F492158

General Info

Members Datasets Scaffolds Average Seq Length
1247 447 1172 304

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2826581358|2826583469
Length 355
Sequence QAASHGVCIQSVTFVLPPRFARLADLCITMSAWERSSMGDESLEHWTRMEIHNLNDIAAFVSSVNAGSFTAAARQLGLTRSAVGKSIVRLEARLQVRLLNRTTRSLSLTDDGQVLYERCVGILQDLDDVEDALAFRRSTPSGRLRMSLPVALGRLHVLPHIERCLKDWPSLSVDATFSDRLVDLIDEGFDLAMRIGPPKEDSRLLTRTVAYQQMITCASPHYLADHPQPRTPEELSAHECLHFVSGGRLLPWHFRVDGQTIAFTQGGRLQMDSAEALHQSALAGLGITTLPSYVVSHDLRSGKLVRVLTDYAEAAEPIRIIYPSKRHLSPKIRLFIDRLVEAWSPCAPWEEGRDR

Samples

Sample ID Description Type Environment
1 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
2 2506520008 Serratia plymuthica AS12 Isolate Unclassified
3 2511231012 Pseudomonas sp. GM33 Isolate Nodule
4 2511231016 Pseudomonas sp. GM50 Isolate Nodule
5 2511231031 Pseudomonas sp. GM16 Isolate Nodule
6 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
7 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
8 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
9 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
10 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
11 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
12 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
13 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
14 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
15 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
16 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
17 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
18 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
19 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
20 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
21 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
22 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
23 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
24 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
25 2721755523 Delftia sp. HK171 Isolate Unclassified
26 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
27 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
28 2738541277 Variovorax sp. GV051 Isolate Unclassified
29 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
30 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
31 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
32 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
33 2738543019 Variovorax sp. GV040 Isolate Unclassified
34 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
35 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
36 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
37 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
38 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
39 2842711865 Duganella sp. R-73148 Isolate Unclassified
40 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
41 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
42 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
43 2857564685 Duganella sp. R-74599 Isolate Unclassified
44 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
45 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
46 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
47 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
48 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
49 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
50 2884411467 Dyella sp. AD56 Isolate Rhizosphere
51 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
52 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
53 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
54 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
55 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
56 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
57 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
58 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
59 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
60 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
61 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
62 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
63 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
64 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
65 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
66 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
67 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
68 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
69 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
70 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
71 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
72 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
73 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
74 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
75 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
76 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
77 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
78 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
79 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
80 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
81 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
82 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
83 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
84 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
85 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
86 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
90 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
91 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
94 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
95 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
96 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
97 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
98 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
99 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
100 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
101 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
106 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
107 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
137 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
144 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
145 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
147 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
148 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
187 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
188 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
189 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
190 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
194 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
219 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
220 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
221 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
224 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
225 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
226 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
227 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
228 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
229 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
230 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
231 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
232 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
233 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
234 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
235 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
240 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
259 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
260 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
261 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
264 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
265 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
268 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
279 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
280 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
289 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
290 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
291 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
294 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
304 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
308 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
309 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
310 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
315 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
316 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
317 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
324 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
325 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
326 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
327 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
328 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
329 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
330 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
333 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
334 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
335 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
349 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
350 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
351 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
352 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
353 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
354 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
355 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
356 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
357 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
358 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
363 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
364 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
379 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
387 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
391 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
392 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
393 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
394 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
395 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
396 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
397 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
398 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
399 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
403 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
404 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
405 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
406 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
407 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
408 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
409 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
410 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
411 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
412 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
413 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
414 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
415 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
416 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
417 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
418 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
419 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
420 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
421 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
422 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
423 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
424 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
425 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
426 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
427 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
428 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
429 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
430 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
431 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
432 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
433 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
434 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
435 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
436 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
437 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
438 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
439 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
440 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
441 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
442 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
443 8052494512 Pseudomonas putida LD6 Isolate Unclassified
444 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
445 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
446 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
447 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.07
Metatranscriptomes 0.08
Isolates 5.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.59
Nodule 1.28
Rhizoplane 2.97
Rhizosphere 77.63
Stem 0
Stem Tuber 0.24
Unclassified 7.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000018 3300002737 Bacteria 277875
2 JGI25154J39366_1004348 3300002738 Bacteria 2572
3 JGI25157J39369_1000011 3300002741 Bacteria 206831
4 JGI25163J39215_1000291 3300002771 Bacteria 17182
5 JGI25163J39215_1000356 3300002771 Bacteria 15075
6 JGI25164J39214_1000007 3300002772 Bacteria 312507
7 JGI25159J45721_1001228 3300002987 Bacteria 10852
8 JGI25165J46597_1000029 3300003214 Bacteria 312507
9 JGI25160J50197_1000012 3300003354 Bacteria 267582
10 JGI25161J50226_1000002 3300003374 Bacteria 420324
11 Ga0055538_1004140 3300003751 Bacteria 1695
12 Ga0055535_1000025 3300003761 Bacteria 213549
13 Ga0055542_1000024 3300003762 Bacteria 277875
14 Ga0055529_1000029 3300003763 Bacteria 277978
15 Ga0055528_1016309 3300003790 Bacteria 2634
16 Ga0055531_10003550 3300003794 Bacteria 9900
17 Ga0055543_1000011 3300004625 Bacteria 196089
18 Ga0065165_1000082 3300005262 Bacteria 158536
19 Ga0065714_10064760 3300005288 Bacteria 19792
20 Ga0065712_10077642 3300005290 Bacteria 3454
21 Ga0070690_100103454 3300005330 Bacteria 1891
22 Ga0070682_100228997 3300005337 Bacteria 1327
23 Ga0070689_100117556 3300005340 Bacteria 2121
24 Ga0070661_100379302 3300005344 Bacteria 1114
25 Ga0070668_100084023 3300005347 Bacteria 2500
26 Ga0070675_100031205 3300005354 Bacteria 4307
27 Ga0070671_100018199 3300005355 Bacteria 5704
28 Ga0070688_100028589 3300005365 Bacteria 3330
29 Ga0070688_100065460 3300005365 Bacteria 2310
30 Ga0070667_100223403 3300005367 Bacteria 1677
31 Ga0070709_10009407 3300005434 Bacteria 5390
32 Ga0070710_10004334 3300005437 Bacteria 6721
33 Ga0070700_100424362 3300005441 Bacteria 1006
34 Ga0070663_100016874 3300005455 Bacteria 4752
35 Ga0070662_100182756 3300005457 Bacteria 1654
36 Ga0068867_100139259 3300005459 Bacteria 1895
37 Ga0070665_100011917 3300005548 Bacteria 8778
38 Ga0070665_100280375 3300005548 Bacteria 1668
39 Ga0068852_100038301 3300005616 Bacteria 4029
40 Ga0068863_100282199 3300005841 Bacteria 1609
41 Ga0068858_100070117 3300005842 Bacteria 3249
42 Ga0081540_1000043 3300005983 Bacteria 134544
43 Ga0075365_10047528 3300006038 Bacteria 2821
44 Ga0075365_10068132 3300006038 Bacteria 2391
45 Ga0075363_100001349 3300006048 Bacteria 9221
46 Ga0075363_100006511 3300006048 Bacteria 5313
47 Ga0075363_100016115 3300006048 Bacteria 3687
48 Ga0075364_10024837 3300006051 Bacteria 3809
49 Ga0075364_10124761 3300006051 Bacteria 1725
50 Ga0075432_10000157 3300006058 Bacteria 16477
51 Ga0075432_10000876 3300006058 Bacteria 9487
52 Ga0070712_100053815 3300006175 Bacteria 2811
53 Ga0075362_10153921 3300006177 Bacteria 1104
54 Ga0075367_10088648 3300006178 Bacteria 1880
55 Ga0075369_10005705 3300006186 Bacteria 4670
56 Ga0075366_10006105 3300006195 Bacteria 6567
57 Ga0075366_10018681 3300006195 Bacteria 4004
58 Ga0075370_10015831 3300006353 Bacteria 4046
59 Ga0075436_100050337 3300006914 Bacteria 2875
60 Ga0079104_1000007 3300006946 Bacteria 390531
61 Ga0079104_1003211 3300006946 Bacteria 7879
62 Ga0105251_10000032 3300009011 Bacteria 120825
63 Ga0105251_10000903 3300009011 Bacteria 26629
64 Ga0105251_10002880 3300009011 Bacteria 12969
65 Ga0105251_10004915 3300009011 Bacteria 8911
66 Ga0105244_10000090 3300009036 Bacteria 97171
67 Ga0105244_10000276 3300009036 Bacteria 51408
68 Ga0105244_10000940 3300009036 Bacteria 24494
69 Ga0105244_10003907 3300009036 Bacteria 10476
70 Ga0105250_10000214 3300009092 Bacteria 47939
71 Ga0105250_10000368 3300009092 Bacteria 33693
72 Ga0105250_10005492 3300009092 Bacteria 5679
73 Ga0105250_10009734 3300009092 Bacteria 4036
74 Ga0105250_10010134 3300009092 Bacteria 3934
75 Ga0111539_10000100 3300009094 Bacteria 91427
76 Ga0105247_10000103 3300009101 Bacteria 90413
77 Ga0105247_10147196 3300009101 Bacteria 1549
78 Ga0105243_10004187 3300009148 Bacteria 11436
79 Ga0105243_10148104 3300009148 Bacteria 2011
80 Ga0105241_10000004 3300009174 Bacteria 803007
81 Ga0105241_10255513 3300009174 Bacteria 1487
82 Ga0105242_10067761 3300009176 Bacteria 2951
83 Ga0105237_10027652 3300009545 Bacteria 5785
84 Ga0105249_10132161 3300009553 Bacteria 2384
85 Ga0105239_10003423 3300010375 Bacteria 19451
86 Ga0105239_10135662 3300010375 Unclassified 2740
87 Ga0105239_10766145 3300010375 Bacteria 1105
88 Ga0157345_1000001 3300012498 Bacteria 152919
89 Ga0157373_10000060 3300013100 Bacteria 95775
90 Ga0157373_10000514 3300013100 Bacteria 30440
91 Ga0157373_10001204 3300013100 Bacteria 19766
92 Ga0157371_10000040 3300013102 Bacteria 207451
93 Ga0157369_10000236 3300013105 Bacteria 76415
94 Ga0157369_10037511 3300013105 Bacteria 5306
95 Ga0163162_10332393 3300013306 Bacteria 1652
96 Ga0163163_10282202 3300014325 Unclassified 1712
97 Ga0182008_10004419 3300014497 Bacteria 8222
98 Ga0182006_1000018 3300015261 Bacteria 299376
99 Ga0182006_1000389 3300015261 Bacteria 36185
100 Ga0163161_10000001 3300017792 Bacteria 2041488
101 Ga0228598_1014675 3300024227 Unclassified 1549
102 Ga0209760_100834 3300025207 Bacteria 4075
103 Ga0209784_100026 3300025224 Bacteria 371540
104 Ga0209672_107937 3300025228 Bacteria 1604
105 Ga0207427_100023 3300025231 Bacteria 439725
106 Ga0209437_100069 3300025233 Bacteria 307733
107 Ga0209258_100059 3300025242 Bacteria 324934
108 Ga0209646_1000007 3300025246 Bacteria 670994
109 Ga0209646_1000264 3300025246 Bacteria 51141
110 Ga0209026_1000036 3300025250 Bacteria 296607
111 Ga0209026_1008110 3300025250 Bacteria 2242
112 Ga0209026_1013010 3300025250 Bacteria 1428
113 Ga0209148_1000010 3300025254 Bacteria 1265567
114 Ga0209759_1000023 3300025256 Bacteria 321695
115 Ga0209233_1000009 3300025261 Bacteria 1265567
116 Ga0209455_1000020 3300025272 Bacteria 702259
117 Ga0209673_1001979 3300025273 Bacteria 15929
118 Ga0209673_1040712 3300025273 Bacteria 1327
119 Ga0209130_1000028 3300025284 Bacteria 325668
120 Ga0209130_1000167 3300025284 Bacteria 95517
121 Ga0209676_1000020 3300025292 Bacteria 617256
122 Ga0209676_1005080 3300025292 Bacteria 7028
123 Ga0209050_1004213 3300025298 Bacteria 9918
124 Ga0209256_1006816 3300025299 Bacteria 5890
125 Ga0207426_1000012 3300025302 Bacteria 730942
126 Ga0207426_1000370 3300025302 Bacteria 79287
127 Ga0209051_1016107 3300025303 Bacteria 3407
128 Ga0209257_1000395 3300025304 Bacteria 86373
129 Ga0207696_1000001 3300025711 Bacteria 2579611
130 Ga0207696_1010502 3300025711 Bacteria 3389
131 Ga0207696_1012444 3300025711 Bacteria 3008
132 Ga0207655_1000004 3300025728 Bacteria 1021221
133 Ga0207655_1000011 3300025728 Bacteria 643321
134 Ga0207655_1000160 3300025728 Bacteria 123265
135 Ga0207655_1000325 3300025728 Bacteria 70385
136 Ga0207655_1005275 3300025728 Bacteria 8863
137 Ga0207713_1000020 3300025735 Bacteria 359258
138 Ga0207713_1000024 3300025735 Bacteria 339156
139 Ga0207713_1000026 3300025735 Bacteria 319032
140 Ga0207713_1002406 3300025735 Bacteria 13664
141 Ga0207692_10027925 3300025898 Bacteria 2663
142 Ga0207710_10000140 3300025900 Bacteria 83223
143 Ga0207684_10092949 3300025910 Bacteria 2571
144 Ga0207654_10000006 3300025911 Bacteria 815027
145 Ga0207671_10029364 3300025914 Bacteria 4105
146 Ga0207693_10043563 3300025915 Bacteria 3530
147 Ga0207659_10169508 3300025926 Bacteria 1721
148 Ga0207700_10085459 3300025928 Bacteria 2476
149 Ga0207644_10005620 3300025931 Bacteria 8167
150 Ga0207706_10001057 3300025933 Bacteria 28001
151 Ga0207706_10159393 3300025933 Bacteria 1984
152 Ga0207686_10036029 3300025934 Bacteria 2974
153 Ga0207709_10000155 3300025935 Bacteria 93200
154 Ga0207709_10244912 3300025935 Bacteria 1306
155 Ga0207665_10046275 3300025939 Bacteria 2915
156 Ga0207679_10151303 3300025945 Bacteria 1889
157 Ga0207651_10025521 3300025960 Bacteria 3674
158 Ga0207668_10241705 3300025972 Bacteria 1461
159 Ga0207640_10020437 3300025981 Bacteria 3931
160 Ga0207703_10044264 3300026035 Bacteria 3577
161 Ga0207639_10215599 3300026041 Bacteria 1655
162 Ga0207678_10113512 3300026067 Bacteria 2311
163 Ga0207641_10249170 3300026088 Bacteria 1658
164 Ga0209281_1000008 3300027111 Bacteria 867470
165 Ga0209281_1000020 3300027111 Bacteria 575972
166 Ga0207428_10003169 3300027907 Bacteria 16100
167 Ga0207428_10021968 3300027907 Bacteria 5391
168 Ga0207428_10077514 3300027907 Bacteria 2602
169 Ga0268266_10006135 3300028379 Bacteria 11063
170 Ga0307517_10000160 3300028786 Bacteria 108370
171 Ga0307517_10076341 3300028786 Bacteria 2927
172 Ga0307515_10171899 3300028794 Bacteria 2156
173 Ga0307511_10073554 3300030521 Bacteria 2471
174 Ga0307512_10130709 3300030522 Bacteria 1576
175 Ga0316181_1197564 3300030744 Bacteria 9385
176 Ga0316182_1423226 3300030745 Bacteria 2427
177 Ga0265762_1009861 3300030760 Bacteria 1706
178 Ga0307513_10343296 3300031456 Unclassified 1243
179 Ga0307509_10001242 3300031507 Bacteria 43229
180 Ga0307509_10001515 3300031507 Bacteria 39177
181 Ga0307509_10089009 3300031507 Bacteria 3167
182 Ga0307509_10153582 3300031507 Bacteria 2213
183 Ga0307508_10000412 3300031616 Bacteria 50808
184 Ga0307508_10001814 3300031616 Bacteria 23664
185 Ga0307514_10002158 3300031649 Bacteria 21139
186 Ga0307514_10041938 3300031649 Bacteria 3602
187 Ga0307514_10126494 3300031649 Bacteria 1770
188 Ga0307516_10197754 3300031730 Bacteria 1732
189 Ga0307407_10117829 3300031903 Bacteria 1678
190 Ga0307412_10016699 3300031911 Bacteria 4378
191 Ga0307412_10034624 3300031911 Bacteria 3220
192 Ga0307414_10004566 3300032004 Bacteria 7532
193 Ga0307411_10188740 3300032005 Bacteria 1571
194 Ga0307411_10373660 3300032005 Bacteria 1170
195 Ga0307507_10006339 3300033179 Bacteria 18255
196 Ga0307510_10000175 3300033180 Bacteria 54436
197 Ga0307510_10037518 3300033180 Bacteria 5375
198 Ga0307510_10129894 3300033180 Bacteria 2196
199 Ga0373934_0025950 3300035086 Bacteria 2272
200 Ga0373923_0085313 3300035111 Bacteria 1375
201 Ga0373936_0082930 3300035113 Bacteria 1337
