F492097

General Info

Members Datasets Scaffolds Average Seq Length
1241 600 1041 486

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0000435|Ga0496124_0000435_42520_44211
Length 563
Sequence VAQVMTNQGRPRSSQIALPFRYRVPPCCAIPGPIIGNSYRFLNNNQFPLWLSSLYDAFLACINRLRPGGCAQYQGVNVSDKTLTNAAGAPIASNNHSLTAGPRGPVLLQDVWLIEKLAHFARERIPERVVHAKGSGAFGTFTVTHDISKYSRAKIFSEVGKQTPVFLRFSTVAGERGAADAERDVRGFAVKFYTDEGNWDLVGNNTPVFFVRDPLKFADFIHTQKRDPQTNLRSATAAWDFWSLSPESLHQVTILMSDRGLPKNYRQQHGFGSHTYSFVNADGERFWVKFHFRSEQGVENYTDQEAAEVVAGDRESAQRDLFNHIANGVFPRWTLKVQIMPEADAATYHINPFDLTKVWPHGDYPLIEVGTLELNRNPDNYFGDVEQAALTPANVVPGIDYSPDKMLQGRLFSYGDAQRYRLGVNHHQIPVNQPRCPMHSFHRDGGMRTDGNLGGTRNYEPNSFGQWKETPAAAEPPLALDGQAADRWNHRVDDDYYSQPGNLFRLMTDDEKARLFANIGRHMADVPEEIQRRQLEHFRRADPAYAEGVAKALGLALREEVPA

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
5 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
6 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
7 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
8 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
11 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
12 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
13 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
14 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
15 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
16 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
17 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
18 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
19 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
20 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
21 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
22 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
23 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
24 2534681786 Brucella suis 92/29 Isolate Unclassified
25 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
26 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
27 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
28 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
29 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
30 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
31 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
32 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
33 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
34 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
35 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
36 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
37 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
38 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
39 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
40 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
41 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
42 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
43 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
44 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
45 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
46 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
47 2643221569 Achromobacter sp. Root565 Isolate Unclassified
48 2643221594 Achromobacter sp. Root170 Isolate Unclassified
49 2643221611 Acidovorax sp. Root219 Isolate Unclassified
50 2643221621 Achromobacter sp. Root83 Isolate Unclassified
51 2643221638 Duganella sp. Root336D2 Isolate Unclassified
52 2643221645 Massilia sp. Root351 Isolate Unclassified
53 2643221664 Massilia sp. Root418 Isolate Unclassified
54 2643221733 Bosea sp. Root381 Isolate Unclassified
55 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
56 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
57 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
58 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
59 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
60 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
61 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
62 2738541280 Massilia sp. GV090 Isolate Unclassified
63 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
64 2738541297 Duganella sp. GV083 Isolate Unclassified
65 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
66 2738541300 Massilia sp. GV016 Isolate Unclassified
67 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
68 2738541357 Duganella sp. GV053 Isolate Unclassified
69 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
70 2738543003 Duganella sp. GV066 Isolate Unclassified
71 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
72 2738543009 Luteibacter sp. OK325 Isolate Unclassified
73 2738543018 Massilia sp. GV045 Isolate Unclassified
74 2738543026 Duganella sp. GV089 Isolate Unclassified
75 2738543029 Duganella sp. GV039 Isolate Unclassified
76 2738543030 Massilia sp. GV097 Isolate Unclassified
77 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
78 2739367651 Pedobacter sp. OK291 Isolate Unclassified
79 2739367700 Dyella sp. YR388 Isolate Unclassified
80 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
81 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
82 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
83 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
84 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
85 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
86 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
87 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
88 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
89 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
90 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
91 2818991450 Burkholderia sp. 604 Isolate Unclassified
92 2821131069 Duganella sp. 1224 Isolate Unclassified
93 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
94 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
95 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
96 2831864461 Roseateles noduli HZ7 Isolate Nodule
97 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
98 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
99 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
100 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
101 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
102 2842711865 Duganella sp. R-73148 Isolate Unclassified
103 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
104 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
105 2849560528 Caulobacter zeae 410 Isolate Unclassified
106 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
107 2851153111 Caulobacter radicis 736 Isolate Unclassified
108 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
109 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
110 2854911287 Brucella lupini LUP21 Isolate Unclassified
111 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
112 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
113 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
114 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
115 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
116 2857553236 Duganella sp. R-74557 Isolate Unclassified
117 2857558681 Duganella sp. R-74565 Isolate Unclassified
118 2857564685 Duganella sp. R-74599 Isolate Unclassified
119 2858950400 Achromobacter sp. K91 Isolate Unclassified
120 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
121 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
122 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
123 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
124 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
125 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
126 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
127 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
128 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
129 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
130 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
131 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
132 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
133 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
134 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
135 2904424332 Duganella sp. 1411 Isolate Rhizosphere
136 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
137 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
138 2914759650 Rhizosphaericola mali Isolate Rhizosphere
139 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
140 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
141 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
142 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
143 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
144 2919404418 Luteibacter sp. 3190 Isolate Unclassified
145 2919476304 Duganella sp. 3397 Isolate Unclassified
146 2919493220 Aeromonas salmonicida salmonicida 3466 Isolate Unclassified
147 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
148 2919543075 Aeromonas salmonicida masoucida 4076 Isolate Unclassified
149 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
150 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
151 2923525760 Aeromonas caviae SLBN-129 Isolate Rhizosphere
152 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
153 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
154 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
155 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
156 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
157 2941479691
158 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
159 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
160 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
161 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
162 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
163 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
164 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
165 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
166 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
167 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
168 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
169 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
170 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
171 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
172 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
173 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
174 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
175 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
176 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
177 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
178 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
179 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
180 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
181 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
182 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
183 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
184 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
185 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
186 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
187 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
188 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
189 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
190 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
191 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
192 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
193 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
194 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
195 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
196 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
197 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
198 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
199 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
200 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
201 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
202 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
203 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
204 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
205 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
206 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
207 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
208 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
209 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
210 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
211 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
212 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
213 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
214 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
215 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
216 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
217 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
218 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
219 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
220 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
221 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
222 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
223 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
224 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
225 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
226 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
227 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
228 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
229 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
230 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
231 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
232 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
233 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
234 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
235 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
236 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
237 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
238 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
239 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
240 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
241 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
242 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
243 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
244 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
245 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
246 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
247 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
248 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
249 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
250 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
251 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
252 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
253 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
254 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
255 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
256 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
257 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
258 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
259 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
260 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
261 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
262 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
263 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
264 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
265 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
266 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
267 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
268 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
269 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
270 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
271 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
272 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
273 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
274 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
275 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
276 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
277 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
278 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
279 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
280 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
281 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
282 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
283 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
284 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
285 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
286 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
287 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
288 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
289 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
290 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
291 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
292 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
293 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
294 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
295 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
296 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
297 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
298 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
299 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
300 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
301 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
302 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
303 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
304 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
310 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
311 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
313 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
314 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
315 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
318 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
319 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
320 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
321 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
322 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
323 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
324 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
325 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
327 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
328 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
329 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
331 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
332 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
334 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
373 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
374 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
375 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
377 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
378 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
379 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
380 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
381 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
382 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
383 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
384 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
385 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
386 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
387 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
388 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
389 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
390 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
391 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
392 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
393 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
394 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
395 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
396 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
397 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
398 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
399 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
400 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
401 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
402 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
403 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
404 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
405 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
406 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
407 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
408 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
409 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
410 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
411 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
412 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
413 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
414 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
415 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
416 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
417 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
418 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
419 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
420 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
421 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
422 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
423 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
424 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
425 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
426 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
427 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
428 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
429 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
430 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
431 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
432 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
433 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
434 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
435 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
436 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
437 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
438 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
439 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
440 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
441 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
442 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
443 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
444 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
445 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
446 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
447 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
448 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
449 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
450 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
451 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
452 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
453 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
454 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
455 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
456 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
457 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
458 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
459 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
460 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
461 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
462 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
463 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
464 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
465 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
466 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
467 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
468 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
469 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
470 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
471 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
472 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
473 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
474 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
475 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
476 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
477 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
478 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
479 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
480 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
481 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
482 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
483 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
484 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
485 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
486 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
487 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
488 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
489 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
490 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
491 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
492 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
493 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
494 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
495 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
496 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
497 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
498 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
499 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
500 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
501 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
502 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
503 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
504 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
505 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
506 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
507 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
508 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
509 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
510 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
511 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
512 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
513 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
514 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
515 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
516 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
517 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
518 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
519 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
520 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
521 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
522 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
523 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
524 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
525 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
526 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
527 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
528 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
529 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
530 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
531 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
532 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
533 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
534 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
535 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
536 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
537 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
538 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
539 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
540 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
541 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
542 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
543 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
544 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
545 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
546 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
547 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
548 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
549 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
550 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
551 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
552 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
553 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
554 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
555 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
556 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
557 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
558 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
559 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
560 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
561 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
562 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
563 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
564 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
565 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
566 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
567 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
568 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
569 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
570 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
571 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
572 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
573 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
574 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
575 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
576 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
577 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
578 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
579 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
580 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
581 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
582 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
583 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
584 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
585 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
586 640753048 Serratia proteamaculans 568 Isolate Endosphere
587 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
588 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
589 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
590 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
591 646564506 Arcobacter nitrofigilis DSM 7299 Isolate Unclassified
592 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
593 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
594 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
595 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified
596 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
597 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
598 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
599 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
600 8055693939 Hafnia alvei A23BA Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.64
Metatranscriptomes 0.24
Isolates 16.12

