207681_10449482
2006 Ga0207681_10511846
2007 Ga0207681_10617494
2008 Ga0207681_10955963
2009 Ga0207681_11488424
2010 Ga0207694_10001250
2011 Ga0207694_10269461
2012 Ga0207650_10000009
2013 Ga0207650_10032369
2014 Ga0207650_10260717
2015 Ga0207650_10405764
2016 Ga0207650_10643398
2017 Ga0207650_10892696
2018 Ga0207650_11268245
2019 Ga0207650_11550905
2020 Ga0207659_10066620
2021 Ga0207659_10109868
2022 Ga0207659_10266119
2023 Ga0207659_10700383
2024 Ga0207687_10597166
2025 Ga0207664_10386217
2026 Ga0207664_10800505
2027 Ga0207644_10018151
2028 Ga0207644_10349784
2029 Ga0207690_10090969
2030 Ga0207690_10407380
2031 Ga0207690_10994912
2032 Ga0207690_11469875
2033 Ga0207706_10309362
2034 Ga0207706_10323950
2035 Ga0207706_10647330
2036 Ga0207706_11128341
2037 Ga0207686_10122559
2038 Ga0207686_10249154
2039 Ga0207686_10417003
2040 Ga0207709_10004977
2041 Ga0207709_10006800
2042 Ga0207709_10271713
2043 Ga0207709_11156236
2044 Ga0207709_11232270
2045 Ga0207709_11785659
2046 Ga0207670_10010469
2047 Ga0207670_10204002
2048 Ga0207670_10333018
2049 Ga0207670_10883703
2050 Ga0207670_11948154
2051 Ga0207669_10490372
2052 Ga0207669_10725064
2053 Ga0207669_10881071
2054 Ga0207704_10147764
2055 Ga0207704_10648731
2056 Ga0207704_10813645
2057 Ga0207704_10870124
2058 Ga0207704_11171902
2059 Ga0207665_10048039
2060 Ga0207665_10056712
2061 Ga0207665_10369804
2062 Ga0207665_10479861
2063 Ga0207691_10007812
2064 Ga0207691_10103418
2065 Ga0207691_10421896
2066 Ga0207691_10454060
2067 Ga0207691_10912083
2068 Ga0207711_10022693
2069 Ga0207711_10044349
2070 Ga0207711_10075155
2071 Ga0207711_10099190
2072 Ga0207711_10103321
2073 Ga0207711_10327447
2074 Ga0207711_10557207
2075 Ga0207711_11250004
2076 Ga0207689_10006841
2077 Ga0207689_10051707
2078 Ga0207689_10168758
2079 Ga0207689_10187239
2080 Ga0207689_10215027
2081 Ga0207689_10308364
2082 Ga0207689_10503452
2083 Ga0207689_10602988
2084 Ga0207661_12104860
2085 Ga0207679_10111912
2086 Ga0207679_10115492
2087 Ga0207679_10239242
2088 Ga0207679_10393430
2089 Ga0207679_11028658
2090 Ga0207679_11659381
2091 Ga0207667_10237178
2092 Ga0207667_10845714
2093 Ga0207667_10853300
2094 Ga0207651_10143291
2095 Ga0207651_10232578
2096 Ga0207651_10538629
2097 Ga0207712_10260872
2098 Ga0207712_10955289
2099 Ga0207712_11200078
2100 Ga0207640_10175384
2101 Ga0207640_10314947
2102 Ga0207640_10405098
2103 Ga0207640_10419614
2104 Ga0207640_10478919
2105 Ga0207640_11649541
2106 Ga0207658_10060382
2107 Ga0207658_10606199
2108 Ga0207677_10280571
2109 Ga0207677_10891540
2110 Ga0207677_11461051
2111 Ga0207703_10053627
2112 Ga0207703_10098485
2113 Ga0207703_10110581
2114 Ga0207703_10255679
2115 Ga0207703_10284299
2116 Ga0207703_10412601
2117 Ga0207703_10465333
2118 Ga0207703_10544919
2119 Ga0207703_10668763
2120 Ga0207703_11023707
2121 Ga0207703_11346875
2122 Ga0207703_11352715
2123 Ga0207639_10019268
2124 Ga0207639_10116585
2125 Ga0207639_10331000
2126 Ga0207639_10409020
2127 Ga0207639_10487087
2128 Ga0207639_10540045
2129 Ga0207639_11532820
2130 Ga0207678_10382116
2131 Ga0207708_10013327
2132 Ga0207708_10016142
2133 Ga0207708_10019307
2134 Ga0207708_10170959
2135 Ga0207708_10326294
2136 Ga0207708_10338823
2137 Ga0207702_10061727
2138 Ga0207641_10039757
2139 Ga0207641_10176728
2140 Ga0207641_10256655
2141 Ga0207641_10374392