202 Ga0373954_0023733 3300035118 Bacteria 2792
203 Ga0373943_0078723 3300035170 Bacteria 1686
204 Ga0373946_0031446 3300035171 Unclassified 2126
205 Ga0373955_0037831 3300035172 Bacteria 2567
206 Ga0373924_0094292 3300035410 Bacteria 1283
207 Ga0373931_0000734 3300035691 Bacteria 13646
208 Ga0373931_0168552 3300035691 Bacteria 1288
209 Ga0373935_0059945 3300035692 Bacteria 2434
210 Ga0373935_0132600 3300035692 Bacteria 1675
211 Ga0373927_0094982 3300035695 Bacteria 1938
212 Ga0373933_0013860 3300035724 Bacteria 4472
213 Ga0373937_0006936 3300036401 Bacteria 9782
214 Ga0373937_0036024 3300036401 Bacteria 4507
215 Ga0373925_0036771 3300037068 Bacteria 3613
216 Ga0373925_0323392 3300037068 Bacteria 1248
217 Ga0373925_0331599 3300037068 Bacteria 1233
218 Ga0395900_0011179 3300037418 Bacteria 9178
219 Ga0395898_0008863 3300037466 Bacteria 10602
220 Ga0395901_0010483 3300038443 Bacteria 9388
221 Ga0439438_000048 3300041405 Bacteria 58674
222 Ga0439438_000153 3300041405 Bacteria 31443
223 Ga0439438_000299 3300041405 Bacteria 22223
224 Ga0439447_000518 3300041407 Bacteria 14295
225 Ga0439447_022348 3300041407 Bacteria 1657
226 Ga0439466_0000208 3300041411 Bacteria 23209
227 Ga0439466_0000978 3300041411 Bacteria 11001
228 Ga0439431_0007455 3300041997 Bacteria 2440
229 Ga0439432_000003 3300042006 Bacteria 117054
230 Ga0439432_016652 3300042006 Bacteria 2472
231 Ga0439451_001113 3300042009 Bacteria 5255
232 Ga0439452_000043 3300042010 Bacteria 132609
233 Ga0439452_000151 3300042010 Bacteria 51160
234 Ga0439452_000253 3300042010 Bacteria 36669
235 Ga0439456_004693 3300042013 Bacteria 2762
236 Ga0450911_000009 3300042115 Bacteria 162968
237 Ga0450919_000024 3300042121 Bacteria 12284
238 Ga0450900_010331 3300042136 Bacteria 1195
239 Ga0450902_000142 3300042137 Bacteria 7962
240 Ga0450903_001619 3300042138 Bacteria 4189
241 Ga0450906_000005 3300042145 Bacteria 44636
242 Ga0450918_000043 3300042531 Bacteria 25951
243 Ga0466972_0001328 3300044658 Bacteria 11974
244 Ga0466965_0013876 3300044683 Bacteria 3807
245 Ga0466966_0050900 3300044684 Bacteria 2634
246 Ga0466957_0121751 3300044842 Bacteria 1664
247 Ga0466960_0058399 3300044901 Bacteria 1884
248 Ga0495617_000159 3300046452 Bacteria 42981
249 Ga0495617_000211 3300046452 Bacteria 35959
250 Ga0495617_000788 3300046452 Bacteria 15320
251 Ga0495617_001579 3300046452 Bacteria 9838
252 Ga0495617_002191 3300046452 Bacteria 7993
253 Ga0495617_003500 3300046452 Bacteria 5885
254 Ga0495617_015679 3300046452 Bacteria 2565
255 Ga0495617_017191 3300046452 Bacteria 2442
256 Ga0495617_061681 3300046452 Bacteria 1239
257 Ga0495627_000010 3300046453 Bacteria 381168
258 Ga0495627_000014 3300046453 Bacteria 326114
259 Ga0495627_000028 3300046453 Bacteria 234737
260 Ga0495627_000031 3300046453 Bacteria 226981
261 Ga0495627_000275 3300046453 Bacteria 51976
262 Ga0495627_001102 3300046453 Bacteria 17605
263 Ga0495627_001126 3300046453 Bacteria 17343
264 Ga0495627_001189 3300046453 Bacteria 16462
265 Ga0495627_005339 3300046453 Bacteria 5197
266 Ga0495627_008278 3300046453 Bacteria 3913
267 Ga0495627_027145 3300046453 Bacteria 1839
268 Ga0495627_045849 3300046453 Bacteria 1330
269 Ga0495592_0000175 3300046454 Bacteria 56416
270 Ga0495592_0000273 3300046454 Bacteria 44143
271 Ga0495592_0003004 3300046454 Bacteria 12003
272 Ga0495592_0007097 3300046454 Bacteria 8383
273 Ga0495592_0056376 3300046454 Unclassified 2904
274 Ga0495603_0000214 3300046455 Bacteria 29899
275 Ga0495603_0015555 3300046455 Bacteria 4604
276 Ga0495603_0126935 3300046455 Bacteria 1486
277 Ga0495590_0000002 3300046457 Bacteria 485720
278 Ga0495590_0000170 3300046457 Bacteria 38656
279 Ga0495590_0000563 3300046457 Bacteria 17589
280 Ga0495590_0000995 3300046457 Bacteria 12494
281 Ga0495590_0001002 3300046457 Bacteria 12462
282 Ga0495590_0019914 3300046457 Bacteria 2387
283 Ga0495590_0046173 3300046457 Bacteria 1519
284 Ga0495591_000002 3300046458 Bacteria 455013
285 Ga0495591_000076 3300046458 Bacteria 111124
286 Ga0495591_000123 3300046458 Bacteria 84832
287 Ga0495591_000281 3300046458 Bacteria 47502
288 Ga0495591_000348 3300046458 Bacteria 40857
289 Ga0495591_000381 3300046458 Bacteria 37690
290 Ga0495591_000730 3300046458 Bacteria 23791
291 Ga0495591_000801 3300046458 Bacteria 22293
292 Ga0495591_001013 3300046458 Bacteria 19005
293 Ga0495591_001795 3300046458 Bacteria 12718
294 Ga0495591_002334 3300046458 Bacteria 10691
295 Ga0495591_003089 3300046458 Bacteria 8819
296 Ga0495591_004237 3300046458 Bacteria 7109
297 Ga0495629_0013668 3300046459 Bacteria 5857
298 Ga0495629_0017431 3300046459 Bacteria 5146
299 Ga0495629_0058578 3300046459 Bacteria 2693
300 Ga0495629_0075923 3300046459 Bacteria 2347
301 Ga0495629_0296270 3300046459 Bacteria 1108
302 Ga0495638_0000022 3300046460 Bacteria 364765
303 Ga0495638_0000810 3300046460 Bacteria 33008
304 Ga0495638_0001488 3300046460 Bacteria 21180
305 Ga0495638_0003402 3300046460 Bacteria 12541
306 Ga0495638_0019816 3300046460 Bacteria 4447
307 Ga0495638_0026418 3300046460 Bacteria 3761
308 Ga0495638_0026645 3300046460 Bacteria 3745
309 Ga0495638_0028333 3300046460 Bacteria 3617
310 Ga0495638_0034109 3300046460 Bacteria 3251
311 Ga0495638_0065581 3300046460 Bacteria 2234
312 Ga0495651_0000198 3300046462 Bacteria 45766
313 Ga0495651_0224030 3300046462 Bacteria 1299
314 Ga0495651_0283165 3300046462 Bacteria 1119
315 Ga0495653_0000115 3300046463 Bacteria 65946
316 Ga0495653_0000535 3300046463 Bacteria 29056
317 Ga0495653_0008057 3300046463 Bacteria 8630
318 Ga0495653_0009488 3300046463 Bacteria 7966
319 Ga0495653_0010992 3300046463 Bacteria 7407
320 Ga0495653_0013367 3300046463 Bacteria 6690
321 Ga0495653_0041391 3300046463 Bacteria 3596
322 Ga0495653_0069281 3300046463 Bacteria 2643
323 Ga0495650_0000031 3300046471 Bacteria 433811
324 Ga0495650_0000101 3300046471 Bacteria 212903
325 Ga0495650_0000180 3300046471 Bacteria 137884
326 Ga0495650_0000400 3300046471 Bacteria 72310
327 Ga0495650_0004706 3300046471 Bacteria 9204
328 Ga0495650_0005373 3300046471 Bacteria 8340
329 Ga0495650_0005612 3300046471 Bacteria 8079
330 Ga0495650_0008078 3300046471 Bacteria 6208
331 Ga0495650_0008100 3300046471 Bacteria 6191
332 Ga0495650_0020960 3300046471 Bacteria 3173
333 Ga0495580_0114811 3300046472 Bacteria 1870
334 Ga0495582_0047361 3300046473 Bacteria 2368
335 Ga0495582_0053049 3300046473 Bacteria 2236
336 Ga0495605_0000001 3300046474 Bacteria 614538
337 Ga0495605_0000011 3300046474 Bacteria 314856
338 Ga0495605_0000219 3300046474 Bacteria 70638
339 Ga0495605_0000272 3300046474 Bacteria 58560
340 Ga0495605_0000324 3300046474 Bacteria 49042
341 Ga0495605_0001557 3300046474 Bacteria 14892
342 Ga0495605_0003358 3300046474 Bacteria 9569
343 Ga0495605_0006230 3300046474 Bacteria 6877
344 Ga0495605_0010299 3300046474 Bacteria 5233
345 Ga0495605_0019013 3300046474 Bacteria 3677
346 Ga0495605_0025760 3300046474 Bacteria 3062
347 Ga0495605_0035146 3300046474 Bacteria 2534
348 Ga0495605_0049555 3300046474 Bacteria 2051
349 Ga0495605_0091738 3300046474 Bacteria 1406
350 Ga0495605_0117260 3300046474 Bacteria 1210
351 Ga0495605_0126166 3300046474 Bacteria 1157
352 Ga0495639_0035495 3300046475 Bacteria 2231
353 Ga0495639_0095270 3300046475 Bacteria 1400
354 Ga0495662_0146261 3300046476 Unclassified 1164
355 Ga0495664_0007012 3300046477 Bacteria 6241
356 Ga0495664_0157392 3300046477 Unclassified 1378
357 Ga0495584_0000393 3300046491 Bacteria 30132
358 Ga0495584_0000412 3300046491 Bacteria 29433
359 Ga0495584_0000921 3300046491 Bacteria 18719
360 Ga0495584_0000997 3300046491 Bacteria 17749
361 Ga0495584_0001596 3300046491 Bacteria 13383
362 Ga0495584_0002131 3300046491 Bacteria 11327
363 Ga0495584_0002729 3300046491 Bacteria 9889
364 Ga0495584_0006322 3300046491 Bacteria 6207
365 Ga0495584_0049904 3300046491 Bacteria 2108
366 Ga0495584_0084168 3300046491 Bacteria 1601
367 Ga0495584_0102687 3300046491 Bacteria 1445
368 Ga0495584_0174495 3300046491 Bacteria 1092
369 Ga0495585_0000533 3300046492 Bacteria 35989
370 Ga0495585_0000890 3300046492 Bacteria 25302
371 Ga0495585_0001048 3300046492 Bacteria 22876
372 Ga0495585_0005963 3300046492 Bacteria 7624
373 Ga0495585_0025532 3300046492 Bacteria 3382
374 Ga0495585_0029087 3300046492 Bacteria 3147
375 Ga0495594_0000218 3300046499 Bacteria 27958
376 Ga0495594_0005625 3300046499 Bacteria 6441
377 Ga0495594_0101135 3300046499 Bacteria 1622
378 Ga0495596_0000028 3300046500 Bacteria 103710
379 Ga0495596_0000102 3300046500 Bacteria 60788
380 Ga0495596_0002599 3300046500 Bacteria 9598
381 Ga0495596_0013544 3300046500 Bacteria 3455
382 Ga0495596_0016021 3300046500 Bacteria 3120
383 Ga0495596_0038296 3300046500 Bacteria 1895
384 Ga0495596_0038297 3300046500 Bacteria 1895
385 Ga0495607_0000025 3300046501 Bacteria 159379
386 Ga0495607_0000073 3300046501 Bacteria 100053
387 Ga0495607_0000075 3300046501 Bacteria 99503
388 Ga0495607_0000297 3300046501 Bacteria 52112
389 Ga0495607_0000373 3300046501 Bacteria 46200
390 Ga0495607_0001544 3300046501 Bacteria 20153
391 Ga0495607_0001985 3300046501 Bacteria 17221
392 Ga0495607_0002127 3300046501 Bacteria 16532
393 Ga0495607_0002143 3300046501 Bacteria 16463
394 Ga0495607_0002617 3300046501 Bacteria 14466
395 Ga0495607_0002662 3300046501 Bacteria 14308
396 Ga0495607_0016210 3300046501 Bacteria 4812
397 Ga0495607_0016252 3300046501 Bacteria 4805
398 Ga0495607_0024310 3300046501 Bacteria 3779
399 Ga0495607_0028386 3300046501 Bacteria 3453
400 Ga0495607_0042724 3300046501 Bacteria 2685
401 Ga0495583_0000032 3300046506 Bacteria 247728
402 Ga0495583_0000118 3300046506 Bacteria 133498
403 Ga0495583_0000167 3300046506 Bacteria 111792
404 Ga0495583_0000347 3300046506 Bacteria 73058
405 Ga0495583_0000611 3300046506 Bacteria 48395
406 Ga0495583_0000659 3300046506 Bacteria 45243
407 Ga0495583_0001972 3300046506 Bacteria 18844
408 Ga0495583_0004219 3300046506 Bacteria 10455
409 Ga0495583_0004799 3300046506 Bacteria 9481
410 Ga0495583_0012763 3300046506 Bacteria 4730
411 Ga0495583_0073505 3300046506 Bacteria 1498
412 Ga0495606_0000023 3300046507 Bacteria 265019
413 Ga0495606_0000440 3300046507 Bacteria 68395
414 Ga0495606_0000656 3300046507 Bacteria 54383
415 Ga0495606_0000816 3300046507 Bacteria 47367
416 Ga0495606_0001711 3300046507 Bacteria 28286
417 Ga0495606_0007864 3300046507 Bacteria 9411
418 Ga0495606_0009405 3300046507 Bacteria 8274
419 Ga0495606_0018109 3300046507 Bacteria 5295
420 Ga0495606_0030223 3300046507 Bacteria 3788
421 Ga0495606_0035426 3300046507 Bacteria 3411
422 Ga0495606_0055180 3300046507 Bacteria 2570
423 Ga0495606_0087254 3300046507 Bacteria 1926
424 Ga0495606_0100873 3300046507 Bacteria 1757
425 Ga0495606_0199644 3300046507 Bacteria 1141
426 Ga0495608_0001490 3300046511 Bacteria 16661
427 Ga0495608_0037276 3300046511 Bacteria 3269
428 Ga0495610_0000043 3300046512 Bacteria 158045
429 Ga0495610_0000287 3300046512 Bacteria 52829
430 Ga0495610_0000374 3300046512 Bacteria 46330
431 Ga0495610_0001041 3300046512 Bacteria 25468
432 Ga0495610_0001419 3300046512 Bacteria 21194
433 Ga0495610_0008218 3300046512 Bacteria 6797
434 Ga0495610_0009552 3300046512 Bacteria 6117
435 Ga0495610_0018038 3300046512 Bacteria 4000
436 Ga0495610_0027669 3300046512 Bacteria 3009
437 Ga0495610_0037514 3300046512 Bacteria 2466
438 Ga0495610_0047795 3300046512 Bacteria 2103
439 Ga0495610_0071559 3300046512 Bacteria 1616
440 Ga0495610_0085718 3300046512 Bacteria 1436
441 Ga0495610_0092265 3300046512 Bacteria 1370
442 Ga0495616_0000121 3300046513 Bacteria 68406
443 Ga0495616_0000225 3300046513 Bacteria 46536
444 Ga0495616_0000294 3300046513 Bacteria 40512
445 Ga0495616_0000612 3300046513 Bacteria 26894
446 Ga0495616_0001687 3300046513 Bacteria 15057
447 Ga0495616_0003512 3300046513 Bacteria 10024
448 Ga0495616_0021534 3300046513 Bacteria 3489
449 Ga0495616_0021561 3300046513 Bacteria 3486
450 Ga0495616_0023676 3300046513 Bacteria 3301
451 Ga0495616_0064168 3300046513 Bacteria 1792
452 Ga0495616_0080848 3300046513 Bacteria 1555
453 Ga0495618_0059745 3300046514 Bacteria 2416
454 Ga0495620_0000134 3300046515 Bacteria 60718
455 Ga0495620_0000203 3300046515 Bacteria 44714
456 Ga0495620_0005103 3300046515 Bacteria 7352
457 Ga0495620_0005736 3300046515 Bacteria 6904
458 Ga0495620_0006318 3300046515 Bacteria 6521
459 Ga0495620_0006719 3300046515 Bacteria 6296
460 Ga0495620_0013424 3300046515 Bacteria 4193
461 Ga0495620_0083752 3300046515 Bacteria 1287
462 Ga0495628_0004076 3300046516 Bacteria 12996
463 Ga0495628_0310261 3300046516 Bacteria 1166
464 Ga0495630_0011094 3300046517 Bacteria 6518
465 Ga0495630_0015730 3300046517 Bacteria 5528
466 Ga0495630_0141618 3300046517 Bacteria 1829
467 Ga0495630_0185366 3300046517 Bacteria 1587
468 Ga0495630_0232668 3300046517 Unclassified 1408
469 Ga0495630_0319723 3300046517 Bacteria 1186
470 Ga0495631_0000010 3300046518 Bacteria 115280
471 Ga0495631_0000117 3300046518 Bacteria 52920
472 Ga0495631_0000411 3300046518 Bacteria 29557
473 Ga0495631_0000614 3300046518 Bacteria 23481
474 Ga0495631_0000857 3300046518 Bacteria 19184
475 Ga0495631_0001521 3300046518 Bacteria 13974
476 Ga0495631_0008476 3300046518 Bacteria 5181
477 Ga0495631_0011038 3300046518 Bacteria 4458
478 Ga0495631_0026272 3300046518 Bacteria 2675
479 Ga0495631_0036161 3300046518 Bacteria 2206
480 Ga0495631_0059034 3300046518 Bacteria 1667
481 Ga0495631_0092704 3300046518 Bacteria 1300
482 Ga0495632_0000031 3300046519 Bacteria 166613
483 Ga0495632_0000053 3300046519 Bacteria 131977
484 Ga0495632_0000111 3300046519 Bacteria 83663
485 Ga0495632_0000244 3300046519 Bacteria 53886
486 Ga0495632_0000361 3300046519 Bacteria 43155
487 Ga0495632_0000600 3300046519 Bacteria 33355
488 Ga0495632_0001229 3300046519 Bacteria 21737
489 Ga0495632_0001440 3300046519 Bacteria 19816
490 Ga0495632_0001562 3300046519 Bacteria 18904
491 Ga0495632_0001720 3300046519 Bacteria 17793
492 Ga0495632_0002091 3300046519 Bacteria 15620
493 Ga0495632_0004518 3300046519 Bacteria 9432
494 Ga0495632_0012163 3300046519 Bacteria 4975
495 Ga0495632_0025616 3300046519 Bacteria 3117
496 Ga0495632_0037443 3300046519 Bacteria 2461
497 Ga0495632_0054381 3300046519 Bacteria 1962
498 Ga0495637_0000017 3300046520 Bacteria 209676
499 Ga0495637_0000081 3300046520 Bacteria 74206
500 Ga0495637_0000276 3300046520 Bacteria 40415
501 Ga0495637_0000473 3300046520 Bacteria 29387
502 Ga0495637_0000544 3300046520 Bacteria 27089
503 Ga0495637_0000888 3300046520 Bacteria 19276
504 Ga0495637_0000940 3300046520 Bacteria 18597
505 Ga0495637_0001719 3300046520 Bacteria 12588
506 Ga0495637_0016549 3300046520 Bacteria 3445
507 Ga0495637_0040714 3300046520 Bacteria 1998
508 Ga0495637_0050398 3300046520 Bacteria 1746
509 Ga0495643_0000019 3300046522 Bacteria 303627
510 Ga0495643_0000061 3300046522 Bacteria 185933
511 Ga0495643_0000604 3300046522 Bacteria 43306
512 Ga0495643_0001499 3300046522 Bacteria 21151
513 Ga0495643_0001821 3300046522 Bacteria 18154
514 Ga0495643_0002156 3300046522 Bacteria 16156
515 Ga0495643_0003132 3300046522 Bacteria 12337
516 Ga0495643_0003293 3300046522 Bacteria 11932
517 Ga0495643_0009337 3300046522 Bacteria 6102
518 Ga0495643_0010234 3300046522 Bacteria 5776
519 Ga0495643_0014233 3300046522 Bacteria 4737
520 Ga0495644_0000171 3300046523 Bacteria 30549
521 Ga0495644_0000370 3300046523 Bacteria 20385
522 Ga0495644_0000448 3300046523 Bacteria 18156
523 Ga0495644_0001129 3300046523 Bacteria 10962
524 Ga0495644_0001799 3300046523 Bacteria 8651
525 Ga0495644_0004982 3300046523 Bacteria 5202
526 Ga0495644_0009390 3300046523 Bacteria 3772
527 Ga0495644_0012036 3300046523 Bacteria 3324
528 Ga0495644_0012531 3300046523 Bacteria 3260
529 Ga0495644_0050185 3300046523 Bacteria 1566
530 Ga0495648_0000051 3300046524 Bacteria 162502
531 Ga0495648_0000352 3300046524 Bacteria 50673
532 Ga0495648_0000768 3300046524 Bacteria 34207
533 Ga0495648_0001031 3300046524 Bacteria 28330
534 Ga0495648_0002051 3300046524 Bacteria 19107
535 Ga0495648_0002378 3300046524 Bacteria 17468
536 Ga0495648_0014129 3300046524 Bacteria 5863
537 Ga0495648_0018494 3300046524 Bacteria 4929
538 Ga0495648_0020870 3300046524 Bacteria 4555
539 Ga0495648_0023882 3300046524 Bacteria 4176
540 Ga0495648_0028096 3300046524 Bacteria 3751
541 Ga0495648_0038813 3300046524 Bacteria 3039
542 Ga0495648_0063603 3300046524 Bacteria 2177
543 Ga0495648_0068854 3300046524 Bacteria 2062
544 Ga0495648_0077946 3300046524 Bacteria 1897
545 Ga0495648_0135743 3300046524 Bacteria 1301
546 Ga0495648_0142184 3300046524 Bacteria 1261
547 Ga0495663_0000012 3300046525 Bacteria 157546
548 Ga0495663_0000295 3300046525 Bacteria 18906
549 Ga0495666_0000035 3300046526 Bacteria 51902
550 Ga0495666_0000081 3300046526 Bacteria 38083
551 Ga0495666_0000362 3300046526 Bacteria 20010
552 Ga0495666_0004401 3300046526 Bacteria 7121
553 Ga0495666_0192814 3300046526 Bacteria 938
554 Ga0495642_0000026 3300046528 Bacteria 90898
555 Ga0495642_0081395 3300046528 Bacteria 1364
556 Ga0495642_0136002 3300046528 Bacteria 1060
557 Ga0495652_0005898 3300046529 Bacteria 11458
558 Ga0495652_0016055 3300046529 Bacteria 6700
559 Ga0495652_0017341 3300046529 Bacteria 6427
560 Ga0495652_0175079 3300046529 Unclassified 1652
561 Ga0495654_0000075 3300046530 Bacteria 113720
562 Ga0495654_0000079 3300046530 Bacteria 109816
563 Ga0495654_0000158 3300046530 Bacteria 67310
564 Ga0495654_0000363 3300046530 Bacteria 39238
565 Ga0495654_0000526 3300046530 Bacteria 31131
566 Ga0495654_0000633 3300046530 Bacteria 27741
567 Ga0495654_0000647 3300046530 Bacteria 27473
568 Ga0495654_0001513 3300046530 Bacteria 15863
569 Ga0495654_0001688 3300046530 Bacteria 14862
570 Ga0495654_0001696 3300046530 Bacteria 14805
571 Ga0495654_0002226 3300046530 Bacteria 12568
572 Ga0495654_0002365 3300046530 Bacteria 12186
573 Ga0495654_0003208 3300046530 Bacteria 10124
574 Ga0495654_0003467 3300046530 Bacteria 9640
575 Ga0495654_0007143 3300046530 Bacteria 6272
576 Ga0495654_0008915 3300046530 Bacteria 5512
577 Ga0495654_0009750 3300046530 Bacteria 5254
578 Ga0495654_0010020 3300046530 Bacteria 5176
579 Ga0495654_0015216 3300046530 Bacteria 4088
580 Ga0495654_0016716 3300046530 Bacteria 3869
581 Ga0495654_0016900 3300046530 Bacteria 3842
582 Ga0495654_0034320 3300046530 Bacteria 2560
583 Ga0495654_0050602 3300046530 Bacteria 2029
584 Ga0495654_0097260 3300046530 Bacteria 1359
585 Ga0495654_0141935 3300046530 Bacteria 1069
586 Ga0495665_0074006 3300046531 Bacteria 1794
587 Ga0495640_0020078 3300046533 Bacteria 4924
588 Ga0495586_0057059 3300046535 Bacteria 2118
589 Ga0495587_0000054 3300046536 Bacteria 97507
590 Ga0495587_0001240 3300046536 Bacteria 16941
591 Ga0495587_0002236 3300046536 Bacteria 12939
592 Ga0495587_0002729 3300046536 Bacteria 11776
593 Ga0495587_0008965 3300046536 Bacteria 6419
594 Ga0495587_0029535 3300046536 Bacteria 3328
595 Ga0495587_0167315 3300046536 Bacteria 1249
596 Ga0495609_0000013 3300046538 Bacteria 328540
597 Ga0495609_0000014 3300046538 Bacteria 326023
598 Ga0495609_0000195 3300046538 Bacteria 60608
599 Ga0495609_0000217 3300046538 Bacteria 57243
600 Ga0495609_0000270 3300046538 Bacteria 48509
601 Ga0495609_0000484 3300046538 Bacteria 31896
602 Ga0495609_0000648 3300046538 Bacteria 27101
603 Ga0495609_0001255 3300046538 Bacteria 17434
604 Ga0495609_0002443 3300046538 Bacteria 11419
605 Ga0495609_0003377 3300046538 Bacteria 9178
606 Ga0495609_0005713 3300046538 Bacteria 6477
607 Ga0495609_0005856 3300046538 Bacteria 6374
608 Ga0495609_0153853 3300046538 Bacteria 977
609 Ga0495597_0000011 3300046542 Bacteria 221377
610 Ga0495597_0000117 3300046542 Bacteria 71911
611 Ga0495597_0001224 3300046542 Bacteria 19111
612 Ga0495597_0002828 3300046542 Bacteria 10636
613 Ga0495597_0003020 3300046542 Bacteria 10148
614 Ga0495597_0006608 3300046542 Bacteria 5980
615 Ga0495597_0016449 3300046542 Bacteria 3491
616 Ga0495597_0017793 3300046542 Bacteria 3340
617 Ga0495597_0029680 3300046542 Bacteria 2496
618 Ga0495645_0007748 3300046543 Bacteria 7470
619 Ga0495645_0047951 3300046543 Bacteria 3112
620 Ga0495645_0093895 3300046543 Bacteria 2140
621 Ga0495645_0237644 3300046543 Unclassified 1217
622 Ga0495622_0000046 3300046557 Bacteria 110625
623 Ga0495622_0000066 3300046557 Bacteria 92491
624 Ga0495622_0016428 3300046557 Bacteria 3446
625 Ga0495622_0023575 3300046557 Bacteria 2870
626 Ga0495622_0099995 3300046557 Bacteria 1329
627 Ga0495633_0000010 3300046558 Bacteria 280844
628 Ga0495633_0000417 3300046558 Bacteria 44120
629 Ga0495633_0000556 3300046558 Bacteria 36606
630 Ga0495633_0002122 3300046558 Bacteria 14231
631 Ga0495633_0009251 3300046558 Bacteria 5459
632 Ga0495633_0096792 3300046558 Bacteria 1371
633 Ga0495667_0005015 3300046559 Bacteria 8945
634 Ga0495667_0103164 3300046559 Bacteria 1845
635 Ga0495656_0000432 3300046615 Bacteria 13633
636 Ga0495656_0017592 3300046615 Bacteria 2730
637 Ga0495656_0021951 3300046615 Bacteria 2493
638 Ga0495656_0226012 3300046615 Bacteria 937
639 Ga0495668_0000497 3300046616 Bacteria 49049
640 Ga0495668_0001733 3300046616 Bacteria 20060
641 Ga0495668_0009395 3300046616 Bacteria 6011
642 Ga0495668_0010954 3300046616 Bacteria 5459
643 Ga0495668_0011156 3300046616 Bacteria 5397
644 Ga0495668_0023709 3300046616 Bacteria 3496
645 Ga0495668_0024529 3300046616 Bacteria 3429
646 Ga0495668_0051004 3300046616 Bacteria 2291
647 Ga0495668_0067183 3300046616 Bacteria 1972
648 Ga0495668_0119674 3300046616 Bacteria 1440
649 Ga0495634_0000169 3300046642 Bacteria 60237
650 Ga0495611_0000019 3300046648 Bacteria 126076
651 Ga0495611_0000427 3300046648 Bacteria 26104
652 Ga0495611_0000541 3300046648 Bacteria 22183
653 Ga0495611_0001962 3300046648 Bacteria 9767
654 Ga0495611_0003806 3300046648 Bacteria 6581
655 Ga0495611_0009589 3300046648 Bacteria 4090
656 Ga0495611_0010267 3300046648 Bacteria 3961
657 Ga0495611_0010691 3300046648 Bacteria 3886
658 Ga0495611_0012377 3300046648 Bacteria 3627
659 Ga0495625_0000016 3300046660 Bacteria 311353
660 Ga0495625_0001103 3300046660 Bacteria 35026
661 Ga0495625_0003500 3300046660 Bacteria 15564
662 Ga0495625_0004052 3300046660 Bacteria 14003
663 Ga0495625_0005973 3300046660 Bacteria 10944
664 Ga0495625_0007051 3300046660 Bacteria 9878
665 Ga0495625_0009003 3300046660 Bacteria 8431
666 Ga0495625_0011590 3300046660 Bacteria 7174
667 Ga0495625_0012737 3300046660 Bacteria 6801
668 Ga0495625_0012739 3300046660 Bacteria 6801
669 Ga0495625_0036190 3300046660 Bacteria 3630
670 Ga0495625_0048382 3300046660 Bacteria 3062
671 Ga0495625_0055524 3300046660 Bacteria 2824
672 Ga0495625_0056526 3300046660 Bacteria 2793
673 Ga0495625_0083311 3300046660 Bacteria 2223
674 Ga0495625_0159078 3300046660 Bacteria 1514
675 Ga0495625_0189121 3300046660 Bacteria 1365
676 Ga0495625_0195995 3300046660 Bacteria 1335
677 Ga0495625_0240979 3300046660 Bacteria 1177
678 Ga0495625_0250824 3300046660 Bacteria 1149
679 Ga0495635_0000033 3300046663 Bacteria 104638
680 Ga0495635_0000035 3300046663 Bacteria 96395
681 Ga0495635_0001797 3300046663 Bacteria 14500
682 Ga0495635_0004930 3300046663 Bacteria 9292
683 Ga0495635_0066839 3300046663 Bacteria 2466
684 Ga0495635_0107120 3300046663 Bacteria 1909
685 Ga0495635_0132915 3300046663 Bacteria 1696
686 Ga0495659_0004235 3300046664 Bacteria 4523
687 Ga0495659_0074835 3300046664 Bacteria 1274
688 Ga0495661_0000001 3300046665 Bacteria 898372