Biome Distribution

Category Percentage (%)
Aerial Root 0.16
Bulb 0
Endosphere 15.31
Nodule 3.14
Rhizoplane 3.3
Rhizosphere 61.8
Stem 0
Stem Tuber 0
Unclassified 16.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002337 3300001989 Bacteria 7306
2 JGI24739J22299_10004923 3300001989 Bacteria 5084
3 JGI24739J22299_10007534 3300001989 Bacteria 4079
4 JGI24735J21928_10002051 3300002067 Bacteria 7094
5 JGI24735J21928_10020646 3300002067 Bacteria 2016
6 JGI24738J21930_10000444 3300002075 Bacteria 11696
7 JGI25155J39150_1000224 3300002704 Bacteria 22214
8 JGI25156J39149_1000357 3300002705 Bacteria 29554
9 JGI25156J39149_1000678 3300002705 Bacteria 18398
10 JGI25156J39149_1000992 3300002705 Bacteria 13398
11 JGI25156J39149_1001322 3300002705 Bacteria 10707
12 JGI25156J39149_1002033 3300002705 Bacteria 7717
13 JGI25162J39368_1000088 3300002737 Bacteria 106999
14 JGI25162J39368_1001976 3300002737 Bacteria 9198
15 JGI25154J39366_1000298 3300002738 Bacteria 29516
16 JGI25157J39369_1000262 3300002741 Bacteria 38795
17 JGI25157J39369_1000678 3300002741 Bacteria 18583
18 JGI25152J39213_1000052 3300002773 Bacteria 77690
19 JGI25152J39213_1000468 3300002773 Bacteria 23555
20 JGI25150J39212_1000182 3300002774 Bacteria 35390
21 JGI25150J39212_1006825 3300002774 Bacteria 2329
22 JGI25159J45721_1003508 3300002987 Bacteria 5531
23 JGI25151J46595_10000888 3300003187 Bacteria 23550
24 JGI25165J46597_1000476 3300003214 Bacteria 39146
25 JGI25165J46597_1003490 3300003214 Bacteria 3874
26 JGI25153J46596_10000542 3300003215 Bacteria 23550
27 rootH2_10148953 3300003320 Bacteria 3636
28 rootH2_10209911 3300003320 Bacteria 2865
29 rootL2_10003775 3300003322 Bacteria 7255
30 rootL2_10034607 3300003322 Bacteria 8020
31 rootL2_10087097 3300003322 Bacteria 5092
32 rootH1_10005241 3300003323 Bacteria 23232
33 rootH1_10007253 3300003323 Bacteria 8226
34 JGI25160J50197_1000171 3300003354 Bacteria 55915
35 JGI25161J50226_1000612 3300003374 Bacteria 14693
36 Ga0006562J51391_1009521 3300003578 Bacteria 1951
37 Ga0055533_1000140 3300003756 Bacteria 76502
38 Ga0055533_1000557 3300003756 Bacteria 13209
39 Ga0055533_1004026 3300003756 Bacteria 2767
40 Ga0055532_1000001 3300003758 Bacteria 1119836
41 Ga0055532_1000059 3300003758 Bacteria 152948
42 Ga0055527_1000014 3300003760 Bacteria 289449
43 Ga0055535_1000001 3300003761 Bacteria 1119836
44 Ga0055535_1003465 3300003761 Bacteria 4456
45 Ga0055542_1000001 3300003762 Bacteria 1119836
46 Ga0055542_1000136 3300003762 Bacteria 93218
47 Ga0055529_1000001 3300003763 Bacteria 826680
48 Ga0055529_1000095 3300003763 Bacteria 134030
49 Ga0055526_1000066 3300003771 Bacteria 101329
50 Ga0055526_1000158 3300003771 Bacteria 60304
51 Ga0055526_1004255 3300003771 Bacteria 8670
52 Ga0055526_1021162 3300003771 Bacteria 2274
53 Ga0055524_1000458 3300003775 Bacteria 33324
54 Ga0055524_1001753 3300003775 Bacteria 11984
55 Ga0055524_1013801 3300003775 Bacteria 3026
56 Ga0055536_1000117 3300003781 Bacteria 69040
57 Ga0055534_1001113 3300003784 Bacteria 11420
58 Ga0055534_1004121 3300003784 Bacteria 4327
59 Ga0055528_1001000 3300003790 Bacteria 18788
60 Ga0055530_10000236 3300003791 Bacteria 49511
61 Ga0055530_10000471 3300003791 Bacteria 35182
62 Ga0055530_10001254 3300003791 Bacteria 19279
63 Ga0055530_10001714 3300003791 Bacteria 15442
64 Ga0055540_1000008 3300003792 Bacteria 309635
65 Ga0055531_10000403 3300003794 Bacteria 41560
66 Ga0055531_10031163 3300003794 Bacteria 1772
67 Ga0055543_1000266 3300004625 Bacteria 38914
68 Ga0055543_1004864 3300004625 Bacteria 3555
69 Ga0065165_1000455 3300005262 Bacteria 64259
70 Ga0065165_1000877 3300005262 Bacteria 38914
71 Ga0065165_1001400 3300005262 Bacteria 26315
72 Ga0065703_1020772 3300005272 Bacteria 1570
73 Ga0065714_10075970 3300005288 Bacteria 2842
74 Ga0065704_10070569 3300005289 Bacteria 20309
75 Ga0070658_10025473 3300005327 Bacteria 4741
76 Ga0070658_10026080 3300005327 Bacteria 4688
77 Ga0070683_100006203 3300005329 Bacteria 10023
78 Ga0070666_10006049 3300005335 Bacteria 7434
79 Ga0070682_100105727 3300005337 Bacteria 1867
80 Ga0070660_100078616 3300005339 Bacteria 2586
81 Ga0070689_100001969 3300005340 Bacteria 13326
82 Ga0070661_100041129 3300005344 Bacteria 3373
83 Ga0070661_100163291 3300005344 Bacteria 1688
84 Ga0070668_100000041 3300005347 Bacteria 78742
85 Ga0070671_100150654 3300005355 Bacteria 1964
86 Ga0070667_100006513 3300005367 Bacteria 9709
87 Ga0070667_100008663 3300005367 Bacteria 8429
88 Ga0070667_100152606 3300005367 Bacteria 2030
89 Ga0070709_10009067 3300005434 Bacteria 5478
90 Ga0070709_10134274 3300005434 Bacteria 1693
91 Ga0070714_100060861 3300005435 Bacteria 3241
92 Ga0070713_100082365 3300005436 Bacteria 2747
93 Ga0070713_100125454 3300005436 Bacteria 2257
94 Ga0070710_10011974 3300005437 Bacteria 4298
95 Ga0070711_100020185 3300005439 Bacteria 4290
96 Ga0070711_100149237 3300005439 Bacteria 1761
97 Ga0070708_100001870 3300005445 Bacteria 16151
98 Ga0070708_100050757 3300005445 Bacteria 3674
99 Ga0070662_100104996 3300005457 Bacteria 2144
100 Ga0070681_10118256 3300005458 Bacteria 2587
101 Ga0068867_100108376 3300005459 Bacteria 2130
102 Ga0070685_10056486 3300005466 Bacteria 2282
103 Ga0070706_100000447 3300005467 Bacteria 49339
104 Ga0070706_100000789 3300005467 Bacteria 35385
105 Ga0070707_100049034 3300005468 Bacteria 4047
106 Ga0070699_100228978 3300005518 Bacteria 1657
107 Ga0070679_100001543 3300005530 Bacteria 20556
108 Ga0070684_100000777 3300005535 Bacteria 22140
109 Ga0070697_100000435 3300005536 Bacteria 31985
110 Ga0070697_100148471 3300005536 Bacteria 1975
111 Ga0068853_100043140 3300005539 Unclassified 3859
112 Ga0068853_100168125 3300005539 Bacteria 1983
113 Ga0070704_100091066 3300005549 Bacteria 2273
114 Ga0068855_100003512 3300005563 Bacteria 19184
115 Ga0068855_100082292 3300005563 Bacteria 3731
116 Ga0068855_100122139 3300005563 Bacteria 2981
117 Ga0068855_100356704 3300005563 Bacteria 1610
118 Ga0070664_100111999 3300005564 Bacteria 2383
119 Ga0068854_100009089 3300005578 Bacteria 6406
120 Ga0068856_100025716 3300005614 Bacteria 5740
121 Ga0068852_100001060 3300005616 Bacteria 18133
122 Ga0068852_100009696 3300005616 Bacteria 7157
123 Ga0068852_100027471 3300005616 Bacteria 4639
124 Ga0068859_100000588 3300005617 Bacteria 36240
125 Ga0068859_100008683 3300005617 Bacteria 10273
126 Ga0068864_100028197 3300005618 Bacteria 4744
127 Ga0068863_100000031 3300005841 Bacteria 175602
128 Ga0068863_100002277 3300005841 Bacteria 19080
129 Ga0068858_100039304 3300005842 Bacteria 4388
130 Ga0068860_100003398 3300005843 Bacteria 16371
131 Ga0068860_100012561 3300005843 Bacteria 8338
132 Ga0068860_100105944 3300005843 Bacteria 2685
133 Ga0068862_100123184 3300005844 Bacteria 2287
134 Ga0081540_1001095 3300005983 Bacteria 23976
135 Ga0081539_10002032 3300005985 Bacteria 30481
136 Ga0075365_10000290 3300006038 Bacteria 17397
137 Ga0075363_100000444 3300006048 Bacteria 12975
138 Ga0075364_10004104 3300006051 Bacteria 8357
139 Ga0075364_10008686 3300006051 Bacteria 6075
140 Ga0075364_10009105 3300006051 Bacteria 5946
141 Ga0075364_10076786 3300006051 Bacteria 2204
142 Ga0070712_100028226 3300006175 Bacteria 3752
143 Ga0075362_10001341 3300006177 Bacteria 7784
144 Ga0075367_10000006 3300006178 Bacteria 46123
145 Ga0075367_10004486 3300006178 Bacteria 6823
146 Ga0075367_10012884 3300006178 Bacteria 4478
147 Ga0075369_10000050 3300006186 Bacteria 30690
148 Ga0075369_10013613 3300006186 Bacteria 3234
149 Ga0075366_10009001 3300006195 Bacteria 5569
150 Ga0075366_10131703 3300006195 Bacteria 1509
151 Ga0097621_100007848 3300006237 Bacteria 7654
152 Ga0097621_100013099 3300006237 Bacteria 6167
153 Ga0075370_10000299 3300006353 Bacteria 17804
154 Ga0075370_10004783 3300006353 Bacteria 6629
155 Ga0075370_10021946 3300006353 Bacteria 3501
156 Ga0068871_100004396 3300006358 Bacteria 9796
157 Ga0075428_100100073 3300006844 Bacteria 3161
158 Ga0075434_100013014 3300006871 Bacteria 7901
159 Ga0075434_100136511 3300006871 Bacteria 2472
160 Ga0068865_100025780 3300006881 Bacteria 3872
161 Ga0097620_100000588 3300006931 Bacteria 36240
162 Ga0097620_100008683 3300006931 Bacteria 10273
163 Ga0079104_1002961 3300006946 Bacteria 8373
164 Ga0075435_100079380 3300007076 Bacteria 2693
165 Ga0105251_10000051 3300009011 Bacteria 106703
166 Ga0105251_10000097 3300009011 Bacteria 85550
167 Ga0105251_10000348 3300009011 Bacteria 46051
168 Ga0105251_10001002 3300009011 Bacteria 24717
169 Ga0105251_10001129 3300009011 Bacteria 23187
170 Ga0105251_10016033 3300009011 Bacteria 4067
171 Ga0105244_10001089 3300009036 Bacteria 22618
172 Ga0105244_10001130 3300009036 Bacteria 22186
173 Ga0105244_10009636 3300009036 Bacteria 5917
174 Ga0105244_10040070 3300009036 Bacteria 2434
175 Ga0105250_10001000 3300009092 Bacteria 16414
176 Ga0105240_10000787 3300009093 Bacteria 57466
177 Ga0105240_10090717 3300009093 Bacteria 3734
178 Ga0105240_10111500 3300009093 Bacteria 3309
179 Ga0105240_10340663 3300009093 Bacteria 1703
180 Ga0105247_10000471 3300009101 Bacteria 33778
181 Ga0105247_10030870 3300009101 Bacteria 3250
182 Ga0114129_10001834 3300009147 Bacteria 28925
183 Ga0114129_10063591 3300009147 Bacteria 5152
184 Ga0105241_10000001 3300009174 Bacteria 879793
185 Ga0105241_10007371 3300009174 Bacteria 8093
186 Ga0105242_10050134 3300009176 Bacteria 3398
187 Ga0105237_10011773 3300009545 Bacteria 9255
188 Ga0105237_10013246 3300009545 Bacteria 8653
189 Ga0105237_10030552 3300009545 Bacteria 5470
190 Ga0105237_10062879 3300009545 Bacteria 3711
191 Ga0105237_10064131 3300009545 Bacteria 3671
192 Ga0105239_10001852 3300010375 Bacteria 27676
193 Ga0105239_10020352 3300010375 Bacteria 7319
194 Ga0157319_1000001 3300012497 Bacteria 423237
195 Ga0157373_10001759 3300013100 Bacteria 16485
196 Ga0157373_10016997 3300013100 Bacteria 5299
197 Ga0157373_10025384 3300013100 Bacteria 4286
198 Ga0157373_10052036 3300013100 Bacteria 2915
199 Ga0157371_10008983 3300013102 Bacteria 7902
200 Ga0157371_10013404 3300013102 Bacteria 6226
201 Ga0157370_10008542 3300013104 Bacteria 11038
202 Ga0157370_10022173 3300013104 Bacteria 6321
203 Ga0157370_10032507 3300013104 Bacteria 5095
204 Ga0157370_10114728 3300013104 Bacteria 2516
205 Ga0157369_10000877 3300013105 Bacteria 38427
206 Ga0157369_10001942 3300013105 Bacteria 24889
207 Ga0157369_10002233 3300013105 Bacteria 23310
208 Ga0157369_10015758 3300013105 Bacteria 8517
209 Ga0157369_10019302 3300013105 Bacteria 7628
210 Ga0157374_10094941 3300013296 Bacteria 2851
211 Ga0157378_10004116 3300013297 Bacteria 12844
212 Ga0163162_10000124 3300013306 Bacteria 68603
213 Ga0163162_10002988 3300013306 Bacteria 16151
214 Ga0163162_10009054 3300013306 Bacteria 9677
215 Ga0163162_10027712 3300013306 Bacteria 5603
216 Ga0163162_10046606 3300013306 Bacteria 4345
217 Ga0163162_10055635 3300013306 Bacteria 3984
218 Ga0163162_10117188 3300013306 Bacteria 2765
219 Ga0163162_10242746 3300013306 Bacteria 1932
220 Ga0157372_10047957 3300013307 Bacteria 4747
221 Ga0157375_10028397 3300013308 Bacteria 5243
222 Ga0157375_10144214 3300013308 Bacteria 2511
223 Ga0163163_10088556 3300014325 Bacteria 3107
224 Ga0163163_10179217 3300014325 Bacteria 2166
225 Ga0182008_10002716 3300014497 Bacteria 10982
226 Ga0182008_10009557 3300014497 Bacteria 5225
227 Ga0157379_10073694 3300014968 Bacteria 3056
228 Ga0157376_10021568 3300014969 Bacteria 5005
229 Ga0182006_1000027 3300015261 Bacteria 252946
230 Ga0182006_1000117 3300015261 Bacteria 85963
231 Ga0182007_10000914 3300015262 Bacteria 16329
232 Ga0182005_1000041 3300015265 Bacteria 150123
233 Ga0182005_1010884 3300015265 Bacteria 2607
234 Ga0163161_10000003 3300017792 Bacteria 339847
235 Ga0163161_10002342 3300017792 Bacteria 13581
236 Ga0163161_10006078 3300017792 Bacteria 8364
237 Ga0163161_10066301 3300017792 Bacteria 2636
238 Ga0213872_10001700 3300021361 Bacteria 13851
239 Ga0213872_10023824 3300021361 Bacteria 2816
240 Ga0224712_10005925 3300022467 Bacteria 3447
241 Ga0224712_10024202 3300022467 Bacteria 2118
242 Ga0209435_100032 3300025206 Bacteria 153068
243 Ga0209436_100706 3300025208 Bacteria 13981
244 Ga0209436_101778 3300025208 Bacteria 7049
245 Ga0209566_104037 3300025225 Bacteria 2087
246 Ga0209674_100005 3300025226 Bacteria 1708125
247 Ga0209674_100025 3300025226 Bacteria 515942
248 Ga0209674_100092 3300025226 Bacteria 172272
249 Ga0209674_100559 3300025226 Bacteria 14723
250 Ga0209672_100001 3300025228 Bacteria 2828210
251 Ga0209672_101263 3300025228 Bacteria 10033
252 Ga0209147_100001 3300025229 Bacteria 2384371
253 Ga0209147_100109 3300025229 Bacteria 153068
254 Ga0209147_104464 3300025229 Bacteria 2328
255 Ga0209563_101429 3300025230 Bacteria 6341
256 Ga0207427_100091 3300025231 Bacteria 133410
257 Ga0207427_100736 3300025231 Bacteria 15098
258 Ga0207427_101457 3300025231 Bacteria 8523
259 Ga0209437_100026 3300025233 Bacteria 542698
260 Ga0209437_100126 3300025233 Bacteria 192521
261 Ga0209437_100190 3300025233 Bacteria 125000
262 Ga0209437_100512 3300025233 Bacteria 27460
263 Ga0209437_101329 3300025233 Bacteria 6485
264 Ga0209258_100001 3300025242 Bacteria 2384269
265 Ga0209258_100190 3300025242 Bacteria 126878
266 Ga0209258_103038 3300025242 Bacteria 3855
267 Ga0207425_1000001 3300025245 Bacteria 2525432
268 Ga0207425_1000028 3300025245 Bacteria 286333
269 Ga0207425_1000479 3300025245 Bacteria 25399
270 Ga0207425_1000668 3300025245 Bacteria 18852
271 Ga0209646_1000010 3300025246 Bacteria 573803
272 Ga0209646_1000113 3300025246 Bacteria 153068
273 Ga0209026_1000102 3300025250 Bacteria 153068
274 Ga0209026_1000482 3300025250 Bacteria 29964
275 Ga0209026_1001487 3300025250 Bacteria 10293
276 Ga0209677_104928 3300025253 Bacteria 3646
277 Ga0209148_1000002 3300025254 Bacteria 2399500
278 Ga0209148_1000003 3300025254 Bacteria 2384288
279 Ga0209148_1000843 3300025254 Bacteria 21760
280 Ga0209148_1001331 3300025254 Bacteria 13094
281 Ga0209759_1000053 3300025256 Bacteria 212789
282 Ga0209759_1000074 3300025256 Bacteria 177152
283 Ga0209759_1000104 3300025256 Bacteria 153068
284 Ga0209759_1000601 3300025256 Bacteria 34849
285 Ga0209759_1000785 3300025256 Bacteria 26511
286 Ga0209129_1000001 3300025258 Bacteria 1452436
287 Ga0209129_1000065 3300025258 Bacteria 232568
288 Ga0209233_1000016 3300025261 Bacteria 907830
289 Ga0209233_1000111 3300025261 Bacteria 260262
290 Ga0209565_1000525 3300025263 Bacteria 27168
291 Ga0209565_1001084 3300025263 Bacteria 13582
292 Ga0209565_1010348 3300025263 Bacteria 2315
293 Ga0209455_1000001 3300025272 Bacteria 2384278
294 Ga0209455_1000121 3300025272 Bacteria 173350
295 Ga0209455_1001017 3300025272 Bacteria 14048
296 Ga0209455_1005995 3300025272 Bacteria 3657
297 Ga0209673_1005777 3300025273 Bacteria 6155
298 Ga0209673_1009288 3300025273 Bacteria 4282
299 Ga0209673_1031053 3300025273 Bacteria 1670
300 Ga0209130_1000365 3300025284 Bacteria 51263
301 Ga0209130_1004140 3300025284 Bacteria 5695
302 Ga0209675_1001170 3300025291 Bacteria 15921
303 Ga0209675_1001540 3300025291 Bacteria 13127
304 Ga0209675_1007196 3300025291 Bacteria 4311
305 Ga0209676_1000002 3300025292 Bacteria 1732948
306 Ga0209676_1006488 3300025292 Bacteria 5761
307 Ga0209025_1000002 3300025294 Bacteria 1393142
308 Ga0209025_1001807 3300025294 Bacteria 25350
309 Ga0209564_1000009 3300025295 Bacteria 950196
310 Ga0209564_1000030 3300025295 Bacteria 503296
311 Ga0209564_1000033 3300025295 Bacteria 446200
312 Ga0209564_1000376 3300025295 Bacteria 82120
313 Ga0209564_1002236 3300025295 Bacteria 15948
314 Ga0209564_1002365 3300025295 Bacteria 15171
315 Ga0209564_1011309 3300025295 Bacteria 4011
316 Ga0209758_1000003 3300025297 Bacteria 1398533
317 Ga0209758_1000116 3300025297 Bacteria 198356
318 Ga0209050_1000006 3300025298 Bacteria 1359702
319 Ga0209050_1000446 3300025298 Bacteria 74770
320 Ga0209050_1000611 3300025298 Bacteria 56265
321 Ga0209050_1001644 3300025298 Bacteria 22822
322 Ga0209256_1000350 3300025299 Bacteria 74944
323 Ga0209256_1000872 3300025299 Bacteria 37384
324 Ga0209256_1002393 3300025299 Bacteria 15456
325 Ga0207426_1000037 3300025302 Bacteria 442735
326 Ga0207426_1000170 3300025302 Bacteria 164216
327 Ga0207426_1002402 3300025302 Bacteria 12068
328 Ga0209051_1000001 3300025303 Bacteria 1732974
329 Ga0209051_1008025 3300025303 Bacteria 5657
330 Ga0209257_1000029 3300025304 Bacteria 695617
331 Ga0209257_1000107 3300025304 Bacteria 240937
332 Ga0209257_1000805 3300025304 Bacteria 45597
333 Ga0207696_1000001 3300025711 Bacteria 2579611
334 Ga0207696_1000848 3300025711 Bacteria 19308
335 Ga0207696_1000887 3300025711 Bacteria 18644
336 Ga0207696_1010719 3300025711 Bacteria 3343
337 Ga0207655_1005796 3300025728 Bacteria 8315
338 Ga0207655_1010725 3300025728 Bacteria 5533
339 Ga0207655_1032863 3300025728 Bacteria 2363
340 Ga0207713_1000023 3300025735 Bacteria 346097
341 Ga0207713_1000031 3300025735 Bacteria 283971
342 Ga0207713_1000131 3300025735 Bacteria 114570
343 Ga0207713_1000143 3300025735 Bacteria 107175
344 Ga0207713_1000305 3300025735 Bacteria 56170
345 Ga0207713_1000321 3300025735 Bacteria 54405
346 Ga0207713_1000354 3300025735 Bacteria 50282
347 Ga0207713_1000388 3300025735 Bacteria 47762
348 Ga0207713_1002908 3300025735 Bacteria 11990
349 Ga0207692_10006262 3300025898 Bacteria 4823
350 Ga0207642_10016620 3300025899 Bacteria 2777
351 Ga0207710_10000116 3300025900 Bacteria 99007
352 Ga0207710_10019236 3300025900 Bacteria 2913
353 Ga0207680_10001105 3300025903 Bacteria 12710
354 Ga0207680_10086567 3300025903 Bacteria 1982
355 Ga0207647_10000234 3300025904 Bacteria 45343
356 Ga0207647_10006534 3300025904 Bacteria 8471
357 Ga0207647_10009811 3300025904 Bacteria 6787
358 Ga0207647_10022621 3300025904 Bacteria 4172
359 Ga0207705_10001908 3300025909 Bacteria 16298
360 Ga0207705_10051051 3300025909 Bacteria 2977
361 Ga0207684_10002377 3300025910 Bacteria 19042
362 Ga0207684_10047767 3300025910 Bacteria 3630
363 Ga0207654_10000004 3300025911 Bacteria 902334
364 Ga0207654_10012124 3300025911 Bacteria 4411
365 Ga0207707_10081615 3300025912 Bacteria 2823
366 Ga0207695_10241323 3300025913 Bacteria 1708
367 Ga0207671_10006312 3300025914 Bacteria 10588
368 Ga0207671_10047963 3300025914 Bacteria 3161
369 Ga0207663_10014101 3300025916 Bacteria 4366
370 Ga0207657_10062536 3300025919 Bacteria 3186
371 Ga0207657_10136562 3300025919 Bacteria 2006
372 Ga0207657_10206626 3300025919 Bacteria 1577
373 Ga0207649_10147633 3300025920 Bacteria 1616
374 Ga0207646_10073685 3300025922 Bacteria 3050
375 Ga0207646_10136125 3300025922 Bacteria 2212
376 Ga0207700_10084214 3300025928 Bacteria 2492
377 Ga0207644_10094036 3300025931 Bacteria 2239
378 Ga0207670_10005546 3300025936 Bacteria 6934
379 Ga0207669_10051895 3300025937 Bacteria 2460
380 Ga0207704_10034563 3300025938 Bacteria 2886
381 Ga0207689_10058951 3300025942 Bacteria 3158
382 Ga0207661_10004240 3300025944 Bacteria 10036
383 Ga0207667_10008873 3300025949 Bacteria 11902
384 Ga0207667_10014176 3300025949 Bacteria 9098
385 Ga0207667_10040612 3300025949 Bacteria 4954
386 Ga0207667_10116038 3300025949 Bacteria 2759
387 Ga0207667_10234016 3300025949 Bacteria 1881
388 Ga0207712_10026076 3300025961 Bacteria 3891
389 Ga0207668_10000038 3300025972 Bacteria 112486
390 Ga0207640_10006301 3300025981 Bacteria 6505
391 Ga0207658_10024979 3300025986 Bacteria 4181
392 Ga0207658_10157363 3300025986 Bacteria 1858
393 Ga0207703_10002892 3300026035 Bacteria 14620
394 Ga0207639_10006894 3300026041 Bacteria 7739
395 Ga0207639_10029672 3300026041 Unclassified 4007
396 Ga0207678_10069274 3300026067 Bacteria 3025
397 Ga0207678_10072268 3300026067 Bacteria 2956
398 Ga0207678_10089329 3300026067 Bacteria 2634
399 Ga0207702_10172713 3300026078 Bacteria 1983
400 Ga0207641_10000050 3300026088 Bacteria 175954
401 Ga0207641_10000133 3300026088 Bacteria 109199
402 Ga0207641_10174634 3300026088 Bacteria 1964
403 Ga0207648_10001120 3300026089 Bacteria 30104
404 Ga0207676_10012264 3300026095 Bacteria 6135
405 Ga0207698_10001835 3300026142 Bacteria 12407
406 Ga0207698_10006777 3300026142 Bacteria 7161
407 Ga0209281_1000038 3300027111 Bacteria 361154
408 Ga0209281_1007572 3300027111 Bacteria 2714
409 Ga0209371_1007072 3300027312 Bacteria 3995
410 Ga0209813_10000578 3300027866 Bacteria 8550
411 Ga0209813_10005296 3300027866 Bacteria 3122
412 Ga0268264_10002332 3300028381 Bacteria 16777
413 Ga0268264_10011225 3300028381 Bacteria 7401
414 Ga0268264_10018928 3300028381 Bacteria 5630
415 Ga0307515_10000024 3300028794 Bacteria 393119
416 Ga0307515_10005522 3300028794 Bacteria 25593
417 Ga0265338_10000258 3300028800 Bacteria 96517
418 Ga0268256_1000690 3300030500 Bacteria 25343
419 Ga0268256_1006008 3300030500 Bacteria 4624
420 Ga0268256_1007225 3300030500 Bacteria 3995
421 Ga0265330_10013718 3300031235 Bacteria 3770
422 Ga0265316_10012182 3300031344 Bacteria 7715
423 Ga0307509_10001996 3300031507 Bacteria 33693
424 Ga0307408_100000007 3300031548 Bacteria 463086
425 Ga0307408_100000103 3300031548 Bacteria 93203
426 Ga0307408_100003318 3300031548 Bacteria 11065
427 Ga0307408_100005407 3300031548 Bacteria 8555
428 Ga0307508_10053266 3300031616 Bacteria 3592
429 Ga0265314_10001830 3300031711 Bacteria 22865
430 Ga0265314_10023722 3300031711 Bacteria 4669
431 Ga0265342_10012313 3300031712 Bacteria 5796
432 Ga0307516_10194944 3300031730 Bacteria 1749
433 Ga0307405_10000001 3300031731 Bacteria 1731270
434 Ga0307413_10009536 3300031824 Bacteria 4652
435 Ga0307412_10000014 3300031911 Bacteria 353795
436 Ga0307412_10000120 3300031911 Bacteria 59537
437 Ga0307412_10000758 3300031911 Bacteria 18729
438 Ga0307412_10010439 3300031911 Bacteria 5348
439 Ga0307412_10039826 3300031911 Bacteria 3037
440 Ga0307416_100000476 3300032002 Bacteria 20481
441 Ga0307416_100006164 3300032002 Bacteria 7476
442 Ga0307416_100063128 3300032002 Bacteria 3032
443 Ga0307414_10000031 3300032004 Bacteria 186808
444 Ga0307507_10000337 3300033179 Bacteria 95356
445 Ga0307510_10003234 3300033180 Bacteria 18935
446 Ga0373934_0032431 3300035086 Bacteria 2049
447 Ga0373956_0010280 3300035119 Bacteria 3831
448 Ga0373931_0010355 3300035691 Bacteria 4481
449 Ga0373937_0026705 3300036401 Bacteria 5217
450 Ga0316582_0027776 3300036647 Bacteria 3422
451 Ga0373925_0020864 3300037068 Bacteria 4775
452 Ga0395899_0000014 3300037312 Bacteria 488813
453 Ga0395899_0090451 3300037312 Bacteria 2219
454 Ga0395900_0000007 3300037418 Bacteria 488860
455 Ga0395900_0002362 3300037418 Bacteria 20872
456 Ga0395900_0017162 3300037418 Bacteria 7388
457 Ga0395900_0109571 3300037418 Bacteria 2837
458 Ga0395898_0000011 3300037466 Bacteria 488860
459 Ga0395898_0000792 3300037466 Bacteria 53811
460 Ga0395898_0163971 3300037466 Bacteria 2126
461 Ga0395905_0000008 3300037471 Bacteria 488860
462 Ga0395905_0000168 3300037471 Bacteria 107034
463 Ga0395905_0005540 3300037471 Bacteria 12882
464 Ga0395901_0000003 3300038443 Bacteria 701538
465 Ga0395901_0000020 3300038443 Bacteria 314918
466 Ga0395901_0000887 3300038443 Bacteria 32901
467 Ga0400485_05677 3300038735 Bacteria 27034
468 Ga0400486_26755 3300038742 Bacteria 12384
469 Ga0400487_02345 3300039110 Bacteria 2700
470 Ga0436360_0788480 3300039438 Bacteria 1765
471 Ga0436361_0022167 3300039447 Bacteria 8344
472 Ga0436361_0031202 3300039447 Bacteria 17500
473 Ga0436361_0064524 3300039447 Bacteria 4838
474 Ga0436361_0489162 3300039447 Bacteria 12076
475 Ga0436361_0979160 3300039447 Bacteria 2414
476 Ga0439436_0000001 3300041404 Bacteria 299341
477 Ga0439436_0010729 3300041404 Bacteria 2792
478 Ga0439438_005606 3300041405 Bacteria 4580
479 Ga0439447_002630 3300041407 Bacteria 6514
480 Ga0439466_0001991 3300041411 Bacteria 8008
481 Ga0439432_014624 3300042006 Bacteria 2655
482 Ga0439449_0005229 3300042007 Bacteria 4978
483 Ga0439452_012720 3300042010 Bacteria 2382
484 Ga0439457_009183 3300042014 Bacteria 2307
485 Ga0439463_000116 3300042016 Bacteria 19790
486 Ga0450890_002562 3300042127 Bacteria 2486
487 Ga0439446_0013290 3300042156 Bacteria 2258
488 Ga0439434_0006646 3300042435 Bacteria 3380
489 Ga0451577_0000266 3300042876 Bacteria 103006
490 Ga0466972_0000099 3300044658 Bacteria 76709
491 Ga0466965_0061216 3300044683 Bacteria 1881
492 Ga0466961_0036880 3300044693 Bacteria 3138
493 Ga0466963_0065204 3300044694 Bacteria 2441
494 Ga0453684_0000844 3300044712 Bacteria 103386
495 Ga0466970_0025509 3300044765 Bacteria 3095
496 Ga0466970_0045861 3300044765 Bacteria 2328
497 Ga0466959_0004970 3300045049 Bacteria 9013
498 Ga0495617_000049 3300046452 Bacteria 113032
499 Ga0495617_000113 3300046452 Bacteria 56843
500 Ga0495617_000556 3300046452 Bacteria 19192
501 Ga0495627_000019 3300046453 Bacteria 309691
502 Ga0495627_000055 3300046453 Bacteria 149482
503 Ga0495627_000133 3300046453 Bacteria 89977
504 Ga0495592_0031195 3300046454 Bacteria 4028
505 Ga0495592_0169880 3300046454 Bacteria 1494
506 Ga0495603_0000061 3300046455 Bacteria 47189
507 Ga0495603_0004003 3300046455 Bacteria 8772
508 Ga0495603_0049304 3300046455 Bacteria 2507
509 Ga0495590_0000003 3300046457 Bacteria 478593
510 Ga0495590_0008220 3300046457 Bacteria 3991
511 Ga0495590_0013143 3300046457 Bacteria 3050
512 Ga0495590_0017447 3300046457 Bacteria 2584
513 Ga0495590_0030518 3300046457 Bacteria 1888
514 Ga0495591_003738 3300046458 Bacteria 7707
515 Ga0495629_0000369 3300046459 Bacteria 38164
