F492066
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1238 | 358 | 2476 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300060344|Ga0587071_176522|Ga0587071_176522_172_513 |
| Length | 113 |
| Sequence | MHSATKQQPAEPATATSVRVEIFDQAYNLRGTDPEYITRLAEYVDQKMRTIAEQTSTIDSLRLAVLAALNIADEYHILKRKQDGSDYLQRAQRLSGMLDEVLQETYKVGERSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 84 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 114 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 122 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 196 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 198 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 211 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 214 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 218 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 222 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 224 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 227 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 228 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 242 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 243 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 244 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 245 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 246 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 247 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 248 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 249 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 250 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 255 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 256 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 257 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 258 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 259 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 260 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 319 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 320 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 321 | 3300049525 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control | Metagenome | Rhizosphere |
| 322 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 323 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 324 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 326 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 345 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 346 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 349 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.12 |
| Metatranscriptomes | 3.88 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.17 |
| Rhizosphere | 94.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 33.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0587071_176522 | 3300060344 | Unclassified | 546 |
| 2 | LJNas_1000310 | 3300000546 | Bacteria | 8526 |
| 3 | Ga0058862_12711097 | 3300004803 | Unclassified | 728 |
| 4 | Ga0065715_10010352 | 3300005293 | Bacteria | 2993 |
| 5 | Ga0065715_11112907 | 3300005293 | Unclassified | 517 |
| 6 | Ga0070658_10073182 | 3300005327 | Bacteria | 2810 |
| 7 | Ga0070676_10531894 | 3300005328 | Bacteria | 839 |
| 8 | Ga0070676_10626270 | 3300005328 | Bacteria | 778 |
| 9 | Ga0070683_100088414 | 3300005329 | Bacteria | 2907 |
| 10 | Ga0070683_100358095 | 3300005329 | Bacteria | 1390 |
| 11 | Ga0070683_100395472 | 3300005329 | Bacteria | 1318 |
| 12 | Ga0070683_100499807 | 3300005329 | Unclassified | 1162 |
| 13 | Ga0070683_100670637 | 3300005329 | Unclassified | 993 |
| 14 | Ga0070683_101588934 | 3300005329 | Unclassified | 629 |
| 15 | Ga0070683_102163289 | 3300005329 | Unclassified | 534 |
| 16 | Ga0070670_100011513 | 3300005331 | Bacteria | 7568 |
| 17 | Ga0070670_100136415 | 3300005331 | Bacteria | 2120 |
| 18 | Ga0070670_100630290 | 3300005331 | Unclassified | 961 |
| 19 | Ga0068869_100015088 | 3300005334 | Bacteria | 5173 |
| 20 | Ga0068869_100035967 | 3300005334 | Bacteria | 3514 |
| 21 | Ga0068869_100646857 | 3300005334 | Bacteria | 897 |
| 22 | Ga0070666_10170669 | 3300005335 | Bacteria | 1523 |
| 23 | Ga0070666_10222524 | 3300005335 | Unclassified | 1331 |
| 24 | Ga0070666_10291617 | 3300005335 | Unclassified | 1161 |
| 25 | Ga0070666_10512178 | 3300005335 | Bacteria | 870 |
| 26 | Ga0070680_100088831 | 3300005336 | Unclassified | 2557 |
| 27 | Ga0070680_100213176 | 3300005336 | Unclassified | 1629 |
| 28 | Ga0070680_100279750 | 3300005336 | Bacteria | 1414 |
| 29 | Ga0070680_100757116 | 3300005336 | Unclassified | 836 |
| 30 | Ga0070680_100886235 | 3300005336 | Unclassified | 770 |