689 Ga0495661_0000005 3300046665 Bacteria 433622
690 Ga0495661_0000179 3300046665 Bacteria 72942
691 Ga0495661_0000276 3300046665 Bacteria 59027
692 Ga0495661_0000968 3300046665 Bacteria 26067
693 Ga0495661_0001594 3300046665 Bacteria 18676
694 Ga0495661_0004062 3300046665 Bacteria 10660
695 Ga0495661_0009808 3300046665 Bacteria 6551
696 Ga0495661_0010442 3300046665 Bacteria 6335
697 Ga0495661_0010610 3300046665 Bacteria 6282
698 Ga0495661_0025122 3300046665 Bacteria 3852
699 Ga0495661_0039990 3300046665 Bacteria 2911
700 Ga0495661_0065506 3300046665 Bacteria 2140
701 Ga0495661_0099321 3300046665 Bacteria 1641
702 Ga0495661_0140842 3300046665 Bacteria 1312
703 Ga0495661_0154760 3300046665 Bacteria 1235
704 Ga0495588_0001682 3300046674 Bacteria 9422
705 Ga0495588_0013228 3300046674 Bacteria 3926
706 Ga0495588_0015016 3300046674 Bacteria 3719
707 Ga0495588_0016992 3300046674 Bacteria 3525
708 Ga0495657_0045836 3300046675 Bacteria 2964
709 Ga0495657_0167043 3300046675 Unclassified 1358
710 Ga0495599_0002388 3300046678 Bacteria 10922
711 Ga0495599_0171601 3300046678 Unclassified 1338
712 Ga0495623_0000234 3300046679 Bacteria 35834
713 Ga0495623_0000327 3300046679 Bacteria 31117
714 Ga0495623_0000870 3300046679 Bacteria 20478
715 Ga0495623_0001077 3300046679 Bacteria 18487
716 Ga0495623_0045323 3300046679 Bacteria 2793
717 Ga0495623_0103580 3300046679 Bacteria 1731
718 Ga0495646_0000147 3300046680 Bacteria 35451
719 Ga0495646_0000606 3300046680 Bacteria 19524
720 Ga0495646_0025189 3300046680 Bacteria 3743
721 Ga0495647_0040328 3300046681 Bacteria 1774
722 Ga0495658_0002679 3300046683 Bacteria 8967
723 Ga0495658_0066815 3300046683 Bacteria 2078
724 Ga0495658_0150072 3300046683 Bacteria 1431
725 Ga0495658_0251632 3300046683 Bacteria 1111
726 Ga0495658_0263672 3300046683 Unclassified 1085
727 Ga0495669_0000063 3300046684 Bacteria 70678
728 Ga0495669_0000693 3300046684 Bacteria 14717
729 Ga0495669_0000729 3300046684 Bacteria 14292
730 Ga0495613_0001661 3300046689 Bacteria 16925
731 Ga0495613_0004700 3300046689 Bacteria 10246
732 Ga0495613_0227503 3300046689 Bacteria 1307
733 Ga0495613_0258958 3300046689 Bacteria 1212
734 Ga0495613_0297756 3300046689 Bacteria 1117
735 Ga0495624_0000014 3300046690 Bacteria 111102
736 Ga0495624_0050773 3300046690 Bacteria 2626
737 Ga0495624_0054400 3300046690 Bacteria 2524
738 Ga0495624_0087798 3300046690 Bacteria 1920
739 Ga0495670_0000018 3300046691 Bacteria 115019
740 Ga0495670_0000021 3300046691 Bacteria 104769
741 Ga0495670_0000023 3300046691 Bacteria 92374
742 Ga0495670_0000046 3300046691 Bacteria 65784
743 Ga0495670_0000206 3300046691 Bacteria 26640
744 Ga0495670_0000494 3300046691 Bacteria 18684
745 Ga0495670_0008269 3300046691 Bacteria 5116
746 Ga0495670_0018939 3300046691 Bacteria 3391
747 Ga0495670_0020320 3300046691 Bacteria 3273
748 Ga0495670_0052118 3300046691 Bacteria 2048
749 Ga0495670_0056822 3300046691 Bacteria 1964
750 Ga0495670_0063555 3300046691 Bacteria 1858
751 Ga0495671_0000004 3300046692 Bacteria 545630
752 Ga0495671_0000036 3300046692 Bacteria 181192
753 Ga0495671_0000153 3300046692 Bacteria 60065
754 Ga0495671_0000584 3300046692 Bacteria 27018
755 Ga0495671_0001075 3300046692 Bacteria 18899
756 Ga0495671_0001525 3300046692 Bacteria 15437
757 Ga0495671_0001930 3300046692 Bacteria 13310
758 Ga0495671_0002435 3300046692 Bacteria 11753
759 Ga0495671_0002646 3300046692 Bacteria 11254
760 Ga0495671_0003136 3300046692 Bacteria 10275
761 Ga0495671_0004538 3300046692 Bacteria 8278
762 Ga0495671_0007712 3300046692 Bacteria 6106
763 Ga0495671_0008577 3300046692 Bacteria 5740
764 Ga0495671_0010032 3300046692 Bacteria 5267
765 Ga0495671_0011928 3300046692 Bacteria 4761
766 Ga0495671_0015465 3300046692 Bacteria 4087
767 Ga0495671_0046210 3300046692 Bacteria 2177
768 Ga0495671_0051798 3300046692 Bacteria 2041
769 Ga0495671_0086905 3300046692 Bacteria 1531
770 Ga0495649_0000079 3300046694 Bacteria 83486
771 Ga0495649_0001029 3300046694 Bacteria 21891
772 Ga0495649_0001191 3300046694 Bacteria 20094
773 Ga0495649_0003496 3300046694 Bacteria 10580
774 Ga0495649_0004389 3300046694 Bacteria 9226
775 Ga0495649_0006464 3300046694 Bacteria 7297
776 Ga0495649_0006652 3300046694 Bacteria 7180
777 Ga0495649_0009298 3300046694 Bacteria 5850
778 Ga0495649_0021834 3300046694 Bacteria 3585
779 Ga0495649_0024937 3300046694 Bacteria 3331
780 Ga0495649_0034071 3300046694 Bacteria 2802
781 Ga0495649_0052884 3300046694 Bacteria 2200
782 Ga0495649_0054965 3300046694 Bacteria 2152
783 Ga0495649_0109709 3300046694 Bacteria 1463
784 Ga0495589_0000255 3300046794 Bacteria 43527
785 Ga0495589_0000426 3300046794 Bacteria 31295
786 Ga0495589_0000440 3300046794 Bacteria 30537
787 Ga0495589_0000681 3300046794 Bacteria 22193
788 Ga0495589_0000793 3300046794 Bacteria 20055
789 Ga0495589_0002588 3300046794 Bacteria 10058
790 Ga0495589_0005707 3300046794 Bacteria 6562
791 Ga0495589_0018452 3300046794 Bacteria 3575
792 Ga0495589_0056357 3300046794 Bacteria 1934
793 Ga0495589_0067029 3300046794 Bacteria 1757
794 Ga0495589_0076132 3300046794 Bacteria 1636
795 Ga0495600_0000247 3300046809 Bacteria 29526
796 Ga0495600_0001037 3300046809 Bacteria 15031
797 Ga0495600_0002203 3300046809 Bacteria 11084
798 Ga0495600_0007621 3300046809 Bacteria 6631
799 Ga0495600_0049234 3300046809 Bacteria 2749
800 Ga0495600_0060783 3300046809 Bacteria 2467
801 Ga0495600_0077558 3300046809 Bacteria 2170
802 Ga0495660_0000136 3300046810 Bacteria 79750
803 Ga0495660_0000179 3300046810 Bacteria 68653
804 Ga0495660_0000234 3300046810 Bacteria 54439
805 Ga0495660_0000296 3300046810 Bacteria 45599
806 Ga0495660_0000712 3300046810 Bacteria 25502
807 Ga0495660_0001110 3300046810 Bacteria 19219
808 Ga0495660_0003729 3300046810 Bacteria 9354
809 Ga0495660_0005404 3300046810 Bacteria 7647
810 Ga0495660_0005837 3300046810 Bacteria 7344
811 Ga0495660_0007010 3300046810 Bacteria 6644
812 Ga0495660_0010394 3300046810 Bacteria 5414
813 Ga0495660_0013083 3300046810 Bacteria 4809
814 Ga0495660_0018300 3300046810 Bacteria 4027
815 Ga0495660_0019585 3300046810 Bacteria 3884
816 Ga0495660_0022226 3300046810 Bacteria 3624
817 Ga0495660_0025755 3300046810 Bacteria 3338
818 Ga0495660_0026183 3300046810 Bacteria 3307
819 Ga0495660_0050465 3300046810 Bacteria 2266
820 Ga0495660_0055678 3300046810 Bacteria 2140
821 Ga0495660_0077358 3300046810 Bacteria 1751
822 Ga0495660_0087131 3300046810 Bacteria 1629
823 Ga0495660_0113262 3300046810 Bacteria 1381
824 Ga0495581_0013183 3300047315 Bacteria 4793
825 Ga0495581_0046517 3300047315 Bacteria 2508
826 Ga0495604_0000094 3300047317 Bacteria 76004
827 Ga0495604_0000962 3300047317 Bacteria 24017
828 Ga0495604_0002503 3300047317 Bacteria 14670
829 Ga0495604_0005789 3300047317 Bacteria 9808
830 Ga0495604_0012001 3300047317 Bacteria 6888
831 Ga0495604_0070511 3300047317 Unclassified 2646
832 Ga0495636_0000230 3300047318 Bacteria 21998
833 Ga0495636_0000265 3300047318 Bacteria 20711
834 Ga0495636_0015933 3300047318 Bacteria 2997
835 Ga0495674_0000058 3300047319 Bacteria 73405
836 Ga0495674_0009382 3300047319 Bacteria 9302
837 Ga0495674_0014689 3300047319 Bacteria 7327
838 Ga0495672_0000001 3300047320 Bacteria 1458820
839 Ga0495672_0000457 3300047320 Bacteria 48226
840 Ga0495672_0000488 3300047320 Bacteria 46246
841 Ga0495672_0000524 3300047320 Bacteria 43828
842 Ga0495672_0000890 3300047320 Bacteria 31373
843 Ga0495672_0000934 3300047320 Bacteria 30487
844 Ga0495672_0001131 3300047320 Bacteria 27027
845 Ga0495672_0002149 3300047320 Bacteria 18430
846 Ga0495672_0002362 3300047320 Bacteria 17434
847 Ga0495672_0002796 3300047320 Bacteria 15568
848 Ga0495672_0013800 3300047320 Bacteria 5557
849 Ga0495672_0015679 3300047320 Bacteria 5134
850 Ga0495672_0023179 3300047320 Bacteria 4023
851 Ga0495672_0026688 3300047320 Bacteria 3681
852 Ga0495672_0145624 3300047320 Bacteria 1233
853 Ga0495676_0000001 3300047321 Bacteria 624167
854 Ga0495676_0000041 3300047321 Bacteria 104634
855 Ga0495676_0000398 3300047321 Bacteria 35184
856 Ga0495676_0000540 3300047321 Bacteria 31009
857 Ga0495676_0001108 3300047321 Bacteria 22842
858 Ga0495680_0000133 3300047322 Bacteria 74109
859 Ga0495680_0000356 3300047322 Bacteria 51144
860 Ga0495680_0001339 3300047322 Bacteria 26787
861 Ga0495680_0002095 3300047322 Bacteria 20727
862 Ga0495680_0006951 3300047322 Bacteria 10443
863 Ga0495680_0028675 3300047322 Bacteria 4562
864 Ga0495680_0074689 3300047322 Bacteria 2574
865 Ga0495680_0087806 3300047322 Unclassified 2338
866 Ga0495683_0000031 3300047323 Bacteria 150363
867 Ga0495683_0000456 3300047323 Bacteria 32056
868 Ga0495683_0000858 3300047323 Bacteria 21507
869 Ga0495683_0001753 3300047323 Bacteria 13707
870 Ga0495683_0003150 3300047323 Bacteria 9643
871 Ga0495683_0005382 3300047323 Bacteria 7105
872 Ga0495683_0007210 3300047323 Bacteria 6034
873 Ga0495683_0007871 3300047323 Bacteria 5717
874 Ga0495683_0042423 3300047323 Bacteria 2293
875 Ga0495683_0087296 3300047323 Bacteria 1515
876 Ga0495687_000465 3300047443 Bacteria 49398
877 Ga0495687_000754 3300047443 Bacteria 35024
878 Ga0495687_033804 3300047443 Bacteria 2315
879 Ga0495687_051693 3300047443 Bacteria 1742
880 Ga0495675_0000257 3300047444 Bacteria 38480
881 Ga0495675_0006026 3300047444 Bacteria 7416
882 Ga0495675_0014750 3300047444 Bacteria 4939
883 Ga0495675_0029894 3300047444 Bacteria 3475
884 Ga0495675_0032070 3300047444 Bacteria 3354
885 Ga0495675_0081532 3300047444 Bacteria 2037
886 Ga0495677_0000313 3300047445 Bacteria 21106
887 Ga0495677_0011997 3300047445 Bacteria 3162
888 Ga0495679_000021 3300047446 Bacteria 226183
889 Ga0495679_000053 3300047446 Bacteria 119015
890 Ga0495679_000064 3300047446 Bacteria 102509
891 Ga0495679_000239 3300047446 Bacteria 45720
892 Ga0495679_000278 3300047446 Bacteria 42823
893 Ga0495679_001352 3300047446 Bacteria 14147
894 Ga0495679_001732 3300047446 Bacteria 12037
895 Ga0495679_004592 3300047446 Bacteria 6306
896 Ga0495679_022082 3300047446 Bacteria 2184
897 Ga0495685_029084 3300047447 Bacteria 1901
898 Ga0495673_0000021 3300047469 Bacteria 545523
899 Ga0495673_0000077 3300047469 Bacteria 204403
900 Ga0495673_0000477 3300047469 Bacteria 43268
901 Ga0495673_0000582 3300047469 Bacteria 36759
902 Ga0495673_0000935 3300047469 Bacteria 26484
903 Ga0495673_0001240 3300047469 Bacteria 21134
904 Ga0495673_0001421 3300047469 Bacteria 19171
905 Ga0495673_0004841 3300047469 Bacteria 8322
906 Ga0495673_0004916 3300047469 Bacteria 8231
907 Ga0495673_0005464 3300047469 Bacteria 7674
908 Ga0495673_0006512 3300047469 Bacteria 6853
909 Ga0495673_0010700 3300047469 Bacteria 4971
910 Ga0495673_0012298 3300047469 Bacteria 4549
911 Ga0495673_0016160 3300047469 Bacteria 3823
912 Ga0495673_0017423 3300047469 Bacteria 3649
913 Ga0495673_0018604 3300047469 Bacteria 3498
914 Ga0495673_0019391 3300047469 Bacteria 3407
915 Ga0495673_0027213 3300047469 Bacteria 2724
916 Ga0495673_0043617 3300047469 Bacteria 2005
917 Ga0495673_0044010 3300047469 Bacteria 1993
918 Ga0495673_0044043 3300047469 Bacteria 1992
919 Ga0495681_0000025 3300047470 Bacteria 148216
920 Ga0495681_0000034 3300047470 Bacteria 125396
921 Ga0495681_0000068 3300047470 Bacteria 96387
922 Ga0495681_0000116 3300047470 Bacteria 69786
923 Ga0495681_0000487 3300047470 Bacteria 30516
924 Ga0495681_0001505 3300047470 Bacteria 17403
925 Ga0495681_0001768 3300047470 Bacteria 15910
926 Ga0495681_0004747 3300047470 Bacteria 9207
927 Ga0495681_0009022 3300047470 Bacteria 6187
928 Ga0495681_0014844 3300047470 Bacteria 4443
929 Ga0495681_0021085 3300047470 Bacteria 3519
930 Ga0495681_0031742 3300047470 Bacteria 2668
931 Ga0495681_0040211 3300047470 Bacteria 2278
932 Ga0495681_0053335 3300047470 Bacteria 1893
933 Ga0495681_0089409 3300047470 Bacteria 1362
934 Ga0495681_0112234 3300047470 Unclassified 1179
935 Ga0495684_0008353 3300047471 Bacteria 8022
936 Ga0495684_0037198 3300047471 Bacteria 3733
937 Ga0495684_0039619 3300047471 Bacteria 3612
938 Ga0495684_0325875 3300047471 Bacteria 1097
939 Ga0495686_0000266 3300047472 Bacteria 93781
940 Ga0495686_0002509 3300047472 Bacteria 17201
941 Ga0495686_0005899 3300047472 Bacteria 9545
942 Ga0495686_0009654 3300047472 Bacteria 6930
943 Ga0495686_0010155 3300047472 Bacteria 6716
944 Ga0495686_0015509 3300047472 Bacteria 5197
945 Ga0495686_0105569 3300047472 Unclassified 1694
946 Ga0495686_0114992 3300047472 Bacteria 1609
947 Ga0495593_0000045 3300047673 Bacteria 50149
948 Ga0495593_0000083 3300047673 Bacteria 41204
949 Ga0495593_0000225 3300047673 Bacteria 30189
950 Ga0495593_0000515 3300047673 Bacteria 21874
951 Ga0495593_0007215 3300047673 Bacteria 6514
952 Ga0495593_0021345 3300047673 Bacteria 3618
953 Ga0495593_0022457 3300047673 Bacteria 3515
954 Ga0495602_0000129 3300048088 Bacteria 71215
955 Ga0495602_0001440 3300048088 Bacteria 23620
956 Ga0495602_0008217 3300048088 Bacteria 10900
957 Ga0495614_0000849 3300048089 Bacteria 12915
958 Ga0495614_0002788 3300048089 Bacteria 7771
959 Ga0495614_0008966 3300048089 Bacteria 4438
960 Ga0495626_0000002 3300048091 Bacteria 436012
961 Ga0495626_0000119 3300048091 Bacteria 102920
962 Ga0495626_0000185 3300048091 Bacteria 75817
963 Ga0495626_0000199 3300048091 Bacteria 72605
964 Ga0495626_0000560 3300048091 Bacteria 36880
965 Ga0495626_0000576 3300048091 Bacteria 36334
966 Ga0495626_0000816 3300048091 Bacteria 28047
967 Ga0495626_0001103 3300048091 Bacteria 22816
968 Ga0495626_0008149 3300048091 Bacteria 5774
969 Ga0496100_0047204 3300048903 Bacteria 2773
970 Ga0496101_0036232 3300048904 Bacteria 3493
971 Ga0496101_0039396 3300048904 Bacteria 3361
972 Ga0496102_0015763 3300048905 Bacteria 6586
973 Ga0496102_0273682 3300048905 Bacteria 1592
974 Ga0496103_0011177 3300048906 Bacteria 5316
975 Ga0496104_0006298 3300048907 Bacteria 10435
976 Ga0496104_0018029 3300048907 Bacteria 6436
977 Ga0496104_0039111 3300048907 Bacteria 4440
978 Ga0496104_0354089 3300048907 Bacteria 1381
979 Ga0496105_0003948 3300048908 Bacteria 11091
980 Ga0496105_0042127 3300048908 Bacteria 3763
981 Ga0496105_0074081 3300048908 Bacteria 2812
982 Ga0496105_0409891 3300048908 Bacteria 1075
983 Ga0496106_0009702 3300048909 Bacteria 7108
984 Ga0496107_0005072 3300048910 Bacteria 8974
985 Ga0496108_0009867 3300048911 Bacteria 7739
986 Ga0496109_0010294 3300048912 Bacteria 7986
987 Ga0496109_0170451 3300048912 Bacteria 2042
988 Ga0496109_0214783 3300048912 Bacteria 1809
989 Ga0496110_0306200 3300048913 Bacteria 1447
990 Ga0496111_0012959 3300048914 Bacteria 5659
991 Ga0496111_0242549 3300048914 Bacteria 1338
992 Ga0496112_0003139 3300048915 Bacteria 13559
993 Ga0496112_0046612 3300048915 Bacteria 4252
994 Ga0496112_0195315 3300048915 Bacteria 1984
995 Ga0496113_0001253 3300048916 Bacteria 13987
996 Ga0496113_0001673 3300048916 Bacteria 12543
997 Ga0496113_0276356 3300048916 Bacteria 1343
998 Ga0496114_0006457 3300048917 Bacteria 9237
999 Ga0496114_0137391 3300048917 Bacteria 2114
1000 Ga0496115_0006763 3300048918 Bacteria 8409
1001 Ga0496116_0000023 3300048919 Bacteria 475792
1002 Ga0496116_0001088 3300048919 Bacteria 32732
1003 Ga0496116_0001333 3300048919 Bacteria 28080
1004 Ga0496116_0018260 3300048919 Bacteria 5414
1005 Ga0496116_0041236 3300048919 Bacteria 3169
1006 Ga0496117_0007269 3300048920 Bacteria 10882
1007 Ga0496117_0012592 3300048920 Bacteria 7441
1008 Ga0496117_0082931 3300048920 Bacteria 2098
1009 Ga0496118_0008039 3300048921 Bacteria 11016
1010 Ga0496118_0021662 3300048921 Bacteria 5649
1011 Ga0496119_0010330 3300048922 Bacteria 7863
1012 Ga0496119_0022158 3300048922 Bacteria 4560
1013 Ga0496119_0067202 3300048922 Bacteria 2115
1014 Ga0496119_0069871 3300048922 Bacteria 2062
1015 Ga0496119_0110165 3300048922 Bacteria 1530
1016 Ga0496119_0122543 3300048922 Bacteria 1427
1017 Ga0496120_0012122 3300048923 Bacteria 5883
1018 Ga0496120_0024033 3300048923 Bacteria 3807
1019 Ga0496121_0003493 3300048924 Bacteria 22347
1020 Ga0496121_0010855 3300048924 Bacteria 10186
1021 Ga0496121_0020868 3300048924 Bacteria 6453
1022 Ga0496121_0051603 3300048924 Bacteria 3462
1023 Ga0496122_0027984 3300048925 Bacteria 4801
1024 Ga0496122_0103251 3300048925 Bacteria 1898
1025 Ga0496124_0000035 3300048927 Bacteria 318099
1026 Ga0496124_0003534 3300048927 Bacteria 19018
1027 Ga0496124_0004953 3300048927 Bacteria 15266
1028 Ga0496124_0008347 3300048927 Bacteria 10846
1029 Ga0496124_0182342 3300048927 Bacteria 1614
1030 Ga0496124_0359585 3300048927 Bacteria 1026
1031 Ga0496125_0006069 3300048928 Bacteria 13195
1032 Ga0496126_0174982 3300048929 Bacteria 1826
1033 Ga0496126_0237692 3300048929 Bacteria 1524
1034 Ga0495678_000008 3300049459 Bacteria 445926
1035 Ga0495678_000375 3300049459 Bacteria 45295
1036 Ga0495678_000614 3300049459 Bacteria 33355
1037 Ga0495678_000883 3300049459 Bacteria 26673
1038 Ga0495678_001676 3300049459 Bacteria 16826
1039 Ga0495678_002125 3300049459 Bacteria 14072
1040 Ga0495678_002873 3300049459 Bacteria 11122
1041 Ga0495678_002914 3300049459 Bacteria 10987
1042 Ga0495678_003236 3300049459 Bacteria 10212
1043 Ga0495678_003291 3300049459 Bacteria 10093
1044 Ga0495678_004576 3300049459 Bacteria 7958
1045 Ga0495678_004759 3300049459 Bacteria 7737
1046 Ga0495678_007172 3300049459 Bacteria 5815
1047 Ga0495678_009864 3300049459 Bacteria 4684
1048 Ga0495678_027115 3300049459 Bacteria 2434
1049 Ga0495678_042967 3300049459 Bacteria 1798
1050 Ga0495678_056054 3300049459 Bacteria 1500
1051 Ga0495682_0000001 3300049460 Bacteria 1559116
1052 Ga0495682_0000075 3300049460 Bacteria 91041
1053 Ga0495682_0000474 3300049460 Bacteria 27668
1054 Ga0495682_0000486 3300049460 Bacteria 27407
1055 Ga0495682_0001748 3300049460 Bacteria 11005
1056 Ga0495682_0021523 3300049460 Bacteria 2415
1057 Ga0495682_0028537 3300049460 Bacteria 2067
1058 Ga0495682_0043075 3300049460 Bacteria 1653
1059 Ga0501032_0002532 3300049569 Bacteria 14305
1060 Ga0501033_0031438 3300049570 Bacteria 3989
1061 Ga0501034_0029887 3300049571 Bacteria 5538
1062 Ga0501036_0060749 3300049572 Bacteria 3201
1063 Ga0501037_0048810 3300049573 Bacteria 3100
1064 Ga0501038_0000593 3300049574 Bacteria 32116
1065 Ga0501039_0017811 3300049575 Bacteria 5449
1066 Ga0501043_0013887 3300049579 Bacteria 6301
1067 Ga0501046_0116003 3300049580 Bacteria 2041
1068 Ga0501047_0287674 3300049581 Bacteria 1487
1069 Ga0501048_0071387 3300049582 Bacteria 2451
1070 Ga0501067_0005973 3300049583 Bacteria 6751
1071 Ga0501069_0000497 3300049585 Bacteria 17891
1072 Ga0501070_0067612 3300049586 Bacteria 2959
1073 Ga0501073_0027391 3300049589 Bacteria 4075
1074 Ga0501074_0026304 3300049590 Bacteria 4218
1075 Ga0501079_0169186 3300049741 Bacteria 1704
1076 Ga0501080_0028056 3300049742 Bacteria 5234
1077 Ga0501083_0008696 3300049744 Bacteria 7161
1078 Ga0501035_0048034 3300049822 Bacteria 3828
1079 Ga0501044_0026146 3300049823 Bacteria 6181
1080 Ga0501045_0039347 3300049824 Bacteria 3441
1081 nmdc:mga03683_45675_c1 3300050489 Bacteria 1813
1082 nmdc:mga03n38_79_c1 3300050490 Bacteria 20629
1083 nmdc:mga00v17_17584_c1 3300050491 Bacteria 4051
1084 nmdc:mga00v17_19289_c1 3300050491 Bacteria 3891
1085 nmdc:mga0yw44_35393_c1 3300050492 Bacteria 2934
1086 nmdc:mga0yw44_64950_c1 3300050492 Bacteria 2247
1087 nmdc:mga0k408_104169_c1 3300050493 Bacteria 1674
1088 nmdc:mga0k408_31413_c1 3300050493 Bacteria 3032
1089 nmdc:mga04h51_40289_c1 3300050495 Bacteria 1521
1090 nmdc:mga07m45_1185_c2 3300050496 Bacteria 9863
1091 nmdc:mga08y16_62_c1 3300050511 Bacteria 89583
1092 nmdc:mga08x19_155549_c1 3300050514 Bacteria 1550
1093 nmdc:mga0sz30_1741_c1 3300050516 Bacteria 7730
1094 Ga0495601_0012779 3300053077 Bacteria 5039
1095 Ga0495601_0108452 3300053077 Bacteria 1796
1096 Ga0495612_0000635 3300053078 Bacteria 14101
1097 Ga0500610_0000022 3300053079 Bacteria 60344
1098 Ga0500610_0000110 3300053079 Bacteria 24846
1099 Ga0500610_0000175 3300053079 Bacteria 19266
1100 Ga0500635_0000025 3300053080 Bacteria 105726
1101 Ga0495595_0000382 3300053084 Bacteria 16787
1102 Ga0495595_0049634 3300053084 Unclassified 1941
1103 Ga0495619_0001282 3300053085 Bacteria 16496
1104 Ga0500643_001003 3300053087 Bacteria 17273
1105 Ga0500644_0009415 3300053088 Bacteria 2611
1106 Ga0500644_0034853 3300053088 Bacteria 1627
1107 Ga0500583_0069013 3300053092 Bacteria 1687
1108 Ga0500651_0000242 3300053093 Bacteria 33458
1109 Ga0500566_0032375 3300053094 Bacteria 3049
1110 Ga0500562_003301 3300053108 Bacteria 4031
1111 Ga0500562_023006 3300053108 Bacteria 1625
1112 Ga0500569_037970 3300053109 Unclassified 1395
1113 Ga0500571_000014 3300053110 Bacteria 67097
1114 Ga0500571_000184 3300053110 Bacteria 22472
1115 Ga0500572_000005 3300053111 Bacteria 84950
1116 Ga0500572_013347 3300053111 Bacteria 2031
1117 Ga0500572_015071 3300053111 Bacteria 1943
1118 Ga0500593_000045 3300053117 Bacteria 43688
1119 Ga0500593_000097 3300053117 Bacteria 32867
1120 Ga0500594_0000881 3300053118 Bacteria 6426
1121 Ga0500594_0002082 3300053118 Bacteria 4326
1122 Ga0500595_002438 3300053119 Bacteria 9234
1123 Ga0500607_000049 3300053121 Bacteria 80941
1124 Ga0500607_056366 3300053121 Bacteria 2075
1125 Ga0500607_160573 3300053121 Bacteria 1028
1126 Ga0500608_068719 3300053122 Bacteria 1686
1127 Ga0500618_000126 3300053125 Bacteria 63007
1128 Ga0500618_000386 3300053125 Bacteria 30359
1129 Ga0500618_009996 3300053125 Bacteria 2564
1130 Ga0500618_012765 3300053125 Bacteria 2191
1131 Ga0500621_005111 3300053126 Bacteria 4017
1132 Ga0500626_020844 3300053128 Bacteria 2917
1133 Ga0500655_000268 3300053133 Bacteria 12145
1134 Ga0500658_0000018 3300053134 Bacteria 141217
1135 Ga0500658_0000028 3300053134 Bacteria 105688
1136 Ga0500659_0000385 3300053135 Bacteria 28387
1137 Ga0500559_0006998 3300053136 Bacteria 5040
1138 Ga0500559_0053877 3300053136 Bacteria 1782
1139 Ga0500564_013350 3300053138 Bacteria 3675
1140 Ga0500573_0005327 3300053140 Bacteria 6885
1141 Ga0500573_0012395 3300053140 Bacteria 4786
1142 Ga0500574_000473 3300053141 Bacteria 5104
1143 Ga0500574_000490 3300053141 Bacteria 5061
1144 Ga0500574_025612 3300053141 Bacteria 1539
1145 Ga0500577_0086946 3300053142 Bacteria 1257
1146 Ga0500586_000041 3300053145 Bacteria 22595
1147 Ga0500586_000073 3300053145 Bacteria 17289
1148 Ga0500586_011561 3300053145 Bacteria 2534
1149 Ga0500586_014951 3300053145 Bacteria 2323
1150 Ga0500616_0005154 3300053153 Bacteria 8973
1151 Ga0500616_0006575 3300053153 Bacteria 7580
1152 Ga0500616_0044142 3300053153 Bacteria 2379
1153 Ga0500619_000294 3300053154 Bacteria 9961
1154 Ga0500619_052177 3300053154 Bacteria 1326
1155 Ga0500622_0016447 3300053156 Bacteria 3952
1156 Ga0500622_0044755 3300053156 Bacteria 2294
1157 Ga0500622_0061221 3300053156 Unclassified 1919
1158 Ga0500624_006576 3300053157 Bacteria 1577
1159 Ga0500627_0000960 3300053158 Bacteria 7802
1160 Ga0500627_0001238 3300053158 Bacteria 7044
1161 Ga0500634_0016997 3300053161 Bacteria 3890
1162 Ga0500634_0020065 3300053161 Bacteria 3609
1163 Ga0500634_0035569 3300053161 Unclassified 2713
1164 Ga0500634_0073846 3300053161 Bacteria 1777
1165 Ga0500638_000705 3300053162 Bacteria 8924
1166 Ga0500636_0004955 3300053177 Bacteria 7560
1167 Ga0500636_0031746 3300053177 Bacteria 3125
1168 Ga0500565_000232 3300053734 Bacteria 2793
1169 Ga0500596_003145 3300053735 Bacteria 3172
1170 Ga0500587_001560 3300053739 Bacteria 3262
1171 Ga0501084_0024652 3300054114 Bacteria 5020
1172 Ga0501082_0024951 3300060353 Bacteria 5150