2142 Ga0207641_10794521
2143 Ga0207641_11097480
2144 Ga0207648_10015715
2145 Ga0207648_10054288
2146 Ga0207648_10238904
2147 Ga0207648_10894496
2148 Ga0207648_11153912
2149 Ga0207648_11203174
2150 Ga0207648_11460838
2151 Ga0207676_10003828
2152 Ga0207676_10013877
2153 Ga0207676_10028017
2154 Ga0207676_10168745
2155 Ga0207676_10227096
2156 Ga0207676_10384601
2157 Ga0207676_10828853
2158 Ga0207676_11310252
2159 Ga0207676_11899933
2160 Ga0207676_12132535
2161 Ga0207676_12425642
2162 Ga0207676_12542069
2163 Ga0207674_10041619
2164 Ga0207674_10048470
2165 Ga0207674_10068065
2166 Ga0207674_10079994
2167 Ga0207674_10098132
2168 Ga0207674_10303764
2169 Ga0207674_10434648
2170 Ga0207674_10908345
2171 Ga0207674_11504251
2172 Ga0207675_100002429
2173 Ga0207675_100007971
2174 Ga0207675_100036053
2175 Ga0207675_100052340
2176 Ga0207675_100067150
2177 Ga0207675_100120399
2178 Ga0207675_100506168
2179 Ga0207675_100634941
2180 Ga0207675_101361573
2181 Ga0207675_101403141
2182 Ga0207683_10044049
2183 Ga0207683_10153677
2184 Ga0207683_10643323
2185 Ga0207683_10910945
2186 Ga0207698_10038495
2187 Ga0207698_10057186
2188 Ga0207698_10313639
2189 Ga0207698_10598242
2190 Ga0207698_10699549
2191 Ga0207698_11421093
2192 Ga0207428_10030722
2193 Ga0207428_10069947
2194 Ga0207428_10091373
2195 Ga0207428_10259595
2196 Ga0268266_10190358
2197 Ga0268265_10054238
2198 Ga0268265_10106366
2199 Ga0268265_10303004
2200 Ga0268265_10429844
2201 Ga0268265_10472998
2202 Ga0268265_10625247
2203 Ga0268265_11156340
2204 Ga0268265_11301539
2205 Ga0268265_12721929
2206 Ga0268264_10014751
2207 Ga0268264_10059468
2208 Ga0268264_10223272
2209 Ga0268264_10235219
2210 Ga0268264_10488861
2211 Ga0268264_10503600
2212 Ga0268264_10634210
2213 Ga0268264_10661887
2214 Ga0268264_10764701
2215 Ga0268264_11019775
2216 Ga0268264_12479667
2217 Ga0314311_1036646
2218 Ga0265340_10239304
2219 Ga0265331_10367724
2220 Ga0307408_100274994
2221 Ga0307408_101043134
2222 Ga0307408_102489185
2223 Ga0265314_10208017
2224 Ga0307405_10809626
2225 Ga0307413_11546305
2226 Ga0307410_10248168
2227 Ga0307407_10537983
2228 Ga0307416_101670612
2229 Ga0307416_101949611
2230 Ga0307416_102855615
2231 Ga0307416_103040854
2232 Ga0307411_11763760
2233 Ga0316583_10303011
2234 Ga0373944_0431579
2235 Ga0373949_0013761
2236 Ga0373951_0001056
2237 Ga0373952_0082505
2238 Ga0373952_0204747
2239 Ga0373941_0017898
2240 Ga0373941_0100224
2241 Ga0373941_0255946
2242 Ga0373954_0316192
2243 Ga0373957_0117921
2244 Ga0373955_0110391
2245 Ga0373955_0839608
2246 Ga0373942_0059558
2247 Ga0373924_0346349
2248 Ga0373931_0051874
2249 Ga0373931_0571167
2250 Ga0373931_0732801
2251 Ga0373933_1117653
2252 Ga0373937_0624948
2253 Ga0373937_0721872
2254 Ga0395900_0042794
2255 Ga0395900_0212470
2256 Ga0395900_1347273
2257 Ga0395898_0162373
2258 Ga0395898_0171057
2259 Ga0395898_0279053
2260 Ga0395898_0467814
2261 Ga0395898_1311127
2262 Ga0395898_1648339
2263 Ga0395905_0088694
2264 Ga0395905_1179823
2265 Ga0395905_1556621
2266 Ga0436364_0394521
2267 Ga0395901_0084143
2268 Ga0395901_0226065
2269 Ga0395901_0276750
2270 Ga0395901_0845363
2271 Ga0395901_1917458
2272 Ga0242422_07548
2273 Ga0242420_008443
2274 Ga0242420_045950
2275 Ga0436365_0592662
2276 Ga0436360_1147962
2277 Ga0436363_1074598
2278 Ga0436362_0731184
2279 Ga0436362_1178460