| 31 | Ga0070682_100041777 | 3300005337 | Bacteria | 2828 |
| 32 | Ga0070682_100930960 | 3300005337 | Unclassified | 716 |
| 33 | Ga0068868_100001354 | 3300005338 | Bacteria | 16898 |
| 34 | Ga0068868_100006887 | 3300005338 | Bacteria | 8073 |
| 35 | Ga0068868_100022322 | 3300005338 | Unclassified | 4774 |
| 36 | Ga0068868_100081667 | 3300005338 | Bacteria | 2592 |
| 37 | Ga0068868_100096506 | 3300005338 | Bacteria | 2388 |
| 38 | Ga0068868_100225742 | 3300005338 | Bacteria | 1569 |
| 39 | Ga0070660_100016337 | 3300005339 | Bacteria | 5386 |
| 40 | Ga0070689_100041444 | 3300005340 | Bacteria | 3535 |
| 41 | Ga0070689_100153738 | 3300005340 | Bacteria | 1857 |
| 42 | Ga0070691_10225582 | 3300005341 | Bacteria | 995 |
| 43 | Ga0070691_10551439 | 3300005341 | Bacteria | 674 |
| 44 | Ga0070687_100036507 | 3300005343 | Unclassified | 2449 |
| 45 | Ga0070661_100123139 | 3300005344 | Bacteria | 1943 |
| 46 | Ga0070661_100128455 | 3300005344 | Bacteria | 1902 |
| 47 | Ga0070661_100442807 | 3300005344 | Bacteria | 1033 |
| 48 | Ga0070661_101949487 | 3300005344 | Unclassified | 500 |
| 49 | Ga0070668_100200689 | 3300005347 | Bacteria | 1637 |
| 50 | Ga0070669_100071693 | 3300005353 | Bacteria | 2564 |
| 51 | Ga0070669_100873618 | 3300005353 | Unclassified | 767 |
| 52 | Ga0070675_100237366 | 3300005354 | Bacteria | 1592 |
| 53 | Ga0070671_100312420 | 3300005355 | Unclassified | 1339 |
| 54 | Ga0070674_100238546 | 3300005356 | Bacteria | 1422 |
| 55 | Ga0070674_100718364 | 3300005356 | Bacteria | 856 |
| 56 | Ga0070673_100072247 | 3300005364 | Bacteria | 2774 |
| 57 | Ga0070688_100876914 | 3300005365 | Unclassified | 706 |
| 58 | Ga0070659_100018797 | 3300005366 | Bacteria | 5217 |
| 59 | Ga0070659_100062532 | 3300005366 | Bacteria | 2943 |
| 60 | Ga0070659_100401533 | 3300005366 | Bacteria | 1157 |
| 61 | Ga0070659_102046803 | 3300005366 | Unclassified | 514 |
| 62 | Ga0070667_100380862 | 3300005367 | Bacteria | 1281 |
| 63 | Ga0070667_100503949 | 3300005367 | Unclassified | 1110 |
| 64 | Ga0070709_10009444 | 3300005434 | Bacteria | 5384 |
| 65 | Ga0070709_10038448 | 3300005434 | Bacteria | 2930 |
| 66 | Ga0070709_10053950 | 3300005434 | Unclassified | 2532 |
| 67 | Ga0070709_10101779 | 3300005434 | Bacteria | 1915 |
| 68 | Ga0070709_10109346 | 3300005434 | Bacteria | 1855 |
| 69 | Ga0070709_10121244 | 3300005434 | Bacteria | 1773 |
| 70 | Ga0070709_10223534 | 3300005434 | Unclassified | 1343 |
| 71 | Ga0070709_10294419 | 3300005434 | Unclassified | 1184 |
| 72 | Ga0070709_10764660 | 3300005434 | Bacteria | 756 |
| 73 | Ga0070709_10803849 | 3300005434 | Unclassified | 738 |
| 74 | Ga0070714_100000040 | 3300005435 | Bacteria | 119253 |
| 75 | Ga0070714_100006319 | 3300005435 | Bacteria | 9134 |
| 76 | Ga0070714_100007393 | 3300005435 | Bacteria | 8545 |
| 77 | Ga0070714_100009776 | 3300005435 | Bacteria | 7559 |
| 78 | Ga0070714_100318628 | 3300005435 | Bacteria | 1453 |
| 79 | Ga0070714_100403887 | 3300005435 | Unclassified | 1292 |
| 80 | Ga0070714_100557105 | 3300005435 | Bacteria | 1098 |
| 81 | Ga0070714_100678805 | 3300005435 | Unclassified | 993 |
| 82 | Ga0070714_101412334 | 3300005435 | Unclassified | 680 |
| 83 | Ga0070714_101447092 | 3300005435 | Unclassified | 671 |
| 84 | Ga0070713_100000302 | 3300005436 | Bacteria | 32656 |
| 85 | Ga0070713_100034144 | 3300005436 | Unclassified | 4082 |
| 86 | Ga0070713_100065351 | 3300005436 | Bacteria | 3055 |
| 87 | Ga0070713_100068959 | 3300005436 | Bacteria | 2981 |
| 88 | Ga0070713_100190215 | 3300005436 | Bacteria | 1849 |
| 89 | Ga0070713_100217087 | 3300005436 | Bacteria | 1734 |
| 90 | Ga0070713_100232115 | 3300005436 | Bacteria | 1678 |
| 91 | Ga0070713_100269201 | 3300005436 | Unclassified | 1559 |
| 92 | Ga0070713_100313698 | 3300005436 | Unclassified | 1447 |
| 93 | Ga0070713_100349914 | 3300005436 | Unclassified | 1371 |
| 94 | Ga0070713_100425284 | 3300005436 | Bacteria | 1244 |
| 95 | Ga0070713_100695116 | 3300005436 | Bacteria | 971 |
| 96 | Ga0070713_100736488 | 3300005436 | Unclassified | 942 |
| 97 | Ga0070713_100805039 | 3300005436 | Unclassified | 901 |
| 98 | Ga0070713_100812550 | 3300005436 | Unclassified | 897 |
| 99 | Ga0070713_101570694 | 3300005436 | Bacteria | 638 |
| 100 | Ga0070713_101783824 | 3300005436 | Unclassified | 597 |
| 101 | Ga0070710_10003267 | 3300005437 | Bacteria | 7685 |
| 102 | Ga0070710_10021693 | 3300005437 | Bacteria | 3352 |
| 103 | Ga0070710_10024132 | 3300005437 | Bacteria | 3205 |
| 104 | Ga0070710_10032022 | 3300005437 | Bacteria | 2844 |
| 105 | Ga0070710_10201898 | 3300005437 | Bacteria | 1256 |