516 Ga0495629_0000818 3300046459 Bacteria 25215
517 Ga0495629_0001732 3300046459 Bacteria 17109
518 Ga0495629_0004061 3300046459 Bacteria 10994
519 Ga0495629_0030333 3300046459 Bacteria 3834
520 Ga0495638_0000012 3300046460 Bacteria 435577
521 Ga0495638_0000091 3300046460 Bacteria 146548
522 Ga0495638_0000777 3300046460 Bacteria 33705
523 Ga0495638_0001101 3300046460 Bacteria 26323
524 Ga0495638_0004234 3300046460 Bacteria 10916
525 Ga0495638_0030025 3300046460 Bacteria 3502
526 Ga0495638_0074555 3300046460 Bacteria 2069
527 Ga0495651_0009711 3300046462 Bacteria 7398
528 Ga0495651_0015864 3300046462 Bacteria 5833
529 Ga0495653_0000013 3300046463 Bacteria 250453
530 Ga0495653_0001073 3300046463 Bacteria 21089
531 Ga0495653_0001528 3300046463 Bacteria 18094
532 Ga0495653_0007481 3300046463 Bacteria 8933
533 Ga0495653_0007668 3300046463 Bacteria 8831
534 Ga0495653_0057751 3300046463 Bacteria 2952
535 Ga0495653_0060930 3300046463 Bacteria 2856
536 Ga0495653_0108533 3300046463 Bacteria 1998
537 Ga0495650_0000272 3300046471 Bacteria 98846
538 Ga0495650_0000343 3300046471 Bacteria 83112
539 Ga0495650_0000585 3300046471 Bacteria 50650
540 Ga0495650_0002944 3300046471 Bacteria 12897
541 Ga0495650_0003293 3300046471 Bacteria 11923
542 Ga0495650_0004900 3300046471 Bacteria 8947
543 Ga0495650_0006165 3300046471 Bacteria 7534
544 Ga0495650_0006548 3300046471 Bacteria 7239
545 Ga0495650_0009215 3300046471 Bacteria 5646
546 Ga0495650_0016096 3300046471 Bacteria 3803
547 Ga0495650_0018287 3300046471 Bacteria 3486
548 Ga0495650_0053698 3300046471 Bacteria 1648
549 Ga0495580_0000051 3300046472 Bacteria 67349
550 Ga0495580_0000075 3300046472 Bacteria 62029
551 Ga0495580_0002112 3300046472 Bacteria 17432
552 Ga0495580_0002733 3300046472 Bacteria 15222
553 Ga0495580_0008766 3300046472 Bacteria 8010
554 Ga0495580_0022572 3300046472 Bacteria 4630
555 Ga0495582_0000933 3300046473 Bacteria 16309
556 Ga0495582_0001741 3300046473 Bacteria 12273
557 Ga0495582_0023486 3300046473 Bacteria 3373
558 Ga0495582_0026900 3300046473 Bacteria 3152
559 Ga0495605_0000048 3300046474 Bacteria 170182
560 Ga0495605_0000248 3300046474 Bacteria 63725
561 Ga0495605_0000739 3300046474 Bacteria 24000
562 Ga0495605_0004288 3300046474 Bacteria 8401
563 Ga0495605_0005538 3300046474 Bacteria 7347
564 Ga0495605_0026141 3300046474 Bacteria 3036
565 Ga0495639_0064137 3300046475 Bacteria 1688
566 Ga0495664_0001444 3300046477 Bacteria 12592
567 Ga0495664_0002023 3300046477 Bacteria 10827
568 Ga0495664_0023799 3300046477 Bacteria 3555
569 Ga0495664_0036517 3300046477 Bacteria 2897
570 Ga0495664_0049255 3300046477 Bacteria 2501
571 Ga0495584_0003744 3300046491 Bacteria 8287
572 Ga0495584_0010108 3300046491 Bacteria 4845
573 Ga0495585_0000656 3300046492 Bacteria 31800
574 Ga0495585_0001923 3300046492 Bacteria 15545
575 Ga0495594_0022484 3300046499 Bacteria 3373
576 Ga0495596_0003112 3300046500 Bacteria 8566
577 Ga0495596_0008266 3300046500 Bacteria 4640
578 Ga0495607_0001023 3300046501 Bacteria 25713
579 Ga0495607_0001103 3300046501 Bacteria 24573
580 Ga0495607_0004273 3300046501 Bacteria 10571
581 Ga0495607_0074914 3300046501 Bacteria 1877
582 Ga0495583_0000096 3300046506 Bacteria 151090
583 Ga0495583_0000111 3300046506 Bacteria 138300
584 Ga0495583_0000411 3300046506 Bacteria 65040
585 Ga0495583_0005032 3300046506 Bacteria 9146
586 Ga0495583_0019017 3300046506 Bacteria 3596
587 Ga0495606_0000141 3300046507 Bacteria 123586
588 Ga0495606_0000181 3300046507 Bacteria 111247
589 Ga0495606_0000371 3300046507 Bacteria 76806
590 Ga0495606_0001341 3300046507 Bacteria 33489
591 Ga0495606_0001575 3300046507 Bacteria 29893
592 Ga0495606_0002442 3300046507 Bacteria 21599
593 Ga0495606_0002973 3300046507 Bacteria 18643
594 Ga0495606_0003604 3300046507 Bacteria 16293
595 Ga0495606_0005194 3300046507 Bacteria 12587
596 Ga0495606_0010149 3300046507 Bacteria 7859
597 Ga0495606_0011992 3300046507 Bacteria 7000
598 Ga0495606_0013138 3300046507 Bacteria 6572
599 Ga0495606_0035688 3300046507 Bacteria 3396
600 Ga0495606_0042239 3300046507 Bacteria 3051
601 Ga0495610_0000003 3300046512 Bacteria 1203910
602 Ga0495610_0001146 3300046512 Bacteria 24109
603 Ga0495610_0002717 3300046512 Bacteria 14558
604 Ga0495610_0003885 3300046512 Bacteria 11344
605 Ga0495610_0005190 3300046512 Bacteria 9327
606 Ga0495610_0005840 3300046512 Bacteria 8646
607 Ga0495610_0009470 3300046512 Bacteria 6156
608 Ga0495610_0027931 3300046512 Bacteria 2991
609 Ga0495610_0031209 3300046512 Bacteria 2782
610 Ga0495610_0038692 3300046512 Bacteria 2419
611 Ga0495616_0000041 3300046513 Bacteria 122413
612 Ga0495616_0000047 3300046513 Bacteria 110592
613 Ga0495616_0026416 3300046513 Bacteria 3091
614 Ga0495618_0009715 3300046514 Bacteria 5811
615 Ga0495618_0022138 3300046514 Bacteria 3923
616 Ga0495618_0049996 3300046514 Bacteria 2640
617 Ga0495620_0000001 3300046515 Bacteria 386508
618 Ga0495620_0000132 3300046515 Bacteria 60838
619 Ga0495620_0026085 3300046515 Bacteria 2753
620 Ga0495628_0000876 3300046516 Bacteria 27763
621 Ga0495628_0001582 3300046516 Bacteria 20859
622 Ga0495628_0004005 3300046516 Bacteria 13121
623 Ga0495628_0004465 3300046516 Bacteria 12405
624 Ga0495630_0002987 3300046517 Bacteria 11729
625 Ga0495630_0010727 3300046517 Bacteria 6616
626 Ga0495630_0052563 3300046517 Bacteria 3050
627 Ga0495631_0000165 3300046518 Bacteria 45258
628 Ga0495631_0000184 3300046518 Bacteria 42706
629 Ga0495631_0004792 3300046518 Bacteria 7133
630 Ga0495631_0069036 3300046518 Bacteria 1528
631 Ga0495632_0000194 3300046519 Bacteria 61534
632 Ga0495632_0000475 3300046519 Bacteria 38064
633 Ga0495632_0000832 3300046519 Bacteria 27194
634 Ga0495632_0004097 3300046519 Bacteria 10048
635 Ga0495632_0008514 3300046519 Bacteria 6283
636 Ga0495637_0000881 3300046520 Bacteria 19418
637 Ga0495637_0011671 3300046520 Bacteria 4217
638 Ga0495637_0018719 3300046520 Bacteria 3209
639 Ga0495643_0000179 3300046522 Bacteria 100406
640 Ga0495643_0002002 3300046522 Bacteria 16993
641 Ga0495643_0004389 3300046522 Bacteria 9882
642 Ga0495644_0012560 3300046523 Bacteria 3256
643 Ga0495648_0000038 3300046524 Bacteria 191612
644 Ga0495648_0000058 3300046524 Bacteria 156717
645 Ga0495648_0000493 3300046524 Bacteria 42504
646 Ga0495648_0003075 3300046524 Bacteria 14906
647 Ga0495648_0004767 3300046524 Bacteria 11480
648 Ga0495648_0006030 3300046524 Bacteria 9950
649 Ga0495648_0015882 3300046524 Bacteria 5443
650 Ga0495648_0020256 3300046524 Bacteria 4644
651 Ga0495648_0030734 3300046524 Bacteria 3546
652 Ga0495648_0059329 3300046524 Bacteria 2283
653 Ga0495666_0002127 3300046526 Bacteria 9826
654 Ga0495666_0012299 3300046526 Bacteria 4267
655 Ga0495666_0019840 3300046526 Bacteria 3333
656 Ga0495642_0000782 3300046528 Bacteria 15467
657 Ga0495652_0000989 3300046529 Bacteria 32515
658 Ga0495652_0019814 3300046529 Bacteria 5986
659 Ga0495652_0042236 3300046529 Bacteria 3932
660 Ga0495652_0066935 3300046529 Bacteria 3012
661 Ga0495652_0071838 3300046529 Bacteria 2886
662 Ga0495652_0163164 3300046529 Bacteria 1727
663 Ga0495654_0000104 3300046530 Bacteria 95266
664 Ga0495654_0000261 3300046530 Bacteria 47872
665 Ga0495654_0000429 3300046530 Bacteria 35515
666 Ga0495654_0004542 3300046530 Bacteria 8208
667 Ga0495654_0005509 3300046530 Bacteria 7333
668 Ga0495654_0011430 3300046530 Bacteria 4802
669 Ga0495654_0017751 3300046530 Bacteria 3735
670 Ga0495665_0001751 3300046531 Bacteria 11678
671 Ga0495665_0002198 3300046531 Bacteria 10564
672 Ga0495665_0004453 3300046531 Bacteria 7560
673 Ga0495665_0008897 3300046531 Bacteria 5446
674 Ga0495665_0046188 3300046531 Bacteria 2313
675 Ga0495640_0007138 3300046533 Bacteria 8795
676 Ga0495640_0014334 3300046533 Bacteria 6000
677 Ga0495640_0029716 3300046533 Bacteria 3920
678 Ga0495586_0001186 3300046535 Bacteria 14628
679 Ga0495586_0003954 3300046535 Bacteria 7955
680 Ga0495587_0002413 3300046536 Bacteria 12451
681 Ga0495587_0030452 3300046536 Bacteria 3272
682 Ga0495587_0048626 3300046536 Bacteria 2511
683 Ga0495609_0000012 3300046538 Bacteria 333994
684 Ga0495609_0000374 3300046538 Bacteria 38378
685 Ga0495609_0000426 3300046538 Bacteria 35215
686 Ga0495609_0000790 3300046538 Bacteria 23698
687 Ga0495609_0029289 3300046538 Bacteria 2508
688 Ga0495597_0000700 3300046542 Bacteria 26805
689 Ga0495597_0001363 3300046542 Bacteria 17689
690 Ga0495597_0001525 3300046542 Bacteria 16468
691 Ga0495597_0002471 3300046542 Bacteria 11672
692 Ga0495597_0009887 3300046542 Bacteria 4690
693 Ga0495645_0000929 3300046543 Bacteria 19941
694 Ga0495645_0006241 3300046543 Bacteria 8257
695 Ga0495645_0010888 3300046543 Bacteria 6388
696 Ga0495622_0000100 3300046557 Bacteria 76484
697 Ga0495622_0001413 3300046557 Bacteria 12133
698 Ga0495622_0002597 3300046557 Bacteria 8709
699 Ga0495622_0008779 3300046557 Bacteria 4680
700 Ga0495622_0029523 3300046557 Bacteria 2562
701 Ga0495622_0031154 3300046557 Bacteria 2493
702 Ga0495633_0000034 3300046558 Bacteria 185552
703 Ga0495633_0000119 3300046558 Bacteria 106455
704 Ga0495633_0000362 3300046558 Bacteria 48938
705 Ga0495633_0000465 3300046558 Bacteria 41465
706 Ga0495633_0010446 3300046558 Bacteria 5065
707 Ga0495633_0015952 3300046558 Bacteria 3887
708 Ga0495633_0029359 3300046558 Bacteria 2676
709 Ga0495667_0037279 3300046559 Bacteria 3241
710 Ga0495668_0000290 3300046616 Bacteria 68805
711 Ga0495668_0002864 3300046616 Bacteria 13685
712 Ga0495668_0009602 3300046616 Bacteria 5921
713 Ga0495634_0001596 3300046642 Bacteria 19826
714 Ga0495634_0004751 3300046642 Bacteria 10569
715 Ga0495634_0004842 3300046642 Bacteria 10445
716 Ga0495611_0000103 3300046648 Bacteria 58463
717 Ga0495611_0000686 3300046648 Bacteria 19230
718 Ga0495625_0000103 3300046660 Bacteria 136109
719 Ga0495625_0000132 3300046660 Bacteria 115728
720 Ga0495625_0001113 3300046660 Bacteria 34865
721 Ga0495625_0003017 3300046660 Bacteria 17334
722 Ga0495625_0009454 3300046660 Bacteria 8158
723 Ga0495625_0023347 3300046660 Bacteria 4725
724 Ga0495625_0027855 3300046660 Bacteria 4245
725 Ga0495625_0037360 3300046660 Bacteria 3564
726 Ga0495625_0063903 3300046660 Bacteria 2598
727 Ga0495625_0066989 3300046660 Bacteria 2528
728 Ga0495635_0015402 3300046663 Bacteria 5348
729 Ga0495635_0022469 3300046663 Bacteria 4392
730 Ga0495635_0064837 3300046663 Bacteria 2507
731 Ga0495659_0000073 3300046664 Bacteria 42850
732 Ga0495659_0013838 3300046664 Bacteria 2632
733 Ga0495661_0000004 3300046665 Bacteria 555340
734 Ga0495661_0005899 3300046665 Bacteria 8655
735 Ga0495661_0019425 3300046665 Bacteria 4452
736 Ga0495661_0021682 3300046665 Bacteria 4184
737 Ga0495588_0022270 3300046674 Bacteria 3131
738 Ga0495588_0037893 3300046674 Bacteria 2451
739 Ga0495657_0033837 3300046675 Bacteria 3554
740 Ga0495599_0000658 3300046678 Bacteria 19541
741 Ga0495599_0076601 3300046678 Bacteria 2088
742 Ga0495623_0012301 3300046679 Bacteria 5540
743 Ga0495623_0058871 3300046679 Bacteria 2414
744 Ga0495623_0065295 3300046679 Bacteria 2276
745 Ga0495646_0003933 3300046680 Bacteria 9288
746 Ga0495646_0006842 3300046680 Bacteria 7237
747 Ga0495646_0012375 3300046680 Bacteria 5425
748 Ga0495646_0014075 3300046680 Bacteria 5087
749 Ga0495646_0016680 3300046680 Bacteria 4664
750 Ga0495646_0022668 3300046680 Bacteria 3959
751 Ga0495646_0022909 3300046680 Bacteria 3934
752 Ga0495669_0000770 3300046684 Bacteria 13693
753 Ga0495669_0004452 3300046684 Bacteria 5787
754 Ga0495669_0018601 3300046684 Bacteria 2989
755 Ga0495613_0003301 3300046689 Bacteria 12074
756 Ga0495613_0008008 3300046689 Bacteria 7861
757 Ga0495613_0048237 3300046689 Bacteria 3145
758 Ga0495624_0000363 3300046690 Bacteria 36049
759 Ga0495624_0002152 3300046690 Bacteria 15026
760 Ga0495624_0002339 3300046690 Bacteria 14388
761 Ga0495670_0003911 3300046691 Bacteria 7318
762 Ga0495670_0006138 3300046691 Bacteria 5899
763 Ga0495670_0010205 3300046691 Bacteria 4619
764 Ga0495671_0000001 3300046692 Bacteria 1169494
765 Ga0495671_0000034 3300046692 Bacteria 195385
766 Ga0495671_0000309 3300046692 Bacteria 41290
767 Ga0495671_0005006 3300046692 Bacteria 7807
768 Ga0495671_0018897 3300046692 Bacteria 3650
769 Ga0495671_0053737 3300046692 Bacteria 1998
770 Ga0495649_0003133 3300046694 Bacteria 11331
771 Ga0495649_0003786 3300046694 Bacteria 10032
772 Ga0495649_0028461 3300046694 Bacteria 3097
773 Ga0495589_0009832 3300046794 Bacteria 4967
774 Ga0495589_0017982 3300046794 Bacteria 3626
775 Ga0495589_0027598 3300046794 Bacteria 2870
776 Ga0495600_0003792 3300046809 Bacteria 8951
777 Ga0495600_0029159 3300046809 Bacteria 3572
778 Ga0495600_0096261 3300046809 Bacteria 1930
779 Ga0495660_0000466 3300046810 Bacteria 33526
780 Ga0495660_0000607 3300046810 Bacteria 28251
781 Ga0495660_0002080 3300046810 Bacteria 12975
782 Ga0495660_0002776 3300046810 Bacteria 11044
783 Ga0495660_0003373 3300046810 Bacteria 9898
784 Ga0495660_0004217 3300046810 Bacteria 8735
785 Ga0495660_0004567 3300046810 Bacteria 8359
786 Ga0495660_0010838 3300046810 Bacteria 5294
787 Ga0495581_0001681 3300047315 Bacteria 12324
788 Ga0495581_0017195 3300047315 Bacteria 4203
789 Ga0495581_0042499 3300047315 Bacteria 2631
790 Ga0495581_0058483 3300047315 Bacteria 2226
791 Ga0495581_0078332 3300047315 Bacteria 1913
792 Ga0495604_0003651 3300047317 Bacteria 12263
793 Ga0495604_0023651 3300047317 Bacteria 4903
794 Ga0495604_0038194 3300047317 Bacteria 3778
795 Ga0495674_0008415 3300047319 Bacteria 9827
796 Ga0495674_0010496 3300047319 Bacteria 8764
797 Ga0495674_0025846 3300047319 Bacteria 5375
798 Ga0495674_0029256 3300047319 Bacteria 5019
799 Ga0495674_0032477 3300047319 Bacteria 4733
800 Ga0495672_0000070 3300047320 Bacteria 184471
801 Ga0495672_0000176 3300047320 Bacteria 92728
802 Ga0495672_0000263 3300047320 Bacteria 72879
803 Ga0495672_0002512 3300047320 Bacteria 16771
804 Ga0495676_0011909 3300047321 Bacteria 7849
805 Ga0495676_0027256 3300047321 Bacteria 4902
806 Ga0495676_0157494 3300047321 Bacteria 1610
807 Ga0495680_0009659 3300047322 Bacteria 8655
808 Ga0495680_0012256 3300047322 Bacteria 7555
809 Ga0495680_0086354 3300047322 Bacteria 2361
810 Ga0495680_0144409 3300047322 Bacteria 1739
811 Ga0495683_0000034 3300047323 Bacteria 148959
812 Ga0495683_0001290 3300047323 Bacteria 16939
813 Ga0495683_0001307 3300047323 Bacteria 16716
814 Ga0495683_0002162 3300047323 Bacteria 12064
815 Ga0495683_0002665 3300047323 Bacteria 10648
816 Ga0495683_0013789 3300047323 Bacteria 4219
817 Ga0495683_0045040 3300047323 Bacteria 2217
818 Ga0495687_000011 3300047443 Bacteria 397225
819 Ga0495687_002443 3300047443 Bacteria 14923
820 Ga0495687_019899 3300047443 Bacteria 3282
821 Ga0495687_022476 3300047443 Bacteria 3027
822 Ga0495675_0004950 3300047444 Bacteria 8115
823 Ga0495675_0012770 3300047444 Bacteria 5290
824 Ga0495675_0019834 3300047444 Bacteria 4271
825 Ga0495677_0006706 3300047445 Bacteria 4334
826 Ga0495679_000109 3300047446 Bacteria 74134
827 Ga0495679_000377 3300047446 Bacteria 34132
828 Ga0495679_000950 3300047446 Bacteria 18019
829 Ga0495679_001329 3300047446 Bacteria 14342
830 Ga0495679_002198 3300047446 Bacteria 10186
831 Ga0495673_0000001 3300047469 Bacteria 1630730
832 Ga0495673_0000006 3300047469 Bacteria 908691
833 Ga0495673_0000013 3300047469 Bacteria 612902
834 Ga0495673_0000015 3300047469 Bacteria 598766
835 Ga0495673_0000049 3300047469 Bacteria 265878
836 Ga0495673_0000823 3300047469 Bacteria 29108
837 Ga0495673_0003680 3300047469 Bacteria 9994
838 Ga0495673_0021828 3300047469 Bacteria 3151
839 Ga0495681_0042597 3300047470 Bacteria 2196
840 Ga0495684_0019488 3300047471 Bacteria 5225
841 Ga0495686_0000014 3300047472 Bacteria 474014
842 Ga0495686_0000149 3300047472 Bacteria 135332
843 Ga0495686_0000255 3300047472 Bacteria 95600
844 Ga0495686_0006880 3300047472 Bacteria 8612
845 Ga0495686_0013387 3300047472 Bacteria 5692
846 Ga0495686_0014873 3300047472 Bacteria 5340
847 Ga0495686_0022063 3300047472 Bacteria 4216
848 Ga0495686_0034237 3300047472 Bacteria 3273
849 Ga0495686_0037558 3300047472 Bacteria 3102
850 Ga0495686_0051973 3300047472 Bacteria 2570
851 Ga0495593_0003797 3300047673 Bacteria 9023
852 Ga0495593_0009553 3300047673 Bacteria 5629
853 Ga0495593_0015971 3300047673 Bacteria 4240
854 Ga0495593_0016785 3300047673 Bacteria 4124
855 Ga0495593_0028151 3300047673 Bacteria 3087
856 Ga0495593_0046487 3300047673 Bacteria 2313
857 Ga0495593_0056585 3300047673 Bacteria 2061
858 Ga0495602_0000840 3300048088 Bacteria 29575
859 Ga0495602_0078992 3300048088 Bacteria 2777
860 Ga0495602_0081879 3300048088 Bacteria 2711
861 Ga0495602_0106486 3300048088 Bacteria 2288
862 Ga0495602_0164330 3300048088 Bacteria 1729
863 Ga0495614_0000434 3300048089 Bacteria 17195
864 Ga0495614_0008580 3300048089 Bacteria 4544
865 Ga0495614_0031513 3300048089 Bacteria 2281
866 Ga0495626_0000074 3300048091 Bacteria 132552
867 Ga0495626_0015369 3300048091 Bacteria 3922
868 Ga0496100_0016348 3300048903 Bacteria 4355
869 Ga0496100_0081836 3300048903 Bacteria 2182
870 Ga0496101_0002730 3300048904 Bacteria 10832
871 Ga0496101_0022535 3300048904 Bacteria 4337
872 Ga0496101_0031993 3300048904 Bacteria 3700
873 Ga0496102_0000661 3300048905 Bacteria 34418
874 Ga0496102_0010371 3300048905 Bacteria 8016
875 Ga0496102_0015524 3300048905 Bacteria 6635
876 Ga0496102_0260440 3300048905 Bacteria 1635
877 Ga0496103_0001616 3300048906 Bacteria 14787
878 Ga0496103_0003187 3300048906 Bacteria 10078
879 Ga0496103_0004293 3300048906 Bacteria 8662
880 Ga0496103_0041089 3300048906 Bacteria 2843
881 Ga0496104_0080317 3300048907 Bacteria 3109
882 Ga0496106_0000001 3300048909 Bacteria 497458
883 Ga0496106_0093316 3300048909 Bacteria 2326
884 Ga0496107_0063107 3300048910 Bacteria 2685
885 Ga0496110_0080392 3300048913 Bacteria 2904
886 Ga0496111_0026674 3300048914 Bacteria 4081
887 Ga0496112_0037967 3300048915 Bacteria 4703
888 Ga0496113_0018949 3300048916 Bacteria 4804
889 Ga0496113_0038038 3300048916 Bacteria 3535
890 Ga0496114_0005374 3300048917 Bacteria 10016
891 Ga0496114_0085651 3300048917 Bacteria 2669
892 Ga0496115_0000044 3300048918 Bacteria 115745
893 Ga0496115_0001226 3300048918 Bacteria 18412
894 Ga0496115_0019820 3300048918 Bacteria 5181
895 Ga0496115_0025983 3300048918 Bacteria 4565
896 Ga0496115_0037291 3300048918 Bacteria 3852
897 Ga0496115_0064586 3300048918 Bacteria 2955
898 Ga0496115_0202215 3300048918 Bacteria 1641
899 Ga0496116_0000007 3300048919 Bacteria 795464
900 Ga0496116_0002257 3300048919 Bacteria 20446
901 Ga0496116_0012782 3300048919 Bacteria 6822
902 Ga0496116_0016629 3300048919 Bacteria 5746
903 Ga0496116_0054549 3300048919 Bacteria 2632
904 Ga0496117_0002491 3300048920 Bacteria 23105
905 Ga0496117_0007212 3300048920 Bacteria 10952
906 Ga0496117_0020755 3300048920 Bacteria 5346
907 Ga0496117_0026204 3300048920 Bacteria 4567
908 Ga0496117_0038027 3300048920 Bacteria 3576
909 Ga0496117_0059094 3300048920 Bacteria 2651
910 Ga0496118_0000259 3300048921 Bacteria 93615
911 Ga0496118_0000669 3300048921 Bacteria 55755
912 Ga0496118_0002811 3300048921 Bacteria 22806
913 Ga0496118_0003220 3300048921 Bacteria 20839
914 Ga0496118_0005972 3300048921 Bacteria 13584
915 Ga0496118_0008488 3300048921 Bacteria 10605
916 Ga0496118_0010335 3300048921 Bacteria 9251
917 Ga0496118_0048421 3300048921 Bacteria 3283
918 Ga0496118_0080892 3300048921 Bacteria 2284
919 Ga0496118_0086493 3300048921 Bacteria 2178
920 Ga0496118_0099089 3300048921 Bacteria 1977
921 Ga0496120_0003113 3300048923 Bacteria 15578
922 Ga0496120_0007965 3300048923 Bacteria 7801
923 Ga0496120_0023234 3300048923 Bacteria 3884
924 Ga0496121_0000161 3300048924 Bacteria 145828
925 Ga0496121_0000288 3300048924 Bacteria 104728
926 Ga0496121_0000479 3300048924 Bacteria 77608
927 Ga0496121_0001261 3300048924 Bacteria 43799
928 Ga0496121_0003427 3300048924 Bacteria 22671
929 Ga0496121_0005273 3300048924 Bacteria 16676
930 Ga0496121_0005981 3300048924 Bacteria 15372
931 Ga0496121_0021126 3300048924 Bacteria 6395
932 Ga0496122_0000560 3300048925 Bacteria 76145
933 Ga0496122_0000878 3300048925 Bacteria 56301
934 Ga0496122_0002514 3300048925 Bacteria 25879
935 Ga0496122_0007186 3300048925 Bacteria 12469
936 Ga0496122_0015020 3300048925 Bacteria 7436
937 Ga0496122_0021381 3300048925 Bacteria 5794
938 Ga0496122_0025980 3300048925 Bacteria 5067
939 Ga0496122_0029262 3300048925 Bacteria 4650
940 Ga0496122_0055042 3300048925 Bacteria 2981
941 Ga0496122_0109363 3300048925 Bacteria 1819
942 Ga0496123_0001228 3300048926 Bacteria 37305
943 Ga0496123_0002185 3300048926 Bacteria 24905
944 Ga0496123_0003057 3300048926 Bacteria 19234
945 Ga0496123_0004457 3300048926 Bacteria 14707
946 Ga0496123_0007989 3300048926 Bacteria 9802
947 Ga0496123_0008663 3300048926 Bacteria 9299
948 Ga0496123_0019819 3300048926 Bacteria 5282
949 Ga0496123_0022693 3300048926 Bacteria 4828
950 Ga0496124_0000435 3300048927 Bacteria 74150
951 Ga0496124_0000909 3300048927 Bacteria 47773
952 Ga0496124_0012247 3300048927 Bacteria 8480
953 Ga0496124_0024181 3300048927 Bacteria 5530
954 Ga0496124_0118411 3300048927 Bacteria 2120
955 Ga0496124_0142932 3300048927 Bacteria 1886
956 Ga0496125_0000168 3300048928 Bacteria 146364
957 Ga0496125_0000856 3300048928 Bacteria 48873
958 Ga0496125_0001001 3300048928 Bacteria 44072
959 Ga0496125_0010055 3300048928 Bacteria 9601
960 Ga0496125_0012148 3300048928 Bacteria 8567
961 Ga0496125_0137779 3300048928 Bacteria 1703
962 Ga0496126_0004283 3300048929 Bacteria 17159
963 Ga0496126_0004599 3300048929 Bacteria 16372
964 Ga0496126_0006612 3300048929 Bacteria 12906
965 Ga0496126_0025732 3300048929 Bacteria 5656
966 Ga0496126_0070134 3300048929 Bacteria 3123
967 Ga0496126_0105803 3300048929 Bacteria 2456
968 Ga0496126_0112920 3300048929 Bacteria 2365
969 Ga0496126_0127225 3300048929 Bacteria 2204
970 Ga0495678_000049 3300049459 Bacteria 163929
971 Ga0495678_000155 3300049459 Bacteria 81324
972 Ga0495678_000500 3300049459 Bacteria 38668
973 Ga0495678_003612 3300049459 Bacteria 9435
974 Ga0495678_006032 3300049459 Bacteria 6527
975 Ga0495678_007459 3300049459 Bacteria 5665
976 Ga0495678_030113 3300049459 Bacteria 2274
977 Ga0501034_0014107 3300049571 Bacteria 8233
978 Ga0501034_0022941 3300049571 Bacteria 6359
979 Ga0501038_0065257 3300049574 Bacteria 3102
980 Ga0501040_0000019 3300049576 Bacteria 73276
981 Ga0501040_0050049 3300049576 Bacteria 2857
982 Ga0501042_0003111 3300049578 Bacteria 10328
983 Ga0501042_0060247 3300049578 Bacteria 2711
984 Ga0501043_0083427 3300049579 Bacteria 2512
985 Ga0501046_0002427 3300049580 Bacteria 17479
986 Ga0501047_0022235 3300049581 Bacteria 6092
987 Ga0501047_0097234 3300049581 Bacteria 2822
988 Ga0501249_007081 3300049679 Bacteria 2312
989 Ga0501279_000999 3300049775 Bacteria 3735
990 Ga0501044_0036403 3300049823 Bacteria 5149
991 nmdc:mga03n38_21131_c1 3300050490 Bacteria 2615
992 nmdc:mga03n38_9233_c1 3300050490 Bacteria 3577
993 nmdc:mga00v17_136738_c1 3300050491 Bacteria 1569
994 nmdc:mga00v17_18864_c1 3300050491 Bacteria 2907
995 nmdc:mga00v17_75952_c1 3300050491 Bacteria 2090
996 nmdc:mga0yw44_29081_c1 3300050492 Bacteria 3187
997 nmdc:mga0yw44_38_c1 3300050492 Bacteria 46328
998 nmdc:mga0k408_1282_c1 3300050493 Bacteria 13605
999 nmdc:mga0k408_20035_c1 3300050493 Bacteria 3743
1000 nmdc:mga0k408_59677_c1 3300050493 Bacteria 2217
1001 nmdc:mga06z11_38_c1 3300050494 Bacteria 54827
1002 nmdc:mga06z11_73_c1 3300050494 Bacteria 42058
1003 nmdc:mga04h51_6028_c1 3300050495 Bacteria 3121
1004 nmdc:mga04h51_603_c1 3300050495 Bacteria 8565
1005 nmdc:mga07m45_1400_c1 3300050496 Bacteria 11026
1006 nmdc:mga07m45_1859_c1 3300050496 Bacteria 9756
1007 nmdc:mga07m45_6283_c1 3300050496 Bacteria 5998
1008 nmdc:mga07m45_65648_c1 3300050496 Bacteria 2061
1009 nmdc:mga05p37_144752_c1 3300050507 Bacteria 2911
1010 nmdc:mga05p37_3069_c1 3300050507 Bacteria 19403
1011 nmdc:mga09592_45239_c1 3300050508 Bacteria 3707
1012 nmdc:mga0n895_72944_c1 3300050512 Bacteria 3407
1013 nmdc:mga0a205_249633_c1 3300050515 Bacteria 1654
1014 nmdc:mga0sz30_1865_c1 3300050516 Bacteria 7502
1015 nmdc:mga0sz30_7496_c1 3300050516 Bacteria 4093
1016 Ga0500578_0061156 3300053086 Bacteria 2405
1017 Ga0500643_000856 3300053087 Bacteria 19429
1018 Ga0500583_0006817 3300053092 Bacteria 3963
1019 Ga0500651_0000101 3300053093 Bacteria 52909
1020 Ga0500555_005125 3300053103 Bacteria 3716
1021 Ga0500562_000080 3300053108 Bacteria 43341
1022 Ga0500594_0016524 3300053118 Bacteria 1794
1023 Ga0500595_000960 3300053119 Bacteria 16254
1024 Ga0500618_000142 3300053125 Bacteria 59775
1025 Ga0500618_000786 3300053125 Bacteria 17782
1026 Ga0500618_019267 3300053125 Bacteria 1681
1027 Ga0500559_0011796 3300053136 Bacteria 3726
1028 Ga0500559_0011951 3300053136 Bacteria 3700
1029 Ga0500586_000917 3300053145 Bacteria 6072
1030 Ga0500586_008042 3300053145 Bacteria 2852
1031 Ga0500619_001719 3300053154 Bacteria 3979
1032 Ga0500622_0000176 3300053156 Bacteria 69125
1033 Ga0500624_000009 3300053157 Bacteria 178763
1034 Ga0500627_0000877 3300053158 Bacteria 8042
1035 Ga0500611_000029 3300053727 Bacteria 89288
1036 Ga0500645_000415 3300053730 Bacteria 29692
1037 Ga0500661_000743 3300055283 Bacteria 6125
1038 Ga0501082_0026495 3300060353 Bacteria 4997
1039 Ga0501082_0075187 3300060353 Bacteria 2910
1040 Ga0466962_0029794 3300061719 Bacteria 2612
1041 Ga0530510_0111947 3300061734 Bacteria 2000