2280 Ga0451791_0271950
2281 Ga0451839_0004775
2282 Ga0451845_0275633
2283 Ga0439433_0101396
2284 Ga0439448_0059846
2285 Ga0439448_0071378
2286 Ga0439451_083280
2287 Ga0439455_0043550
2288 Ga0439455_0222023
2289 Ga0450914_023954
2290 Ga0439446_0173899
2291 Ga0439446_0229329
2292 Ga0439458_0013440
2293 Ga0451577_0086067
2294 Ga0451577_0092149
2295 Ga0439440_0033176
2296 Ga0453683_0014187
2297 Ga0453683_0031893
2298 Ga0453683_1129375
2299 Ga0466966_0362748
2300 Ga0466963_0263725
2301 Ga0466963_0401483
2302 Ga0453684_0009087
2303 Ga0453684_0191143
2304 Ga0466968_0261712
2305 Ga0466957_0323145
2306 Ga0466957_0411039
2307 Ga0466960_0025115
2308 Ga0451576_0010166
2309 Ga0451576_0137816
2310 Ga0451576_0220673
2311 Ga0451576_1966133
2312 Ga0451576_2008069
2313 Ga0451576_2192811
2314 Ga0451576_2423857
2315 Ga0451576_2440648
2316 Ga0466958_0392240
2317 Ga0466967_0405252
2318 Ga0466967_2168322
2319 Ga0495592_0769933
2320 Ga0495592_0927788
2321 Ga0495603_0192595
2322 Ga0495629_0537005
2323 Ga0495651_0006432
2324 Ga0495653_0731533
2325 Ga0495584_0551794
2326 Ga0495608_0132642
2327 Ga0495630_0432849
2328 Ga0495652_0111393
2329 Ga0495598_0055992
2330 Ga0495621_0092657
2331 Ga0495597_0302174
2332 Ga0495656_0483971
2333 Ga0495635_1011851
2334 Ga0495657_0088825
2335 Ga0495599_0558382
2336 Ga0495623_0148159
2337 Ga0495647_0072109
2338 Ga0495613_0591978
2339 Ga0495674_1227907
2340 Ga0495680_0524926
2341 Ga0495684_0000552
2342 Ga0495684_0367066
2343 Ga0496103_0162645
2344 Ga0496104_0030518
2345 Ga0496104_1541675
2346 Ga0496106_0053387
2347 Ga0496106_0358906
2348 Ga0496106_0365652
2349 Ga0496106_0404936
2350 Ga0496107_0335640
2351 Ga0496107_1131639
2352 Ga0496108_0229739
2353 Ga0496108_0842727
2354 Ga0496108_1079404
2355 Ga0496109_0402064
2356 Ga0496110_0170462
2357 Ga0496110_0518305
2358 Ga0496110_1695334
2359 Ga0496111_0803424
2360 Ga0496112_0234516
2361 Ga0496112_0498819
2362 Ga0496112_0738083
2363 Ga0496112_1121096
2364 Ga0496112_1179079
2365 Ga0496113_0038277
2366 Ga0496113_0471869
2367 Ga0496113_0716453
2368 Ga0496113_0783931
2369 Ga0496113_0994275
2370 Ga0496115_0274203
2371 Ga0501291_036551
2372 Ga0501292_003696
2373 Ga0501292_048580
2374 Ga0501293_018048
2375 Ga0501295_031242
2376 Ga0501297_014073
2377 Ga0501298_001069
2378 Ga0501298_012138
2379 Ga0501299_026071
2380 Ga0501300_091597
2381 Ga0501301_036220
2382 Ga0501033_0605179
2383 Ga0501036_0284479
2384 Ga0501036_0930725
2385 Ga0501038_1342304
2386 Ga0501040_0444725
2387 Ga0501041_0827991
2388 Ga0501042_0139472
2389 Ga0501042_0303697
2390 Ga0501043_0217118
2391 Ga0501046_0286214
2392 Ga0501046_1185179
2393 Ga0501067_0621836
2394 Ga0501069_0998879
2395 Ga0501070_0134440
2396 Ga0501071_0122191
2397 Ga0501072_0775491
2398 Ga0501074_1039519
2399 Ga0501074_1294574
2400 Ga0501075_0078134
2401 Ga0501076_0343517
2402 Ga0501076_0437058
2403 Ga0501077_0604314
2404 Ga0501198_007781
2405 Ga0501198_035120
2406 Ga0501201_011936
2407 Ga0501202_010786
2408 Ga0501216_000310
2409 Ga0501216_003751
2410 Ga0501216_056853
2411 Ga0501216_092422
2412 Ga0501217_012689
2413 Ga0501223_002190
2414 Ga0501223_014720
2415 Ga0501227_021814
2416 Ga0501227_194219
2417 Ga0501233_019893
2418 Ga0501235_005492
2419 Ga0501236_015545
2420 Ga0501243_008856
2421 Ga0501246_032138
2422 Ga0501247_008433
2423 Ga0501247_019847