| 106 | Ga0070710_10220004 | 3300005437 | Bacteria | 1208 |
| 107 | Ga0070710_10352339 | 3300005437 | Unclassified | 975 |
| 108 | Ga0070701_10532247 | 3300005438 | Bacteria | 768 |
| 109 | Ga0070711_100000549 | 3300005439 | Bacteria | 19585 |
| 110 | Ga0070711_100000903 | 3300005439 | Bacteria | 15645 |
| 111 | Ga0070711_100005691 | 3300005439 | Bacteria | 7471 |
| 112 | Ga0070711_100043050 | 3300005439 | Bacteria | 3056 |
| 113 | Ga0070711_100119098 | 3300005439 | Bacteria | 1950 |
| 114 | Ga0070711_100125793 | 3300005439 | Unclassified | 1902 |
| 115 | Ga0070711_100132347 | 3300005439 | Unclassified | 1859 |
| 116 | Ga0070711_100189961 | 3300005439 | Unclassified | 1578 |
| 117 | Ga0070711_100458328 | 3300005439 | Bacteria | 1045 |
| 118 | Ga0070711_100559674 | 3300005439 | Bacteria | 949 |
| 119 | Ga0070711_100582797 | 3300005439 | Bacteria | 931 |
| 120 | Ga0070711_101786778 | 3300005439 | Unclassified | 539 |
| 121 | Ga0070708_100000920 | 3300005445 | Bacteria | 22275 |
| 122 | Ga0070708_100004665 | 3300005445 | Bacteria | 10805 |
| 123 | Ga0070708_100005861 | 3300005445 | Bacteria | 9757 |
| 124 | Ga0070708_100008905 | 3300005445 | Bacteria | 8080 |
| 125 | Ga0070708_100013098 | 3300005445 | Bacteria | 6783 |
| 126 | Ga0070708_100026864 | 3300005445 | Bacteria | 4932 |
| 127 | Ga0070708_100049935 | 3300005445 | Bacteria | 3702 |
| 128 | Ga0070708_100151217 | 3300005445 | Bacteria | 2159 |
| 129 | Ga0070708_100166629 | 3300005445 | Bacteria | 2055 |
| 130 | Ga0070708_100196726 | 3300005445 | Bacteria | 1886 |
| 131 | Ga0070708_100987516 | 3300005445 | Unclassified | 790 |
| 132 | Ga0070708_101212755 | 3300005445 | Bacteria | 706 |
| 133 | Ga0070708_101259776 | 3300005445 | Unclassified | 691 |
| 134 | Ga0070708_101737638 | 3300005445 | Unclassified | 580 |
| 135 | Ga0070663_100255075 | 3300005455 | Bacteria | 1389 |
| 136 | Ga0070678_100408896 | 3300005456 | Bacteria | 1181 |
| 137 | Ga0070678_100693520 | 3300005456 | Unclassified | 917 |
| 138 | Ga0070678_101700841 | 3300005456 | Unclassified | 594 |
| 139 | Ga0070662_100011735 | 3300005457 | Bacteria | 5785 |
| 140 | Ga0070662_100066738 | 3300005457 | Bacteria | 2640 |
| 141 | Ga0070662_100939018 | 3300005457 | Unclassified | 739 |
| 142 | Ga0070662_101072476 | 3300005457 | Bacteria | 691 |
| 143 | Ga0070681_10000070 | 3300005458 | Bacteria | 75170 |
| 144 | Ga0070681_10062741 | 3300005458 | Bacteria | 3690 |
| 145 | Ga0070681_10114716 | 3300005458 | Bacteria | 2632 |
| 146 | Ga0070681_10298045 | 3300005458 | Bacteria | 1522 |
| 147 | Ga0070681_10368092 | 3300005458 | Unclassified | 1348 |
| 148 | Ga0070681_11376430 | 3300005458 | Unclassified | 629 |
| 149 | Ga0068867_100009658 | 3300005459 | Bacteria | 6801 |
| 150 | Ga0068867_100217136 | 3300005459 | Unclassified | 1539 |
| 151 | Ga0068867_101064717 | 3300005459 | Unclassified | 736 |
| 152 | Ga0068867_101537578 | 3300005459 | Bacteria | 620 |
| 153 | Ga0070685_10273989 | 3300005466 | Bacteria | 1127 |
| 154 | Ga0070685_10291040 | 3300005466 | Bacteria | 1097 |
| 155 | Ga0070706_100000472 | 3300005467 | Bacteria | 47626 |
| 156 | Ga0070706_100004575 | 3300005467 | Bacteria | 13283 |
| 157 | Ga0070706_100013246 | 3300005467 | Bacteria | 7628 |
| 158 | Ga0070706_100045502 | 3300005467 | Bacteria | 4054 |
| 159 | Ga0070706_100136575 | 3300005467 | Unclassified | 2289 |
| 160 | Ga0070706_100285891 | 3300005467 | Unclassified | 1539 |
| 161 | Ga0070706_100407949 | 3300005467 | Bacteria | 1265 |
| 162 | Ga0070706_100434977 | 3300005467 | Bacteria | 1221 |
| 163 | Ga0070707_100000270 | 3300005468 | Bacteria | 51562 |
| 164 | Ga0070707_100012494 | 3300005468 | Bacteria | 7931 |
| 165 | Ga0070707_100029580 | 3300005468 | Bacteria | 5215 |
| 166 | Ga0070707_100141925 | 3300005468 | Unclassified | 2337 |
| 167 | Ga0070707_100396977 | 3300005468 | Unclassified | 1339 |
| 168 | Ga0070707_100421745 | 3300005468 | Bacteria | 1295 |
| 169 | Ga0070707_100528072 | 3300005468 | Bacteria | 1142 |
| 170 | Ga0070707_100812614 | 3300005468 | Bacteria | 899 |
| 171 | Ga0070707_101097954 | 3300005468 | Bacteria | 761 |
| 172 | Ga0070707_101343430 | 3300005468 | Bacteria | 681 |
| 173 | Ga0070707_101425450 | 3300005468 | Unclassified | 659 |
| 174 | Ga0070698_100000336 | 3300005471 | Bacteria | 48369 |
| 175 | Ga0070698_100011858 | 3300005471 | Bacteria | 9246 |
| 176 | Ga0070698_100148712 | 3300005471 | Unclassified | 2291 |
| 177 | Ga0070698_100547237 | 3300005471 | Bacteria | 1097 |
| 178 | Ga0070698_100726536 | 3300005471 | Unclassified | 936 |
| 179 | Ga0070698_100747791 | 3300005471 | Bacteria | 921 |