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006195 Ga0075366_10131703 Ga0075366_101317031 375
2 3300046454 Ga0495592_0169880 Ga0495592_0169880_11_1306 403
3 3300046518 Ga0495631_0069036 Ga0495631_0069036_38_1324 407
4 3300048088 Ga0495602_0164330 Ga0495602_0164330_403_1719 414
5 3300003791 Ga0055530_10001714 Ga0055530_100017142 421
6 3300061719 Ga0466962_0029794 Ga0466962_0029794_1232_2596 429
7 3300009036 Ga0105244_10001089 Ga0105244_100010897 430
8 3300009092 Ga0105250_10001000 Ga0105250_1000100010 430
9 3300046463 Ga0495653_0057751 Ga0495653_0057751_1572_2936 430
10 3300047320 Ga0495672_0000070 Ga0495672_0000070_93075_94430 430
11 3300046674 Ga0495588_0037893 Ga0495588_0037893_11_1378 431
12 3300049459 Ga0495678_007459 Ga0495678_007459_4275_5654 431
13 3300003322 rootL2_10087097 rootL2_100870972 432
14 3300049581 Ga0501047_0022235 Ga0501047_0022235_962_2407 437
15 3300005457 Ga0070662_100104996 Ga0070662_1001049962 438
16 iso_pu_bacteria 2824600985 2824601712 438
17 iso_pu_bacteria 2824609381 2824611317 438
18 iso_pu_bacteria 2824653114 2824653400 438
19 iso_pu_bacteria 2888419890 2888422311 438
20 3300002737 JGI25162J39368_1001976 JGI25162J39368_10019764 440
21 3300003214 JGI25165J46597_1000476 JGI25165J46597_100047631 440
22 3300009093 Ga0105240_10111500 Ga0105240_101115002 440
23 3300025231 Ga0207427_100091 Ga0207427_10009130 440
24 3300025233 Ga0209437_100026 Ga0209437_100026137 440
25 3300025261 Ga0209233_1000111 Ga0209233_100011131 440
26 3300046472 Ga0495580_0022572 Ga0495580_0022572_3207_4601 440
27 3300050493 nmdc:mga0k408_20035_c1 nmdc:mga0k408_20035_c1_15_1466 440
28 3300048920 Ga0496117_0026204 Ga0496117_0026204_3100_4458 441
29 iso_pu_bacteria 2901300506 2901308901 441
30 3300046501 Ga0495607_0004273 Ga0495607_0004273_7499_8935 442
31 3300047472 Ga0495686_0037558 Ga0495686_0037558_1172_2671 442
32 3300048923 Ga0496120_0007965 Ga0496120_0007965_25_1488 442
33 3300013105 Ga0157369_10002233 Ga0157369_1000223318 445
34 3300046453 Ga0495627_000133 Ga0495627_000133_53170_54603 445
35 3300046513 Ga0495616_0000041 Ga0495616_0000041_75881_77314 445
36 3300046519 Ga0495632_0000475 Ga0495632_0000475_2889_4322 445
37 3300046524 Ga0495648_0004767 Ga0495648_0004767_6329_7762 445
38 3300046530 Ga0495654_0000104 Ga0495654_0000104_91341_92774 445
39 3300046660 Ga0495625_0000103 Ga0495625_0000103_44416_45849 445
40 3300046692 Ga0495671_0005006 Ga0495671_0005006_370_1803 445
41 3300046810 Ga0495660_0004217 Ga0495660_0004217_3094_4527 445
42 3300047323 Ga0495683_0002162 Ga0495683_0002162_9369_10802 445
43 3300048091 Ga0495626_0000074 Ga0495626_0000074_86706_88139 445
44 3300049459 Ga0495678_000500 Ga0495678_000500_1766_3199 445
45 3300002704 JGI25155J39150_1000224 JGI25155J39150_10002244 447
46 3300002705 JGI25156J39149_1000357 JGI25156J39149_10003574 447
47 3300002738 JGI25154J39366_1000298 JGI25154J39366_10002984 447
48 3300002741 JGI25157J39369_1000262 JGI25157J39369_100026217 447
49 3300003758 Ga0055532_1000059 Ga0055532_100005929 447
50 3300003761 Ga0055535_1003465 Ga0055535_10034652 447
51 3300003781 Ga0055536_1000117 Ga0055536_100011737 447
52 3300003791 Ga0055530_10000236 Ga0055530_1000023629 447
53 3300003791 Ga0055530_10000471 Ga0055530_1000047114 447
54 3300003792 Ga0055540_1000008 Ga0055540_100000838 447
55 3300003794 Ga0055531_10000403 Ga0055531_1000040333 447
56 3300005288 Ga0065714_10075970 Ga0065714_100759704 447
57 3300005329 Ga0070683_100006203 Ga0070683_1000062035 447
58 3300005535 Ga0070684_100000777 Ga0070684_1000007777 447
59 3300005616 Ga0068852_100009696 Ga0068852_1000096964 447
60 3300005616 Ga0068852_100027471 Ga0068852_1000274713 447
61 3300009011 Ga0105251_10016033 Ga0105251_100160332 447
62 3300009036 Ga0105244_10009636 Ga0105244_100096364 447
63 3300009093 Ga0105240_10000787 Ga0105240_1000078744 447
64 3300014497 Ga0182008_10009557 Ga0182008_100095574 447
65 3300025206 Ga0209435_100032 Ga0209435_100032111 447
66 3300025229 Ga0209147_100109 Ga0209147_100109111 447
67 3300025233 Ga0209437_100512 Ga0209437_1005126 447
68 3300025242 Ga0209258_100190 Ga0209258_10019084 447
69 3300025246 Ga0209646_1000113 Ga0209646_1000113111 447
70 3300025250 Ga0209026_1000102 Ga0209026_1000102111 447
71 3300025256 Ga0209759_1000104 Ga0209759_1000104111 447
72 3300025272 Ga0209455_1005995 Ga0209455_10059953 447
73 3300025292 Ga0209676_1000002 Ga0209676_10000021533 447
74 3300025298 Ga0209050_1000006 Ga0209050_100000638 447
75 3300025303 Ga0209051_1000001 Ga0209051_10000011533 447
76 3300025304 Ga0209257_1000029 Ga0209257_100002938 447
77 3300025711 Ga0207696_1000887 Ga0207696_10008875 447
78 3300025711 Ga0207696_1010719 Ga0207696_10107192 447
79 3300025728 Ga0207655_1005796 Ga0207655_10057965 447
80 3300025735 Ga0207713_1000131 Ga0207713_100013178 447
81 3300025735 Ga0207713_1000143 Ga0207713_100014310 447
82 3300025944 Ga0207661_10004240 Ga0207661_100042407 447
83 3300026142 Ga0207698_10006777 Ga0207698_100067773 447
84 3300032004 Ga0307414_10000031 Ga0307414_10000031159 447
85 3300046660 Ga0495625_0009454 Ga0495625_0009454_6098_7546 447
86 3300048919 Ga0496116_0012782 Ga0496116_0012782_1695_3143 447
87 3300048921 Ga0496118_0086493 Ga0496118_0086493_205_1653 447
88 3300048925 Ga0496122_0007186 Ga0496122_0007186_7335_8783 447
89 3300048926 Ga0496123_0004457 Ga0496123_0004457_5777_7225 447
90 3300048928 Ga0496125_0010055 Ga0496125_0010055_7470_8918 447
91 iso_pu_bacteria 2739367651 2739591555 448
92 iso_pu_bacteria 646564506 646813448 448
93 3300005539 Ga0068853_100043140 Ga0068853_1000431402 449
94 3300026041 Ga0207639_10029672 Ga0207639_100296724 449
95 3300031711 Ga0265314_10001830 Ga0265314_100018306 450
96 iso_pu_bacteria 2523231067 2523469851 451
97 3300002773 JGI25152J39213_1000468 JGI25152J39213_100046813 452
98 3300002774 JGI25150J39212_1000182 JGI25150J39212_100018210 452
99 3300003187 JGI25151J46595_10000888 JGI25151J46595_1000088813 452
100 3300003215 JGI25153J46596_10000542 JGI25153J46596_1000054213 452
101 3300025245 Ga0207425_1000028 Ga0207425_1000028157 452
102 3300025258 Ga0209129_1000065 Ga0209129_1000065105 452
103 3300025273 Ga0209673_1005777 Ga0209673_10057773 452
104 3300025294 Ga0209025_1000002 Ga0209025_1000002115 452
105 3300025297 Ga0209758_1000003 Ga0209758_1000003122 452
106 iso_pu_bacteria 2511231010 2511292182 452
107 iso_pu_bacteria 2600255318 2601799270 452
108 iso_pu_bacteria 2603880185 2606078500 452
109 iso_pu_bacteria 2603880199 2606130608 452
110 iso_pu_bacteria 2623620443 2624480248 452
111 iso_pu_bacteria 2713897149 2715758580 452
112 iso_pu_bacteria 2739367700 2739731973 452
113 iso_pu_bacteria 2878029506 2878032154 452
114 iso_pu_bacteria 2881927736 2881930032 452
115 iso_pu_bacteria 2919063839 2919068745 452
116 iso_pu_bacteria 3007861166 3007861724 452
117 iso_pu_bacteria 8055301274 8055307719 452
118 iso_pu_bacteria 8055693939 8055696799 452
119 3300038735 Ga0400485_05677 Ga0400485_05677_641_2092 453
120 3300038742 Ga0400486_26755 Ga0400486_26755_10880_12331 453
121 3300039110 Ga0400487_02345 Ga0400487_02345_636_2087 453
122 3300039447 Ga0436361_0489162 Ga0436361_0489162_8489_9946 453
123 iso_pu_bacteria 2506520007 2506579554 453
124 iso_pu_bacteria 2506520008 2506584693 453
125 iso_pu_bacteria 2508501071 2508853344 453
126 iso_pu_bacteria 2585428057 2587728439 453
127 iso_pu_bacteria 2593339238 2595445732 453
128 iso_pu_bacteria 2600255292 2601671932 453
129 iso_pu_bacteria 2654587920 2656277013 453
130 iso_pu_bacteria 2687453601 2689446076 453
131 iso_pu_bacteria 2718218334 2721027963 453
132 iso_pu_bacteria 2738543009 2739227435 453
133 iso_pu_bacteria 2791355048 2792458548 453
134 iso_pu_bacteria 2806310673 2807179987 453
135 iso_pu_bacteria 2842918807 2842919325 453
136 iso_pu_bacteria 2849560528 2849564045 453
137 iso_pu_bacteria 2849573788 2849577495 453
138 iso_pu_bacteria 2851153111 2851157491 453
139 iso_pu_bacteria 2852103415 2852104789 453
140 iso_pu_bacteria 2857547612 2857552294 453
141 iso_pu_bacteria 2869551831 2869555420 453
142 iso_pu_bacteria 2898329390 2898332168 453
143 iso_pu_bacteria 2919404418 2919405930 453
144 iso_pu_bacteria 2953994433 2953997947 453
145 iso_pu_bacteria 640753048 640938824 453
146 3300003771 Ga0055526_1000066 Ga0055526_100006679 454
147 3300006051 Ga0075364_10009105 Ga0075364_100091056 454
148 3300006177 Ga0075362_10001341 Ga0075362_100013416 454
149 3300006178 Ga0075367_10012884 Ga0075367_100128843 454
150 3300006186 Ga0075369_10013613 Ga0075369_100136133 454
151 3300006195 Ga0075366_10009001 Ga0075366_100090013 454
152 3300006353 Ga0075370_10004783 Ga0075370_100047833 454
153 3300009036 Ga0105244_10040070 Ga0105244_100400702 454
154 3300012497 Ga0157319_1000001 Ga0157319_1000001105 454
155 3300025245 Ga0207425_1000479 Ga0207425_10004794 454
156 3300025294 Ga0209025_1001807 Ga0209025_100180711 454
157 3300025295 Ga0209564_1000009 Ga0209564_1000009563 454
158 3300025304 Ga0209257_1000805 Ga0209257_100080512 454
159 3300025728 Ga0207655_1032863 Ga0207655_10328632 454
160 3300035086 Ga0373934_0032431 Ga0373934_0032431_584_2026 454
161 3300036401 Ga0373937_0026705 Ga0373937_0026705_115_1557 454
162 3300037068 Ga0373925_0020864 Ga0373925_0020864_385_1827 454
163 3300042127 Ga0450890_002562 Ga0450890_002562_465_1904 454
164 3300046460 Ga0495638_0000012 Ga0495638_0000012_164927_166408 454
165 3300046471 Ga0495650_0000343 Ga0495650_0000343_62549_64003 454
166 3300046471 Ga0495650_0009215 Ga0495650_0009215_4040_5494 454
167 3300046474 Ga0495605_0000248 Ga0495605_0000248_39111_40565 454
168 3300046507 Ga0495606_0000141 Ga0495606_0000141_15675_17129 454
169 3300046512 Ga0495610_0003885 Ga0495610_0003885_2378_3832 454
170 3300046520 Ga0495637_0000881 Ga0495637_0000881_17832_19286 454
171 3300046524 Ga0495648_0000038 Ga0495648_0000038_25205_26686 454
172 3300046530 Ga0495654_0000261 Ga0495654_0000261_20883_22337 454
173 3300046616 Ga0495668_0000290 Ga0495668_0000290_56416_57870 454
174 3300046809 Ga0495600_0096261 Ga0495600_0096261_358_1800 454
175 3300047472 Ga0495686_0000149 Ga0495686_0000149_7704_9185 454
176 3300047472 Ga0495686_0051973 Ga0495686_0051973_164_1618 454
177 3300048919 Ga0496116_0054549 Ga0496116_0054549_710_2164 454
178 3300048927 Ga0496124_0012247 Ga0496124_0012247_4028_5482 454
179 3300048927 Ga0496124_0118411 Ga0496124_0118411_554_2008 454
180 3300050490 nmdc:mga03n38_9233_c1 nmdc:mga03n38_9233_c1_756_2216 454
181 3300050491 nmdc:mga00v17_18864_c1 nmdc:mga00v17_18864_c1_800_2260 454
182 3300050493 nmdc:mga0k408_1282_c1 nmdc:mga0k408_1282_c1_3072_4532 454
183 3300050493 nmdc:mga0k408_59677_c1 nmdc:mga0k408_59677_c1_293_1753 454
184 3300050496 nmdc:mga07m45_1859_c1 nmdc:mga07m45_1859_c1_4557_6017 454
185 3300050516 nmdc:mga0sz30_7496_c1 nmdc:mga0sz30_7496_c1_710_2170 454
186 3300060353 Ga0501082_0026495 Ga0501082_0026495_1938_3380 454
187 iso_pu_bacteria 2511231000 2511233505 454
188 iso_pu_bacteria 2513237083 2513560199 454
189 iso_pu_bacteria 2515154189 2516016954 454
190 iso_pu_bacteria 2582581873 2585426347 454
191 iso_pu_bacteria 2585428061 2587752770 454
192 iso_pu_bacteria 2585428095 2587866419 454
193 iso_pu_bacteria 2643221554 2643787390 454
194 iso_pu_bacteria 2643221611 2644072742 454
195 iso_pu_bacteria 2643221638 2644214095 454
196 iso_pu_bacteria 2643221645 2644252414 454
197 iso_pu_bacteria 2643221733 2644728136 454
198 iso_pu_bacteria 2738541280 2738741554 454
199 iso_pu_bacteria 2738541297 2738829611 454
200 iso_pu_bacteria 2738541300 2738843828 454
201 iso_pu_bacteria 2738541357 2739153407 454
202 iso_pu_bacteria 2738543003 2739195327 454
203 iso_pu_bacteria 2738543018 2739277633 454
204 iso_pu_bacteria 2738543026 2739321803 454
205 iso_pu_bacteria 2738543029 2739339641 454
206 iso_pu_bacteria 2738543030 2739346682 454
207 iso_pu_bacteria 2821131069 2821131222 454
208 iso_pu_bacteria 2842711865 2842714439 454
209 iso_pu_bacteria 2854681122 2854683423 454
210 iso_pu_bacteria 2857553236 2857554111 454
211 iso_pu_bacteria 2857558681 2857561552 454
212 iso_pu_bacteria 2857564685 2857565106 454
213 iso_pu_bacteria 2883087390 2883094711 454
214 iso_pu_bacteria 2891670763 2891673573 454
215 iso_pu_bacteria 2904424332 2904426427 454
216 iso_pu_bacteria 2917554339 2917557661 454
217 iso_pu_bacteria 2919476304 2919478754 454
218 iso_pu_bacteria 2919493220 2919496948 454
219 iso_pu_bacteria 2939669807 2939671666 454
220 iso_pu_bacteria 3006969106 3006972579 454
221 iso_pu_bacteria 8003955200 8003957466 454
222 3300003762 Ga0055542_1000136 Ga0055542_100013689 455
223 3300005340 Ga0070689_100001969 Ga0070689_1000019692 455
224 3300005466 Ga0070685_10056486 Ga0070685_100564862 455
225 3300025228 Ga0209672_101263 Ga0209672_1012633 455
226 3300025231 Ga0207427_100736 Ga0207427_1007363 455
227 3300025233 Ga0209437_100126 Ga0209437_1001266 455
228 3300025242 Ga0209258_103038 Ga0209258_1030385 455
229 3300025254 Ga0209148_1000002 Ga0209148_10000021438 455
230 3300025936 Ga0207670_10005546 Ga0207670_100055461 455
231 3300026067 Ga0207678_10089329 Ga0207678_100893292 455
232 3300028800 Ga0265338_10000258 Ga0265338_1000025874 455
233 3300031824 Ga0307413_10009536 Ga0307413_100095364 455
234 3300046460 Ga0495638_0000777 Ga0495638_0000777_26734_28176 455
235 3300046460 Ga0495638_0001101 Ga0495638_0001101_13273_14715 455
236 3300046471 Ga0495650_0000585 Ga0495650_0000585_7578_9020 455
237 3300046507 Ga0495606_0002973 Ga0495606_0002973_11811_13253 455
238 3300046557 Ga0495622_0002597 Ga0495622_0002597_5947_7389 455
239 3300046660 Ga0495625_0027855 Ga0495625_0027855_1306_2748 455
240 3300048918 Ga0496115_0001226 Ga0496115_0001226_9707_11149 455
241 3300048918 Ga0496115_0019820 Ga0496115_0019820_2710_4152 455
242 3300048918 Ga0496115_0025983 Ga0496115_0025983_417_1859 455
243 3300048929 Ga0496126_0070134 Ga0496126_0070134_353_1795 455
244 3300048929 Ga0496126_0112920 Ga0496126_0112920_41_1483 455
245 3300048929 Ga0496126_0127225 Ga0496126_0127225_244_1686 455
246 3300049571 Ga0501034_0014107 Ga0501034_0014107_1234_2679 455
247 3300053093 Ga0500651_0000101 Ga0500651_0000101_33700_35148 455
248 3300061734 Ga0530510_0111947 Ga0530510_0111947_189_1628 455
249 iso_pu_bacteria 2512564014 2512642333 455
250 iso_pu_bacteria 2513237143 2513903395 455
251 iso_pu_bacteria 2513237150 2513954350 455
252 iso_pu_bacteria 2513237165 2514040950 455
253 iso_pu_bacteria 2522572158 2523104433 455
254 iso_pu_bacteria 2534681786 2535486326 455
255 iso_pu_bacteria 2548876994 2550695965 455
256 iso_pu_bacteria 2554235132 2554813099 455
257 iso_pu_bacteria 2606217733 2608385402 455
258 iso_pu_bacteria 2643221664 2644357086 455
259 iso_pu_bacteria 2738543031 2739348830 455
260 iso_pu_bacteria 2739367866 2740031887 455
261 iso_pu_bacteria 2808606401 2809063124 455
262 iso_pu_bacteria 2808606404 2809079088 455
263 iso_pu_bacteria 2808606405 2809083537 455
264 iso_pu_bacteria 2818991445 2819594906 455
265 iso_pu_bacteria 2831864461 2831864722 455
266 iso_pu_bacteria 2846540461 2846540494 455
267 iso_pu_bacteria 2854911287 2854914996 455
268 iso_pu_bacteria 2856287931 2856289184 455
269 iso_pu_bacteria 2857357740 2857363445 455
270 iso_pu_bacteria 2880518877 2880520382 455
271 iso_pu_bacteria 2884811622 2884816130 455
272 iso_pu_bacteria 2884836552 2884838244 455
273 iso_pu_bacteria 2884852848 2884854536 455
274 iso_pu_bacteria 2896154374 2896159207 455
275 iso_pu_bacteria 2919543075 2919547228 455
276 iso_pu_bacteria 2919709256 2919709371 455
277 iso_pu_bacteria 2923525760 2923526071 455
278 iso_pu_bacteria 2928968154 2928972124 455
279 iso_pu_bacteria 2958512119 2958513140 455
280 iso_pu_bacteria 644736347 644748900 455
281 iso_pu_bacteria 8002392321 8002396198 455
282 iso_pu_bacteria 8011350971 8011355988 455
283 3300002705 JGI25156J39149_1000678 JGI25156J39149_10006788 456
284 3300002741 JGI25157J39369_1000678 JGI25157J39369_100067811 456
285 3300003771 Ga0055526_1000158 Ga0055526_100015816 456
286 3300005272 Ga0065703_1020772 Ga0065703_10207721 456
287 3300005434 Ga0070709_10009067 Ga0070709_100090672 456
288 3300005435 Ga0070714_100060861 Ga0070714_1000608612 456
289 3300005436 Ga0070713_100082365 Ga0070713_1000823651 456
290 3300005437 Ga0070710_10011974 Ga0070710_100119744 456
291 3300005439 Ga0070711_100020185 Ga0070711_1000201853 456
292 3300005445 Ga0070708_100001870 Ga0070708_1000018705 456
293 3300005467 Ga0070706_100000447 Ga0070706_10000044725 456
294 3300005518 Ga0070699_100228978 Ga0070699_1002289782 456
295 3300005536 Ga0070697_100000435 Ga0070697_1000004359 456
296 3300006175 Ga0070712_100028226 Ga0070712_1000282262 456
297 3300006946 Ga0079104_1002961 Ga0079104_10029614 456
298 3300009011 Ga0105251_10000348 Ga0105251_1000034822 456
299 3300009011 Ga0105251_10001129 Ga0105251_100011294 456
300 3300009101 Ga0105247_10000471 Ga0105247_100004717 456
301 3300009174 Ga0105241_10000001 Ga0105241_10000001661 456
302 3300013100 Ga0157373_10001759 Ga0157373_100017599 456
303 3300013104 Ga0157370_10022173 Ga0157370_100221732 456
304 3300014497 Ga0182008_10002716 Ga0182008_100027163 456
305 3300017792 Ga0163161_10000003 Ga0163161_10000003216 456
306 3300025229 Ga0209147_104464 Ga0209147_1044641 456
307 3300025250 Ga0209026_1000482 Ga0209026_100048212 456
308 3300025250 Ga0209026_1001487 Ga0209026_10014876 456
309 3300025256 Ga0209759_1000785 Ga0209759_100078523 456
310 3300025273 Ga0209673_1031053 Ga0209673_10310531 456
311 3300025295 Ga0209564_1000033 Ga0209564_100003334 456
312 3300025711 Ga0207696_1000001 Ga0207696_10000012301 456
313 3300025735 Ga0207713_1000321 Ga0207713_100032129 456
314 3300025735 Ga0207713_1000388 Ga0207713_10003889 456
315 3300025898 Ga0207692_10006262 Ga0207692_100062622 456
316 3300025900 Ga0207710_10000116 Ga0207710_1000011632 456
317 3300025904 Ga0207647_10000234 Ga0207647_1000023440 456
318 3300025910 Ga0207684_10047767 Ga0207684_100477672 456
319 3300025911 Ga0207654_10000004 Ga0207654_10000004688 456
320 3300025916 Ga0207663_10014101 Ga0207663_100141013 456
321 3300027111 Ga0209281_1000038 Ga0209281_1000038223 456
322 3300027111 Ga0209281_1007572 Ga0209281_10075722 456
323 3300039447 Ga0436361_0064524 Ga0436361_0064524_2382_3848 456
324 3300046453 Ga0495627_000019 Ga0495627_000019_31046_32482 456
325 3300046457 Ga0495590_0030518 Ga0495590_0030518_31_1485 456
326 3300046471 Ga0495650_0000272 Ga0495650_0000272_79966_81426 456
327 3300046471 Ga0495650_0006548 Ga0495650_0006548_46_1479 456
328 3300046474 Ga0495605_0000048 Ga0495605_0000048_56652_58085 456
329 3300046477 Ga0495664_0001444 Ga0495664_0001444_6458_7906 456
330 3300046499 Ga0495594_0022484 Ga0495594_0022484_81_1529 456
331 3300046501 Ga0495607_0074914 Ga0495607_0074914_243_1676 456
332 3300046506 Ga0495583_0000096 Ga0495583_0000096_42805_44238 456