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2511231035 2511433550 245
2 3300047470 Ga0495681_0040211 Ga0495681_0040211_1489_2253 254
3 3300046660 Ga0495625_0048382 Ga0495625_0048382_25_819 258
4 3300046615 Ga0495656_0226012 Ga0495656_0226012_18_809 263
5 3300046507 Ga0495606_0199644 Ga0495606_0199644_302_1102 265
6 3300046474 Ga0495605_0117260 Ga0495605_0117260_359_1165 267
7 3300048929 Ga0496126_0174982 Ga0496126_0174982_986_1792 267
8 3300002987 JGI25159J45721_1001228 JGI25159J45721_100122810 274
9 3300003354 JGI25160J50197_1000012 JGI25160J50197_1000012200 274
10 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002352 274
11 3300004625 Ga0055543_1000011 Ga0055543_1000011105 274
12 3300005262 Ga0065165_1000082 Ga0065165_100008269 274
13 3300005437 Ga0070710_10004334 Ga0070710_100043343 274
14 3300048924 Ga0496121_0020868 Ga0496121_0020868_3393_4304 279
15 3300046474 Ga0495605_0025760 Ga0495605_0025760_194_1129 283
16 3300046513 Ga0495616_0080848 Ga0495616_0080848_235_1170 283
17 3300046524 Ga0495648_0068854 Ga0495648_0068854_580_1515 283
18 3300046794 Ga0495589_0067029 Ga0495589_0067029_641_1576 283
19 3300047319 Ga0495674_0014689 Ga0495674_0014689_1685_2620 283
20 3300047320 Ga0495672_0026688 Ga0495672_0026688_1661_2596 283
21 3300047323 Ga0495683_0042423 Ga0495683_0042423_497_1432 283
22 3300047443 Ga0495687_033804 Ga0495687_033804_801_1736 283
23 3300047469 Ga0495673_0017423 Ga0495673_0017423_1382_2317 283
24 3300048903 Ga0496100_0047204 Ga0496100_0047204_631_1566 283
25 3300048904 Ga0496101_0036232 Ga0496101_0036232_1351_2286 283
26 3300048907 Ga0496104_0018029 Ga0496104_0018029_1571_2506 283
27 3300048908 Ga0496105_0074081 Ga0496105_0074081_862_1797 283
28 3300048915 Ga0496112_0046612 Ga0496112_0046612_1697_2632 283
29 3300048916 Ga0496113_0001673 Ga0496113_0001673_9976_10911 283
30 3300048922 Ga0496119_0122543 Ga0496119_0122543_389_1324 283
31 3300048924 Ga0496121_0003493 Ga0496121_0003493_1733_2668 283
32 3300003794 Ga0055531_10003550 Ga0055531_100035506 285
33 3300025292 Ga0209676_1005080 Ga0209676_10050806 285
34 3300025298 Ga0209050_1004213 Ga0209050_10042137 285
35 3300025303 Ga0209051_1016107 Ga0209051_10161073 285
36 3300025304 Ga0209257_1000395 Ga0209257_100039535 285
37 3300009148 Ga0105243_10148104 Ga0105243_101481041 286
38 3300046471 Ga0495650_0020960 Ga0495650_0020960_1085_2002 286
39 3300046660 Ga0495625_0012737 Ga0495625_0012737_3149_4084 287
40 3300025935 Ga0207709_10244912 Ga0207709_102449121 288
41 3300046501 Ga0495607_0002143 Ga0495607_0002143_14218_15144 288
42 3300046507 Ga0495606_0000440 Ga0495606_0000440_18796_19722 288
43 iso_pu_bacteria 2721755523 2722883237 288
44 iso_pu_bacteria 2894023352 2894025545 288
45 3300003790 Ga0055528_1016309 Ga0055528_10163095 289
46 3300005434 Ga0070709_10009407 Ga0070709_100094079 290
47 3300006175 Ga0070712_100053815 Ga0070712_1000538153 290
48 3300025898 Ga0207692_10027925 Ga0207692_100279252 290
49 3300025915 Ga0207693_10043563 Ga0207693_100435634 290
50 3300025928 Ga0207700_10085459 Ga0207700_100854592 290
51 3300025939 Ga0207665_10046275 Ga0207665_100462751 290
52 3300044683 Ga0466965_0013876 Ga0466965_0013876_2180_3091 290
53 3300046507 Ga0495606_0035426 Ga0495606_0035426_1129_2040 290
54 3300047443 Ga0495687_000465 Ga0495687_000465_45998_46909 290
55 3300006946 Ga0079104_1000007 Ga0079104_1000007148 292
56 3300009092 Ga0105250_10005492 Ga0105250_100054925 292
57 3300009148 Ga0105243_10004187 Ga0105243_1000418710 292
58 3300025711 Ga0207696_1012444 Ga0207696_10124442 292
59 3300025935 Ga0207709_10000155 Ga0207709_1000015521 292
60 3300027111 Ga0209281_1000020 Ga0209281_1000020349 292
61 3300053140 Ga0500573_0005327 Ga0500573_0005327_5314_6222 292
62 3300053156 Ga0500622_0061221 Ga0500622_0061221_70_978 292
63 3300009036 Ga0105244_10000276 Ga0105244_100002767 293
64 3300025728 Ga0207655_1000011 Ga0207655_1000011521 293
65 3300046453 Ga0495627_008278 Ga0495627_008278_1619_2569 293
66 3300046512 Ga0495610_0047795 Ga0495610_0047795_491_1441 293
67 3300046515 Ga0495620_0013424 Ga0495620_0013424_1056_2006 293
68 3300046538 Ga0495609_0153853 Ga0495609_0153853_13_894 293
69 3300046660 Ga0495625_0055524 Ga0495625_0055524_1216_2166 293
70 3300046665 Ga0495661_0039990 Ga0495661_0039990_1358_2308 293
71 3300046692 Ga0495671_0011928 Ga0495671_0011928_2303_3253 293
72 3300046810 Ga0495660_0018300 Ga0495660_0018300_1055_2005 293
73 3300048920 Ga0496117_0082931 Ga0496117_0082931_34_948 293
74 3300048922 Ga0496119_0110165 Ga0496119_0110165_386_1336 293
75 3300048924 Ga0496121_0010855 Ga0496121_0010855_896_1846 293
76 3300053079 Ga0500610_0000175 Ga0500610_0000175_6285_7235 293
77 3300053117 Ga0500593_000045 Ga0500593_000045_8980_9930 293
78 3300053134 Ga0500658_0000018 Ga0500658_0000018_79193_80143 293
79 3300053158 Ga0500627_0001238 Ga0500627_0001238_2484_3434 293
80 3300053161 Ga0500634_0016997 Ga0500634_0016997_1503_2453 293
81 3300053079 Ga0500610_0000110 Ga0500610_0000110_18924_19874 294
82 3300053161 Ga0500634_0020065 Ga0500634_0020065_1408_2358 294
83 3300032005 Ga0307411_10373660 Ga0307411_103736601 295
84 3300046522 Ga0495643_0000019 Ga0495643_0000019_53301_54188 295
85 iso_pu_bacteria 2600255389 2602007913 295
86 iso_pu_bacteria 2738543020 2739289941 295
87 iso_pu_bacteria 2738543021 2739295253 295
88 iso_pu_bacteria 2908669403 2908673330 295
89 iso_pu_bacteria 3005409236 3005413555 295
90 3300030744 Ga0316181_1197564 Ga0316181_11975643 296
91 3300046512 Ga0495610_0008218 Ga0495610_0008218_3906_4859 296
92 3300046528 Ga0495642_0136002 Ga0495642_0136002_26_916 296
93 iso_pu_bacteria 2511231012 2511299581 296
94 iso_pu_bacteria 2511231031 2511411720 296
95 iso_pu_bacteria 2643221565 2643843402 296
96 iso_pu_bacteria 2738541294 2738810604 296
97 iso_pu_bacteria 2738541309 2738897964 296
98 iso_pu_bacteria 2738543015 2739257877 296
99 iso_pu_bacteria 8056125926 8056128938 296
100 iso_pu_bacteria 8056161164 8056166006 296
101 iso_pu_bacteria 2718217725 2718634448 297
102 iso_pu_bacteria 2738541277 2738723706 297
103 iso_pu_bacteria 2738543019 2739284437 297
104 iso_pu_bacteria 2738543031 2739349642 297
105 iso_pu_bacteria 2738543031 2739351309 297
106 iso_pu_bacteria 2842832357 2842834484 297
107 iso_pu_bacteria 2919385768 2919390389 297
108 iso_pu_bacteria 2974289157 2974291097 297
109 iso_pu_bacteria 3007855910 3007856760 297
110 iso_pu_bacteria 8029995093 8029998050 297
111 iso_pu_bacteria 8056166840 8056168465 297
112 3300010375 Ga0105239_10135662 Ga0105239_101356623 298
113 3300010375 Ga0105239_10766145 Ga0105239_107661451 298
114 3300013306 Ga0163162_10332393 Ga0163162_103323932 298
115 3300035113 Ga0373936_0082930 Ga0373936_0082930_326_1222 298
116 3300046536 Ga0495587_0002729 Ga0495587_0002729_14_910 298
117 3300048915 Ga0496112_0195315 Ga0496112_0195315_61_957 298
118 iso_pu_bacteria 2643221541 2643730118 298
119 iso_pu_bacteria 2643221606 2644045604 298
120 iso_pu_bacteria 2643221671 2644392770 298
121 iso_pu_bacteria 2858466076 2858466686 298
122 iso_pu_bacteria 2871272651 2871274790 298
123 iso_pu_bacteria 2888419890 2888425145 298
124 iso_pu_bacteria 8055092621 8055092706 298
125 3300031507 Ga0307509_10153582 Ga0307509_101535823 299
126 3300042006 Ga0439432_000003 Ga0439432_000003_57136_58035 299
127 3300046507 Ga0495606_0000023 Ga0495606_0000023_189313_190212 299
128 3300046660 Ga0495625_0012739 Ga0495625_0012739_1287_2186 299
129 3300046692 Ga0495671_0015465 Ga0495671_0015465_477_1376 299
130 3300046694 Ga0495649_0034071 Ga0495649_0034071_642_1541 299
131 3300046694 Ga0495649_0109709 Ga0495649_0109709_203_1102 299
132 3300046810 Ga0495660_0013083 Ga0495660_0013083_1887_2786 299
133 3300047469 Ga0495673_0012298 Ga0495673_0012298_2311_3210 299
134 3300047472 Ga0495686_0114992 Ga0495686_0114992_631_1530 299
135 3300053080 Ga0500635_0000025 Ga0500635_0000025_86621_87577 299
136 iso_pu_bacteria 2506520007 2506577508 299
137 iso_pu_bacteria 2506520008 2506582646 299
138 iso_pu_bacteria 2654587920 2656278425 299
139 iso_pu_bacteria 2687453601 2689443988 299
140 iso_pu_bacteria 2857564685 2857565802 299
141 iso_pu_bacteria 2860339153 2860342553 299
142 iso_pu_bacteria 2900051742 2900054870 299
143 iso_pu_bacteria 2931396565 2931402633 299
144 3300002738 JGI25154J39366_1004348 JGI25154J39366_10043483 300
145 3300005288 Ga0065714_10064760 Ga0065714_1006476025 300
146 3300006058 Ga0075432_10000876 Ga0075432_100008767 300
147 3300006914 Ga0075436_100050337 Ga0075436_1000503373 300
148 3300009011 Ga0105251_10000032 Ga0105251_1000003291 300
149 3300013100 Ga0157373_10000514 Ga0157373_1000051427 300
150 3300025273 Ga0209673_1001979 Ga0209673_10019799 300
151 3300025273 Ga0209673_1040712 Ga0209673_10407122 300
152 3300025299 Ga0209256_1006816 Ga0209256_10068165 300
153 3300025735 Ga0207713_1000020 Ga0207713_1000020312 300
154 3300027907 Ga0207428_10077514 Ga0207428_100775144 300
155 3300028786 Ga0307517_10076341 Ga0307517_100763415 300
156 3300030521 Ga0307511_10073554 Ga0307511_100735542 300
157 3300033180 Ga0307510_10000175 Ga0307510_1000017542 300
158 3300041405 Ga0439438_000299 Ga0439438_000299_8171_9073 300
159 3300041407 Ga0439447_000518 Ga0439447_000518_2262_3164 300
160 3300041411 Ga0439466_0000208 Ga0439466_0000208_8162_9064 300
161 3300042010 Ga0439452_000151 Ga0439452_000151_24296_25198 300
162 3300042010 Ga0439452_000253 Ga0439452_000253_8198_9100 300
163 3300046452 Ga0495617_000159 Ga0495617_000159_19662_20564 300
164 3300046452 Ga0495617_000211 Ga0495617_000211_17869_18771 300
165 3300046452 Ga0495617_000788 Ga0495617_000788_6481_7383 300
166 3300046452 Ga0495617_001579 Ga0495617_001579_3168_4070 300
167 3300046452 Ga0495617_002191 Ga0495617_002191_4588_5490 300
168 3300046452 Ga0495617_015679 Ga0495617_015679_167_1069 300
169 3300046452 Ga0495617_061681 Ga0495617_061681_229_1131 300
170 3300046453 Ga0495627_000010 Ga0495627_000010_318692_319594 300
171 3300046453 Ga0495627_000031 Ga0495627_000031_65910_66812 300
172 3300046453 Ga0495627_000275 Ga0495627_000275_25733_26635 300
173 3300046453 Ga0495627_001126 Ga0495627_001126_5564_6466 300
174 3300046453 Ga0495627_027145 Ga0495627_027145_125_1027 300
175 3300046453 Ga0495627_045849 Ga0495627_045849_125_1027 300
176 3300046454 Ga0495592_0000273 Ga0495592_0000273_15484_16386 300
177 3300046455 Ga0495603_0000214 Ga0495603_0000214_5257_6159 300
178 3300046455 Ga0495603_0126935 Ga0495603_0126935_272_1174 300
179 3300046457 Ga0495590_0000170 Ga0495590_0000170_23478_24380 300
180 3300046457 Ga0495590_0000563 Ga0495590_0000563_507_1409 300
181 3300046457 Ga0495590_0001002 Ga0495590_0001002_6208_7110 300
182 3300046457 Ga0495590_0019914 Ga0495590_0019914_933_1835 300
183 3300046457 Ga0495590_0046173 Ga0495590_0046173_397_1299 300
184 3300046458 Ga0495591_000002 Ga0495591_000002_223117_224019 300
185 3300046458 Ga0495591_000123 Ga0495591_000123_65425_66327 300
186 3300046458 Ga0495591_000281 Ga0495591_000281_23363_24265 300
187 3300046458 Ga0495591_000348 Ga0495591_000348_9281_10183 300
188 3300046458 Ga0495591_000381 Ga0495591_000381_24169_25071 300
189 3300046458 Ga0495591_001013 Ga0495591_001013_6824_7726 300
190 3300046458 Ga0495591_001795 Ga0495591_001795_4903_5805 300
191 3300046458 Ga0495591_002334 Ga0495591_002334_389_1291 300
192 3300046458 Ga0495591_003089 Ga0495591_003089_7529_8431 300
193 3300046459 Ga0495629_0058578 Ga0495629_0058578_1022_1924 300
194 3300046460 Ga0495638_0000810 Ga0495638_0000810_6328_7230 300
195 3300046460 Ga0495638_0001488 Ga0495638_0001488_5480_6382 300
196 3300046460 Ga0495638_0003402 Ga0495638_0003402_3623_4525 300
197 3300046460 Ga0495638_0019816 Ga0495638_0019816_2106_3008 300
198 3300046460 Ga0495638_0026418 Ga0495638_0026418_553_1455 300
199 3300046460 Ga0495638_0026645 Ga0495638_0026645_104_1006 300
200 3300046460 Ga0495638_0034109 Ga0495638_0034109_346_1248 300
201 3300046463 Ga0495653_0000115 Ga0495653_0000115_21364_22266 300
202 3300046463 Ga0495653_0008057 Ga0495653_0008057_2701_3603 300
203 3300046463 Ga0495653_0009488 Ga0495653_0009488_2668_3570 300
204 3300046463 Ga0495653_0010992 Ga0495653_0010992_733_1635 300
205 3300046471 Ga0495650_0000101 Ga0495650_0000101_209209_210111 300
206 3300046471 Ga0495650_0000180 Ga0495650_0000180_23563_24465 300
207 3300046471 Ga0495650_0000400 Ga0495650_0000400_39071_39973 300
208 3300046471 Ga0495650_0005373 Ga0495650_0005373_5352_6254 300
209 3300046471 Ga0495650_0005612 Ga0495650_0005612_1859_2761 300
210 3300046471 Ga0495650_0008078 Ga0495650_0008078_2760_3662 300
211 3300046472 Ga0495580_0114811 Ga0495580_0114811_163_1065 300
212 3300046473 Ga0495582_0047361 Ga0495582_0047361_1041_1943 300
213 3300046473 Ga0495582_0053049 Ga0495582_0053049_362_1264 300
214 3300046474 Ga0495605_0000001 Ga0495605_0000001_243930_244832 300
215 3300046474 Ga0495605_0000011 Ga0495605_0000011_10019_10921 300
216 3300046474 Ga0495605_0000272 Ga0495605_0000272_36408_37310 300
217 3300046474 Ga0495605_0000324 Ga0495605_0000324_7545_8447 300
218 3300046474 Ga0495605_0001557 Ga0495605_0001557_8846_9748 300
219 3300046474 Ga0495605_0003358 Ga0495605_0003358_692_1594 300
220 3300046474 Ga0495605_0010299 Ga0495605_0010299_3912_4814 300
221 3300046474 Ga0495605_0035146 Ga0495605_0035146_1285_2187 300
222 3300046474 Ga0495605_0091738 Ga0495605_0091738_238_1140 300
223 3300046475 Ga0495639_0095270 Ga0495639_0095270_268_1170 300
224 3300046491 Ga0495584_0000393 Ga0495584_0000393_19771_20673 300
225 3300046491 Ga0495584_0000412 Ga0495584_0000412_17886_18788 300
226 3300046491 Ga0495584_0000921 Ga0495584_0000921_8309_9211 300
227 3300046491 Ga0495584_0000997 Ga0495584_0000997_8306_9208 300
228 3300046491 Ga0495584_0001596 Ga0495584_0001596_12459_13361 300
229 3300046491 Ga0495584_0002131 Ga0495584_0002131_7904_8806 300
230 3300046491 Ga0495584_0002729 Ga0495584_0002729_486_1388 300
231 3300046491 Ga0495584_0084168 Ga0495584_0084168_267_1169 300
232 3300046491 Ga0495584_0174495 Ga0495584_0174495_145_1047 300
233 3300046492 Ga0495585_0000533 Ga0495585_0000533_23944_24846 300
234 3300046492 Ga0495585_0000890 Ga0495585_0000890_8306_9208 300
235 3300046492 Ga0495585_0001048 Ga0495585_0001048_13666_14568 300
236 3300046499 Ga0495594_0000218 Ga0495594_0000218_15219_16121 300
237 3300046499 Ga0495594_0101135 Ga0495594_0101135_392_1294 300
238 3300046500 Ga0495596_0000102 Ga0495596_0000102_36566_37468 300
239 3300046500 Ga0495596_0038296 Ga0495596_0038296_827_1729 300
240 3300046500 Ga0495596_0038297 Ga0495596_0038297_827_1729 300
241 3300046501 Ga0495607_0000297 Ga0495607_0000297_24281_25183 300
242 3300046501 Ga0495607_0000373 Ga0495607_0000373_10487_11389 300
243 3300046501 Ga0495607_0001544 Ga0495607_0001544_7696_8598 300
244 3300046501 Ga0495607_0001985 Ga0495607_0001985_9292_10194 300
245 3300046501 Ga0495607_0002617 Ga0495607_0002617_845_1747 300
246 3300046501 Ga0495607_0002662 Ga0495607_0002662_6806_7708 300
247 3300046501 Ga0495607_0024310 Ga0495607_0024310_1945_2847 300
248 3300046501 Ga0495607_0028386 Ga0495607_0028386_1970_2872 300
249 3300046506 Ga0495583_0000167 Ga0495583_0000167_37581_38483 300
250 3300046506 Ga0495583_0000347 Ga0495583_0000347_34707_35609 300
251 3300046506 Ga0495583_0000611 Ga0495583_0000611_21259_22161 300
252 3300046506 Ga0495583_0001972 Ga0495583_0001972_9967_10869 300
253 3300046506 Ga0495583_0004799 Ga0495583_0004799_431_1333 300
254 3300046506 Ga0495583_0012763 Ga0495583_0012763_2384_3286 300
255 3300046506 Ga0495583_0073505 Ga0495583_0073505_17_919 300
256 3300046507 Ga0495606_0009405 Ga0495606_0009405_303_1205 300
257 3300046507 Ga0495606_0030223 Ga0495606_0030223_931_1833 300
258 3300046507 Ga0495606_0087254 Ga0495606_0087254_119_1021 300
259 3300046512 Ga0495610_0000374 Ga0495610_0000374_22502_23404 300
260 3300046512 Ga0495610_0001041 Ga0495610_0001041_1405_2307 300
261 3300046512 Ga0495610_0001419 Ga0495610_0001419_167_1069 300
262 3300046512 Ga0495610_0018038 Ga0495610_0018038_534_1436 300
263 3300046512 Ga0495610_0027669 Ga0495610_0027669_106_1008 300
264 3300046512 Ga0495610_0071559 Ga0495610_0071559_289_1191 300
265 3300046512 Ga0495610_0085718 Ga0495610_0085718_246_1148 300
266 3300046512 Ga0495610_0092265 Ga0495610_0092265_302_1204 300
267 3300046513 Ga0495616_0000121 Ga0495616_0000121_16563_17465 300
268 3300046513 Ga0495616_0000612 Ga0495616_0000612_8745_9647 300
269 3300046513 Ga0495616_0001687 Ga0495616_0001687_8597_9499 300
270 3300046513 Ga0495616_0003512 Ga0495616_0003512_3688_4590 300
271 3300046513 Ga0495616_0021534 Ga0495616_0021534_1538_2440 300
272 3300046513 Ga0495616_0023676 Ga0495616_0023676_593_1495 300
273 3300046515 Ga0495620_0000134 Ga0495620_0000134_27072_27974 300
274 3300046515 Ga0495620_0005736 Ga0495620_0005736_5880_6782 300
275 3300046515 Ga0495620_0006719 Ga0495620_0006719_1516_2418 300
276 3300046516 Ga0495628_0310261 Ga0495628_0310261_92_994 300
277 3300046517 Ga0495630_0015730 Ga0495630_0015730_2502_3404 300
278 3300046517 Ga0495630_0185366 Ga0495630_0185366_185_1087 300
279 3300046518 Ga0495631_0000411 Ga0495631_0000411_16969_17871 300
280 3300046518 Ga0495631_0000857 Ga0495631_0000857_9370_10272 300
281 3300046518 Ga0495631_0008476 Ga0495631_0008476_1255_2157 300
282 3300046518 Ga0495631_0059034 Ga0495631_0059034_362_1264 300
283 3300046518 Ga0495631_0092704 Ga0495631_0092704_244_1146 300
284 3300046519 Ga0495632_0000111 Ga0495632_0000111_47308_48210 300
285 3300046519 Ga0495632_0000600 Ga0495632_0000600_16876_17778 300
286 3300046519 Ga0495632_0001440 Ga0495632_0001440_5538_6440 300
287 3300046519 Ga0495632_0001562 Ga0495632_0001562_8309_9211 300
288 3300046519 Ga0495632_0001720 Ga0495632_0001720_8586_9488 300
289 3300046519 Ga0495632_0004518 Ga0495632_0004518_7602_8504 300
290 3300046519 Ga0495632_0012163 Ga0495632_0012163_3139_4041 300
291 3300046520 Ga0495637_0000017 Ga0495637_0000017_62868_63770 300
292 3300046520 Ga0495637_0000081 Ga0495637_0000081_33213_34115 300
293 3300046520 Ga0495637_0000276 Ga0495637_0000276_23274_24176 300
294 3300046520 Ga0495637_0000544 Ga0495637_0000544_3381_4283 300
295 3300046520 Ga0495637_0001719 Ga0495637_0001719_10161_11063 300
296 3300046520 Ga0495637_0016549 Ga0495637_0016549_783_1685 300
297 3300046520 Ga0495637_0040714 Ga0495637_0040714_929_1831 300
298 3300046522 Ga0495643_0000604 Ga0495643_0000604_15435_16337 300
299 3300046522 Ga0495643_0001499 Ga0495643_0001499_12274_13176 300
300 3300046522 Ga0495643_0002156 Ga0495643_0002156_11976_12878 300
301 3300046522 Ga0495643_0003132 Ga0495643_0003132_9091_9993 300
302 3300046522 Ga0495643_0003293 Ga0495643_0003293_4125_5027 300
303 3300046522 Ga0495643_0014233 Ga0495643_0014233_1236_2138 300
304 3300046523 Ga0495644_0000171 Ga0495644_0000171_21792_22694 300
305 3300046523 Ga0495644_0000370 Ga0495644_0000370_14940_15842 300
306 3300046523 Ga0495644_0000448 Ga0495644_0000448_5310_6212 300
307 3300046523 Ga0495644_0001129 Ga0495644_0001129_4478_5380 300
308 3300046523 Ga0495644_0001799 Ga0495644_0001799_1789_2691 300
309 3300046523 Ga0495644_0004982 Ga0495644_0004982_1539_2441 300
310 3300046523 Ga0495644_0012036 Ga0495644_0012036_2341_3243 300
311 3300046523 Ga0495644_0050185 Ga0495644_0050185_588_1490 300
312 3300046524 Ga0495648_0001031 Ga0495648_0001031_7976_8878 300
313 3300046524 Ga0495648_0002051 Ga0495648_0002051_8382_9284 300
314 3300046524 Ga0495648_0002378 Ga0495648_0002378_7345_8247 300
315 3300046524 Ga0495648_0018494 Ga0495648_0018494_2215_3117 300
316 3300046524 Ga0495648_0020870 Ga0495648_0020870_3312_4214 300
317 3300046524 Ga0495648_0063603 Ga0495648_0063603_979_1881 300
318 3300046524 Ga0495648_0077946 Ga0495648_0077946_305_1207 300
319 3300046524 Ga0495648_0135743 Ga0495648_0135743_213_1115 300
320 3300046524 Ga0495648_0142184 Ga0495648_0142184_218_1120 300
321 3300046526 Ga0495666_0000035 Ga0495666_0000035_24071_24973 300