| 180 | Ga0070699_100000579 | 3300005518 | Bacteria | 34706 |
| 181 | Ga0070699_100019389 | 3300005518 | Bacteria | 5854 |
| 182 | Ga0070699_100046777 | 3300005518 | Unclassified | 3744 |
| 183 | Ga0070699_100076363 | 3300005518 | Bacteria | 2916 |
| 184 | Ga0070699_100190241 | 3300005518 | Bacteria | 1823 |
| 185 | Ga0070699_100238983 | 3300005518 | Bacteria | 1621 |
| 186 | Ga0070699_100523165 | 3300005518 | Unclassified | 1078 |
| 187 | Ga0070699_101267387 | 3300005518 | Bacteria | 676 |
| 188 | Ga0070679_100027510 | 3300005530 | Bacteria | 5598 |
| 189 | Ga0070679_100046228 | 3300005530 | Unclassified | 4339 |
| 190 | Ga0070679_100184424 | 3300005530 | Bacteria | 2058 |
| 191 | Ga0070679_100193523 | 3300005530 | Bacteria | 2002 |
| 192 | Ga0070679_100300412 | 3300005530 | Unclassified | 1556 |
| 193 | Ga0070684_100031997 | 3300005535 | Bacteria | 4481 |
| 194 | Ga0070684_100111030 | 3300005535 | Bacteria | 2459 |
| 195 | Ga0070684_100211468 | 3300005535 | Unclassified | 1768 |
| 196 | Ga0070684_100213470 | 3300005535 | Unclassified | 1759 |
| 197 | Ga0070684_100309027 | 3300005535 | Bacteria | 1451 |
| 198 | Ga0070684_100557295 | 3300005535 | Bacteria | 1064 |
| 199 | Ga0070697_100000017 | 3300005536 | Bacteria | 141440 |
| 200 | Ga0070697_100000827 | 3300005536 | Bacteria | 23222 |
| 201 | Ga0070697_100006743 | 3300005536 | Bacteria | 8906 |
| 202 | Ga0070697_100011320 | 3300005536 | Bacteria | 6970 |
| 203 | Ga0070697_100017160 | 3300005536 | Bacteria | 5692 |
| 204 | Ga0070697_100147819 | 3300005536 | Unclassified | 1979 |
| 205 | Ga0070697_100525916 | 3300005536 | Unclassified | 1036 |
| 206 | Ga0070697_100733687 | 3300005536 | Unclassified | 872 |
| 207 | Ga0070697_101430477 | 3300005536 | Unclassified | 617 |
| 208 | Ga0068853_100073438 | 3300005539 | Bacteria | 2982 |
| 209 | Ga0068853_100264108 | 3300005539 | Bacteria | 1583 |
| 210 | Ga0070672_101035161 | 3300005543 | Bacteria | 728 |
| 211 | Ga0070672_101408953 | 3300005543 | Unclassified | 623 |
| 212 | Ga0070686_100157519 | 3300005544 | Bacteria | 1596 |
| 213 | Ga0070686_100203529 | 3300005544 | Bacteria | 1421 |
| 214 | Ga0070686_100463180 | 3300005544 | Unclassified | 977 |
| 215 | Ga0070695_100133438 | 3300005545 | Bacteria | 1714 |
| 216 | Ga0070695_100368591 | 3300005545 | Bacteria | 1081 |
| 217 | Ga0070695_100609247 | 3300005545 | Unclassified | 858 |
| 218 | Ga0070695_101282804 | 3300005545 | Bacteria | 605 |
| 219 | Ga0070696_100006097 | 3300005546 | Bacteria | 8053 |
| 220 | Ga0070696_100056636 | 3300005546 | Bacteria | 2734 |
| 221 | Ga0070696_100699948 | 3300005546 | Bacteria | 826 |
| 222 | Ga0070696_101874982 | 3300005546 | Bacteria | 519 |
| 223 | Ga0070693_100028654 | 3300005547 | Bacteria | 3029 |
| 224 | Ga0070693_100159719 | 3300005547 | Bacteria | 1435 |
| 225 | Ga0070693_100190046 | 3300005547 | Bacteria | 1327 |
| 226 | Ga0070693_100757866 | 3300005547 | Unclassified | 716 |
| 227 | Ga0070693_100851750 | 3300005547 | Unclassified | 679 |
| 228 | Ga0070665_100061903 | 3300005548 | Bacteria | 3752 |
| 229 | Ga0070665_100275088 | 3300005548 | Unclassified | 1686 |
| 230 | Ga0068855_100000492 | 3300005563 | Bacteria | 48798 |
| 231 | Ga0068855_100004432 | 3300005563 | Bacteria | 17153 |
| 232 | Ga0068855_100005794 | 3300005563 | Bacteria | 15085 |
| 233 | Ga0068855_100092224 | 3300005563 | Bacteria | 3493 |
| 234 | Ga0068855_100675230 | 3300005563 | Bacteria | 1107 |
| 235 | Ga0068855_101506433 | 3300005563 | Bacteria | 690 |
| 236 | Ga0068855_101800997 | 3300005563 | Bacteria | 622 |
| 237 | Ga0068855_102193222 | 3300005563 | Unclassified | 555 |
| 238 | Ga0070664_100000862 | 3300005564 | Bacteria | 23445 |
| 239 | Ga0070664_100060831 | 3300005564 | Bacteria | 3217 |
| 240 | Ga0070664_100079874 | 3300005564 | Bacteria | 2816 |
| 241 | Ga0070664_100111678 | 3300005564 | Bacteria | 2386 |
| 242 | Ga0070664_100869612 | 3300005564 | Bacteria | 844 |
| 243 | Ga0068857_100006961 | 3300005577 | Bacteria | 9733 |
| 244 | Ga0068857_100085853 | 3300005577 | Bacteria | 2813 |
| 245 | Ga0068857_100101302 | 3300005577 | Bacteria | 2584 |
| 246 | Ga0068857_100428431 | 3300005577 | Unclassified | 1234 |
| 247 | Ga0068854_100003250 | 3300005578 | Bacteria | 10124 |
| 248 | Ga0068854_100004359 | 3300005578 | Bacteria | 8922 |
| 249 | Ga0068854_100040833 | 3300005578 | Bacteria | 3275 |
| 250 | Ga0068854_100158689 | 3300005578 | Bacteria | 1750 |
| 251 | Ga0068854_101211807 | 3300005578 | Unclassified | 677 |
| 252 | Ga0068856_100000114 | 3300005614 | Bacteria | 79977 |
| 253 | Ga0068856_100000693 | 3300005614 | Bacteria | 36529 |