333 3300046514 Ga0495618_0049996 Ga0495618_0049996_52_1500 456
334 3300046515 Ga0495620_0000001 Ga0495620_0000001_7861_9294 456
335 3300046518 Ga0495631_0004792 Ga0495631_0004792_5629_7062 456
336 3300046520 Ga0495637_0018719 Ga0495637_0018719_711_2165 456
337 3300046524 Ga0495648_0015882 Ga0495648_0015882_2966_4399 456
338 3300046526 Ga0495666_0012299 Ga0495666_0012299_62_1510 456
339 3300046530 Ga0495654_0000429 Ga0495654_0000429_28563_29999 456
340 3300046530 Ga0495654_0011430 Ga0495654_0011430_2945_4378 456
341 3300046533 Ga0495640_0029716 Ga0495640_0029716_62_1510 456
342 3300046535 Ga0495586_0001186 Ga0495586_0001186_3337_4785 456
343 3300046536 Ga0495587_0048626 Ga0495587_0048626_88_1536 456
344 3300046538 Ga0495609_0000012 Ga0495609_0000012_45495_46928 456
345 3300046542 Ga0495597_0002471 Ga0495597_0002471_5761_7194 456
346 3300046543 Ga0495645_0000929 Ga0495645_0000929_8132_9580 456
347 3300046558 Ga0495633_0000034 Ga0495633_0000034_141343_142776 456
348 3300046558 Ga0495633_0000119 Ga0495633_0000119_7659_9119 456
349 3300046642 Ga0495634_0001596 Ga0495634_0001596_321_1769 456
350 3300046648 Ga0495611_0000686 Ga0495611_0000686_987_2420 456
351 3300046660 Ga0495625_0001113 Ga0495625_0001113_29177_30637 456
352 3300046663 Ga0495635_0064837 Ga0495635_0064837_984_2432 456
353 3300046665 Ga0495661_0000004 Ga0495661_0000004_511075_512508 456
354 3300046678 Ga0495599_0076601 Ga0495599_0076601_81_1529 456
355 3300046680 Ga0495646_0003933 Ga0495646_0003933_960_2408 456
356 3300046691 Ga0495670_0010205 Ga0495670_0010205_2328_3761 456
357 3300046692 Ga0495671_0018897 Ga0495671_0018897_1583_3016 456
358 3300046794 Ga0495589_0017982 Ga0495589_0017982_214_1647 456
359 3300046810 Ga0495660_0004567 Ga0495660_0004567_2328_3761 456
360 3300047319 Ga0495674_0010496 Ga0495674_0010496_6445_7893 456
361 3300047323 Ga0495683_0000034 Ga0495683_0000034_104913_106346 456
362 3300047446 Ga0495679_000377 Ga0495679_000377_24884_26317 456
363 3300047470 Ga0495681_0042597 Ga0495681_0042597_577_2010 456
364 3300047673 Ga0495593_0009553 Ga0495593_0009553_95_1543 456
365 3300048918 Ga0496115_0037291 Ga0496115_0037291_120_1598 456
366 3300048919 Ga0496116_0000007 Ga0496116_0000007_256271_257707 456
367 3300048920 Ga0496117_0002491 Ga0496117_0002491_13529_14965 456
368 3300048921 Ga0496118_0000669 Ga0496118_0000669_14417_15850 456
369 3300048921 Ga0496118_0003220 Ga0496118_0003220_8297_9733 456
370 3300048924 Ga0496121_0000161 Ga0496121_0000161_13852_15285 456
371 3300048928 Ga0496125_0000856 Ga0496125_0000856_30021_31499 456
372 3300048929 Ga0496126_0105803 Ga0496126_0105803_54_1487 456
373 3300049459 Ga0495678_000049 Ga0495678_000049_119854_121287 456
374 3300050515 nmdc:mga0a205_249633_c1 nmdc:mga0a205_249633_c1_72_1553 456
375 3300053125 Ga0500618_019267 Ga0500618_019267_214_1647 456
376 iso_pu_bacteria 2501025502 2501078882 456
377 iso_pu_bacteria 2508501125 2509129363 456
378 iso_pu_bacteria 2510065045 2510249950 456
379 iso_pu_bacteria 2510917013 2511089520 456
380 iso_pu_bacteria 2512047030 2512347497 456
381 iso_pu_bacteria 2513237098 2513678142 456
382 iso_pu_bacteria 2513237151 2513962482 456
383 iso_pu_bacteria 2513237166 2514046263 456
384 iso_pu_bacteria 2515154122 2515679443 456
385 iso_pu_bacteria 2515154122 2515686716 456
386 iso_pu_bacteria 2554235234 2555259819 456
387 iso_pu_bacteria 2562617112 2563061879 456
388 iso_pu_bacteria 2585428060 2587748928 456
389 iso_pu_bacteria 2588254257 2590610525 456
390 iso_pu_bacteria 2599185292 2599902970 456
391 iso_pu_bacteria 2599185307 2599974374 456
392 iso_pu_bacteria 2600255283 2601627270 456
393 iso_pu_bacteria 2643221569 2643861799 456
394 iso_pu_bacteria 2643221594 2643983172 456
395 iso_pu_bacteria 2643221621 2644123433 456
396 iso_pu_bacteria 2667528175 2671123670 456
397 iso_pu_bacteria 2711768613 2713478285 456
398 iso_pu_bacteria 2718217991 2719639108 456
399 iso_pu_bacteria 2738541296 2738820138 456
400 iso_pu_bacteria 2738541298 2738832618 456
401 iso_pu_bacteria 2738541306 2738874145 456
402 iso_pu_bacteria 2738543002 2739185775 456
403 iso_pu_bacteria 2738543008 2739220743 456
404 iso_pu_bacteria 2751185846 2753568802 456
405 iso_pu_bacteria 2791355137 2792832988 456
406 iso_pu_bacteria 2808606395 2809033304 456
407 iso_pu_bacteria 2818991450 2819620850 456
408 iso_pu_bacteria 2834641062 2834645582 456
409 iso_pu_bacteria 2842324504 2842326889 456
410 iso_pu_bacteria 2842324504 2842331356 456
411 iso_pu_bacteria 2842348783 2842350494 456
412 iso_pu_bacteria 2842348783 2842355696 456
413 iso_pu_bacteria 2842454564 2842462000 456
414 iso_pu_bacteria 2857537821 2857538204 456
415 iso_pu_bacteria 2885270888 2885277324 456
416 iso_pu_bacteria 2902682994 2902683461 456
417 iso_pu_bacteria 2902682994 2902684119 456
418 iso_pu_bacteria 2904483920 2904483942 456
419 iso_pu_bacteria 2904615490 2904618904 456
420 iso_pu_bacteria 2914759650 2914763061 456
421 iso_pu_bacteria 2919108558 2919110930 456
422 iso_pu_bacteria 2919527303 2919529893 456
423 iso_pu_bacteria 2921643360 2921643752 456
424 iso_pu_bacteria 2921643360 2921649553 456
425 iso_pu_bacteria 2928108538 2928109651 456
426 iso_pu_bacteria 2928135762 2928136895 456
427 iso_pu_bacteria 2928503688 2928506422 456
428 iso_pu_bacteria 2941479691 2941482442 456
429 iso_pu_bacteria 2945934425 2945935403 456
430 iso_pu_bacteria 2960617483 2960618577 456
431 iso_pu_bacteria 2971820967 2971822526 456
432 iso_pu_bacteria 2990703756 2990704048 456
433 iso_pu_bacteria 3000376612 3000378380 456
434 iso_pu_bacteria 641736151 642422205 456
435 iso_pu_bacteria 642555112 642594310 456
436 iso_pu_bacteria 642555113 642620276 456
437 iso_pu_bacteria 8054844752 8054846603 456
438 iso_pu_bacteria 8054849141 8054851941 456
439 iso_pu_bacteria 8055266321 8055266726 456
440 iso_pu_bacteria 8055301274 8055303943 456
441 3300002075 JGI24738J21930_10000444 JGI24738J21930_100004445 457
442 3300002773 JGI25152J39213_1000052 JGI25152J39213_100005276 457
443 3300002774 JGI25150J39212_1006825 JGI25150J39212_10068252 457
444 3300002987 JGI25159J45721_1003508 JGI25159J45721_10035082 457
445 3300003320 rootH2_10148953 rootH2_101489533 457
446 3300003322 rootL2_10003775 rootL2_100037754 457
447 3300003374 JGI25161J50226_1000612 JGI25161J50226_10006126 457
448 3300003756 Ga0055533_1004026 Ga0055533_10040262 457
449 3300003763 Ga0055529_1000095 Ga0055529_100009586 457
450 3300003771 Ga0055526_1021162 Ga0055526_10211621 457
451 3300003775 Ga0055524_1000458 Ga0055524_100045830 457
452 3300003775 Ga0055524_1001753 Ga0055524_10017534 457
453 3300003775 Ga0055524_1013801 Ga0055524_10138013 457
454 3300003784 Ga0055534_1001113 Ga0055534_100111311 457
455 3300003784 Ga0055534_1004121 Ga0055534_10041212 457
456 3300003790 Ga0055528_1001000 Ga0055528_10010006 457
457 3300003791 Ga0055530_10001254 Ga0055530_100012541 457
458 3300003794 Ga0055531_10031163 Ga0055531_100311631 457
459 3300004625 Ga0055543_1000266 Ga0055543_10002666 457
460 3300005262 Ga0065165_1000877 Ga0065165_10008776 457
461 3300005289 Ga0065704_10070569 Ga0065704_1007056916 457
462 3300005344 Ga0070661_100163291 Ga0070661_1001632912 457
463 3300005467 Ga0070706_100000789 Ga0070706_10000078933 457
464 3300006051 Ga0075364_10004104 Ga0075364_100041047 457
465 3300006178 Ga0075367_10004486 Ga0075367_100044866 457
466 3300006353 Ga0075370_10021946 Ga0075370_100219465 457
467 3300006844 Ga0075428_100100073 Ga0075428_1001000732 457
468 3300006871 Ga0075434_100013014 Ga0075434_1000130144 457
469 3300009036 Ga0105244_10001130 Ga0105244_100011309 457
470 3300009147 Ga0114129_10001834 Ga0114129_1000183410 457
471 3300009147 Ga0114129_10063591 Ga0114129_100635911 457
472 3300013104 Ga0157370_10008542 Ga0157370_100085429 457
473 3300013306 Ga0163162_10009054 Ga0163162_100090541 457
474 3300015261 Ga0182006_1000027 Ga0182006_100002754 457
475 3300015261 Ga0182006_1000117 Ga0182006_100011712 457
476 3300015265 Ga0182005_1000041 Ga0182005_1000041113 457
477 3300017792 Ga0163161_10002342 Ga0163161_100023422 457
478 3300017792 Ga0163161_10006078 Ga0163161_100060785 457
479 3300021361 Ga0213872_10001700 Ga0213872_1000170011 457
480 3300025208 Ga0209436_100706 Ga0209436_1007066 457
481 3300025208 Ga0209436_101778 Ga0209436_1017786 457
482 3300025226 Ga0209674_100559 Ga0209674_10055910 457
483 3300025233 Ga0209437_101329 Ga0209437_1013292 457
484 3300025245 Ga0207425_1000001 Ga0207425_10000011747 457
485 3300025245 Ga0207425_1000668 Ga0207425_10006686 457
486 3300025246 Ga0209646_1000010 Ga0209646_1000010469 457
487 3300025254 Ga0209148_1000843 Ga0209148_10008435 457
488 3300025258 Ga0209129_1000001 Ga0209129_1000001924 457
489 3300025263 Ga0209565_1000525 Ga0209565_100052525 457
490 3300025263 Ga0209565_1001084 Ga0209565_100108415 457
491 3300025263 Ga0209565_1010348 Ga0209565_10103482 457
492 3300025272 Ga0209455_1000121 Ga0209455_100012164 457
493 3300025284 Ga0209130_1000365 Ga0209130_10003656 457
494 3300025284 Ga0209130_1004140 Ga0209130_10041405 457
495 3300025291 Ga0209675_1001170 Ga0209675_100117017 457
496 3300025291 Ga0209675_1001540 Ga0209675_100154016 457
497 3300025291 Ga0209675_1007196 Ga0209675_10071961 457
498 3300025295 Ga0209564_1000376 Ga0209564_10003768 457
499 3300025295 Ga0209564_1002236 Ga0209564_10022365 457
500 3300025295 Ga0209564_1002365 Ga0209564_100236515 457
501 3300025297 Ga0209758_1000116 Ga0209758_1000116185 457
502 3300025298 Ga0209050_1000446 Ga0209050_100044670 457
503 3300025298 Ga0209050_1000611 Ga0209050_10006112 457
504 3300025299 Ga0209256_1000350 Ga0209256_100035074 457
505 3300025299 Ga0209256_1000872 Ga0209256_100087226 457
506 3300025299 Ga0209256_1002393 Ga0209256_100239316 457
507 3300025302 Ga0207426_1002402 Ga0207426_10024025 457
508 3300025303 Ga0209051_1008025 Ga0209051_10080257 457
509 3300025304 Ga0209257_1000107 Ga0209257_100010716 457
510 3300025711 Ga0207696_1000848 Ga0207696_10008485 457
511 3300025728 Ga0207655_1010725 Ga0207655_10107254 457
512 3300025910 Ga0207684_10002377 Ga0207684_100023774 457
513 3300031235 Ga0265330_10013718 Ga0265330_100137182 457
514 3300031344 Ga0265316_10012182 Ga0265316_100121826 457
515 3300031507 Ga0307509_10001996 Ga0307509_1000199615 457
516 3300031548 Ga0307408_100000103 Ga0307408_10000010379 457
517 3300031548 Ga0307408_100005407 Ga0307408_1000054075 457
518 3300031711 Ga0265314_10023722 Ga0265314_100237222 457
519 3300031712 Ga0265342_10012313 Ga0265342_100123133 457
520 3300031731 Ga0307405_10000001 Ga0307405_100000011231 457
521 3300031911 Ga0307412_10000758 Ga0307412_1000075811 457
522 3300032002 Ga0307416_100006164 Ga0307416_1000061648 457
523 3300035691 Ga0373931_0010355 Ga0373931_0010355_1343_2806 457
524 3300039447 Ga0436361_0031202 Ga0436361_0031202_1111_2574 457
525 3300041404 Ga0439436_0000001 Ga0439436_0000001_263659_265095 457
526 3300041404 Ga0439436_0010729 Ga0439436_0010729_464_1909 457
527 3300041405 Ga0439438_005606 Ga0439438_005606_670_2115 457
528 3300041407 Ga0439447_002630 Ga0439447_002630_4498_5943 457
529 3300041411 Ga0439466_0001991 Ga0439466_0001991_710_2155 457
530 3300042006 Ga0439432_014624 Ga0439432_014624_619_2064 457
531 3300042010 Ga0439452_012720 Ga0439452_012720_274_1719 457
532 3300042156 Ga0439446_0013290 Ga0439446_0013290_564_2009 457
533 3300042435 Ga0439434_0006646 Ga0439434_0006646_947_2392 457
534 3300044658 Ga0466972_0000099 Ga0466972_0000099_45_1691 457
535 3300044765 Ga0466970_0025509 Ga0466970_0025509_218_1864 457
536 3300044765 Ga0466970_0045861 Ga0466970_0045861_405_1868 457
537 3300046452 Ga0495617_000049 Ga0495617_000049_21269_22732 457
538 3300046452 Ga0495617_000113 Ga0495617_000113_36220_37656 457
539 3300046453 Ga0495627_000055 Ga0495627_000055_11743_13209 457
540 3300046457 Ga0495590_0000003 Ga0495590_0000003_460144_461607 457
541 3300046460 Ga0495638_0000091 Ga0495638_0000091_52146_53609 457
542 3300046460 Ga0495638_0030025 Ga0495638_0030025_1931_3367 457
543 3300046460 Ga0495638_0074555 Ga0495638_0074555_481_1944 457
544 3300046463 Ga0495653_0000013 Ga0495653_0000013_230663_232126 457
545 3300046471 Ga0495650_0004900 Ga0495650_0004900_105_1568 457
546 3300046471 Ga0495650_0006165 Ga0495650_0006165_416_1852 457
547 3300046471 Ga0495650_0016096 Ga0495650_0016096_1466_2929 457
548 3300046491 Ga0495584_0003744 Ga0495584_0003744_2325_3761 457
549 3300046491 Ga0495584_0010108 Ga0495584_0010108_1327_2790 457
550 3300046492 Ga0495585_0000656 Ga0495585_0000656_92_1555 457
551 3300046492 Ga0495585_0001923 Ga0495585_0001923_13765_15201 457
552 3300046501 Ga0495607_0001023 Ga0495607_0001023_3406_4869 457
553 3300046506 Ga0495583_0005032 Ga0495583_0005032_7483_8946 457
554 3300046506 Ga0495583_0019017 Ga0495583_0019017_206_1669 457
555 3300046507 Ga0495606_0000181 Ga0495606_0000181_104570_106006 457
556 3300046507 Ga0495606_0000371 Ga0495606_0000371_8146_9609 457
557 3300046507 Ga0495606_0001575 Ga0495606_0001575_19807_21270 457
558 3300046507 Ga0495606_0010149 Ga0495606_0010149_1339_2802 457
559 3300046507 Ga0495606_0013138 Ga0495606_0013138_4583_6019 457
560 3300046512 Ga0495610_0000003 Ga0495610_0000003_153203_154666 457
561 3300046512 Ga0495610_0001146 Ga0495610_0001146_4559_5995 457
562 3300046512 Ga0495610_0002717 Ga0495610_0002717_232_1695 457
563 3300046512 Ga0495610_0005840 Ga0495610_0005840_2645_4081 457
564 3300046512 Ga0495610_0009470 Ga0495610_0009470_4551_6014 457
565 3300046512 Ga0495610_0031209 Ga0495610_0031209_96_1559 457
566 3300046512 Ga0495610_0038692 Ga0495610_0038692_434_1897 457
567 3300046513 Ga0495616_0000047 Ga0495616_0000047_45792_47228 457
568 3300046513 Ga0495616_0026416 Ga0495616_0026416_1519_2982 457
569 3300046516 Ga0495628_0001582 Ga0495628_0001582_5234_6670 457
570 3300046518 Ga0495631_0000184 Ga0495631_0000184_19594_21030 457
571 3300046519 Ga0495632_0000194 Ga0495632_0000194_11417_12853 457
572 3300046519 Ga0495632_0008514 Ga0495632_0008514_679_2115 457
573 3300046520 Ga0495637_0011671 Ga0495637_0011671_2305_3768 457
574 3300046522 Ga0495643_0000179 Ga0495643_0000179_86770_88233 457
575 3300046522 Ga0495643_0004389 Ga0495643_0004389_157_1620 457
576 3300046523 Ga0495644_0012560 Ga0495644_0012560_1617_3083 457
577 3300046524 Ga0495648_0000058 Ga0495648_0000058_139034_140497 457
578 3300046524 Ga0495648_0003075 Ga0495648_0003075_12139_13602 457
579 3300046524 Ga0495648_0059329 Ga0495648_0059329_221_1657 457
580 3300046528 Ga0495642_0000782 Ga0495642_0000782_8766_10202 457
581 3300046529 Ga0495652_0019814 Ga0495652_0019814_2293_3729 457
582 3300046530 Ga0495654_0004542 Ga0495654_0004542_3636_5099 457
583 3300046530 Ga0495654_0005509 Ga0495654_0005509_3112_4548 457
584 3300046538 Ga0495609_0000426 Ga0495609_0000426_20499_21962 457
585 3300046538 Ga0495609_0000790 Ga0495609_0000790_14978_16444 457
586 3300046538 Ga0495609_0029289 Ga0495609_0029289_910_2373 457
587 3300046542 Ga0495597_0000700 Ga0495597_0000700_6991_8454 457
588 3300046542 Ga0495597_0001525 Ga0495597_0001525_14913_16376 457
589 3300046557 Ga0495622_0001413 Ga0495622_0001413_1548_3011 457
590 3300046557 Ga0495622_0031154 Ga0495622_0031154_791_2254 457
591 3300046558 Ga0495633_0000362 Ga0495633_0000362_14140_15603 457
592 3300046558 Ga0495633_0000465 Ga0495633_0000465_30427_31890 457
593 3300046558 Ga0495633_0015952 Ga0495633_0015952_625_2088 457
594 3300046558 Ga0495633_0029359 Ga0495633_0029359_68_1531 457
595 3300046616 Ga0495668_0002864 Ga0495668_0002864_10390_11853 457
596 3300046648 Ga0495611_0000103 Ga0495611_0000103_19560_20996 457
597 3300046660 Ga0495625_0000132 Ga0495625_0000132_105104_106567 457
598 3300046660 Ga0495625_0023347 Ga0495625_0023347_697_2160 457
599 3300046660 Ga0495625_0037360 Ga0495625_0037360_131_1594 457
600 3300046660 Ga0495625_0063903 Ga0495625_0063903_425_1861 457
601 3300046664 Ga0495659_0013838 Ga0495659_0013838_414_1877 457
602 3300046665 Ga0495661_0019425 Ga0495661_0019425_2538_4001 457
603 3300046684 Ga0495669_0000770 Ga0495669_0000770_1171_2607 457
604 3300046684 Ga0495669_0004452 Ga0495669_0004452_1339_2802 457
605 3300046691 Ga0495670_0003911 Ga0495670_0003911_2453_3889 457
606 3300046691 Ga0495670_0006138 Ga0495670_0006138_4356_5792 457
607 3300046692 Ga0495671_0000001 Ga0495671_0000001_511506_512969 457
608 3300046694 Ga0495649_0003786 Ga0495649_0003786_1143_2606 457
609 3300046694 Ga0495649_0028461 Ga0495649_0028461_132_1568 457
610 3300046810 Ga0495660_0000466 Ga0495660_0000466_17024_18460 457
611 3300046810 Ga0495660_0000607 Ga0495660_0000607_20418_21884 457
612 3300046810 Ga0495660_0002080 Ga0495660_0002080_7025_8491 457
613 3300046810 Ga0495660_0003373 Ga0495660_0003373_4041_5477 457
614 3300046810 Ga0495660_0010838 Ga0495660_0010838_1034_2497 457
615 3300047320 Ga0495672_0000263 Ga0495672_0000263_15407_16870 457
616 3300047323 Ga0495683_0001307 Ga0495683_0001307_12874_14310 457
617 3300047323 Ga0495683_0013789 Ga0495683_0013789_148_1611 457
618 3300047443 Ga0495687_002443 Ga0495687_002443_9045_10508 457
619 3300047445 Ga0495677_0006706 Ga0495677_0006706_2858_4321 457
620 3300047469 Ga0495673_0000001 Ga0495673_0000001_1402662_1404098 457
621 3300047469 Ga0495673_0000006 Ga0495673_0000006_686146_687609 457
622 3300047469 Ga0495673_0000049 Ga0495673_0000049_105276_106739 457
623 3300047472 Ga0495686_0000255 Ga0495686_0000255_19249_20685 457
624 3300047472 Ga0495686_0013387 Ga0495686_0013387_477_1913 457
625 3300047472 Ga0495686_0022063 Ga0495686_0022063_343_1779 457
626 3300048906 Ga0496103_0003187 Ga0496103_0003187_6320_7783 457
627 3300048919 Ga0496116_0016629 Ga0496116_0016629_3188_4654 457
628 3300048923 Ga0496120_0023234 Ga0496120_0023234_136_1599 457
629 3300048924 Ga0496121_0001261 Ga0496121_0001261_2085_3521 457
630 3300048924 Ga0496121_0005273 Ga0496121_0005273_11975_13411 457
631 3300048924 Ga0496121_0005981 Ga0496121_0005981_9254_10717 457
632 3300048926 Ga0496123_0007989 Ga0496123_0007989_2609_4072 457
633 3300048927 Ga0496124_0024181 Ga0496124_0024181_3192_4658 457
634 3300048927 Ga0496124_0142932 Ga0496124_0142932_162_1625 457
635 3300048929 Ga0496126_0006612 Ga0496126_0006612_8220_9683 457
636 3300049459 Ga0495678_000155 Ga0495678_000155_59691_61154 457
637 3300049459 Ga0495678_003612 Ga0495678_003612_7832_9295 457
638 3300049459 Ga0495678_030113 Ga0495678_030113_85_1767 457
639 3300049574 Ga0501038_0065257 Ga0501038_0065257_692_2140 457
640 3300049579 Ga0501043_0083427 Ga0501043_0083427_880_2328 457
641 3300049581 Ga0501047_0097234 Ga0501047_0097234_904_2352 457
642 3300049679 Ga0501249_007081 Ga0501249_007081_208_1671 457
643 3300049775 Ga0501279_000999 Ga0501279_000999_1449_2912 457
644 3300049823 Ga0501044_0036403 Ga0501044_0036403_2921_4369 457
645 3300050491 nmdc:mga00v17_75952_c1 nmdc:mga00v17_75952_c1_572_2011 457