322 3300046526 Ga0495666_0000081 Ga0495666_0000081_21379_22281 300
323 3300046526 Ga0495666_0000362 Ga0495666_0000362_13575_14477 300
324 3300046526 Ga0495666_0004401 Ga0495666_0004401_2207_3109 300
325 3300046528 Ga0495642_0000026 Ga0495642_0000026_30135_31037 300
326 3300046529 Ga0495652_0017341 Ga0495652_0017341_3493_4395 300
327 3300046530 Ga0495654_0000075 Ga0495654_0000075_62191_63093 300
328 3300046530 Ga0495654_0000158 Ga0495654_0000158_50957_51859 300
329 3300046530 Ga0495654_0001688 Ga0495654_0001688_9222_10124 300
330 3300046530 Ga0495654_0001696 Ga0495654_0001696_7179_8081 300
331 3300046530 Ga0495654_0002226 Ga0495654_0002226_8319_9221 300
332 3300046530 Ga0495654_0007143 Ga0495654_0007143_4092_4994 300
333 3300046530 Ga0495654_0009750 Ga0495654_0009750_3880_4782 300
334 3300046530 Ga0495654_0016716 Ga0495654_0016716_2140_3042 300
335 3300046530 Ga0495654_0016900 Ga0495654_0016900_1021_1923 300
336 3300046530 Ga0495654_0034320 Ga0495654_0034320_742_1644 300
337 3300046530 Ga0495654_0050602 Ga0495654_0050602_301_1203 300
338 3300046530 Ga0495654_0097260 Ga0495654_0097260_104_1006 300
339 3300046530 Ga0495654_0141935 Ga0495654_0141935_18_920 300
340 3300046536 Ga0495587_0000054 Ga0495587_0000054_26984_27886 300
341 3300046536 Ga0495587_0002236 Ga0495587_0002236_1131_2033 300
342 3300046536 Ga0495587_0008965 Ga0495587_0008965_5321_6223 300
343 3300046536 Ga0495587_0029535 Ga0495587_0029535_1653_2555 300
344 3300046538 Ga0495609_0000013 Ga0495609_0000013_249760_250662 300
345 3300046538 Ga0495609_0000014 Ga0495609_0000014_280379_281281 300
346 3300046538 Ga0495609_0000195 Ga0495609_0000195_7976_8878 300
347 3300046538 Ga0495609_0000270 Ga0495609_0000270_9795_10697 300
348 3300046538 Ga0495609_0001255 Ga0495609_0001255_7973_8875 300
349 3300046538 Ga0495609_0003377 Ga0495609_0003377_2549_3478 300
350 3300046538 Ga0495609_0005713 Ga0495609_0005713_5309_6211 300
351 3300046542 Ga0495597_0000011 Ga0495597_0000011_138998_139900 300
352 3300046542 Ga0495597_0002828 Ga0495597_0002828_2372_3274 300
353 3300046542 Ga0495597_0006608 Ga0495597_0006608_1976_2878 300
354 3300046542 Ga0495597_0016449 Ga0495597_0016449_151_1053 300
355 3300046543 Ga0495645_0093895 Ga0495645_0093895_710_1612 300
356 3300046557 Ga0495622_0000046 Ga0495622_0000046_15452_16354 300
357 3300046557 Ga0495622_0000066 Ga0495622_0000066_16160_17062 300
358 3300046557 Ga0495622_0099995 Ga0495622_0099995_312_1214 300
359 3300046558 Ga0495633_0000010 Ga0495633_0000010_10019_10921 300
360 3300046558 Ga0495633_0096792 Ga0495633_0096792_400_1302 300
361 3300046615 Ga0495656_0000432 Ga0495656_0000432_8913_9815 300
362 3300046615 Ga0495656_0017592 Ga0495656_0017592_547_1449 300
363 3300046615 Ga0495656_0021951 Ga0495656_0021951_579_1481 300
364 3300046616 Ga0495668_0000497 Ga0495668_0000497_24827_25729 300
365 3300046616 Ga0495668_0011156 Ga0495668_0011156_506_1408 300
366 3300046616 Ga0495668_0023709 Ga0495668_0023709_1076_1978 300
367 3300046616 Ga0495668_0024529 Ga0495668_0024529_932_1834 300
368 3300046616 Ga0495668_0067183 Ga0495668_0067183_292_1194 300
369 3300046616 Ga0495668_0119674 Ga0495668_0119674_134_1036 300
370 3300046642 Ga0495634_0000169 Ga0495634_0000169_32357_33259 300
371 3300046648 Ga0495611_0000019 Ga0495611_0000019_98062_98964 300
372 3300046648 Ga0495611_0000427 Ga0495611_0000427_6594_7496 300
373 3300046648 Ga0495611_0000541 Ga0495611_0000541_9990_10892 300
374 3300046648 Ga0495611_0003806 Ga0495611_0003806_189_1091 300
375 3300046648 Ga0495611_0009589 Ga0495611_0009589_2890_3792 300
376 3300046660 Ga0495625_0000016 Ga0495625_0000016_194106_195008 300
377 3300046660 Ga0495625_0001103 Ga0495625_0001103_23055_23957 300
378 3300046660 Ga0495625_0004052 Ga0495625_0004052_4067_4969 300
379 3300046660 Ga0495625_0007051 Ga0495625_0007051_668_1570 300
380 3300046660 Ga0495625_0036190 Ga0495625_0036190_384_1286 300
381 3300046660 Ga0495625_0240979 Ga0495625_0240979_126_1028 300
382 3300046660 Ga0495625_0250824 Ga0495625_0250824_65_967 300
383 3300046663 Ga0495635_0000033 Ga0495635_0000033_26987_27889 300
384 3300046663 Ga0495635_0000035 Ga0495635_0000035_55390_56292 300
385 3300046663 Ga0495635_0004930 Ga0495635_0004930_135_1037 300
386 3300046664 Ga0495659_0004235 Ga0495659_0004235_1701_2603 300
387 3300046664 Ga0495659_0074835 Ga0495659_0074835_233_1135 300
388 3300046665 Ga0495661_0000001 Ga0495661_0000001_685456_686358 300
389 3300046665 Ga0495661_0000179 Ga0495661_0000179_29782_30684 300
390 3300046665 Ga0495661_0000276 Ga0495661_0000276_46862_47764 300
391 3300046665 Ga0495661_0001594 Ga0495661_0001594_8687_9589 300
392 3300046665 Ga0495661_0004062 Ga0495661_0004062_4211_5113 300
393 3300046665 Ga0495661_0010442 Ga0495661_0010442_193_1095 300
394 3300046665 Ga0495661_0025122 Ga0495661_0025122_2642_3544 300
395 3300046665 Ga0495661_0140842 Ga0495661_0140842_180_1082 300
396 3300046665 Ga0495661_0154760 Ga0495661_0154760_208_1110 300
397 3300046674 Ga0495588_0015016 Ga0495588_0015016_1656_2558 300
398 3300046679 Ga0495623_0000234 Ga0495623_0000234_7952_8854 300
399 3300046679 Ga0495623_0000870 Ga0495623_0000870_13607_14509 300
400 3300046680 Ga0495646_0000147 Ga0495646_0000147_26982_27884 300
401 3300046680 Ga0495646_0000606 Ga0495646_0000606_6840_7742 300
402 3300046684 Ga0495669_0000063 Ga0495669_0000063_24101_25003 300
403 3300046689 Ga0495613_0001661 Ga0495613_0001661_4106_5008 300
404 3300046689 Ga0495613_0258958 Ga0495613_0258958_85_987 300
405 3300046690 Ga0495624_0000014 Ga0495624_0000014_63923_64825 300
406 3300046691 Ga0495670_0000018 Ga0495670_0000018_24809_25711 300
407 3300046691 Ga0495670_0000206 Ga0495670_0000206_6606_7508 300
408 3300046691 Ga0495670_0000494 Ga0495670_0000494_12681_13583 300
409 3300046691 Ga0495670_0052118 Ga0495670_0052118_405_1307 300
410 3300046691 Ga0495670_0063555 Ga0495670_0063555_19_921 300
411 3300046692 Ga0495671_0000153 Ga0495671_0000153_32186_33088 300
412 3300046692 Ga0495671_0001075 Ga0495671_0001075_17625_18527 300
413 3300046692 Ga0495671_0001930 Ga0495671_0001930_11173_12075 300
414 3300046692 Ga0495671_0002435 Ga0495671_0002435_10061_10963 300
415 3300046692 Ga0495671_0002646 Ga0495671_0002646_579_1481 300
416 3300046692 Ga0495671_0003136 Ga0495671_0003136_2541_3443 300
417 3300046692 Ga0495671_0004538 Ga0495671_0004538_5207_6109 300
418 3300046692 Ga0495671_0007712 Ga0495671_0007712_1953_2855 300
419 3300046692 Ga0495671_0008577 Ga0495671_0008577_193_1095 300
420 3300046692 Ga0495671_0010032 Ga0495671_0010032_114_1016 300
421 3300046692 Ga0495671_0051798 Ga0495671_0051798_311_1213 300
422 3300046692 Ga0495671_0086905 Ga0495671_0086905_224_1126 300
423 3300046694 Ga0495649_0000079 Ga0495649_0000079_65709_66611 300
424 3300046694 Ga0495649_0001029 Ga0495649_0001029_17485_18387 300
425 3300046694 Ga0495649_0003496 Ga0495649_0003496_2306_3208 300
426 3300046694 Ga0495649_0004389 Ga0495649_0004389_2523_3425 300
427 3300046694 Ga0495649_0006652 Ga0495649_0006652_5677_6579 300
428 3300046694 Ga0495649_0009298 Ga0495649_0009298_3832_4734 300
429 3300046794 Ga0495589_0000426 Ga0495589_0000426_22418_23320 300
430 3300046794 Ga0495589_0000440 Ga0495589_0000440_14319_15221 300
431 3300046794 Ga0495589_0002588 Ga0495589_0002588_9055_9957 300
432 3300046794 Ga0495589_0005707 Ga0495589_0005707_5445_6347 300
433 3300046794 Ga0495589_0076132 Ga0495589_0076132_329_1231 300
434 3300046809 Ga0495600_0000247 Ga0495600_0000247_21373_22275 300
435 3300046809 Ga0495600_0001037 Ga0495600_0001037_1656_2558 300
436 3300046809 Ga0495600_0007621 Ga0495600_0007621_958_1860 300
437 3300046810 Ga0495660_0000234 Ga0495660_0000234_48561_49463 300
438 3300046810 Ga0495660_0001110 Ga0495660_0001110_9782_10684 300
439 3300046810 Ga0495660_0003729 Ga0495660_0003729_2334_3236 300
440 3300046810 Ga0495660_0010394 Ga0495660_0010394_4494_5396 300
441 3300046810 Ga0495660_0019585 Ga0495660_0019585_2791_3693 300
442 3300046810 Ga0495660_0022226 Ga0495660_0022226_749_1651 300
443 3300046810 Ga0495660_0026183 Ga0495660_0026183_1906_2808 300
444 3300046810 Ga0495660_0055678 Ga0495660_0055678_550_1452 300
445 3300046810 Ga0495660_0113262 Ga0495660_0113262_289_1191 300
446 3300047317 Ga0495604_0000094 Ga0495604_0000094_15686_16588 300
447 3300047317 Ga0495604_0000962 Ga0495604_0000962_1575_2477 300
448 3300047317 Ga0495604_0005789 Ga0495604_0005789_26_928 300
449 3300047318 Ga0495636_0000230 Ga0495636_0000230_8557_9459 300
450 3300047318 Ga0495636_0000265 Ga0495636_0000265_3496_4398 300
451 3300047319 Ga0495674_0000058 Ga0495674_0000058_45569_46471 300
452 3300047320 Ga0495672_0000457 Ga0495672_0000457_24498_25400 300
453 3300047320 Ga0495672_0000488 Ga0495672_0000488_26137_27039 300
454 3300047320 Ga0495672_0000524 Ga0495672_0000524_15581_16483 300
455 3300047320 Ga0495672_0000890 Ga0495672_0000890_26597_27499 300
456 3300047320 Ga0495672_0000934 Ga0495672_0000934_14345_15247 300
457 3300047320 Ga0495672_0002362 Ga0495672_0002362_7973_8875 300
458 3300047320 Ga0495672_0002796 Ga0495672_0002796_6256_7158 300
459 3300047320 Ga0495672_0013800 Ga0495672_0013800_1970_2872 300
460 3300047320 Ga0495672_0015679 Ga0495672_0015679_3884_4786 300
461 3300047320 Ga0495672_0145624 Ga0495672_0145624_191_1093 300
462 3300047321 Ga0495676_0000001 Ga0495676_0000001_312904_313806 300
463 3300047321 Ga0495676_0000041 Ga0495676_0000041_26938_27840 300
464 3300047322 Ga0495680_0000133 Ga0495680_0000133_27827_28729 300
465 3300047322 Ga0495680_0000356 Ga0495680_0000356_43682_44584 300
466 3300047322 Ga0495680_0002095 Ga0495680_0002095_740_1642 300
467 3300047322 Ga0495680_0028675 Ga0495680_0028675_1164_2066 300
468 3300047323 Ga0495683_0000456 Ga0495683_0000456_15018_15920 300
469 3300047323 Ga0495683_0000858 Ga0495683_0000858_12638_13540 300
470 3300047323 Ga0495683_0003150 Ga0495683_0003150_8253_9155 300
471 3300047323 Ga0495683_0007210 Ga0495683_0007210_3858_4760 300
472 3300047323 Ga0495683_0087296 Ga0495683_0087296_77_979 300
473 3300047443 Ga0495687_000754 Ga0495687_000754_12697_13599 300
474 3300047443 Ga0495687_051693 Ga0495687_051693_611_1513 300
475 3300047444 Ga0495675_0000257 Ga0495675_0000257_5315_6217 300
476 3300047444 Ga0495675_0014750 Ga0495675_0014750_494_1396 300
477 3300047444 Ga0495675_0029894 Ga0495675_0029894_1581_2483 300
478 3300047444 Ga0495675_0081532 Ga0495675_0081532_748_1650 300
479 3300047445 Ga0495677_0000313 Ga0495677_0000313_7557_8459 300
480 3300047446 Ga0495679_000053 Ga0495679_000053_99482_100384 300
481 3300047446 Ga0495679_000064 Ga0495679_000064_17213_18115 300
482 3300047446 Ga0495679_000239 Ga0495679_000239_34926_35828 300
483 3300047446 Ga0495679_000278 Ga0495679_000278_18552_19454 300
484 3300047446 Ga0495679_001732 Ga0495679_001732_1468_2370 300
485 3300047446 Ga0495679_004592 Ga0495679_004592_2629_3531 300
486 3300047446 Ga0495679_022082 Ga0495679_022082_1129_2031 300
487 3300047447 Ga0495685_029084 Ga0495685_029084_296_1198 300
488 3300047469 Ga0495673_0000477 Ga0495673_0000477_21339_22241 300
489 3300047469 Ga0495673_0000582 Ga0495673_0000582_17159_18061 300
490 3300047469 Ga0495673_0001240 Ga0495673_0001240_11115_12017 300
491 3300047469 Ga0495673_0004841 Ga0495673_0004841_6390_7292 300
492 3300047469 Ga0495673_0005464 Ga0495673_0005464_2932_3834 300
493 3300047469 Ga0495673_0006512 Ga0495673_0006512_2112_3014 300
494 3300047469 Ga0495673_0010700 Ga0495673_0010700_3486_4388 300
495 3300047469 Ga0495673_0018604 Ga0495673_0018604_2069_2971 300
496 3300047469 Ga0495673_0027213 Ga0495673_0027213_500_1402 300
497 3300047469 Ga0495673_0044010 Ga0495673_0044010_917_1819 300
498 3300047469 Ga0495673_0044043 Ga0495673_0044043_729_1631 300
499 3300047470 Ga0495681_0000034 Ga0495681_0000034_33002_33904 300
500 3300047470 Ga0495681_0000068 Ga0495681_0000068_76787_77689 300
501 3300047470 Ga0495681_0000116 Ga0495681_0000116_14118_15020 300
502 3300047470 Ga0495681_0000487 Ga0495681_0000487_21711_22613 300
503 3300047470 Ga0495681_0004747 Ga0495681_0004747_3333_4235 300
504 3300047470 Ga0495681_0009022 Ga0495681_0009022_48_950 300
505 3300047470 Ga0495681_0014844 Ga0495681_0014844_50_952 300
506 3300047470 Ga0495681_0053335 Ga0495681_0053335_166_1068 300
507 3300047471 Ga0495684_0008353 Ga0495684_0008353_2379_3281 300
508 3300047471 Ga0495684_0037198 Ga0495684_0037198_569_1471 300
509 3300047472 Ga0495686_0002509 Ga0495686_0002509_7829_8731 300
510 3300047472 Ga0495686_0005899 Ga0495686_0005899_6377_7279 300
511 3300047472 Ga0495686_0009654 Ga0495686_0009654_1863_2765 300
512 3300047472 Ga0495686_0015509 Ga0495686_0015509_2288_3190 300
513 3300047673 Ga0495593_0000225 Ga0495593_0000225_12525_13427 300
514 3300047673 Ga0495593_0007215 Ga0495593_0007215_895_1797 300
515 3300047673 Ga0495593_0021345 Ga0495593_0021345_1193_2095 300
516 3300048088 Ga0495602_0000129 Ga0495602_0000129_27870_28772 300
517 3300048091 Ga0495626_0000002 Ga0495626_0000002_384414_385316 300
518 3300048091 Ga0495626_0000119 Ga0495626_0000119_48293_49195 300
519 3300048091 Ga0495626_0000185 Ga0495626_0000185_51940_52842 300
520 3300048091 Ga0495626_0000199 Ga0495626_0000199_49886_50788 300
521 3300048091 Ga0495626_0000560 Ga0495626_0000560_30384_31286 300
522 3300048091 Ga0495626_0000576 Ga0495626_0000576_12188_13090 300
523 3300048091 Ga0495626_0001103 Ga0495626_0001103_12703_13605 300
524 3300048907 Ga0496104_0039111 Ga0496104_0039111_834_1739 300
525 3300048908 Ga0496105_0042127 Ga0496105_0042127_2048_2953 300
526 3300048913 Ga0496110_0306200 Ga0496110_0306200_432_1337 300
527 3300048919 Ga0496116_0018260 Ga0496116_0018260_2862_3767 300
528 3300048922 Ga0496119_0010330 Ga0496119_0010330_3149_4054 300
529 3300048925 Ga0496122_0027984 Ga0496122_0027984_1896_2801 300
530 3300048927 Ga0496124_0000035 Ga0496124_0000035_214494_215396 300
531 3300048927 Ga0496124_0003534 Ga0496124_0003534_2839_3741 300
532 3300048927 Ga0496124_0004953 Ga0496124_0004953_13704_14609 300
533 3300048928 Ga0496125_0006069 Ga0496125_0006069_4352_5257 300
534 3300049459 Ga0495678_000008 Ga0495678_000008_365501_366403 300
535 3300049459 Ga0495678_000614 Ga0495678_000614_15578_16480 300
536 3300049459 Ga0495678_001676 Ga0495678_001676_5307_6209 300
537 3300049459 Ga0495678_002873 Ga0495678_002873_7086_7988 300
538 3300049459 Ga0495678_002914 Ga0495678_002914_8011_8913 300
539 3300049459 Ga0495678_004759 Ga0495678_004759_3453_4355 300
540 3300049459 Ga0495678_027115 Ga0495678_027115_1051_1953 300
541 3300049459 Ga0495678_056054 Ga0495678_056054_221_1123 300
542 3300049460 Ga0495682_0000075 Ga0495682_0000075_82176_83078 300
543 3300049460 Ga0495682_0000474 Ga0495682_0000474_18791_19693 300
544 3300049460 Ga0495682_0000486 Ga0495682_0000486_22418_23320 300
545 3300049460 Ga0495682_0001748 Ga0495682_0001748_2241_3143 300
546 3300049460 Ga0495682_0028537 Ga0495682_0028537_238_1140 300
547 3300050514 nmdc:mga08x19_155549_c1 nmdc:mga08x19_155549_c1_566_1468 300
548 3300053111 Ga0500572_000005 Ga0500572_000005_26930_27832 300
549 3300053140 Ga0500573_0012395 Ga0500573_0012395_60_962 300
550 3300053142 Ga0500577_0086946 Ga0500577_0086946_94_996 300
551 3300053145 Ga0500586_014951 Ga0500586_014951_1159_2061 300
552 iso_pu_bacteria 2842711865 2842715826 300
553 iso_pu_bacteria 2960603979 2960604905 300
554 3300005457 Ga0070662_100182756 Ga0070662_1001827562 301
555 3300006946 Ga0079104_1003211 Ga0079104_10032113 301
556 3300009011 Ga0105251_10000903 Ga0105251_1000090320 301
557 3300009092 Ga0105250_10000368 Ga0105250_1000036821 301
558 3300009101 Ga0105247_10000103 Ga0105247_1000010358 301
559 3300009174 Ga0105241_10000004 Ga0105241_10000004644 301
560 3300013100 Ga0157373_10001204 Ga0157373_100012046 301
561 3300014497 Ga0182008_10004419 Ga0182008_100044194 301
562 3300017792 Ga0163161_10000001 Ga0163161_10000001218 301
563 3300025292 Ga0209676_1000020 Ga0209676_100002067 301
564 3300025711 Ga0207696_1000001 Ga0207696_1000001305 301
565 3300025735 Ga0207713_1000024 Ga0207713_1000024201 301
566 3300025735 Ga0207713_1000026 Ga0207713_1000026144 301
567 3300025900 Ga0207710_10000140 Ga0207710_1000014076 301
568 3300025911 Ga0207654_10000006 Ga0207654_10000006662 301
569 3300025933 Ga0207706_10159393 Ga0207706_101593932 301
570 3300027111 Ga0209281_1000008 Ga0209281_1000008149 301
571 3300028786 Ga0307517_10000160 Ga0307517_1000016068 301
572 3300030522 Ga0307512_10130709 Ga0307512_101307092 301
573 3300031456 Ga0307513_10343296 Ga0307513_103432962 301
574 3300031507 Ga0307509_10001242 Ga0307509_100012424 301
575 3300031616 Ga0307508_10000412 Ga0307508_1000041212 301
576 3300031649 Ga0307514_10002158 Ga0307514_1000215812 301
577 3300031649 Ga0307514_10041938 Ga0307514_100419382 301
578 3300031903 Ga0307407_10117829 Ga0307407_101178291 301
579 3300031911 Ga0307412_10016699 Ga0307412_100166994 301
580 3300031911 Ga0307412_10034624 Ga0307412_100346242 301
581 3300032004 Ga0307414_10004566 Ga0307414_100045663 301
582 3300032005 Ga0307411_10188740 Ga0307411_101887402 301
583 3300033179 Ga0307507_10006339 Ga0307507_100063397 301
584 3300041405 Ga0439438_000048 Ga0439438_000048_57453_58358 301
585 3300041405 Ga0439438_000153 Ga0439438_000153_21735_22640 301
586 3300041407 Ga0439447_022348 Ga0439447_022348_320_1225 301
587 3300041411 Ga0439466_0000978 Ga0439466_0000978_8720_9625 301
588 3300042006 Ga0439432_016652 Ga0439432_016652_148_1062 301
589 3300042009 Ga0439451_001113 Ga0439451_001113_4097_5002 301
590 3300042010 Ga0439452_000043 Ga0439452_000043_22850_23755 301
591 3300042013 Ga0439456_004693 Ga0439456_004693_988_1893 301
592 3300042115 Ga0450911_000009 Ga0450911_000009_131250_132155 301
593 3300042136 Ga0450900_010331 Ga0450900_010331_167_1072 301
594 3300042138 Ga0450903_001619 Ga0450903_001619_1030_1935 301
595 3300042145 Ga0450906_000005 Ga0450906_000005_21930_22835 301
596 3300046453 Ga0495627_000028 Ga0495627_000028_7109_8023 301
597 3300046459 Ga0495629_0075923 Ga0495629_0075923_1342_2247 301
598 3300046460 Ga0495638_0065581 Ga0495638_0065581_282_1187 301
599 3300046501 Ga0495607_0000075 Ga0495607_0000075_931_1869 301
600 3300046513 Ga0495616_0000294 Ga0495616_0000294_7141_8046 301
601 3300046515 Ga0495620_0006318 Ga0495620_0006318_2423_3328 301
602 3300046518 Ga0495631_0000614 Ga0495631_0000614_22304_23209 301
603 3300046530 Ga0495654_0000526 Ga0495654_0000526_8739_9653 301
604 3300046530 Ga0495654_0010020 Ga0495654_0010020_1498_2403 301
605 3300046660 Ga0495625_0009003 Ga0495625_0009003_629_1534 301
606 3300046660 Ga0495625_0159078 Ga0495625_0159078_271_1176 301
607 3300046663 Ga0495635_0107120 Ga0495635_0107120_686_1660 301
608 3300046663 Ga0495635_0132915 Ga0495635_0132915_401_1306 301
609 3300046674 Ga0495588_0001682 Ga0495588_0001682_7088_7993 301
610 3300046683 Ga0495658_0002679 Ga0495658_0002679_3684_4589 301
611 3300046690 Ga0495624_0054400 Ga0495624_0054400_1044_1949 301
612 3300046692 Ga0495671_0000584 Ga0495671_0000584_16840_17745 301
613 3300046809 Ga0495600_0077558 Ga0495600_0077558_78_983 301
614 3300047318 Ga0495636_0015933 Ga0495636_0015933_309_1229 301
615 3300047321 Ga0495676_0000398 Ga0495676_0000398_30590_31495 301
616 3300047321 Ga0495676_0000540 Ga0495676_0000540_26635_27609 301
617 3300047673 Ga0495593_0000083 Ga0495593_0000083_1302_2207 301
618 3300047673 Ga0495593_0000515 Ga0495593_0000515_3711_4685 301
619 3300048089 Ga0495614_0000849 Ga0495614_0000849_1680_2654 301
620 3300048089 Ga0495614_0002788 Ga0495614_0002788_2112_3017 301
621 3300048919 Ga0496116_0000023 Ga0496116_0000023_188183_189097 301
622 3300048920 Ga0496117_0012592 Ga0496117_0012592_2730_3644 301
623 3300048921 Ga0496118_0021662 Ga0496118_0021662_3567_4481 301
624 3300053079 Ga0500610_0000022 Ga0500610_0000022_431_1336 301
625 3300053087 Ga0500643_001003 Ga0500643_001003_9887_10792 301
626 3300053088 Ga0500644_0009415 Ga0500644_0009415_1121_2026 301