| 254 | Ga0068856_100005568 | 3300005614 | Bacteria | 12403 |
| 255 | Ga0068856_100010824 | 3300005614 | Bacteria | 8859 |
| 256 | Ga0068856_100011573 | 3300005614 | Bacteria | 8557 |
| 257 | Ga0068856_100065703 | 3300005614 | Bacteria | 3585 |
| 258 | Ga0068856_100208021 | 3300005614 | Unclassified | 1971 |
| 259 | Ga0068856_100219338 | 3300005614 | Bacteria | 1917 |
| 260 | Ga0068856_100238480 | 3300005614 | Unclassified | 1834 |
| 261 | Ga0068856_100620974 | 3300005614 | Unclassified | 1102 |
| 262 | Ga0068856_101948067 | 3300005614 | Unclassified | 598 |
| 263 | Ga0068856_102106689 | 3300005614 | Bacteria | 574 |
| 264 | Ga0068856_102116281 | 3300005614 | Unclassified | 572 |
| 265 | Ga0070702_100431122 | 3300005615 | Unclassified | 951 |
| 266 | Ga0068852_100101107 | 3300005616 | Bacteria | 2603 |
| 267 | Ga0068852_100130996 | 3300005616 | Bacteria | 2309 |
| 268 | Ga0068852_100277740 | 3300005616 | Unclassified | 1614 |
| 269 | Ga0068852_100969053 | 3300005616 | Unclassified | 869 |
| 270 | Ga0068859_100000657 | 3300005617 | Bacteria | 34600 |
| 271 | Ga0068859_100007007 | 3300005617 | Bacteria | 11447 |
| 272 | Ga0068859_100398093 | 3300005617 | Bacteria | 1473 |
| 273 | Ga0068864_100001871 | 3300005618 | Bacteria | 17280 |
| 274 | Ga0068864_100043099 | 3300005618 | Bacteria | 3863 |
| 275 | Ga0068864_100084201 | 3300005618 | Bacteria | 2793 |
| 276 | Ga0068866_10027522 | 3300005718 | Bacteria | 2698 |
| 277 | Ga0068866_10076804 | 3300005718 | Bacteria | 1782 |
| 278 | Ga0068866_10106878 | 3300005718 | Bacteria | 1554 |
| 279 | Ga0068866_10731623 | 3300005718 | Unclassified | 681 |
| 280 | Ga0068861_100118273 | 3300005719 | Bacteria | 2134 |
| 281 | Ga0068861_100219595 | 3300005719 | Unclassified | 1606 |
| 282 | Ga0068861_101529936 | 3300005719 | Bacteria | 655 |
| 283 | Ga0068861_101800829 | 3300005719 | Unclassified | 607 |
| 284 | Ga0068851_10013620 | 3300005834 | Bacteria | 3850 |
| 285 | Ga0068851_10021584 | 3300005834 | Bacteria | 3126 |
| 286 | Ga0068851_10148156 | 3300005834 | Bacteria | 1281 |
| 287 | Ga0068851_10423855 | 3300005834 | Unclassified | 786 |
| 288 | Ga0068870_10324989 | 3300005840 | Bacteria | 979 |
| 289 | Ga0068863_100063381 | 3300005841 | Bacteria | 3496 |
| 290 | Ga0068863_100102242 | 3300005841 | Bacteria | 2725 |
| 291 | Ga0068863_100282919 | 3300005841 | Bacteria | 1607 |
| 292 | Ga0068863_100431304 | 3300005841 | Bacteria | 1292 |
| 293 | Ga0068863_101221775 | 3300005841 | Bacteria | 758 |
| 294 | Ga0068863_101419547 | 3300005841 | Bacteria | 702 |
| 295 | Ga0068863_101440995 | 3300005841 | Unclassified | 697 |
| 296 | Ga0068863_101967770 | 3300005841 | Unclassified | 594 |
| 297 | Ga0068863_102423833 | 3300005841 | Bacteria | 534 |
| 298 | Ga0068858_100005644 | 3300005842 | Bacteria | 12240 |
| 299 | Ga0068858_100039760 | 3300005842 | Bacteria | 4360 |
| 300 | Ga0068858_100044039 | 3300005842 | Bacteria | 4138 |
| 301 | Ga0068858_100210161 | 3300005842 | Unclassified | 1841 |
| 302 | Ga0068858_100329829 | 3300005842 | Bacteria | 1459 |
| 303 | Ga0068858_100445441 | 3300005842 | Bacteria | 1247 |
| 304 | Ga0068860_100038215 | 3300005843 | Bacteria | 4592 |
| 305 | Ga0068860_100097154 | 3300005843 | Unclassified | 2808 |
| 306 | Ga0068860_101940302 | 3300005843 | Unclassified | 610 |
| 307 | Ga0068862_100044378 | 3300005844 | Bacteria | 3791 |
| 308 | Ga0070717_10002921 | 3300006028 | Bacteria | 12143 |
| 309 | Ga0070717_10006862 | 3300006028 | Bacteria | 8405 |
| 310 | Ga0070717_10008345 | 3300006028 | Bacteria | 7735 |
| 311 | Ga0070717_10008866 | 3300006028 | Bacteria | 7531 |
| 312 | Ga0070717_10010635 | 3300006028 | Bacteria | 6955 |
| 313 | Ga0070717_10013761 | 3300006028 | Bacteria | 6208 |
| 314 | Ga0070717_10024769 | 3300006028 | Unclassified | 4769 |
| 315 | Ga0070717_10034165 | 3300006028 | Unclassified | 4109 |
| 316 | Ga0070717_10045101 | 3300006028 | Bacteria | 3603 |
| 317 | Ga0070717_10073244 | 3300006028 | Bacteria | 2862 |
| 318 | Ga0070717_10094766 | 3300006028 | Bacteria | 2526 |
| 319 | Ga0070717_10146155 | 3300006028 | Unclassified | 2042 |
| 320 | Ga0070717_10321089 | 3300006028 | Bacteria | 1379 |
| 321 | Ga0070717_10396529 | 3300006028 | Unclassified | 1239 |
| 322 | Ga0070717_10557803 | 3300006028 | Bacteria | 1038 |
| 323 | Ga0070717_10930472 | 3300006028 | Unclassified | 791 |
| 324 | Ga0070717_11095402 | 3300006028 | Unclassified | 725 |
| 325 | Ga0070717_11633731 | 3300006028 | Unclassified | 584 |
| 326 | Ga0070717_12134355 | 3300006028 | Unclassified | 504 |
| 327 | Ga0070715_10033303 | 3300006163 | Unclassified | 2105 |
| 328 | Ga0070715_10043901 | 3300006163 | Bacteria | 1887 |