646 3300050496 nmdc:mga07m45_65648_c1 nmdc:mga07m45_65648_c1_306_1766 457
647 3300050507 nmdc:mga05p37_144752_c1 nmdc:mga05p37_144752_c1_607_2067 457
648 3300050507 nmdc:mga05p37_3069_c1 nmdc:mga05p37_3069_c1_10575_12035 457
649 3300050508 nmdc:mga09592_45239_c1 nmdc:mga09592_45239_c1_1929_3389 457
650 3300053125 Ga0500618_000786 Ga0500618_000786_157_1620 457
651 3300053145 Ga0500586_000917 Ga0500586_000917_125_1588 457
652 3300053145 Ga0500586_008042 Ga0500586_008042_1127_2590 457
653 3300053730 Ga0500645_000415 Ga0500645_000415_20818_22254 457
654 iso_pu_bacteria 2547132130 2547501445 457
655 iso_pu_bacteria 2751185846 2753565356 457
656 iso_pu_bacteria 2816332141 2816516261 457
657 iso_pu_bacteria 2818991450 2819620390 457
658 iso_pu_bacteria 2842391507 2842393553 457
659 iso_pu_bacteria 2858950400 2858952020 457
660 iso_pu_bacteria 2916699645 2916701143 457
661 iso_pu_bacteria 2919134579 2919136930 457
662 iso_pu_bacteria 2928108538 2928109010 457
663 iso_pu_bacteria 2928135762 2928136233 457
664 iso_pu_bacteria 2928503688 2928503986 457
665 iso_pu_bacteria 2957491536 2957497797 457
666 iso_pu_bacteria 2961064222 2961068449 457
667 iso_pu_bacteria 2964712639 2964717562 457
668 iso_pu_bacteria 2970076120 2970077825 457
669 iso_pu_bacteria 2984568884 2984570984 457
670 iso_pu_bacteria 2984572630 2984573792 457
671 iso_pu_bacteria 3000017691 3000018640 457
672 iso_pu_bacteria 8048746797 8048747668 457
673 3300003323 rootH1_10007253 rootH1_100072532 458
674 3300003756 Ga0055533_1000140 Ga0055533_100014039 458
675 3300007076 Ga0075435_100079380 Ga0075435_1000793804 458
676 3300014325 Ga0163163_10088556 Ga0163163_100885562 458
677 3300015265 Ga0182005_1010884 Ga0182005_10108842 458
678 3300021361 Ga0213872_10023824 Ga0213872_100238242 458
679 3300025225 Ga0209566_104037 Ga0209566_1040372 458
680 3300025226 Ga0209674_100025 Ga0209674_100025270 458
681 3300025253 Ga0209677_104928 Ga0209677_1049283 458
682 3300025302 Ga0207426_1000170 Ga0207426_100017020 458
683 3300026041 Ga0207639_10006894 Ga0207639_100068947 458
684 3300026088 Ga0207641_10174634 Ga0207641_101746342 458
685 3300036647 Ga0316582_0027776 Ga0316582_0027776_26_1477 458
686 3300039447 Ga0436361_0979160 Ga0436361_0979160_197_1657 458
687 3300044683 Ga0466965_0061216 Ga0466965_0061216_98_1570 458
688 3300046452 Ga0495617_000556 Ga0495617_000556_17699_19138 458
689 3300046462 Ga0495651_0009711 Ga0495651_0009711_48_1544 458
690 3300046471 Ga0495650_0003293 Ga0495650_0003293_8661_10100 458
691 3300046472 Ga0495580_0000051 Ga0495580_0000051_56694_58133 458
692 3300046507 Ga0495606_0001341 Ga0495606_0001341_7743_9224 458
693 3300046507 Ga0495606_0002442 Ga0495606_0002442_6612_8051 458
694 3300046507 Ga0495606_0035688 Ga0495606_0035688_534_1973 458
695 3300046507 Ga0495606_0042239 Ga0495606_0042239_1350_2789 458
696 3300046512 Ga0495610_0005190 Ga0495610_0005190_7666_9150 458
697 3300046515 Ga0495620_0000132 Ga0495620_0000132_12138_13577 458
698 3300046518 Ga0495631_0000165 Ga0495631_0000165_3620_5059 458
699 3300046519 Ga0495632_0004097 Ga0495632_0004097_6973_8412 458
700 3300046529 Ga0495652_0163164 Ga0495652_0163164_36_1532 458
701 3300046530 Ga0495654_0017751 Ga0495654_0017751_2221_3687 458
702 3300046542 Ga0495597_0001363 Ga0495597_0001363_14961_16406 458
703 3300046542 Ga0495597_0009887 Ga0495597_0009887_2134_3600 458
704 3300046660 Ga0495625_0003017 Ga0495625_0003017_15256_16722 458
705 3300046664 Ga0495659_0000073 Ga0495659_0000073_11058_12524 458
706 3300046678 Ga0495599_0000658 Ga0495599_0000658_16954_18393 458
707 3300046692 Ga0495671_0000309 Ga0495671_0000309_28834_30300 458
708 3300046810 Ga0495660_0002776 Ga0495660_0002776_2687_4153 458
709 3300047320 Ga0495672_0000176 Ga0495672_0000176_7569_9035 458
710 3300047321 Ga0495676_0157494 Ga0495676_0157494_59_1555 458
711 3300047469 Ga0495673_0000015 Ga0495673_0000015_327785_329227 458
712 3300047469 Ga0495673_0000823 Ga0495673_0000823_4459_5898 458
713 3300047472 Ga0495686_0014873 Ga0495686_0014873_2571_4010 458
714 3300047472 Ga0495686_0034237 Ga0495686_0034237_1018_2484 458
715 3300048088 Ga0495602_0081879 Ga0495602_0081879_1044_2540 458
716 3300048918 Ga0496115_0202215 Ga0496115_0202215_135_1601 458
717 3300048929 Ga0496126_0004599 Ga0496126_0004599_3121_4560 458
718 3300049576 Ga0501040_0000019 Ga0501040_0000019_50686_52143 458
719 3300049576 Ga0501040_0050049 Ga0501040_0050049_714_2171 458
720 3300049578 Ga0501042_0003111 Ga0501042_0003111_69_1526 458
721 3300049578 Ga0501042_0060247 Ga0501042_0060247_1189_2646 458
722 3300053119 Ga0500595_000960 Ga0500595_000960_4793_6289 458
723 3300053154 Ga0500619_001719 Ga0500619_001719_2085_3581 458
724 3300060353 Ga0501082_0075187 Ga0501082_0075187_235_1740 458
725 iso_pu_bacteria 2515154123 2515690455 458
726 iso_pu_bacteria 2857542790 2857543617 458
727 iso_pu_bacteria 2977243572 2977244319 458
728 3300002737 JGI25162J39368_1000088 JGI25162J39368_100008886 459
729 3300003320 rootH2_10209911 rootH2_102099112 459
730 3300003323 rootH1_10005241 rootH1_100052414 459
731 3300003578 Ga0006562J51391_1009521 Ga0006562J51391_10095211 459
732 3300003771 Ga0055526_1004255 Ga0055526_10042556 459
733 3300004625 Ga0055543_1004864 Ga0055543_10048643 459
734 3300005262 Ga0065165_1000455 Ga0065165_10004559 459
735 3300005327 Ga0070658_10025473 Ga0070658_100254733 459
736 3300005327 Ga0070658_10026080 Ga0070658_100260802 459
737 3300005335 Ga0070666_10006049 Ga0070666_100060495 459
738 3300005337 Ga0070682_100105727 Ga0070682_1001057272 459
739 3300005339 Ga0070660_100078616 Ga0070660_1000786161 459
740 3300005344 Ga0070661_100041129 Ga0070661_1000411292 459
741 3300005347 Ga0070668_100000041 Ga0070668_10000004188 459
742 3300005367 Ga0070667_100006513 Ga0070667_1000065139 459
743 3300005367 Ga0070667_100008663 Ga0070667_1000086636 459
744 3300005434 Ga0070709_10134274 Ga0070709_101342741 459
745 3300005436 Ga0070713_100125454 Ga0070713_1001254542 459
746 3300005439 Ga0070711_100149237 Ga0070711_1001492371 459
747 3300005445 Ga0070708_100050757 Ga0070708_1000507576 459
748 3300005458 Ga0070681_10118256 Ga0070681_101182562 459
749 3300005459 Ga0068867_100108376 Ga0068867_1001083762 459
750 3300005468 Ga0070707_100049034 Ga0070707_1000490341 459
751 3300005530 Ga0070679_100001543 Ga0070679_1000015439 459
752 3300005536 Ga0070697_100148471 Ga0070697_1001484712 459
753 3300005539 Ga0068853_100168125 Ga0068853_1001681251 459
754 3300005563 Ga0068855_100003512 Ga0068855_10000351216 459
755 3300005563 Ga0068855_100082292 Ga0068855_1000822923 459
756 3300005563 Ga0068855_100356704 Ga0068855_1003567041 459
757 3300005564 Ga0070664_100111999 Ga0070664_1001119993 459
758 3300005578 Ga0068854_100009089 Ga0068854_1000090892 459
759 3300005614 Ga0068856_100025716 Ga0068856_1000257162 459
760 3300005616 Ga0068852_100001060 Ga0068852_1000010604 459
761 3300005617 Ga0068859_100000588 Ga0068859_10000058828 459
762 3300005617 Ga0068859_100008683 Ga0068859_1000086832 459
763 3300005618 Ga0068864_100028197 Ga0068864_1000281972 459
764 3300005841 Ga0068863_100000031 Ga0068863_10000003180 459
765 3300005841 Ga0068863_100002277 Ga0068863_1000022777 459
766 3300005842 Ga0068858_100039304 Ga0068858_1000393042 459
767 3300005843 Ga0068860_100003398 Ga0068860_1000033987 459
768 3300005843 Ga0068860_100012561 Ga0068860_1000125616 459
769 3300005843 Ga0068860_100105944 Ga0068860_1001059443 459
770 3300005844 Ga0068862_100123184 Ga0068862_1001231841 459
771 3300005983 Ga0081540_1001095 Ga0081540_100109511 459
772 3300005985 Ga0081539_10002032 Ga0081539_100020323 459
773 3300006178 Ga0075367_10000006 Ga0075367_1000000636 459
774 3300006186 Ga0075369_10000050 Ga0075369_100000501 459
775 3300006237 Ga0097621_100007848 Ga0097621_1000078482 459
776 3300006237 Ga0097621_100013099 Ga0097621_1000130997 459
777 3300006353 Ga0075370_10000299 Ga0075370_100002994 459
778 3300006358 Ga0068871_100004396 Ga0068871_1000043969 459
779 3300006871 Ga0075434_100136511 Ga0075434_1001365112 459
780 3300006881 Ga0068865_100025780 Ga0068865_1000257803 459
781 3300006931 Ga0097620_100000588 Ga0097620_1000005883 459
782 3300006931 Ga0097620_100008683 Ga0097620_1000086832 459
783 3300009093 Ga0105240_10090717 Ga0105240_100907173 459
784 3300009101 Ga0105247_10030870 Ga0105247_100308701 459
785 3300009174 Ga0105241_10007371 Ga0105241_100073712 459
786 3300009176 Ga0105242_10050134 Ga0105242_100501343 459
787 3300009545 Ga0105237_10011773 Ga0105237_100117733 459
788 3300009545 Ga0105237_10013246 Ga0105237_100132466 459
789 3300009545 Ga0105237_10030552 Ga0105237_100305525 459
790 3300009545 Ga0105237_10062879 Ga0105237_100628792 459
791 3300009545 Ga0105237_10064131 Ga0105237_100641312 459
792 3300010375 Ga0105239_10001852 Ga0105239_1000185214 459
793 3300010375 Ga0105239_10020352 Ga0105239_100203524 459
794 3300013100 Ga0157373_10025384 Ga0157373_100253841 459
795 3300013100 Ga0157373_10052036 Ga0157373_100520361 459
796 3300013102 Ga0157371_10008983 Ga0157371_100089837 459
797 3300013102 Ga0157371_10013404 Ga0157371_100134043 459
798 3300013104 Ga0157370_10032507 Ga0157370_100325072 459
799 3300013104 Ga0157370_10114728 Ga0157370_101147282 459
800 3300013105 Ga0157369_10000877 Ga0157369_1000087733 459
801 3300013105 Ga0157369_10001942 Ga0157369_100019426 459
802 3300013105 Ga0157369_10015758 Ga0157369_100157583 459
803 3300013296 Ga0157374_10094941 Ga0157374_100949413 459
804 3300013297 Ga0157378_10004116 Ga0157378_100041163 459
805 3300013306 Ga0163162_10000124 Ga0163162_100001244 459
806 3300013306 Ga0163162_10027712 Ga0163162_100277121 459
807 3300013306 Ga0163162_10055635 Ga0163162_100556353 459
808 3300013306 Ga0163162_10242746 Ga0163162_102427462 459
809 3300013307 Ga0157372_10047957 Ga0157372_100479572 459
810 3300013308 Ga0157375_10144214 Ga0157375_101442141 459
811 3300014968 Ga0157379_10073694 Ga0157379_100736942 459
812 3300014969 Ga0157376_10021568 Ga0157376_100215682 459
813 3300022467 Ga0224712_10005925 Ga0224712_100059253 459
814 3300025233 Ga0209437_100190 Ga0209437_10019023 459
815 3300025273 Ga0209673_1009288 Ga0209673_10092884 459
816 3300025292 Ga0209676_1006488 Ga0209676_10064886 459
817 3300025295 Ga0209564_1000030 Ga0209564_1000030407 459
818 3300025298 Ga0209050_1001644 Ga0209050_100164422 459
819 3300025735 Ga0207713_1000023 Ga0207713_1000023130 459
820 3300025899 Ga0207642_10016620 Ga0207642_100166202 459
821 3300025900 Ga0207710_10019236 Ga0207710_100192361 459
822 3300025903 Ga0207680_10001105 Ga0207680_1000110512 459
823 3300025903 Ga0207680_10086567 Ga0207680_100865671 459
824 3300025909 Ga0207705_10001908 Ga0207705_100019087 459
825 3300025909 Ga0207705_10051051 Ga0207705_100510512 459
826 3300025911 Ga0207654_10012124 Ga0207654_100121242 459
827 3300025912 Ga0207707_10081615 Ga0207707_100816152 459
828 3300025914 Ga0207671_10006312 Ga0207671_100063122 459
829 3300025914 Ga0207671_10047963 Ga0207671_100479632 459
830 3300025919 Ga0207657_10062536 Ga0207657_100625362 459
831 3300025919 Ga0207657_10136562 Ga0207657_101365622 459
832 3300025919 Ga0207657_10206626 Ga0207657_102066261 459
833 3300025920 Ga0207649_10147633 Ga0207649_101476331 459
834 3300025922 Ga0207646_10073685 Ga0207646_100736852 459
835 3300025922 Ga0207646_10136125 Ga0207646_101361252 459
836 3300025928 Ga0207700_10084214 Ga0207700_100842142 459
837 3300025937 Ga0207669_10051895 Ga0207669_100518952 459
838 3300025938 Ga0207704_10034563 Ga0207704_100345632 459
839 3300025942 Ga0207689_10058951 Ga0207689_100589511 459
840 3300025949 Ga0207667_10008873 Ga0207667_1000887310 459
841 3300025949 Ga0207667_10014176 Ga0207667_100141766 459
842 3300025949 Ga0207667_10040612 Ga0207667_100406124 459
843 3300025949 Ga0207667_10116038 Ga0207667_101160382 459
844 3300025949 Ga0207667_10234016 Ga0207667_102340161 459
845 3300025961 Ga0207712_10026076 Ga0207712_100260763 459
846 3300025972 Ga0207668_10000038 Ga0207668_1000003875 459
847 3300025981 Ga0207640_10006301 Ga0207640_100063014 459
848 3300025986 Ga0207658_10024979 Ga0207658_100249794 459
849 3300025986 Ga0207658_10157363 Ga0207658_101573631 459
850 3300026035 Ga0207703_10002892 Ga0207703_100028928 459
851 3300026078 Ga0207702_10172713 Ga0207702_101727132 459
852 3300026088 Ga0207641_10000050 Ga0207641_1000005051 459
853 3300026088 Ga0207641_10000133 Ga0207641_1000013326 459
854 3300026089 Ga0207648_10001120 Ga0207648_1000112018 459
855 3300026095 Ga0207676_10012264 Ga0207676_100122642 459
856 3300026142 Ga0207698_10001835 Ga0207698_100018358 459
857 3300027312 Ga0209371_1007072 Ga0209371_10070722 459
858 3300027866 Ga0209813_10000578 Ga0209813_100005788 459
859 3300027866 Ga0209813_10005296 Ga0209813_100052962 459
860 3300028381 Ga0268264_10002332 Ga0268264_100023328 459
861 3300028381 Ga0268264_10011225 Ga0268264_100112251 459
862 3300028381 Ga0268264_10018928 Ga0268264_100189285 459
863 3300028794 Ga0307515_10000024 Ga0307515_10000024200 459
864 3300028794 Ga0307515_10005522 Ga0307515_1000552216 459
865 3300030500 Ga0268256_1000690 Ga0268256_100069022 459
866 3300030500 Ga0268256_1006008 Ga0268256_10060083 459
867 3300030500 Ga0268256_1007225 Ga0268256_10072254 459
868 3300031616 Ga0307508_10053266 Ga0307508_100532663 459
869 3300031911 Ga0307412_10000120 Ga0307412_1000012042 459
870 3300031911 Ga0307412_10039826 Ga0307412_100398262 459
871 3300033179 Ga0307507_10000337 Ga0307507_1000033770 459
872 3300035119 Ga0373956_0010280 Ga0373956_0010280_665_2245 459
873 3300037312 Ga0395899_0000014 Ga0395899_0000014_302736_304295 459
874 3300037312 Ga0395899_0090451 Ga0395899_0090451_447_1964 459
875 3300037418 Ga0395900_0000007 Ga0395900_0000007_302755_304314 459
876 3300037418 Ga0395900_0017162 Ga0395900_0017162_1460_2902 459
877 3300037418 Ga0395900_0109571 Ga0395900_0109571_371_1825 459
878 3300037466 Ga0395898_0000011 Ga0395898_0000011_184547_186106 459
879 3300037466 Ga0395898_0000792 Ga0395898_0000792_48700_50154 459
880 3300037466 Ga0395898_0163971 Ga0395898_0163971_163_1605 459
881 3300037471 Ga0395905_0000008 Ga0395905_0000008_302755_304314 459
882 3300038443 Ga0395901_0000003 Ga0395901_0000003_515644_517092 459
883 3300038443 Ga0395901_0000020 Ga0395901_0000020_128813_130372 459
884 3300038443 Ga0395901_0000887 Ga0395901_0000887_24913_26367 459
885 3300039438 Ga0436360_0788480 Ga0436360_0788480_244_1707 459
886 3300039447 Ga0436361_0022167 Ga0436361_0022167_3233_4696 459
887 3300042007 Ga0439449_0005229 Ga0439449_0005229_104_1618 459
888 3300042014 Ga0439457_009183 Ga0439457_009183_525_2039 459
889 3300042876 Ga0451577_0000266 Ga0451577_0000266_89419_90939 459
890 3300044693 Ga0466961_0036880 Ga0466961_0036880_675_2216 459
891 3300044694 Ga0466963_0065204 Ga0466963_0065204_199_1740 459
892 3300044712 Ga0453684_0000844 Ga0453684_0000844_12448_13968 459
893 3300045049 Ga0466959_0004970 Ga0466959_0004970_4978_6441 459
894 3300046471 Ga0495650_0018287 Ga0495650_0018287_1650_3149 459
895 3300046506 Ga0495583_0000111 Ga0495583_0000111_128290_129789 459
896 3300046506 Ga0495583_0000411 Ga0495583_0000411_38341_39840 459
897 3300046516 Ga0495628_0004465 Ga0495628_0004465_7748_9199 459
898 3300046519 Ga0495632_0000832 Ga0495632_0000832_23194_24693 459
899 3300046522 Ga0495643_0002002 Ga0495643_0002002_8268_10100 459
900 3300046524 Ga0495648_0000493 Ga0495648_0000493_40833_42359 459
901 3300046531 Ga0495665_0001751 Ga0495665_0001751_2102_3553 459
902 3300046538 Ga0495609_0000374 Ga0495609_0000374_29465_30940 459
903 3300046558 Ga0495633_0010446 Ga0495633_0010446_398_1897 459
904 3300046616 Ga0495668_0009602 Ga0495668_0009602_823_2328 459
905 3300046665 Ga0495661_0021682 Ga0495661_0021682_2138_3631 459
906 3300046680 Ga0495646_0022668 Ga0495646_0022668_837_2288 459
907 3300046692 Ga0495671_0000034 Ga0495671_0000034_25180_26679 459
908 3300047319 Ga0495674_0032477 Ga0495674_0032477_2353_3804 459
909 3300047469 Ga0495673_0000013 Ga0495673_0000013_97881_99380 459
910 3300047472 Ga0495686_0006880 Ga0495686_0006880_2342_3841 459
911 3300047673 Ga0495593_0016785 Ga0495593_0016785_1242_2693 459
912 3300048904 Ga0496101_0022535 Ga0496101_0022535_2373_3815 459
913 3300048909 Ga0496106_0000001 Ga0496106_0000001_429765_431246 459
914 3300048918 Ga0496115_0000044 Ga0496115_0000044_40774_42270 459
915 3300048920 Ga0496117_0038027 Ga0496117_0038027_1795_3240 459
916 3300048921 Ga0496118_0099089 Ga0496118_0099089_120_1565 459
917 3300048923 Ga0496120_0003113 Ga0496120_0003113_186_1631 459
918 3300048924 Ga0496121_0000479 Ga0496121_0000479_120_1565 459
919 3300048925 Ga0496122_0000878 Ga0496122_0000878_40410_41855 459
920 3300048925 Ga0496122_0021381 Ga0496122_0021381_3784_5241 459
921 3300048925 Ga0496122_0025980 Ga0496122_0025980_1803_3305 459
922 3300048925 Ga0496122_0029262 Ga0496122_0029262_1722_3167 459
923 3300048925 Ga0496122_0055042 Ga0496122_0055042_123_1652 459
924 3300048926 Ga0496123_0001228 Ga0496123_0001228_1425_2882 459
925 3300048926 Ga0496123_0003057 Ga0496123_0003057_3464_4909 459
926 3300048926 Ga0496123_0019819 Ga0496123_0019819_2380_3909 459
927 3300048926 Ga0496123_0022693 Ga0496123_0022693_2246_3688 459
928 3300048927 Ga0496124_0000909 Ga0496124_0000909_11153_12619 459
929 3300048928 Ga0496125_0000168 Ga0496125_0000168_47716_49161 459
930 3300048928 Ga0496125_0001001 Ga0496125_0001001_12499_14061 459
931 3300048928 Ga0496125_0012148 Ga0496125_0012148_4198_5643 459
932 3300048929 Ga0496126_0025732 Ga0496126_0025732_204_1649 459
933 3300050492 nmdc:mga0yw44_38_c1 nmdc:mga0yw44_38_c1_16252_17715 459
934 3300050494 nmdc:mga06z11_38_c1 nmdc:mga06z11_38_c1_37760_39223 459
935 3300050494 nmdc:mga06z11_73_c1 nmdc:mga06z11_73_c1_33566_35065 459
936 3300050495 nmdc:mga04h51_6028_c1 nmdc:mga04h51_6028_c1_493_1956 459
937 3300050495 nmdc:mga04h51_603_c1 nmdc:mga04h51_603_c1_95_1594 459
938 3300050496 nmdc:mga07m45_6283_c1 nmdc:mga07m45_6283_c1_1236_2699 459
939 3300050512 nmdc:mga0n895_72944_c1 nmdc:mga0n895_72944_c1_486_1937 459
940 3300050516 nmdc:mga0sz30_1865_c1 nmdc:mga0sz30_1865_c1_166_1629 459
941 3300053086 Ga0500578_0061156 Ga0500578_0061156_84_1598 459
942 3300053087 Ga0500643_000856 Ga0500643_000856_15608_17107 459
943 3300053092 Ga0500583_0006817 Ga0500583_0006817_929_2455 459
944 3300053103 Ga0500555_005125 Ga0500555_005125_406_1905 459
945 3300053108 Ga0500562_000080 Ga0500562_000080_17450_18946 459
946 3300053118 Ga0500594_0016524 Ga0500594_0016524_235_1740 459
947 3300053125 Ga0500618_000142 Ga0500618_000142_52408_53898 459
948 3300053136 Ga0500559_0011796 Ga0500559_0011796_2175_3674 459
949 3300053156 Ga0500622_0000176 Ga0500622_0000176_48134_49630 459
950 3300053157 Ga0500624_000009 Ga0500624_000009_102262_103854 459
951 3300053158 Ga0500627_0000877 Ga0500627_0000877_1748_3253 459
952 3300053727 Ga0500611_000029 Ga0500611_000029_46651_48165 459