627 3300053092 Ga0500583_0069013 Ga0500583_0069013_246_1151 301
628 3300053093 Ga0500651_0000242 Ga0500651_0000242_22269_23174 301
629 3300053094 Ga0500566_0032375 Ga0500566_0032375_1980_2885 301
630 3300053108 Ga0500562_003301 Ga0500562_003301_2250_3155 301
631 3300053108 Ga0500562_023006 Ga0500562_023006_452_1357 301
632 3300053109 Ga0500569_037970 Ga0500569_037970_269_1174 301
633 3300053110 Ga0500571_000014 Ga0500571_000014_29626_30600 301
634 3300053110 Ga0500571_000184 Ga0500571_000184_7269_8174 301
635 3300053111 Ga0500572_013347 Ga0500572_013347_1044_1949 301
636 3300053117 Ga0500593_000097 Ga0500593_000097_7162_8067 301
637 3300053118 Ga0500594_0002082 Ga0500594_0002082_2263_3168 301
638 3300053121 Ga0500607_000049 Ga0500607_000049_25577_26482 301
639 3300053121 Ga0500607_056366 Ga0500607_056366_454_1359 301
640 3300053122 Ga0500608_068719 Ga0500608_068719_467_1372 301
641 3300053125 Ga0500618_009996 Ga0500618_009996_1312_2286 301
642 3300053125 Ga0500618_012765 Ga0500618_012765_426_1331 301
643 3300053128 Ga0500626_020844 Ga0500626_020844_194_1099 301
644 3300053133 Ga0500655_000268 Ga0500655_000268_10810_11715 301
645 3300053134 Ga0500658_0000028 Ga0500658_0000028_94499_95404 301
646 3300053136 Ga0500559_0006998 Ga0500559_0006998_2155_3060 301
647 3300053138 Ga0500564_013350 Ga0500564_013350_2389_3294 301
648 3300053141 Ga0500574_000473 Ga0500574_000473_385_1359 301
649 3300053141 Ga0500574_025612 Ga0500574_025612_564_1469 301
650 3300053145 Ga0500586_011561 Ga0500586_011561_1415_2320 301
651 3300053153 Ga0500616_0006575 Ga0500616_0006575_837_1742 301
652 3300053153 Ga0500616_0044142 Ga0500616_0044142_328_1233 301
653 3300053154 Ga0500619_052177 Ga0500619_052177_92_997 301
654 3300053157 Ga0500624_006576 Ga0500624_006576_533_1438 301
655 3300053158 Ga0500627_0000960 Ga0500627_0000960_4544_5449 301
656 3300053161 Ga0500634_0073846 Ga0500634_0073846_271_1176 301
657 3300053162 Ga0500638_000705 Ga0500638_000705_3551_4456 301
658 3300053177 Ga0500636_0004955 Ga0500636_0004955_6118_7023 301
659 3300053177 Ga0500636_0031746 Ga0500636_0031746_318_1292 301
660 3300053734 Ga0500565_000232 Ga0500565_000232_444_1349 301
661 3300053735 Ga0500596_003145 Ga0500596_003145_894_1799 301
662 iso_pu_bacteria 2513237150 2513953571 301
663 iso_pu_bacteria 2513237165 2514044264 301
664 iso_pu_bacteria 2600255256 2601536024 301
665 iso_pu_bacteria 2600255257 2601540428 301
666 iso_pu_bacteria 2600255310 2601759018 301
667 iso_pu_bacteria 2600255311 2601764920 301
668 iso_pu_bacteria 2874645413 2874649509 301
669 iso_pu_bacteria 2879127579 2879129496 301
670 iso_pu_bacteria 2879142872 2879145705 301
671 iso_pu_bacteria 644736347 644750390 301
672 iso_pu_bacteria 8052494512 8052497115 301
673 3300005337 Ga0070682_100228997 Ga0070682_1002289971 302
674 3300005347 Ga0070668_100084023 Ga0070668_1000840232 302
675 3300005441 Ga0070700_100424362 Ga0070700_1004243621 302
676 3300005455 Ga0070663_100016874 Ga0070663_1000168742 302
677 3300005548 Ga0070665_100011917 Ga0070665_10001191710 302
678 3300005548 Ga0070665_100280375 Ga0070665_1002803752 302
679 3300005983 Ga0081540_1000043 Ga0081540_100004323 302
680 3300006038 Ga0075365_10068132 Ga0075365_100681323 302
681 3300006048 Ga0075363_100001349 Ga0075363_1000013495 302
682 3300006048 Ga0075363_100016115 Ga0075363_1000161154 302
683 3300006051 Ga0075364_10024837 Ga0075364_100248372 302
684 3300006178 Ga0075367_10088648 Ga0075367_100886482 302
685 3300006186 Ga0075369_10005705 Ga0075369_100057054 302
686 3300006195 Ga0075366_10006105 Ga0075366_100061054 302
687 3300006353 Ga0075370_10015831 Ga0075370_100158315 302
688 3300009011 Ga0105251_10004915 Ga0105251_100049154 302
689 3300009036 Ga0105244_10000940 Ga0105244_100009408 302
690 3300009036 Ga0105244_10003907 Ga0105244_100039079 302
691 3300009092 Ga0105250_10000214 Ga0105250_100002146 302
692 3300009092 Ga0105250_10009734 Ga0105250_100097343 302
693 3300009094 Ga0111539_10000100 Ga0111539_1000010030 302
694 3300009101 Ga0105247_10147196 Ga0105247_101471962 302
695 3300009174 Ga0105241_10255513 Ga0105241_102555132 302
696 3300009176 Ga0105242_10067761 Ga0105242_100677612 302
697 3300009545 Ga0105237_10027652 Ga0105237_100276523 302
698 3300009553 Ga0105249_10132161 Ga0105249_101321613 302
699 3300010375 Ga0105239_10003423 Ga0105239_100034238 302
700 3300013105 Ga0157369_10037511 Ga0157369_100375115 302
701 3300014325 Ga0163163_10282202 Ga0163163_102822022 302
702 3300015261 Ga0182006_1000018 Ga0182006_100001827 302
703 3300025284 Ga0209130_1000028 Ga0209130_100002898 302
704 3300025302 Ga0207426_1000012 Ga0207426_1000012483 302
705 3300025728 Ga0207655_1000160 Ga0207655_1000160121 302
706 3300025728 Ga0207655_1005275 Ga0207655_10052753 302
707 3300025735 Ga0207713_1002406 Ga0207713_100240611 302
708 3300025910 Ga0207684_10092949 Ga0207684_100929492 302
709 3300025972 Ga0207668_10241705 Ga0207668_102417051 302
710 3300025981 Ga0207640_10020437 Ga0207640_100204373 302
711 3300026067 Ga0207678_10113512 Ga0207678_101135123 302
712 3300027907 Ga0207428_10003169 Ga0207428_100031697 302
713 3300028379 Ga0268266_10006135 Ga0268266_100061353 302
714 3300035170 Ga0373943_0078723 Ga0373943_0078723_682_1590 302
715 3300035691 Ga0373931_0000734 Ga0373931_0000734_6230_7138 302
716 3300035692 Ga0373935_0132600 Ga0373935_0132600_100_1008 302
717 3300035695 Ga0373927_0094982 Ga0373927_0094982_417_1325 302
718 3300037418 Ga0395900_0011179 Ga0395900_0011179_1683_2594 302
719 3300037466 Ga0395898_0008863 Ga0395898_0008863_3180_4091 302
720 3300038443 Ga0395901_0010483 Ga0395901_0010483_5554_6465 302
721 3300041997 Ga0439431_0007455 Ga0439431_0007455_321_1232 302
722 3300044842 Ga0466957_0121751 Ga0466957_0121751_739_1650 302
723 3300044901 Ga0466960_0058399 Ga0466960_0058399_192_1103 302
724 3300046453 Ga0495627_001189 Ga0495627_001189_3821_4729 302
725 3300046458 Ga0495591_000076 Ga0495591_000076_37460_38371 302
726 3300046460 Ga0495638_0000022 Ga0495638_0000022_111592_112500 302
727 3300046471 Ga0495650_0000031 Ga0495650_0000031_47864_48775 302
728 3300046475 Ga0495639_0035495 Ga0495639_0035495_1144_2052 302
729 3300046477 Ga0495664_0007012 Ga0495664_0007012_278_1186 302
730 3300046491 Ga0495584_0006322 Ga0495584_0006322_1622_2533 302
731 3300046491 Ga0495584_0049904 Ga0495584_0049904_903_1811 302
732 3300046501 Ga0495607_0000073 Ga0495607_0000073_51493_52401 302
733 3300046506 Ga0495583_0000032 Ga0495583_0000032_133426_134334 302
734 3300046507 Ga0495606_0000816 Ga0495606_0000816_24564_25475 302
735 3300046507 Ga0495606_0018109 Ga0495606_0018109_3340_4251 302
736 3300046512 Ga0495610_0000043 Ga0495610_0000043_25819_26727 302
737 3300046517 Ga0495630_0319723 Ga0495630_0319723_91_999 302
738 3300046519 Ga0495632_0000053 Ga0495632_0000053_120924_121832 302
739 3300046519 Ga0495632_0002091 Ga0495632_0002091_12769_13677 302
740 3300046522 Ga0495643_0000061 Ga0495643_0000061_61042_61950 302
741 3300046524 Ga0495648_0000051 Ga0495648_0000051_50003_50911 302
742 3300046524 Ga0495648_0038813 Ga0495648_0038813_633_1541 302
743 3300046525 Ga0495663_0000012 Ga0495663_0000012_10153_11061 302
744 3300046525 Ga0495663_0000295 Ga0495663_0000295_1124_2032 302
745 3300046526 Ga0495666_0192814 Ga0495666_0192814_15_923 302
746 3300046530 Ga0495654_0000079 Ga0495654_0000079_16174_17085 302
747 3300046530 Ga0495654_0000647 Ga0495654_0000647_22956_23867 302
748 3300046530 Ga0495654_0002365 Ga0495654_0002365_2809_3717 302
749 3300046530 Ga0495654_0003208 Ga0495654_0003208_6262_7173 302
750 3300046558 Ga0495633_0000417 Ga0495633_0000417_5152_6060 302
751 3300046558 Ga0495633_0009251 Ga0495633_0009251_2434_3342 302
752 3300046559 Ga0495667_0103164 Ga0495667_0103164_537_1445 302
753 3300046660 Ga0495625_0005973 Ga0495625_0005973_1912_2820 302
754 3300046660 Ga0495625_0056526 Ga0495625_0056526_746_1654 302
755 3300046665 Ga0495661_0009808 Ga0495661_0009808_1503_2411 302
756 3300046665 Ga0495661_0099321 Ga0495661_0099321_389_1297 302
757 3300046681 Ga0495647_0040328 Ga0495647_0040328_782_1690 302
758 3300046683 Ga0495658_0066815 Ga0495658_0066815_594_1502 302
759 3300046683 Ga0495658_0251632 Ga0495658_0251632_74_982 302
760 3300046689 Ga0495613_0297756 Ga0495613_0297756_68_976 302
761 3300046691 Ga0495670_0000023 Ga0495670_0000023_53957_54868 302
762 3300046692 Ga0495671_0000004 Ga0495671_0000004_112727_113635 302
763 3300046692 Ga0495671_0000036 Ga0495671_0000036_61042_61950 302
764 3300046694 Ga0495649_0006464 Ga0495649_0006464_5281_6192 302
765 3300046794 Ga0495589_0000681 Ga0495589_0000681_2674_3582 302
766 3300046810 Ga0495660_0087131 Ga0495660_0087131_605_1516 302
767 3300047315 Ga0495581_0046517 Ga0495581_0046517_553_1461 302
768 3300047323 Ga0495683_0001753 Ga0495683_0001753_3008_3919 302
769 3300047323 Ga0495683_0005382 Ga0495683_0005382_4539_5447 302
770 3300047446 Ga0495679_000021 Ga0495679_000021_2587_3495 302
771 3300047446 Ga0495679_001352 Ga0495679_001352_10029_10940 302
772 3300047469 Ga0495673_0000021 Ga0495673_0000021_112727_113635 302
773 3300047469 Ga0495673_0004916 Ga0495673_0004916_3423_4334 302
774 3300047470 Ga0495681_0000025 Ga0495681_0000025_121433_122341 302
775 3300047470 Ga0495681_0021085 Ga0495681_0021085_1407_2315 302
776 3300047471 Ga0495684_0325875 Ga0495684_0325875_19_927 302
777 3300047472 Ga0495686_0010155 Ga0495686_0010155_1744_2652 302
778 3300047472 Ga0495686_0105569 Ga0495686_0105569_340_1248 302
779 3300048904 Ga0496101_0039396 Ga0496101_0039396_132_1040 302
780 3300048905 Ga0496102_0015763 Ga0496102_0015763_5102_6010 302
781 3300048906 Ga0496103_0011177 Ga0496103_0011177_4051_4959 302
782 3300048907 Ga0496104_0006298 Ga0496104_0006298_7661_8569 302
783 3300048908 Ga0496105_0003948 Ga0496105_0003948_1750_2658 302
784 3300048909 Ga0496106_0009702 Ga0496106_0009702_287_1195 302
785 3300048910 Ga0496107_0005072 Ga0496107_0005072_1424_2332 302
786 3300048911 Ga0496108_0009867 Ga0496108_0009867_4534_5442 302
787 3300048912 Ga0496109_0010294 Ga0496109_0010294_5211_6119 302
788 3300048912 Ga0496109_0214783 Ga0496109_0214783_424_1335 302
789 3300048914 Ga0496111_0012959 Ga0496111_0012959_4283_5191 302
790 3300048915 Ga0496112_0003139 Ga0496112_0003139_6338_7246 302
791 3300048916 Ga0496113_0001253 Ga0496113_0001253_9675_10583 302
792 3300048917 Ga0496114_0006457 Ga0496114_0006457_1742_2650 302
793 3300048918 Ga0496115_0006763 Ga0496115_0006763_91_999 302
794 3300048919 Ga0496116_0041236 Ga0496116_0041236_1115_2023 302
795 3300048920 Ga0496117_0007269 Ga0496117_0007269_3567_4478 302
796 3300048921 Ga0496118_0008039 Ga0496118_0008039_6421_7332 302
797 3300048922 Ga0496119_0022158 Ga0496119_0022158_1481_2389 302
798 3300048922 Ga0496119_0067202 Ga0496119_0067202_655_1566 302
799 3300048922 Ga0496119_0069871 Ga0496119_0069871_896_1807 302
800 3300048923 Ga0496120_0012122 Ga0496120_0012122_1830_2738 302
801 3300048923 Ga0496120_0024033 Ga0496120_0024033_555_1466 302
802 3300048924 Ga0496121_0051603 Ga0496121_0051603_582_1493 302
803 3300048925 Ga0496122_0103251 Ga0496122_0103251_383_1294 302
804 3300048927 Ga0496124_0008347 Ga0496124_0008347_3470_4381 302
805 3300048927 Ga0496124_0182342 Ga0496124_0182342_382_1290 302
806 3300048927 Ga0496124_0359585 Ga0496124_0359585_80_991 302
807 3300048929 Ga0496126_0237692 Ga0496126_0237692_46_954 302
808 3300049459 Ga0495678_007172 Ga0495678_007172_4263_5174 302
809 3300049459 Ga0495678_009864 Ga0495678_009864_2286_3194 302
810 3300049460 Ga0495682_0000001 Ga0495682_0000001_516627_517538 302
811 3300050490 nmdc:mga03n38_79_c1 nmdc:mga03n38_79_c1_7324_8235 302
812 3300050491 nmdc:mga00v17_17584_c1 nmdc:mga00v17_17584_c1_746_1654 302
813 3300050492 nmdc:mga0yw44_35393_c1 nmdc:mga0yw44_35393_c1_1530_2441 302
814 3300050495 nmdc:mga04h51_40289_c1 nmdc:mga04h51_40289_c1_156_1067 302
815 3300050496 nmdc:mga07m45_1185_c2 nmdc:mga07m45_1185_c2_5687_6598 302
816 3300050511 nmdc:mga08y16_62_c1 nmdc:mga08y16_62_c1_53072_53983 302
817 3300050516 nmdc:mga0sz30_1741_c1 nmdc:mga0sz30_1741_c1_4282_5190 302
818 3300053088 Ga0500644_0034853 Ga0500644_0034853_120_1028 302
819 3300053121 Ga0500607_160573 Ga0500607_160573_44_952 302
820 3300053136 Ga0500559_0053877 Ga0500559_0053877_134_1042 302
821 3300053156 Ga0500622_0044755 Ga0500622_0044755_76_984 302
822 3300053161 Ga0500634_0035569 Ga0500634_0035569_105_1013 302
823 3300005340 Ga0070689_100117556 Ga0070689_1001175562 303
824 3300005354 Ga0070675_100031205 Ga0070675_1000312053 303
825 3300005355 Ga0070671_100018199 Ga0070671_1000181995 303
826 3300005365 Ga0070688_100065460 Ga0070688_1000654602 303
827 3300005367 Ga0070667_100223403 Ga0070667_1002234032 303
828 3300006038 Ga0075365_10047528 Ga0075365_100475282 303
829 3300009036 Ga0105244_10000090 Ga0105244_1000009024 303
830 3300024227 Ga0228598_1014675 Ga0228598_10146751 303
831 3300025728 Ga0207655_1000004 Ga0207655_1000004130 303
832 3300025926 Ga0207659_10169508 Ga0207659_101695081 303
833 3300025931 Ga0207644_10005620 Ga0207644_100056207 303
834 3300025945 Ga0207679_10151303 Ga0207679_101513034 303
835 3300025960 Ga0207651_10025521 Ga0207651_100255213 303
836 3300030760 Ga0265762_1009861 Ga0265762_10098611 303
837 3300035086 Ga0373934_0025950 Ga0373934_0025950_87_998 303
838 3300035111 Ga0373923_0085313 Ga0373923_0085313_59_970 303
839 3300035171 Ga0373946_0031446 Ga0373946_0031446_1133_2044 303
840 3300035410 Ga0373924_0094292 Ga0373924_0094292_80_991 303
841 3300036401 Ga0373937_0036024 Ga0373937_0036024_2511_3422 303
842 3300037068 Ga0373925_0331599 Ga0373925_0331599_312_1223 303
843 3300046454 Ga0495592_0056376 Ga0495592_0056376_352_1263 303
844 3300046457 Ga0495590_0000995 Ga0495590_0000995_75_986 303
845 3300046459 Ga0495629_0296270 Ga0495629_0296270_46_957 303
846 3300046463 Ga0495653_0041391 Ga0495653_0041391_400_1311 303
847 3300046476 Ga0495662_0146261 Ga0495662_0146261_189_1100 303
848 3300046501 Ga0495607_0016210 Ga0495607_0016210_3715_4626 303
849 3300046501 Ga0495607_0042724 Ga0495607_0042724_251_1189 303
850 3300046507 Ga0495606_0007864 Ga0495606_0007864_8338_9276 303
851 3300046507 Ga0495606_0100873 Ga0495606_0100873_421_1332 303
852 3300046512 Ga0495610_0009552 Ga0495610_0009552_4992_5903 303
853 3300046517 Ga0495630_0232668 Ga0495630_0232668_347_1258 303
854 3300046519 Ga0495632_0000361 Ga0495632_0000361_38902_39813 303
855 3300046522 Ga0495643_0001821 Ga0495643_0001821_13770_14708 303
856 3300046524 Ga0495648_0000768 Ga0495648_0000768_16786_17697 303
857 3300046529 Ga0495652_0175079 Ga0495652_0175079_333_1244 303
858 3300046542 Ga0495597_0017793 Ga0495597_0017793_1744_2655 303
859 3300046665 Ga0495661_0065506 Ga0495661_0065506_244_1155 303
860 3300046675 Ga0495657_0167043 Ga0495657_0167043_257_1168 303
861 3300046678 Ga0495599_0171601 Ga0495599_0171601_107_1018 303
862 3300046683 Ga0495658_0263672 Ga0495658_0263672_150_1061 303
863 3300046690 Ga0495624_0050773 Ga0495624_0050773_1662_2597 303
864 3300046691 Ga0495670_0000046 Ga0495670_0000046_24320_25231 303
865 3300046694 Ga0495649_0021834 Ga0495649_0021834_305_1216 303
866 3300047317 Ga0495604_0070511 Ga0495604_0070511_36_947 303
867 3300047322 Ga0495680_0087806 Ga0495680_0087806_308_1219 303
868 3300047469 Ga0495673_0019391 Ga0495673_0019391_385_1296 303
869 3300047472 Ga0495686_0000266 Ga0495686_0000266_6660_7598 303
870 3300048912 Ga0496109_0170451 Ga0496109_0170451_29_940 303
871 3300048914 Ga0496111_0242549 Ga0496111_0242549_129_1040 303
872 3300048916 Ga0496113_0276356 Ga0496113_0276356_178_1089 303
873 3300048919 Ga0496116_0001333 Ga0496116_0001333_13782_14720 303
874 3300049460 Ga0495682_0021523 Ga0495682_0021523_1395_2306 303
875 3300049460 Ga0495682_0043075 Ga0495682_0043075_363_1301 303
876 3300053084 Ga0495595_0049634 Ga0495595_0049634_855_1766 303
877 3300053145 Ga0500586_000041 Ga0500586_000041_19073_19984 303
878 iso_pu_bacteria 2721755763 2723875799 303
879 3300025284 Ga0209130_1000167 Ga0209130_10001677 304
880 3300025302 Ga0207426_1000370 Ga0207426_100037073 304
881 3300037068 Ga0373925_0036771 Ga0373925_0036771_387_1301 304
882 3300044684 Ga0466966_0050900 Ga0466966_0050900_576_1517 304
883 3300046453 Ga0495627_001102 Ga0495627_001102_895_1809 304
884 3300046471 Ga0495650_0004706 Ga0495650_0004706_3412_4326 304
885 3300046501 Ga0495607_0000025 Ga0495607_0000025_95369_96283 304
886 3300046506 Ga0495583_0000118 Ga0495583_0000118_105331_106245 304
887 3300046506 Ga0495583_0000659 Ga0495583_0000659_18802_19716 304
888 3300046512 Ga0495610_0037514 Ga0495610_0037514_749_1663 304
889 3300046515 Ga0495620_0000203 Ga0495620_0000203_9872_10786 304
890 3300046530 Ga0495654_0001513 Ga0495654_0001513_5083_5997 304
891 3300046542 Ga0495597_0001224 Ga0495597_0001224_9888_10802 304
892 3300046665 Ga0495661_0000005 Ga0495661_0000005_303553_304467 304
893 3300046691 Ga0495670_0018939 Ga0495670_0018939_1944_2858 304
894 3300046794 Ga0495589_0000793 Ga0495589_0000793_8951_9865 304
895 3300046810 Ga0495660_0000179 Ga0495660_0000179_50760_51674 304
896 3300046810 Ga0495660_0000296 Ga0495660_0000296_39108_40022 304
897 3300047320 Ga0495672_0000001 Ga0495672_0000001_843569_844483 304
898 3300047323 Ga0495683_0000031 Ga0495683_0000031_10006_10920 304
899 3300048917 Ga0496114_0137391 Ga0496114_0137391_295_1269 304
900 3300049459 Ga0495678_000375 Ga0495678_000375_34488_35402 304
901 iso_pu_bacteria 2562617112 2563065005 304
902 iso_pu_bacteria 2711768613 2713482006 304
903 3300006195 Ga0075366_10018681 Ga0075366_100186811 305
904 3300009011 Ga0105251_10002880 Ga0105251_100028802 305
905 3300013102 Ga0157371_10000040 Ga0157371_1000004028 305
906 3300028794 Ga0307515_10171899 Ga0307515_101718992 305
907 3300031507 Ga0307509_10001515 Ga0307509_1000151514 305
908 3300031507 Ga0307509_10089009 Ga0307509_100890094 305
909 3300031616 Ga0307508_10001814 Ga0307508_100018142 305
910 3300031649 Ga0307514_10126494 Ga0307514_101264943 305
911 3300033180 Ga0307510_10037518 Ga0307510_100375187 305
912 3300033180 Ga0307510_10129894 Ga0307510_101298941 305
913 3300046452 Ga0495617_017191 Ga0495617_017191_1337_2254 305
914 3300046454 Ga0495592_0000175 Ga0495592_0000175_14616_15533 305
915 3300046455 Ga0495603_0015555 Ga0495603_0015555_2155_3072 305
916 3300046457 Ga0495590_0000002 Ga0495590_0000002_342550_343494 305
917 3300046459 Ga0495629_0017431 Ga0495629_0017431_1796_2713 305
918 3300046474 Ga0495605_0019013 Ga0495605_0019013_2304_3221 305
919 3300046491 Ga0495584_0102687 Ga0495584_0102687_469_1386 305
920 3300046492 Ga0495585_0005963 Ga0495585_0005963_4092_5009 305
921 3300046499 Ga0495594_0005625 Ga0495594_0005625_2485_3402 305
922 3300046500 Ga0495596_0013544 Ga0495596_0013544_2334_3251 305
923 3300046501 Ga0495607_0016252 Ga0495607_0016252_2687_3604 305
924 3300046513 Ga0495616_0064168 Ga0495616_0064168_850_1767 305
925 3300046515 Ga0495620_0083752 Ga0495620_0083752_310_1227 305
926 3300046518 Ga0495631_0011038 Ga0495631_0011038_3318_4235 305
927 3300046518 Ga0495631_0026272 Ga0495631_0026272_850_1767 305
928 3300046519 Ga0495632_0000031 Ga0495632_0000031_107041_107958 305
929 3300046519 Ga0495632_0000244 Ga0495632_0000244_11622_12539 305
930 3300046523 Ga0495644_0009390 Ga0495644_0009390_1673_2590 305
931 3300046523 Ga0495644_0012531 Ga0495644_0012531_163_1080 305
932 3300046524 Ga0495648_0000352 Ga0495648_0000352_10613_11530 305
933 3300046524 Ga0495648_0023882 Ga0495648_0023882_261_1178 305
934 3300046528 Ga0495642_0081395 Ga0495642_0081395_65_982 305
935 3300046531 Ga0495665_0074006 Ga0495665_0074006_468_1385 305
936 3300046536 Ga0495587_0167315 Ga0495587_0167315_280_1197 305
937 3300046538 Ga0495609_0000484 Ga0495609_0000484_8967_9884 305
938 3300046542 Ga0495597_0029680 Ga0495597_0029680_383_1300 305
939 3300046557 Ga0495622_0016428 Ga0495622_0016428_226_1143 305
940 3300046616 Ga0495668_0001733 Ga0495668_0001733_14281_15225 305