2424 Ga0501249_002614
2425 Ga0501249_010924
2426 Ga0501253_012188
2427 Ga0501256_037122
2428 Ga0501257_054830
2429 Ga0501258_044808
2430 Ga0501221_007563
2431 Ga0501225_0029786
2432 Ga0501234_032613
2433 Ga0501245_002004
2434 Ga0501079_0522523
2435 Ga0501079_0559960
2436 Ga0501081_0209570
2437 Ga0501081_0493561
2438 Ga0501081_0648121
2439 Ga0501081_1552637
2440 Ga0501267_027634
2441 Ga0501268_007100
2442 Ga0501273_004926
2443 Ga0501279_044556
2444 Ga0501282_012055
2445 Ga0501283_016015
2446 Ga0501283_017973
2447 Ga0501283_021171
2448 Ga0501045_0621958
2449 Ga0501204_005190
2450 nmdc:mga05p37_108420_c1
2451 nmdc:mga05p37_1590774_c1
2452 nmdc:mga05p37_753744_c1
2453 nmdc:mga05p37_794467_c1
2454 nmdc:mga05p37_960394_c1
2455 nmdc:mga09592_621928_c1
2456 nmdc:mga0qj67_287055_c1
2457 nmdc:mga06r32_1196332_c1
2458 nmdc:mga06r32_1600802_c1
2459 nmdc:mga06r32_301603_c1
2460 nmdc:mga08y16_1378084_c1
2461 nmdc:mga08y16_1877511_c1
2462 nmdc:mga08y16_340703_c1
2463 nmdc:mga08y16_406941_c1
2464 nmdc:mga08y16_61917_c1
2465 nmdc:mga0n895_108330_c1
2466 nmdc:mga0n895_1386906_c1
2467 nmdc:mga0n895_1662504_c1
2468 nmdc:mga0n895_172394_c1
2469 nmdc:mga0n895_232858_c1
2470 nmdc:mga0n895_405292_c1
2471 nmdc:mga0n895_440957_c1
2472 nmdc:mga0n895_651977_c1
2473 nmdc:mga0n895_69768_c1
2474 nmdc:mga0n895_72164_c1
2475 nmdc:mga0rr50_106659_c1
2476 nmdc:mga0rr50_612331_c1
2477 nmdc:mga08x19_13846_c1
2478 nmdc:mga08x19_4513_c1
2479 nmdc:mga0a205_168508_c1
2480 nmdc:mga0a205_185363_c1
2481 nmdc:mga0a205_258516_c1
2482 nmdc:mga0a205_29807_c1
2483 nmdc:mga0a205_310384_c1
2484 nmdc:mga0a205_32680_c1
2485 nmdc:mga0a205_47462_c1
2486 nmdc:mga0a205_491664_c1
2487 nmdc:mga0a205_60747_c1
2488 nmdc:mga0a205_740380_c1
2489 Ga0500635_0237704
2490 Ga0500642_0176354
2491 Ga0500645_030122
2492 Ga0500587_056397
2493 Ga0501084_0453292
2494 Ga0501084_1510754
2495 Ga0587085_040814
2496 Ga0587107_006237
2497 Ga0501082_0836480
2498 Ga0501082_1560519
2499 2501940645
2500 2855683750
2501 2856862730
2502 649815493

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8706 3 98
3po0-assembly1.cif.gz_A crystal structure of samp1 from haloferax volcanii 0.8358 3 98
4hro-assembly1.cif.gz_A crystal structure of h. volcanii small archaeal modifier protein 1 0.8289 3 91
1v8c-assembly1.cif.gz_A crystal structure of moad related protein from thermus thermophilus hb8 0.8262 3 93
4n6e-assembly1.cif.gz_B-2 crystal structure of amycolatopsis orientalis bexx/cyso complex 0.812 1 98
ID Description Score Start End Superfamily
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8381 1 98 3.10.20.30
af_Q54NM8_4_86_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8293 1 98 3.10.20.30
4hroA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8289 3 91 3.10.20.30
af_Q6MWY3_4_79_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8201 2 95 3.10.20.30
4n6eB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.812 1 98 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A535NE45-F1-model_v4 MoaD/ThiS family protein 1.001 1 46
AF-A0A1F8SIJ2-F1-model_v4 Molybdopterin synthase sulfur carrier subunit 0.9882 1 94
AF-A0A3N5W3B6-F1-model_v4 MoaD/ThiS family protein 0.9875 1 67
AF-A0A653EFW6-F1-model_v4 ThiS family protein 0.987 2 98
AF-A0A1G0N952-F1-model_v4 MoaD/ThiS family protein 0.9851 2 98

Map