| 329 | Ga0070715_10148350 | 3300006163 | Bacteria | 1146 |
| 330 | Ga0070715_10767031 | 3300006163 | Unclassified | 582 |
| 331 | Ga0070716_100000092 | 3300006173 | Bacteria | 35441 |
| 332 | Ga0070716_100001536 | 3300006173 | Bacteria | 10347 |
| 333 | Ga0070716_100006363 | 3300006173 | Bacteria | 5766 |
| 334 | Ga0070716_100021384 | 3300006173 | Bacteria | 3409 |
| 335 | Ga0070716_100048892 | 3300006173 | Bacteria | 2393 |
| 336 | Ga0070716_100142544 | 3300006173 | Bacteria | 1530 |
| 337 | Ga0070716_100634371 | 3300006173 | Unclassified | 808 |
| 338 | Ga0070716_100635230 | 3300006173 | Bacteria | 808 |
| 339 | Ga0070716_100770035 | 3300006173 | Unclassified | 742 |
| 340 | Ga0070716_101359244 | 3300006173 | Bacteria | 576 |
| 341 | Ga0070716_101755969 | 3300006173 | Unclassified | 513 |
| 342 | Ga0070712_100000273 | 3300006175 | Bacteria | 28938 |
| 343 | Ga0070712_100001148 | 3300006175 | Bacteria | 16007 |
| 344 | Ga0070712_100044003 | 3300006175 | Bacteria | 3076 |
| 345 | Ga0070712_100050284 | 3300006175 | Bacteria | 2899 |
| 346 | Ga0070712_100065839 | 3300006175 | Bacteria | 2573 |
| 347 | Ga0070712_100135644 | 3300006175 | Unclassified | 1871 |
| 348 | Ga0070712_100182475 | 3300006175 | Unclassified | 1636 |
| 349 | Ga0070712_100189625 | 3300006175 | Bacteria | 1608 |
| 350 | Ga0070712_100207341 | 3300006175 | Unclassified | 1544 |
| 351 | Ga0070712_100324752 | 3300006175 | Bacteria | 1252 |
| 352 | Ga0070712_101019947 | 3300006175 | Unclassified | 716 |
| 353 | Ga0070712_101667280 | 3300006175 | Bacteria | 558 |
| 354 | Ga0097621_100000454 | 3300006237 | Bacteria | 28711 |
| 355 | Ga0097621_100000912 | 3300006237 | Bacteria | 20655 |
| 356 | Ga0097621_100008230 | 3300006237 | Bacteria | 7500 |
| 357 | Ga0097621_100036892 | 3300006237 | Bacteria | 3913 |
| 358 | Ga0097621_100041946 | 3300006237 | Bacteria | 3685 |
| 359 | Ga0097621_100128500 | 3300006237 | Bacteria | 2154 |
| 360 | Ga0097621_100151643 | 3300006237 | Bacteria | 1988 |
| 361 | Ga0097621_100315068 | 3300006237 | Unclassified | 1385 |
| 362 | Ga0097621_100947790 | 3300006237 | Unclassified | 803 |
| 363 | Ga0097621_100998742 | 3300006237 | Bacteria | 783 |
| 364 | Ga0068871_100000262 | 3300006358 | Bacteria | 36261 |
| 365 | Ga0068871_100000689 | 3300006358 | Bacteria | 23008 |
| 366 | Ga0068871_100010069 | 3300006358 | Bacteria | 6876 |
| 367 | Ga0068871_100060620 | 3300006358 | Bacteria | 3087 |
| 368 | Ga0068871_100203599 | 3300006358 | Bacteria | 1710 |
| 369 | Ga0068871_100218126 | 3300006358 | Bacteria | 1652 |
| 370 | Ga0068871_100278584 | 3300006358 | Bacteria | 1462 |
| 371 | Ga0068871_100289763 | 3300006358 | Unclassified | 1434 |
| 372 | Ga0068871_100371633 | 3300006358 | Unclassified | 1268 |
| 373 | Ga0068871_100838043 | 3300006358 | Unclassified | 849 |
| 374 | Ga0068871_101046780 | 3300006358 | Bacteria | 761 |
| 375 | Ga0068871_101327039 | 3300006358 | Unclassified | 677 |
| 376 | Ga0068871_101800241 | 3300006358 | Unclassified | 581 |
| 377 | Ga0075434_100000654 | 3300006871 | Bacteria | 26874 |
| 378 | Ga0075434_100082356 | 3300006871 | Bacteria | 3215 |
| 379 | Ga0075434_100085518 | 3300006871 | Unclassified | 3153 |
| 380 | Ga0075434_100722701 | 3300006871 | Unclassified | 1013 |
| 381 | Ga0068865_100016416 | 3300006881 | Bacteria | 4738 |
| 382 | Ga0068865_100246993 | 3300006881 | Bacteria | 1407 |
| 383 | Ga0068865_100281216 | 3300006881 | Unclassified | 1325 |
| 384 | Ga0068865_100674401 | 3300006881 | Bacteria | 881 |
| 385 | Ga0068865_101053013 | 3300006881 | Unclassified | 714 |
| 386 | Ga0075436_100000809 | 3300006914 | Bacteria | 20792 |
| 387 | Ga0075436_100027070 | 3300006914 | Unclassified | 3948 |
| 388 | Ga0075436_100066582 | 3300006914 | Unclassified | 2490 |
| 389 | Ga0075436_100215996 | 3300006914 | Bacteria | 1360 |
| 390 | Ga0097620_100000657 | 3300006931 | Bacteria | 34600 |
| 391 | Ga0097620_100007007 | 3300006931 | Bacteria | 11447 |
| 392 | Ga0097620_100398080 | 3300006931 | Bacteria | 1473 |
| 393 | Ga0075435_100000231 | 3300007076 | Bacteria | 34126 |
| 394 | Ga0075435_100002901 | 3300007076 | Bacteria | 11513 |
| 395 | Ga0075435_100164226 | 3300007076 | Bacteria | 1872 |
| 396 | Ga0075435_100622033 | 3300007076 | Bacteria | 937 |
| 397 | Ga0075435_101098968 | 3300007076 | Unclassified | 695 |
| 398 | Ga0099794_10380753 | 3300007265 | Unclassified | 736 |
| 399 | Ga0099795_10036590 | 3300007788 | Bacteria | 1723 |
| 400 | Ga0099795_10202484 | 3300007788 | Bacteria | 838 |
| 401 | Ga0105250_10032276 | 3300009092 | Unclassified | 2103 |
| 402 | Ga0105240_10062373 | 3300009093 | Bacteria | 4641 |