941 3300046616 Ga0495668_0051004 Ga0495668_0051004_485_1402 305
942 3300046648 Ga0495611_0001962 Ga0495611_0001962_4083_5000 305
943 3300046648 Ga0495611_0012377 Ga0495611_0012377_226_1143 305
944 3300046665 Ga0495661_0010610 Ga0495661_0010610_2765_3682 305
945 3300046674 Ga0495588_0013228 Ga0495588_0013228_2657_3574 305
946 3300046684 Ga0495669_0000693 Ga0495669_0000693_10337_11254 305
947 3300046684 Ga0495669_0000729 Ga0495669_0000729_7228_8145 305
948 3300046689 Ga0495613_0004700 Ga0495613_0004700_7846_8763 305
949 3300046691 Ga0495670_0020320 Ga0495670_0020320_886_1803 305
950 3300046691 Ga0495670_0056822 Ga0495670_0056822_354_1298 305
951 3300046694 Ga0495649_0054965 Ga0495649_0054965_424_1341 305
952 3300046794 Ga0495589_0018452 Ga0495589_0018452_472_1389 305
953 3300046810 Ga0495660_0000712 Ga0495660_0000712_1218_2135 305
954 3300047315 Ga0495581_0013183 Ga0495581_0013183_2018_2935 305
955 3300047322 Ga0495680_0074689 Ga0495680_0074689_1088_2005 305
956 3300047445 Ga0495677_0011997 Ga0495677_0011997_2020_2937 305
957 3300048089 Ga0495614_0008966 Ga0495614_0008966_909_1826 305
958 3300049459 Ga0495678_003291 Ga0495678_003291_4202_5146 305
959 3300050492 nmdc:mga0yw44_64950_c1 nmdc:mga0yw44_64950_c1_975_1895 305
960 3300053118 Ga0500594_0000881 Ga0500594_0000881_852_1769 305
961 3300053125 Ga0500618_000126 Ga0500618_000126_24086_25003 305
962 3300053135 Ga0500659_0000385 Ga0500659_0000385_4011_4928 305
963 3300053156 Ga0500622_0016447 Ga0500622_0016447_1024_1941 305
964 3300053739 Ga0500587_001560 Ga0500587_001560_685_1602 305
965 iso_pu_bacteria 2511231031 2511413105 305
966 iso_pu_bacteria 2597489888 2597864069 305
967 iso_pu_bacteria 2643221650 2644282620 305
968 iso_pu_bacteria 2738541271 2738687830 305
969 iso_pu_bacteria 2738543016 2739263735 305
970 iso_pu_bacteria 2738543025 2739313216 305
971 iso_pu_bacteria 2884411467 2884413920 305
972 iso_pu_bacteria 2908446538 2908450701 305
973 iso_pu_bacteria 2969304461 2969307103 305
974 3300030745 Ga0316182_1423226 Ga0316182_14232261 306
975 3300046453 Ga0495627_000014 Ga0495627_000014_7248_8171 306
976 3300046462 Ga0495651_0283165 Ga0495651_0283165_156_1076 306
977 3300046501 Ga0495607_0002127 Ga0495607_0002127_2472_3395 306
978 3300046519 Ga0495632_0001229 Ga0495632_0001229_13998_14921 306
979 3300046530 Ga0495654_0000363 Ga0495654_0000363_2925_3848 306
980 3300046694 Ga0495649_0001191 Ga0495649_0001191_10203_11126 306
981 3300047320 Ga0495672_0002149 Ga0495672_0002149_2093_3016 306
982 3300048905 Ga0496102_0273682 Ga0496102_0273682_54_1067 306
983 3300049569 Ga0501032_0002532 Ga0501032_0002532_12971_13918 306
984 3300049570 Ga0501033_0031438 Ga0501033_0031438_586_1533 306
985 3300049571 Ga0501034_0029887 Ga0501034_0029887_1862_2809 306
986 3300049572 Ga0501036_0060749 Ga0501036_0060749_485_1432 306
987 3300049573 Ga0501037_0048810 Ga0501037_0048810_1669_2616 306
988 3300049574 Ga0501038_0000593 Ga0501038_0000593_27901_28848 306
989 3300049575 Ga0501039_0017811 Ga0501039_0017811_1206_2153 306
990 3300049579 Ga0501043_0013887 Ga0501043_0013887_3774_4721 306
991 3300049580 Ga0501046_0116003 Ga0501046_0116003_485_1432 306
992 3300049581 Ga0501047_0287674 Ga0501047_0287674_280_1227 306
993 3300049582 Ga0501048_0071387 Ga0501048_0071387_623_1570 306
994 3300049583 Ga0501067_0005973 Ga0501067_0005973_4022_4969 306
995 3300049585 Ga0501069_0000497 Ga0501069_0000497_16431_17378 306
996 3300049586 Ga0501070_0067612 Ga0501070_0067612_206_1153 306
997 3300049589 Ga0501073_0027391 Ga0501073_0027391_2956_3903 306
998 3300049590 Ga0501074_0026304 Ga0501074_0026304_1359_2306 306
999 3300049741 Ga0501079_0169186 Ga0501079_0169186_387_1334 306
1000 3300049742 Ga0501080_0028056 Ga0501080_0028056_2726_3673 306
1001 3300049744 Ga0501083_0008696 Ga0501083_0008696_1933_2880 306
1002 3300049822 Ga0501035_0048034 Ga0501035_0048034_2602_3549 306
1003 3300049823 Ga0501044_0026146 Ga0501044_0026146_1935_2882 306
1004 3300049824 Ga0501045_0039347 Ga0501045_0039347_1139_2086 306
1005 3300053125 Ga0500618_000386 Ga0500618_000386_26138_27061 306
1006 3300054114 Ga0501084_0024652 Ga0501084_0024652_2136_3083 306
1007 3300060353 Ga0501082_0024951 Ga0501082_0024951_2789_3736 306
1008 3300046518 Ga0495631_0001521 Ga0495631_0001521_7665_8615 307
1009 3300046519 Ga0495632_0025616 Ga0495632_0025616_1747_2670 307
1010 3300046524 Ga0495648_0014129 Ga0495648_0014129_3157_4080 307
1011 3300046660 Ga0495625_0083311 Ga0495625_0083311_833_1756 307
1012 3300046810 Ga0495660_0000136 Ga0495660_0000136_24551_25474 307
1013 3300048091 Ga0495626_0008149 Ga0495626_0008149_1722_2645 307
1014 3300049459 Ga0495678_003236 Ga0495678_003236_5350_6273 307
1015 3300053153 Ga0500616_0005154 Ga0500616_0005154_6694_7644 307
1016 3300005344 Ga0070661_100379302 Ga0070661_1003793022 308
1017 3300006048 Ga0075363_100006511 Ga0075363_1000065116 308
1018 3300006177 Ga0075362_10153921 Ga0075362_101539211 308
1019 3300015261 Ga0182006_1000389 Ga0182006_100038921 308
1020 3300025246 Ga0209646_1000007 Ga0209646_1000007483 308
1021 3300025250 Ga0209026_1013010 Ga0209026_10130101 308
1022 3300025933 Ga0207706_10001057 Ga0207706_1000105721 308
1023 3300035118 Ga0373954_0023733 Ga0373954_0023733_1268_2245 308
1024 3300035172 Ga0373955_0037831 Ga0373955_0037831_355_1332 308
1025 3300035692 Ga0373935_0059945 Ga0373935_0059945_340_1317 308
1026 3300035724 Ga0373933_0013860 Ga0373933_0013860_258_1235 308
1027 3300036401 Ga0373937_0006936 Ga0373937_0006936_389_1366 308
1028 3300037068 Ga0373925_0323392 Ga0373925_0323392_190_1167 308
1029 3300044658 Ga0466972_0001328 Ga0466972_0001328_3469_4428 308
1030 3300046454 Ga0495592_0007097 Ga0495592_0007097_5010_5987 308
1031 3300046459 Ga0495629_0013668 Ga0495629_0013668_2718_3695 308
1032 3300046462 Ga0495651_0000198 Ga0495651_0000198_19722_20699 308
1033 3300046463 Ga0495653_0013367 Ga0495653_0013367_239_1216 308
1034 3300046477 Ga0495664_0157392 Ga0495664_0157392_27_1004 308
1035 3300046511 Ga0495608_0001490 Ga0495608_0001490_13053_14030 308
1036 3300046517 Ga0495630_0141618 Ga0495630_0141618_332_1309 308
1037 3300046529 Ga0495652_0005898 Ga0495652_0005898_7471_8448 308
1038 3300046533 Ga0495640_0020078 Ga0495640_0020078_2045_3022 308
1039 3300046536 Ga0495587_0001240 Ga0495587_0001240_14279_15256 308
1040 3300046543 Ga0495645_0237644 Ga0495645_0237644_29_1006 308
1041 3300046559 Ga0495667_0005015 Ga0495667_0005015_1211_2188 308
1042 3300046663 Ga0495635_0001797 Ga0495635_0001797_13064_14041 308
1043 3300046679 Ga0495623_0001077 Ga0495623_0001077_12862_13839 308
1044 3300046683 Ga0495658_0150072 Ga0495658_0150072_352_1329 308
1045 3300046689 Ga0495613_0227503 Ga0495613_0227503_79_1056 308
1046 3300046809 Ga0495600_0049234 Ga0495600_0049234_159_1136 308
1047 3300047317 Ga0495604_0002503 Ga0495604_0002503_11704_12681 308
1048 3300047319 Ga0495674_0009382 Ga0495674_0009382_6721_7698 308
1049 3300047322 Ga0495680_0001339 Ga0495680_0001339_20132_21109 308
1050 3300047444 Ga0495675_0032070 Ga0495675_0032070_2153_3130 308
1051 3300047471 Ga0495684_0039619 Ga0495684_0039619_1991_2968 308
1052 3300047673 Ga0495593_0022457 Ga0495593_0022457_1999_2976 308
1053 3300048088 Ga0495602_0008217 Ga0495602_0008217_2662_3639 308
1054 3300048907 Ga0496104_0354089 Ga0496104_0354089_130_1068 308
1055 3300048908 Ga0496105_0409891 Ga0496105_0409891_17_955 308
1056 3300050489 nmdc:mga03683_45675_c1 nmdc:mga03683_45675_c1_661_1614 308
1057 3300050493 nmdc:mga0k408_31413_c1 nmdc:mga0k408_31413_c1_1945_2871 308
1058 3300053077 Ga0495601_0108452 Ga0495601_0108452_464_1441 308
1059 3300053078 Ga0495612_0000635 Ga0495612_0000635_5354_6331 308
1060 3300053084 Ga0495595_0000382 Ga0495595_0000382_14613_15590 308
1061 3300053085 Ga0495619_0001282 Ga0495619_0001282_15193_16170 308
1062 3300006051 Ga0075364_10124761 Ga0075364_101247612 309
1063 3300006058 Ga0075432_10000157 Ga0075432_100001574 309
1064 3300009092 Ga0105250_10010134 Ga0105250_100101343 309
1065 3300012498 Ga0157345_1000001 Ga0157345_1000001113 309
1066 3300013100 Ga0157373_10000060 Ga0157373_1000006039 309
1067 3300013105 Ga0157369_10000236 Ga0157369_1000023612 309
1068 3300025711 Ga0207696_1010502 Ga0207696_10105022 309
1069 3300025728 Ga0207655_1000325 Ga0207655_100032550 309
1070 3300027907 Ga0207428_10021968 Ga0207428_100219682 309
1071 3300031730 Ga0307516_10197754 Ga0307516_101977542 309
1072 3300042137 Ga0450902_000142 Ga0450902_000142_565_1503 309
1073 3300046452 Ga0495617_003500 Ga0495617_003500_1761_2699 309
1074 3300046453 Ga0495627_000031 Ga0495627_000031_166201_167139 309
1075 3300046453 Ga0495627_005339 Ga0495627_005339_2719_3657 309
1076 3300046458 Ga0495591_000730 Ga0495591_000730_3864_4802 309
1077 3300046458 Ga0495591_000801 Ga0495591_000801_10151_11089 309
1078 3300046458 Ga0495591_004237 Ga0495591_004237_5121_6059 309
1079 3300046460 Ga0495638_0028333 Ga0495638_0028333_2355_3293 309
1080 3300046463 Ga0495653_0000535 Ga0495653_0000535_1558_2496 309
1081 3300046463 Ga0495653_0069281 Ga0495653_0069281_255_1193 309
1082 3300046471 Ga0495650_0008100 Ga0495650_0008100_3946_4884 309
1083 3300046474 Ga0495605_0000219 Ga0495605_0000219_38673_39611 309
1084 3300046474 Ga0495605_0006230 Ga0495605_0006230_2684_3622 309
1085 3300046474 Ga0495605_0049555 Ga0495605_0049555_350_1288 309
1086 3300046492 Ga0495585_0029087 Ga0495585_0029087_2054_2992 309
1087 3300046500 Ga0495596_0000028 Ga0495596_0000028_101453_102391 309
1088 3300046500 Ga0495596_0002599 Ga0495596_0002599_1846_2784 309
1089 3300046500 Ga0495596_0016021 Ga0495596_0016021_951_1889 309
1090 3300046506 Ga0495583_0004219 Ga0495583_0004219_1469_2407 309
1091 3300046507 Ga0495606_0000656 Ga0495606_0000656_39746_40684 309
1092 3300046507 Ga0495606_0001711 Ga0495606_0001711_24290_25228 309
1093 3300046507 Ga0495606_0055180 Ga0495606_0055180_789_1727 309
1094 3300046512 Ga0495610_0000287 Ga0495610_0000287_43622_44560 309
1095 3300046513 Ga0495616_0000225 Ga0495616_0000225_29795_30733 309
1096 3300046513 Ga0495616_0021561 Ga0495616_0021561_1950_2888 309
1097 3300046515 Ga0495620_0005103 Ga0495620_0005103_2934_3872 309
1098 3300046517 Ga0495630_0011094 Ga0495630_0011094_2975_3913 309
1099 3300046518 Ga0495631_0000010 Ga0495631_0000010_1578_2516 309
1100 3300046518 Ga0495631_0000117 Ga0495631_0000117_13918_14856 309
1101 3300046518 Ga0495631_0036161 Ga0495631_0036161_644_1582 309
1102 3300046519 Ga0495632_0037443 Ga0495632_0037443_1297_2235 309
1103 3300046519 Ga0495632_0054381 Ga0495632_0054381_847_1785 309
1104 3300046520 Ga0495637_0000473 Ga0495637_0000473_24768_25706 309
1105 3300046520 Ga0495637_0000888 Ga0495637_0000888_5818_6756 309
1106 3300046520 Ga0495637_0000940 Ga0495637_0000940_14495_15433 309
1107 3300046520 Ga0495637_0050398 Ga0495637_0050398_182_1120 309
1108 3300046522 Ga0495643_0009337 Ga0495643_0009337_3851_4789 309
1109 3300046522 Ga0495643_0010234 Ga0495643_0010234_3865_4809 309
1110 3300046524 Ga0495648_0028096 Ga0495648_0028096_2699_3637 309
1111 3300046530 Ga0495654_0000633 Ga0495654_0000633_5325_6263 309
1112 3300046530 Ga0495654_0003467 Ga0495654_0003467_5614_6552 309
1113 3300046530 Ga0495654_0008915 Ga0495654_0008915_2170_3108 309
1114 3300046530 Ga0495654_0015216 Ga0495654_0015216_1320_2258 309
1115 3300046538 Ga0495609_0000217 Ga0495609_0000217_54923_55861 309
1116 3300046538 Ga0495609_0000648 Ga0495609_0000648_12536_13474 309
1117 3300046538 Ga0495609_0002443 Ga0495609_0002443_7351_8289 309
1118 3300046542 Ga0495597_0000117 Ga0495597_0000117_13091_14029 309
1119 3300046542 Ga0495597_0003020 Ga0495597_0003020_3769_4707 309
1120 3300046557 Ga0495622_0023575 Ga0495622_0023575_1624_2562 309
1121 3300046558 Ga0495633_0000556 Ga0495633_0000556_22604_23542 309
1122 3300046558 Ga0495633_0002122 Ga0495633_0002122_7472_8410 309
1123 3300046616 Ga0495668_0009395 Ga0495668_0009395_1313_2251 309
1124 3300046616 Ga0495668_0010954 Ga0495668_0010954_3269_4207 309
1125 3300046648 Ga0495611_0010267 Ga0495611_0010267_217_1155 309
1126 3300046648 Ga0495611_0010691 Ga0495611_0010691_1461_2399 309
1127 3300046660 Ga0495625_0003500 Ga0495625_0003500_13313_14251 309
1128 3300046660 Ga0495625_0011590 Ga0495625_0011590_3164_4102 309
1129 3300046660 Ga0495625_0189121 Ga0495625_0189121_415_1353 309
1130 3300046660 Ga0495625_0195995 Ga0495625_0195995_137_1075 309
1131 3300046665 Ga0495661_0000968 Ga0495661_0000968_854_1792 309
1132 3300046679 Ga0495623_0000327 Ga0495623_0000327_4279_5217 309
1133 3300046690 Ga0495624_0087798 Ga0495624_0087798_326_1264 309
1134 3300046691 Ga0495670_0000021 Ga0495670_0000021_26849_27787 309
1135 3300046691 Ga0495670_0008269 Ga0495670_0008269_2793_3731 309
1136 3300046692 Ga0495671_0001525 Ga0495671_0001525_4137_5075 309
1137 3300046692 Ga0495671_0046210 Ga0495671_0046210_610_1548 309
1138 3300046694 Ga0495649_0024937 Ga0495649_0024937_86_1024 309
1139 3300046694 Ga0495649_0052884 Ga0495649_0052884_85_1029 309
1140 3300046794 Ga0495589_0000255 Ga0495589_0000255_18257_19195 309
1141 3300046794 Ga0495589_0056357 Ga0495589_0056357_800_1738 309
1142 3300046809 Ga0495600_0060783 Ga0495600_0060783_849_1787 309
1143 3300046810 Ga0495660_0005404 Ga0495660_0005404_376_1314 309
1144 3300046810 Ga0495660_0005837 Ga0495660_0005837_5539_6477 309
1145 3300046810 Ga0495660_0007010 Ga0495660_0007010_3480_4418 309
1146 3300046810 Ga0495660_0025755 Ga0495660_0025755_1415_2353 309
1147 3300046810 Ga0495660_0050465 Ga0495660_0050465_108_1046 309
1148 3300046810 Ga0495660_0077358 Ga0495660_0077358_446_1384 309
1149 3300047320 Ga0495672_0001131 Ga0495672_0001131_6393_7331 309
1150 3300047320 Ga0495672_0023179 Ga0495672_0023179_472_1410 309
1151 3300047321 Ga0495676_0001108 Ga0495676_0001108_18837_19775 309
1152 3300047322 Ga0495680_0006951 Ga0495680_0006951_7813_8751 309
1153 3300047323 Ga0495683_0007871 Ga0495683_0007871_2119_3057 309
1154 3300047444 Ga0495675_0006026 Ga0495675_0006026_2182_3120 309
1155 3300047446 Ga0495679_000064 Ga0495679_000064_97339_98277 309
1156 3300047469 Ga0495673_0000935 Ga0495673_0000935_3280_4218 309
1157 3300047469 Ga0495673_0001421 Ga0495673_0001421_3911_4849 309
1158 3300047469 Ga0495673_0016160 Ga0495673_0016160_129_1067 309
1159 3300047469 Ga0495673_0043617 Ga0495673_0043617_946_1884 309
1160 3300047470 Ga0495681_0001505 Ga0495681_0001505_3596_4534 309
1161 3300047470 Ga0495681_0001768 Ga0495681_0001768_5501_6439 309
1162 3300047470 Ga0495681_0031742 Ga0495681_0031742_283_1221 309
1163 3300047470 Ga0495681_0089409 Ga0495681_0089409_74_1012 309
1164 3300047673 Ga0495593_0000045 Ga0495593_0000045_12337_13275 309
1165 3300048091 Ga0495626_0000816 Ga0495626_0000816_23943_24881 309
1166 3300048919 Ga0496116_0001088 Ga0496116_0001088_3397_4335 309
1167 3300049459 Ga0495678_000883 Ga0495678_000883_12133_13071 309
1168 3300049459 Ga0495678_002125 Ga0495678_002125_987_1925 309
1169 3300049459 Ga0495678_004576 Ga0495678_004576_3353_4291 309
1170 3300049459 Ga0495678_042967 Ga0495678_042967_662_1600 309
1171 3300050491 nmdc:mga00v17_19289_c1 nmdc:mga00v17_19289_c1_786_1724 309
1172 3300050493 nmdc:mga0k408_104169_c1 nmdc:mga0k408_104169_c1_397_1368 309
1173 3300053111 Ga0500572_015071 Ga0500572_015071_902_1840 309
1174 3300053126 Ga0500621_005111 Ga0500621_005111_1914_2852 309
1175 3300053145 Ga0500586_000073 Ga0500586_000073_2755_3693 309
1176 3300025250 Ga0209026_1008110 Ga0209026_10081102 310
1177 3300035691 Ga0373931_0168552 Ga0373931_0168552_213_1187 310
1178 3300042121 Ga0450919_000024 Ga0450919_000024_10382_11341 310
1179 3300042531 Ga0450918_000043 Ga0450918_000043_1036_1995 310
1180 3300046492 Ga0495585_0025532 Ga0495585_0025532_2291_3250 310
1181 3300046529 Ga0495652_0016055 Ga0495652_0016055_5424_6356 310
1182 3300046535 Ga0495586_0057059 Ga0495586_0057059_1072_2004 310
1183 3300046538 Ga0495609_0005856 Ga0495609_0005856_737_1669 310
1184 3300046543 Ga0495645_0047951 Ga0495645_0047951_1112_2071 310
1185 3300046674 Ga0495588_0016992 Ga0495588_0016992_1827_2759 310
1186 3300046679 Ga0495623_0045323 Ga0495623_0045323_1531_2463 310
1187 3300047470 Ga0495681_0112234 Ga0495681_0112234_206_1138 310
1188 3300048088 Ga0495602_0001440 Ga0495602_0001440_5037_5969 310
1189 3300005330 Ga0070690_100103454 Ga0070690_1001034542 311
1190 3300005365 Ga0070688_100028589 Ga0070688_1000285892 311
1191 3300005459 Ga0068867_100139259 Ga0068867_1001392592 311
1192 3300005616 Ga0068852_100038301 Ga0068852_1000383013 311
1193 3300005841 Ga0068863_100282199 Ga0068863_1002821992 311
1194 3300005842 Ga0068858_100070117 Ga0068858_1000701172 311
1195 3300025914 Ga0207671_10029364 Ga0207671_100293644 311
1196 3300025934 Ga0207686_10036029 Ga0207686_100360292 311
1197 3300026035 Ga0207703_10044264 Ga0207703_100442643 311
1198 3300026041 Ga0207639_10215599 Ga0207639_102155992 311
1199 3300026088 Ga0207641_10249170 Ga0207641_102491702 311
1200 3300046474 Ga0495605_0126166 Ga0495605_0126166_85_1020 311
1201 iso_pu_bacteria 2842815866 2842817208 311
1202 iso_pu_bacteria 2945909444 2945912540 311
1203 iso_pu_bacteria 2945984333 2945985161 311
1204 3300047469 Ga0495673_0000077 Ga0495673_0000077_104466_105404 312
1205 3300046454 Ga0495592_0003004 Ga0495592_0003004_10561_11529 313
1206 3300046462 Ga0495651_0224030 Ga0495651_0224030_11_979 313
1207 3300046511 Ga0495608_0037276 Ga0495608_0037276_2270_3238 313
1208 3300046514 Ga0495618_0059745 Ga0495618_0059745_167_1135 313
1209 3300046516 Ga0495628_0004076 Ga0495628_0004076_8440_9408 313
1210 3300046663 Ga0495635_0066839 Ga0495635_0066839_1322_2290 313
1211 3300046675 Ga0495657_0045836 Ga0495657_0045836_1691_2659 313
1212 3300046678 Ga0495599_0002388 Ga0495599_0002388_3191_4159 313
1213 3300046679 Ga0495623_0103580 Ga0495623_0103580_503_1471 313
1214 3300046809 Ga0495600_0002203 Ga0495600_0002203_4317_5285 313
1215 3300047317 Ga0495604_0012001 Ga0495604_0012001_2072_3040 313
1216 3300053077 Ga0495601_0012779 Ga0495601_0012779_347_1315 313
1217 3300053119 Ga0500595_002438 Ga0500595_002438_3523_4491 313
1218 3300053141 Ga0500574_000490 Ga0500574_000490_3251_4219 313
1219 3300053154 Ga0500619_000294 Ga0500619_000294_4663_5631 313
1220 iso_pu_bacteria 2842849001 2842850279 313
1221 iso_pu_bacteria 2511231016 2511328458 314
1222 3300005290 Ga0065712_10077642 Ga0065712_100776421 318
1223 3300046543 Ga0495645_0007748 Ga0495645_0007748_1801_2787 319
1224 3300046680 Ga0495646_0025189 Ga0495646_0025189_1972_2958 319
1225 iso_pu_bacteria 2826581358 2826583469 325
1226 3300002737 JGI25162J39368_1000018 JGI25162J39368_1000018147 327
1227 3300002741 JGI25157J39369_1000011 JGI25157J39369_100001141 327
1228 3300002771 JGI25163J39215_1000291 JGI25163J39215_100029116 327
1229 3300002771 JGI25163J39215_1000356 JGI25163J39215_100035617 327
1230 3300002772 JGI25164J39214_1000007 JGI25164J39214_1000007147 327
1231 3300003214 JGI25165J46597_1000029 JGI25165J46597_1000029140 327
1232 3300003751 Ga0055538_1004140 Ga0055538_10041401 327
1233 3300003761 Ga0055535_1000025 Ga0055535_100002545 327
1234 3300003762 Ga0055542_1000024 Ga0055542_1000024147 327
1235 3300003763 Ga0055529_1000029 Ga0055529_1000029147 327
1236 3300025207 Ga0209760_100834 Ga0209760_1008342 327
1237 3300025224 Ga0209784_100026 Ga0209784_100026136 327
1238 3300025228 Ga0209672_107937 Ga0209672_1079371 327
1239 3300025231 Ga0207427_100023 Ga0207427_100023136 327
1240 3300025233 Ga0209437_100069 Ga0209437_100069126 327
1241 3300025242 Ga0209258_100059 Ga0209258_100059136 327
1242 3300025246 Ga0209646_1000264 Ga0209646_100026427 327
1243 3300025250 Ga0209026_1000036 Ga0209026_1000036117 327
1244 3300025254 Ga0209148_1000010 Ga0209148_1000010135 327
1245 3300025256 Ga0209759_1000023 Ga0209759_100002338 327
1246 3300025261 Ga0209233_1000009 Ga0209233_10000091036 327
1247 3300025272 Ga0209455_1000020 Ga0209455_1000020468 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