953 3300055283 Ga0500661_000743 Ga0500661_000743_2692_4191 459
954 3300001989 JGI24739J22299_10004923 JGI24739J22299_100049236 460
955 3300002067 JGI24735J21928_10020646 JGI24735J21928_100206463 460
956 3300002705 JGI25156J39149_1000992 JGI25156J39149_10009927 460
957 3300002705 JGI25156J39149_1001322 JGI25156J39149_100132210 460
958 3300002705 JGI25156J39149_1002033 JGI25156J39149_10020333 460
959 3300003214 JGI25165J46597_1003490 JGI25165J46597_10034903 460
960 3300003322 rootL2_10034607 rootL2_100346075 460
961 3300003354 JGI25160J50197_1000171 JGI25160J50197_100017139 460
962 3300003756 Ga0055533_1000557 Ga0055533_10005577 460
963 3300003758 Ga0055532_1000001 Ga0055532_1000001982 460
964 3300003760 Ga0055527_1000014 Ga0055527_100001422 460
965 3300003761 Ga0055535_1000001 Ga0055535_100000122 460
966 3300003762 Ga0055542_1000001 Ga0055542_1000001981 460
967 3300003763 Ga0055529_1000001 Ga0055529_100000122 460
968 3300005262 Ga0065165_1001400 Ga0065165_100140015 460
969 3300005367 Ga0070667_100152606 Ga0070667_1001526061 460
970 3300005549 Ga0070704_100091066 Ga0070704_1000910662 460
971 3300005563 Ga0068855_100122139 Ga0068855_1001221393 460
972 3300006051 Ga0075364_10008686 Ga0075364_100086863 460
973 3300009011 Ga0105251_10000097 Ga0105251_1000009762 460
974 3300009011 Ga0105251_10001002 Ga0105251_1000100213 460
975 3300013100 Ga0157373_10016997 Ga0157373_100169973 460
976 3300013105 Ga0157369_10019302 Ga0157369_100193024 460
977 3300017792 Ga0163161_10066301 Ga0163161_100663011 460
978 3300022467 Ga0224712_10024202 Ga0224712_100242022 460
979 3300025226 Ga0209674_100005 Ga0209674_1000051414 460
980 3300025226 Ga0209674_100092 Ga0209674_10009237 460
981 3300025228 Ga0209672_100001 Ga0209672_1000011811 460
982 3300025229 Ga0209147_100001 Ga0209147_1000011811 460
983 3300025230 Ga0209563_101429 Ga0209563_1014293 460
984 3300025231 Ga0207427_101457 Ga0207427_1014574 460
985 3300025242 Ga0209258_100001 Ga0209258_1000011811 460
986 3300025254 Ga0209148_1000003 Ga0209148_10000031811 460
987 3300025256 Ga0209759_1000053 Ga0209759_1000053119 460
988 3300025256 Ga0209759_1000074 Ga0209759_100007447 460
989 3300025256 Ga0209759_1000601 Ga0209759_10006013 460
990 3300025261 Ga0209233_1000016 Ga0209233_1000016771 460
991 3300025272 Ga0209455_1000001 Ga0209455_10000011811 460
992 3300025295 Ga0209564_1011309 Ga0209564_10113093 460
993 3300025302 Ga0207426_1000037 Ga0207426_1000037171 460
994 3300025735 Ga0207713_1000031 Ga0207713_10000317 460
995 3300025735 Ga0207713_1000305 Ga0207713_100030527 460
996 3300025904 Ga0207647_10009811 Ga0207647_100098114 460
997 3300026067 Ga0207678_10069274 Ga0207678_100692743 460
998 3300031548 Ga0307408_100000007 Ga0307408_100000007379 460
999 3300031548 Ga0307408_100003318 Ga0307408_1000033189 460
1000 3300031730 Ga0307516_10194944 Ga0307516_101949441 460
1001 3300031911 Ga0307412_10000014 Ga0307412_1000001410 460
1002 3300031911 Ga0307412_10010439 Ga0307412_100104394 460
1003 3300032002 Ga0307416_100000476 Ga0307416_1000004766 460
1004 3300032002 Ga0307416_100063128 Ga0307416_1000631281 460
1005 3300033180 Ga0307510_10003234 Ga0307510_1000323412 460
1006 3300037471 Ga0395905_0000168 Ga0395905_0000168_48739_50187 460
1007 3300042016 Ga0439463_000116 Ga0439463_000116_12551_14005 460
1008 3300046455 Ga0495603_0000061 Ga0495603_0000061_44171_45625 460
1009 3300046457 Ga0495590_0008220 Ga0495590_0008220_851_2305 460
1010 3300046458 Ga0495591_003738 Ga0495591_003738_2636_4090 460
1011 3300046459 Ga0495629_0000369 Ga0495629_0000369_29705_31159 460
1012 3300046459 Ga0495629_0000818 Ga0495629_0000818_22685_24139 460
1013 3300046459 Ga0495629_0030333 Ga0495629_0030333_272_1726 460
1014 3300046462 Ga0495651_0015864 Ga0495651_0015864_897_2351 460
1015 3300046463 Ga0495653_0001073 Ga0495653_0001073_12719_14173 460
1016 3300046463 Ga0495653_0007668 Ga0495653_0007668_7075_8529 460
1017 3300046463 Ga0495653_0060930 Ga0495653_0060930_872_2326 460
1018 3300046463 Ga0495653_0108533 Ga0495653_0108533_301_1815 460
1019 3300046472 Ga0495580_0000075 Ga0495580_0000075_58171_59625 460
1020 3300046472 Ga0495580_0002733 Ga0495580_0002733_389_1843 460
1021 3300046472 Ga0495580_0008766 Ga0495580_0008766_6167_7621 460
1022 3300046473 Ga0495582_0000933 Ga0495582_0000933_4976_6430 460
1023 3300046473 Ga0495582_0023486 Ga0495582_0023486_1702_3156 460
1024 3300046473 Ga0495582_0026900 Ga0495582_0026900_433_1887 460
1025 3300046474 Ga0495605_0000739 Ga0495605_0000739_15731_17275 460
1026 3300046474 Ga0495605_0005538 Ga0495605_0005538_2393_3847 460
1027 3300046474 Ga0495605_0026141 Ga0495605_0026141_129_1580 460
1028 3300046477 Ga0495664_0002023 Ga0495664_0002023_5197_6651 460
1029 3300046477 Ga0495664_0023799 Ga0495664_0023799_1580_3094 460
1030 3300046477 Ga0495664_0049255 Ga0495664_0049255_58_1551 460
1031 3300046500 Ga0495596_0003112 Ga0495596_0003112_696_2150 460
1032 3300046500 Ga0495596_0008266 Ga0495596_0008266_1203_2654 460
1033 3300046501 Ga0495607_0001103 Ga0495607_0001103_15523_16977 460
1034 3300046507 Ga0495606_0003604 Ga0495606_0003604_12494_14011 460
1035 3300046507 Ga0495606_0005194 Ga0495606_0005194_9429_10880 460
1036 3300046507 Ga0495606_0011992 Ga0495606_0011992_1803_3257 460
1037 3300046512 Ga0495610_0027931 Ga0495610_0027931_623_2074 460
1038 3300046514 Ga0495618_0009715 Ga0495618_0009715_329_1843 460
1039 3300046514 Ga0495618_0022138 Ga0495618_0022138_2202_3656 460
1040 3300046516 Ga0495628_0000876 Ga0495628_0000876_22192_23646 460
1041 3300046517 Ga0495630_0010727 Ga0495630_0010727_3463_4917 460
1042 3300046517 Ga0495630_0052563 Ga0495630_0052563_1236_2750 460
1043 3300046524 Ga0495648_0006030 Ga0495648_0006030_3720_5174 460
1044 3300046524 Ga0495648_0030734 Ga0495648_0030734_35_1489 460
1045 3300046526 Ga0495666_0002127 Ga0495666_0002127_1450_2904 460
1046 3300046526 Ga0495666_0019840 Ga0495666_0019840_1544_2998 460
1047 3300046529 Ga0495652_0000989 Ga0495652_0000989_1451_2905 460
1048 3300046529 Ga0495652_0066935 Ga0495652_0066935_597_2111 460
1049 3300046529 Ga0495652_0071838 Ga0495652_0071838_17_1471 460
1050 3300046531 Ga0495665_0002198 Ga0495665_0002198_1266_2720 460
1051 3300046531 Ga0495665_0004453 Ga0495665_0004453_4392_5846 460
1052 3300046533 Ga0495640_0007138 Ga0495640_0007138_5552_7006 460
1053 3300046533 Ga0495640_0014334 Ga0495640_0014334_4383_5837 460
1054 3300046535 Ga0495586_0003954 Ga0495586_0003954_4745_6199 460
1055 3300046536 Ga0495587_0002413 Ga0495587_0002413_1842_3296 460
1056 3300046536 Ga0495587_0030452 Ga0495587_0030452_394_1848 460
1057 3300046543 Ga0495645_0010888 Ga0495645_0010888_997_2451 460
1058 3300046557 Ga0495622_0008779 Ga0495622_0008779_820_2274 460
1059 3300046557 Ga0495622_0029523 Ga0495622_0029523_691_2145 460
1060 3300046642 Ga0495634_0004751 Ga0495634_0004751_2912_4426 460
1061 3300046642 Ga0495634_0004842 Ga0495634_0004842_5280_6734 460
1062 3300046660 Ga0495625_0066989 Ga0495625_0066989_524_1978 460
1063 3300046663 Ga0495635_0015402 Ga0495635_0015402_3792_5306 460
1064 3300046663 Ga0495635_0022469 Ga0495635_0022469_1641_3095 460
1065 3300046665 Ga0495661_0005899 Ga0495661_0005899_6899_8353 460
1066 3300046675 Ga0495657_0033837 Ga0495657_0033837_904_2418 460
1067 3300046679 Ga0495623_0012301 Ga0495623_0012301_1757_3211 460
1068 3300046679 Ga0495623_0058871 Ga0495623_0058871_498_2012 460
1069 3300046680 Ga0495646_0006842 Ga0495646_0006842_909_2363 460
1070 3300046680 Ga0495646_0012375 Ga0495646_0012375_2873_4327 460
1071 3300046680 Ga0495646_0014075 Ga0495646_0014075_2723_4177 460
1072 3300046680 Ga0495646_0016680 Ga0495646_0016680_2742_4196 460
1073 3300046680 Ga0495646_0022909 Ga0495646_0022909_516_2030 460
1074 3300046689 Ga0495613_0003301 Ga0495613_0003301_6633_8087 460
1075 3300046689 Ga0495613_0048237 Ga0495613_0048237_1616_3070 460
1076 3300046690 Ga0495624_0000363 Ga0495624_0000363_303_1757 460
1077 3300046690 Ga0495624_0002339 Ga0495624_0002339_5464_6918 460
1078 3300046692 Ga0495671_0053737 Ga0495671_0053737_444_1898 460
1079 3300046694 Ga0495649_0003133 Ga0495649_0003133_7612_9066 460
1080 3300046794 Ga0495589_0027598 Ga0495589_0027598_1036_2490 460
1081 3300046809 Ga0495600_0003792 Ga0495600_0003792_6100_7614 460
1082 3300046809 Ga0495600_0029159 Ga0495600_0029159_226_1680 460
1083 3300047315 Ga0495581_0001681 Ga0495581_0001681_6751_8205 460
1084 3300047315 Ga0495581_0058483 Ga0495581_0058483_265_1779 460
1085 3300047315 Ga0495581_0078332 Ga0495581_0078332_77_1531 460
1086 3300047317 Ga0495604_0003651 Ga0495604_0003651_6217_7671 460
1087 3300047317 Ga0495604_0038194 Ga0495604_0038194_2130_3584 460
1088 3300047319 Ga0495674_0008415 Ga0495674_0008415_1451_2905 460
1089 3300047319 Ga0495674_0025846 Ga0495674_0025846_1049_2503 460
1090 3300047319 Ga0495674_0029256 Ga0495674_0029256_1747_3240 460
1091 3300047321 Ga0495676_0011909 Ga0495676_0011909_5588_7042 460
1092 3300047322 Ga0495680_0009659 Ga0495680_0009659_6899_8353 460
1093 3300047322 Ga0495680_0086354 Ga0495680_0086354_301_1815 460
1094 3300047323 Ga0495683_0002665 Ga0495683_0002665_6592_8046 460
1095 3300047323 Ga0495683_0045040 Ga0495683_0045040_719_2173 460
1096 3300047443 Ga0495687_019899 Ga0495687_019899_1298_2752 460
1097 3300047443 Ga0495687_022476 Ga0495687_022476_852_2303 460
1098 3300047444 Ga0495675_0004950 Ga0495675_0004950_1357_2811 460
1099 3300047444 Ga0495675_0019834 Ga0495675_0019834_1482_2936 460
1100 3300047446 Ga0495679_000109 Ga0495679_000109_54031_55485 460
1101 3300047446 Ga0495679_001329 Ga0495679_001329_6317_7771 460
1102 3300047446 Ga0495679_002198 Ga0495679_002198_3988_5442 460
1103 3300047469 Ga0495673_0003680 Ga0495673_0003680_5644_7098 460
1104 3300047469 Ga0495673_0021828 Ga0495673_0021828_136_1590 460
1105 3300047471 Ga0495684_0019488 Ga0495684_0019488_2721_4175 460
1106 3300047673 Ga0495593_0003797 Ga0495593_0003797_910_2364 460
1107 3300047673 Ga0495593_0015971 Ga0495593_0015971_1172_2626 460
1108 3300047673 Ga0495593_0028151 Ga0495593_0028151_1260_2774 460
1109 3300048088 Ga0495602_0000840 Ga0495602_0000840_599_2053 460
1110 3300048089 Ga0495614_0000434 Ga0495614_0000434_5627_7081 460
1111 3300048089 Ga0495614_0008580 Ga0495614_0008580_2961_4415 460
1112 3300048091 Ga0495626_0015369 Ga0495626_0015369_1138_2592 460
1113 3300048903 Ga0496100_0016348 Ga0496100_0016348_66_1520 460
1114 3300048904 Ga0496101_0031993 Ga0496101_0031993_46_1500 460
1115 3300048905 Ga0496102_0000661 Ga0496102_0000661_21812_23266 460
1116 3300048906 Ga0496103_0001616 Ga0496103_0001616_2031_3485 460
1117 3300048916 Ga0496113_0038038 Ga0496113_0038038_1356_2810 460
1118 3300048920 Ga0496117_0020755 Ga0496117_0020755_2914_4374 460
1119 3300048920 Ga0496117_0059094 Ga0496117_0059094_809_2263 460
1120 3300048921 Ga0496118_0002811 Ga0496118_0002811_20270_21724 460
1121 3300048921 Ga0496118_0005972 Ga0496118_0005972_7255_8709 460
1122 3300048921 Ga0496118_0008488 Ga0496118_0008488_8331_9785 460
1123 3300048921 Ga0496118_0048421 Ga0496118_0048421_1554_3008 460
1124 3300048921 Ga0496118_0080892 Ga0496118_0080892_675_2135 460
1125 3300048924 Ga0496121_0000288 Ga0496121_0000288_58671_60182 460
1126 3300048924 Ga0496121_0003427 Ga0496121_0003427_15819_17267 460
1127 3300048924 Ga0496121_0021126 Ga0496121_0021126_2939_4393 460
1128 3300048925 Ga0496122_0000560 Ga0496122_0000560_64808_66448 460
1129 3300048925 Ga0496122_0002514 Ga0496122_0002514_15845_17293 460
1130 3300048925 Ga0496122_0109363 Ga0496122_0109363_168_1622 460
1131 3300048926 Ga0496123_0002185 Ga0496123_0002185_7635_9083 460
1132 3300048929 Ga0496126_0004283 Ga0496126_0004283_2808_4268 460
1133 3300049459 Ga0495678_006032 Ga0495678_006032_947_2395 460
1134 3300049571 Ga0501034_0022941 Ga0501034_0022941_2559_4046 460
1135 3300049580 Ga0501046_0002427 Ga0501046_0002427_11995_13482 460
1136 3300053136 Ga0500559_0011951 Ga0500559_0011951_1101_2639 460
1137 3300001989 JGI24739J22299_10007534 JGI24739J22299_100075343 461
1138 3300002067 JGI24735J21928_10002051 JGI24735J21928_100020511 461
1139 3300005355 Ga0070671_100150654 Ga0070671_1001506542 461
1140 3300009011 Ga0105251_10000051 Ga0105251_1000005131 461
1141 3300009093 Ga0105240_10340663 Ga0105240_103406632 461
1142 3300013306 Ga0163162_10046606 Ga0163162_100466062 461
1143 3300015262 Ga0182007_10000914 Ga0182007_100009144 461
1144 3300025254 Ga0209148_1001331 Ga0209148_10013313 461
1145 3300025272 Ga0209455_1001017 Ga0209455_10010172 461
1146 3300025735 Ga0207713_1000354 Ga0207713_100035438 461
1147 3300025735 Ga0207713_1002908 Ga0207713_100290811 461
1148 3300025904 Ga0207647_10006534 Ga0207647_100065346 461
1149 3300025904 Ga0207647_10022621 Ga0207647_100226213 461
1150 3300025913 Ga0207695_10241323 Ga0207695_102413231 461
1151 3300025931 Ga0207644_10094036 Ga0207644_100940363 461
1152 3300037418 Ga0395900_0002362 Ga0395900_0002362_6536_7987 461
1153 3300037471 Ga0395905_0005540 Ga0395905_0005540_1730_3202 461
1154 3300046454 Ga0495592_0031195 Ga0495592_0031195_66_1529 461
1155 3300046455 Ga0495603_0004003 Ga0495603_0004003_2894_4381 461
1156 3300046455 Ga0495603_0049304 Ga0495603_0049304_969_2432 461
1157 3300046457 Ga0495590_0013143 Ga0495590_0013143_1257_2729 461
1158 3300046457 Ga0495590_0017447 Ga0495590_0017447_320_1891 461
1159 3300046459 Ga0495629_0001732 Ga0495629_0001732_12744_14231 461
1160 3300046459 Ga0495629_0004061 Ga0495629_0004061_1041_2504 461
1161 3300046463 Ga0495653_0001528 Ga0495653_0001528_9993_11456 461
1162 3300046463 Ga0495653_0007481 Ga0495653_0007481_5054_6517 461
1163 3300046471 Ga0495650_0002944 Ga0495650_0002944_7099_8586 461
1164 3300046472 Ga0495580_0002112 Ga0495580_0002112_9993_11456 461
1165 3300046473 Ga0495582_0001741 Ga0495582_0001741_6197_7660 461
1166 3300046475 Ga0495639_0064137 Ga0495639_0064137_99_1586 461
1167 3300046515 Ga0495620_0026085 Ga0495620_0026085_1192_2664 461
1168 3300046516 Ga0495628_0004005 Ga0495628_0004005_8067_9530 461
1169 3300046517 Ga0495630_0002987 Ga0495630_0002987_2721_4184 461
1170 3300046524 Ga0495648_0020256 Ga0495648_0020256_78_1541 461
1171 3300046529 Ga0495652_0042236 Ga0495652_0042236_2104_3567 461
1172 3300046531 Ga0495665_0008897 Ga0495665_0008897_2920_4383 461
1173 3300046531 Ga0495665_0046188 Ga0495665_0046188_193_1680 461
1174 3300046543 Ga0495645_0006241 Ga0495645_0006241_5346_6833 461
1175 3300046557 Ga0495622_0000100 Ga0495622_0000100_29409_30872 461
1176 3300046559 Ga0495667_0037279 Ga0495667_0037279_1317_2804 461
1177 3300046674 Ga0495588_0022270 Ga0495588_0022270_1541_3028 461
1178 3300046679 Ga0495623_0065295 Ga0495623_0065295_759_2222 461
1179 3300046684 Ga0495669_0018601 Ga0495669_0018601_361_1848 461
1180 3300046689 Ga0495613_0008008 Ga0495613_0008008_3284_4747 461
1181 3300046690 Ga0495624_0002152 Ga0495624_0002152_9245_10708 461
1182 3300047315 Ga0495581_0017195 Ga0495581_0017195_75_1538 461
1183 3300047315 Ga0495581_0042499 Ga0495581_0042499_718_2205 461
1184 3300047317 Ga0495604_0023651 Ga0495604_0023651_49_1512 461
1185 3300047320 Ga0495672_0002512 Ga0495672_0002512_15029_16513 461
1186 3300047321 Ga0495676_0027256 Ga0495676_0027256_3348_4811 461
1187 3300047322 Ga0495680_0012256 Ga0495680_0012256_5057_6520 461
1188 3300047322 Ga0495680_0144409 Ga0495680_0144409_192_1679 461
1189 3300047323 Ga0495683_0001290 Ga0495683_0001290_7372_8844 461
1190 3300047443 Ga0495687_000011 Ga0495687_000011_261119_262597 461
1191 3300047444 Ga0495675_0012770 Ga0495675_0012770_2574_4037 461
1192 3300047446 Ga0495679_000950 Ga0495679_000950_9993_11456 461
1193 3300047472 Ga0495686_0000014 Ga0495686_0000014_296802_298286 461
1194 3300047673 Ga0495593_0046487 Ga0495593_0046487_678_2165 461
1195 3300047673 Ga0495593_0056585 Ga0495593_0056585_369_1841 461
1196 3300048088 Ga0495602_0078992 Ga0495602_0078992_558_2030 461
1197 3300048088 Ga0495602_0106486 Ga0495602_0106486_746_2209 461
1198 3300048089 Ga0495614_0031513 Ga0495614_0031513_73_1536 461
1199 3300048904 Ga0496101_0002730 Ga0496101_0002730_1702_3174 461
1200 3300048905 Ga0496102_0015524 Ga0496102_0015524_2739_4223 461
1201 3300048906 Ga0496103_0004293 Ga0496103_0004293_5886_7358 461
1202 3300048906 Ga0496103_0041089 Ga0496103_0041089_407_2005 461
1203 3300048907 Ga0496104_0080317 Ga0496104_0080317_1296_2783 461
1204 3300048909 Ga0496106_0093316 Ga0496106_0093316_353_1840 461
1205 3300048910 Ga0496107_0063107 Ga0496107_0063107_1020_2492 461
1206 3300048913 Ga0496110_0080392 Ga0496110_0080392_46_1518 461
1207 3300048914 Ga0496111_0026674 Ga0496111_0026674_989_2461 461
1208 3300048915 Ga0496112_0037967 Ga0496112_0037967_655_2127 461
1209 3300048916 Ga0496113_0018949 Ga0496113_0018949_3284_4756 461
1210 3300048917 Ga0496114_0005374 Ga0496114_0005374_7912_9399 461
1211 3300048918 Ga0496115_0064586 Ga0496115_0064586_752_2239 461
1212 3300048919 Ga0496116_0002257 Ga0496116_0002257_10961_12433 461
1213 3300048920 Ga0496117_0007212 Ga0496117_0007212_6585_8069 461
1214 3300048921 Ga0496118_0000259 Ga0496118_0000259_58015_59613 461
1215 3300048921 Ga0496118_0010335 Ga0496118_0010335_4812_6296 461
1216 3300048925 Ga0496122_0015020 Ga0496122_0015020_1616_3088 461
1217 3300048926 Ga0496123_0008663 Ga0496123_0008663_1069_2541 461
1218 3300048927 Ga0496124_0000435 Ga0496124_0000435_42520_44211 461
1219 3300048928 Ga0496125_0137779 Ga0496125_0137779_92_1564 461
1220 3300006038 Ga0075365_10000290 Ga0075365_100002907 462
1221 3300006048 Ga0075363_100000444 Ga0075363_1000004446 462
1222 3300006051 Ga0075364_10076786 Ga0075364_100767862 462
1223 3300013306 Ga0163162_10002988 Ga0163162_100029883 462
1224 3300013308 Ga0157375_10028397 Ga0157375_100283973 462
1225 3300026067 Ga0207678_10072268 Ga0207678_100722682 462
1226 3300046460 Ga0495638_0004234 Ga0495638_0004234_2176_3642 462
1227 3300046471 Ga0495650_0053698 Ga0495650_0053698_107_1573 462
1228 3300046474 Ga0495605_0004288 Ga0495605_0004288_4757_6223 462
1229 3300046477 Ga0495664_0036517 Ga0495664_0036517_992_2458 462
1230 3300046794 Ga0495589_0009832 Ga0495589_0009832_2382_3848 462
1231 3300048903 Ga0496100_0081836 Ga0496100_0081836_114_1580 462
1232 3300048905 Ga0496102_0010371 Ga0496102_0010371_5802_7268 462
1233 3300048917 Ga0496114_0085651 Ga0496114_0085651_720_2186 462
1234 3300050490 nmdc:mga03n38_21131_c1 nmdc:mga03n38_21131_c1_198_1700 462
1235 3300050491 nmdc:mga00v17_136738_c1 nmdc:mga00v17_136738_c1_36_1538 462
1236 3300050492 nmdc:mga0yw44_29081_c1 nmdc:mga0yw44_29081_c1_908_2410 462
1237 3300050496 nmdc:mga07m45_1400_c1 nmdc:mga07m45_1400_c1_8797_10299 462
1238 3300013306 Ga0163162_10117188 Ga0163162_101171883 465
1239 3300014325 Ga0163163_10179217 Ga0163163_101792172 465
1240 3300048905 Ga0496102_0260440 Ga0496102_0260440_26_1555 465
1241 3300001989 JGI24739J22299_10002337 JGI24739J22299_100023373 470