| 403 | Ga0105240_10110102 | 3300009093 | Bacteria | 3334 |
| 404 | Ga0105240_10117779 | 3300009093 | Bacteria | 3202 |
| 405 | Ga0105240_10204205 | 3300009093 | Bacteria | 2314 |
| 406 | Ga0105240_10401783 | 3300009093 | Unclassified | 1543 |
| 407 | Ga0105240_10668931 | 3300009093 | Unclassified | 1136 |
| 408 | Ga0105240_11554318 | 3300009093 | Unclassified | 693 |
| 409 | Ga0105240_12346328 | 3300009093 | Unclassified | 552 |
| 410 | Ga0105245_10000435 | 3300009098 | Bacteria | 38523 |
| 411 | Ga0105245_10079432 | 3300009098 | Bacteria | 2995 |
| 412 | Ga0105245_10216732 | 3300009098 | Bacteria | 1845 |
| 413 | Ga0105245_10934663 | 3300009098 | Bacteria | 910 |
| 414 | Ga0105247_10011644 | 3300009101 | Bacteria | 5298 |
| 415 | Ga0105247_10031638 | 3300009101 | Bacteria | 3211 |
| 416 | Ga0105247_10280750 | 3300009101 | Unclassified | 1149 |
| 417 | Ga0105247_10836176 | 3300009101 | Unclassified | 705 |
| 418 | Ga0114129_10271029 | 3300009147 | Unclassified | 2271 |
| 419 | Ga0114129_11490867 | 3300009147 | Bacteria | 831 |
| 420 | Ga0105243_10355811 | 3300009148 | Bacteria | 1346 |
| 421 | Ga0105241_10027902 | 3300009174 | Unclassified | 4204 |
| 422 | Ga0105241_10083427 | 3300009174 | Bacteria | 2507 |
| 423 | Ga0105241_10124304 | 3300009174 | Bacteria | 2081 |
| 424 | Ga0105241_10134890 | 3300009174 | Bacteria | 2003 |
| 425 | Ga0105241_10135042 | 3300009174 | Unclassified | 2002 |
| 426 | Ga0105241_10155093 | 3300009174 | Bacteria | 1877 |
| 427 | Ga0105241_10288076 | 3300009174 | Unclassified | 1405 |
| 428 | Ga0105241_10641021 | 3300009174 | Bacteria | 964 |
| 429 | Ga0105241_10783091 | 3300009174 | Bacteria | 877 |
| 430 | Ga0105241_10992723 | 3300009174 | Unclassified | 785 |
| 431 | Ga0105242_10018808 | 3300009176 | Bacteria | 5407 |
| 432 | Ga0105242_10092452 | 3300009176 | Unclassified | 2548 |
| 433 | Ga0105242_10408364 | 3300009176 | Bacteria | 1269 |
| 434 | Ga0105248_10013447 | 3300009177 | Bacteria | 9009 |
| 435 | Ga0105248_10036290 | 3300009177 | Bacteria | 5513 |
| 436 | Ga0105248_10076358 | 3300009177 | Bacteria | 3766 |
| 437 | Ga0105248_13250575 | 3300009177 | Unclassified | 517 |
| 438 | Ga0105237_10024086 | 3300009545 | Bacteria | 6228 |
| 439 | Ga0105237_10071399 | 3300009545 | Bacteria | 3467 |
| 440 | Ga0105237_10200887 | 3300009545 | Bacteria | 1993 |
| 441 | Ga0105237_10380096 | 3300009545 | Bacteria | 1417 |
| 442 | Ga0105237_10526824 | 3300009545 | Bacteria | 1188 |
| 443 | Ga0105237_10738573 | 3300009545 | Unclassified | 991 |
| 444 | Ga0105237_10871935 | 3300009545 | Unclassified | 907 |
| 445 | Ga0105238_10003235 | 3300009551 | Bacteria | 16274 |
| 446 | Ga0105238_10028319 | 3300009551 | Bacteria | 5709 |
| 447 | Ga0105238_10149058 | 3300009551 | Bacteria | 2315 |
| 448 | Ga0105238_10410837 | 3300009551 | Bacteria | 1347 |
| 449 | Ga0105238_10778789 | 3300009551 | Unclassified | 971 |
| 450 | Ga0105249_10017700 | 3300009553 | Bacteria | 6328 |
| 451 | Ga0105249_11482585 | 3300009553 | Unclassified | 751 |
| 452 | Ga0099796_10042229 | 3300010159 | Unclassified | 1548 |
| 453 | Ga0099796_10290270 | 3300010159 | Unclassified | 690 |
| 454 | Ga0105239_10014341 | 3300010375 | Bacteria | 8792 |
| 455 | Ga0105239_10095211 | 3300010375 | Bacteria | 3289 |
| 456 | Ga0105239_10276770 | 3300010375 | Bacteria | 1889 |
| 457 | Ga0105239_10609523 | 3300010375 | Bacteria | 1246 |
| 458 | Ga0105239_10959651 | 3300010375 | Bacteria | 982 |
| 459 | Ga0105239_11801808 | 3300010375 | Unclassified | 709 |
| 460 | Ga0105239_12884188 | 3300010375 | Unclassified | 561 |
| 461 | Ga0105239_13238786 | 3300010375 | Unclassified | 530 |
| 462 | Ga0105246_10185134 | 3300011119 | Bacteria | 1607 |
| 463 | Ga0105246_11796462 | 3300011119 | Bacteria | 586 |
| 464 | Ga0157373_10002689 | 3300013100 | Bacteria | 13474 |
| 465 | Ga0157373_10083838 | 3300013100 | Bacteria | 2247 |
| 466 | Ga0157373_10118343 | 3300013100 | Bacteria | 1862 |
| 467 | Ga0157373_10255496 | 3300013100 | Bacteria | 1240 |
| 468 | Ga0157373_10406457 | 3300013100 | Bacteria | 976 |
| 469 | Ga0157373_10755771 | 3300013100 | Unclassified | 715 |
| 470 | Ga0157373_11271866 | 3300013100 | Unclassified | 556 |
| 471 | Ga0157371_10009228 | 3300013102 | Bacteria | 7782 |
| 472 | Ga0157371_10027534 | 3300013102 | Unclassified | 4122 |
| 473 | Ga0157371_10172653 | 3300013102 | Unclassified | 1545 |
| 474 | Ga0157370_10041301 | 3300013104 | Bacteria | 4451 |
| 475 | Ga0157370_10333694 | 3300013104 | Bacteria | 1398 |
| 476 | Ga0157370_10760049 | 3300013104 | Bacteria | 883 |
| 477 | Ga0157369_10000487 | 3300013105 | Bacteria | 52675 |