54

113

0.98

PF03466

LysR_substrate

LysR substrate binding domain

137

344

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.939 20 106
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.922 23 106
7trv-assembly1.cif.gz_B crystal structure of the dna-binding domain of the lysr family transcriptional regulator yfba from yersinia pestis 0.9184 20 106
5x0n-assembly2.cif.gz_B regulatory domain of variant c227s aphb from vibrio vulnificus 0.9177 112 311
5z4z-assembly1.cif.gz_A crystal structure of pacysb ntd domain with space group c2 0.915 23 106
ID Description Score Start End Superfamily
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9892 23 104 1.10.10.10
af_P67662_3_85_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9779 23 104 1.10.10.10
af_P77700_7_92_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9685 25 104 1.10.10.10
af_P52696_4_93_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.965 23 104 1.10.10.10
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9631 23 100 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X6IIS4-F1-model_v4 deleted 0.9611 23 99
AF-A0A2Y6EL52-F1-model_v4 LYSR-type transcriptional regulator 0.957 20 103 GO:0003700
GO:0006351
GO:0043565
AF-A0A2G6K8T7-F1-model_v4 LysR family transcriptional regulator 0.9323 20 94 GO:0003700
GO:0005829
AF-A0A447T6W0-F1-model_v4 D-malate degradation protein R 0.9278 110 322 GO:0003700
GO:0006351
GO:0043565
AF-A0A7X6IIS4-F1-model_v4 deleted 0.9262 23 99

Feature Viewer

pLDDT pTM Quality
86.21 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map