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00199

Catalase

Catalase

84

466

0.99

PF06628

Catalase-rel

Catalase-related immune-responsive

490

553

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e4y-assembly1.cif.gz_A crystal structure of a 33kda catalase-related protein from mycobacterium avium subsp. paratuberculosis. i2(1)2(1)2(1) crystal form 0.8465 39 343
7vn0-assembly1.cif.gz_D catpo mutant - t188a 0.8425 2 392
7vn0-assembly1.cif.gz_C catpo mutant - t188a 0.8424 2 392
7vn0-assembly1.cif.gz_A catpo mutant - t188a 0.8424 2 392
7wca-assembly1.cif.gz_D catpo mutant - e484a 0.8419 2 392
ID Description Score Start End Superfamily
3j7bB01 Few Secondary Structures;Irregular;Cytochrome C Oxidase; Chain J; 0.9771 4 46 4.10.91.20
1qqwA01 Few Secondary Structures;Irregular;Cytochrome C Oxidase; Chain J; 0.9711 4 46 4.10.91.20
4b7fD02 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.9612 48 353 2.40.180.10
4b7fD02 Mainly Beta;Beta Barrel;Catalase HpII,;Catalase core domain 0.9575 48 353 2.40.180.10
1th2D01 Few Secondary Structures;Irregular;Cytochrome C Oxidase; Chain J; 0.9572 4 46 4.10.91.20
ID Description Score Start End GO Terms
AF-D2KRF9-F1-model_v4 Hydrogen peroxide dismutase (EC 1.11.1.6) 0.9957 193 353 GO:0004096
GO:0005737
GO:0020037
GO:0042542
GO:0042744
AF-A9QTJ8-F1-model_v4 Catalase 0.9945 73 355 GO:0004096
GO:0005737
GO:0020037
GO:0042542
GO:0042744
AF-C8XTB1-F1-model_v4 Catalase 0.9936 62 352 GO:0004096
GO:0005739
GO:0005777
GO:0020037
GO:0042542
GO:0042744
AF-A0A0S2I7A4-F1-model_v4 Catalase 0.9932 174 332 GO:0004096
GO:0005737
GO:0020037
GO:0042542
GO:0042744
AF-A0A6B3EDU7-F1-model_v4 Catalase 0.9926 98 326 GO:0004096
GO:0005737
GO:0020037
GO:0042542
GO:0042744

Feature Viewer

pLDDT pTM Quality
87.27 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map