| 478 | Ga0157369_10025043 | 3300013105 | Bacteria | 6627 |
| 479 | Ga0157369_10041153 | 3300013105 | Bacteria | 5044 |
| 480 | Ga0157369_10042625 | 3300013105 | Bacteria | 4950 |
| 481 | Ga0157369_10062526 | 3300013105 | Unclassified | 4011 |
| 482 | Ga0157369_10079189 | 3300013105 | Bacteria | 3520 |
| 483 | Ga0157369_10208223 | 3300013105 | Bacteria | 2050 |
| 484 | Ga0157369_10290250 | 3300013105 | Bacteria | 1703 |
| 485 | Ga0157369_10512119 | 3300013105 | Unclassified | 1241 |
| 486 | Ga0157369_10919460 | 3300013105 | Bacteria | 897 |
| 487 | Ga0157374_10000243 | 3300013296 | Bacteria | 50690 |
| 488 | Ga0157374_10000751 | 3300013296 | Bacteria | 28307 |
| 489 | Ga0157374_10057111 | 3300013296 | Bacteria | 3645 |
| 490 | Ga0157374_10123731 | 3300013296 | Bacteria | 2498 |
| 491 | Ga0157374_10139405 | 3300013296 | Bacteria | 2353 |
| 492 | Ga0157374_10306864 | 3300013296 | Bacteria | 1571 |
| 493 | Ga0157374_10331705 | 3300013296 | Unclassified | 1509 |
| 494 | Ga0157374_10583985 | 3300013296 | Unclassified | 1127 |
| 495 | Ga0157374_10760931 | 3300013296 | Bacteria | 983 |
| 496 | Ga0157374_10856485 | 3300013296 | Unclassified | 926 |
| 497 | Ga0157374_10860148 | 3300013296 | Unclassified | 924 |
| 498 | Ga0157378_10000183 | 3300013297 | Bacteria | 60010 |
| 499 | Ga0157378_10000201 | 3300013297 | Bacteria | 58196 |
| 500 | Ga0157378_10000288 | 3300013297 | Bacteria | 49108 |
| 501 | Ga0157378_10002198 | 3300013297 | Bacteria | 17308 |
| 502 | Ga0157378_10014399 | 3300013297 | Bacteria | 6924 |
| 503 | Ga0157378_10033557 | 3300013297 | Bacteria | 4539 |
| 504 | Ga0157378_10210324 | 3300013297 | Bacteria | 1844 |
| 505 | Ga0157378_10817031 | 3300013297 | Unclassified | 959 |
| 506 | Ga0157378_10999856 | 3300013297 | Unclassified | 871 |
| 507 | Ga0157378_11755096 | 3300013297 | Bacteria | 668 |
| 508 | Ga0163162_10003496 | 3300013306 | Bacteria | 15016 |
| 509 | Ga0163162_10049078 | 3300013306 | Bacteria | 4229 |
| 510 | Ga0163162_10098209 | 3300013306 | Bacteria | 3018 |
| 511 | Ga0157372_10000234 | 3300013307 | Bacteria | 61633 |
| 512 | Ga0157372_10000558 | 3300013307 | Bacteria | 41005 |
| 513 | Ga0157372_10001354 | 3300013307 | Bacteria | 26495 |
| 514 | Ga0157372_10001584 | 3300013307 | Bacteria | 24799 |
| 515 | Ga0157372_10003500 | 3300013307 | Bacteria | 16918 |
| 516 | Ga0157372_10056481 | 3300013307 | Bacteria | 4386 |
| 517 | Ga0157372_10072958 | 3300013307 | Bacteria | 3868 |
| 518 | Ga0157372_10080541 | 3300013307 | Unclassified | 3685 |
| 519 | Ga0157372_10221558 | 3300013307 | Bacteria | 2193 |
| 520 | Ga0157372_10223841 | 3300013307 | Unclassified | 2181 |
| 521 | Ga0157372_10605264 | 3300013307 | Bacteria | 1277 |
| 522 | Ga0157372_10741718 | 3300013307 | Bacteria | 1142 |
| 523 | Ga0157372_10925656 | 3300013307 | Bacteria | 1011 |
| 524 | Ga0157372_11511443 | 3300013307 | Unclassified | 773 |
| 525 | Ga0157372_11967349 | 3300013307 | Unclassified | 672 |
| 526 | Ga0157375_10008727 | 3300013308 | Bacteria | 8880 |
| 527 | Ga0157375_10031893 | 3300013308 | Bacteria | 4991 |
| 528 | Ga0163163_10241139 | 3300014325 | Unclassified | 1857 |
| 529 | Ga0163163_10311263 | 3300014325 | Bacteria | 1628 |
| 530 | Ga0163163_10599299 | 3300014325 | Bacteria | 1165 |
| 531 | Ga0163163_12788505 | 3300014325 | Unclassified | 545 |
| 532 | Ga0182008_10042616 | 3300014497 | Bacteria | 2261 |
| 533 | Ga0182008_10595811 | 3300014497 | Bacteria | 620 |
| 534 | Ga0157379_10037014 | 3300014968 | Bacteria | 4350 |
| 535 | Ga0157379_10043289 | 3300014968 | Bacteria | 4020 |
| 536 | Ga0157379_10108897 | 3300014968 | Bacteria | 2488 |
| 537 | Ga0157379_10449288 | 3300014968 | Unclassified | 1190 |
| 538 | Ga0157379_12547628 | 3300014968 | Unclassified | 512 |
| 539 | Ga0157376_10000884 | 3300014969 | Bacteria | 19635 |
| 540 | Ga0157376_10013897 | 3300014969 | Bacteria | 6020 |
| 541 | Ga0157376_10070444 | 3300014969 | Bacteria | 2968 |
| 542 | Ga0157376_10081007 | 3300014969 | Bacteria | 2786 |
| 543 | Ga0157376_10406923 | 3300014969 | Bacteria | 1317 |
| 544 | Ga0182007_10002598 | 3300015262 | Bacteria | 8891 |
| 545 | Ga0182005_1010452 | 3300015265 | Bacteria | 2669 |
| 546 | Ga0206356_11763600 | 3300020070 | Unclassified | 726 |
| 547 | Ga0206352_10528900 | 3300020078 | Unclassified | 743 |
| 548 | Ga0206352_11322468 | 3300020078 | Bacteria | 750 |
| 549 | Ga0206350_11263534 | 3300020080 | Bacteria | 1002 |
| 550 | Ga0213876_10183762 | 3300021384 | Unclassified | 1112 |
| 551 | Ga0213876_10382871 | 3300021384 | Bacteria | 748 |
| 552 | Ga0213875_10275513 | 3300021388 | Unclassified | 794 |
| 553 | Ga0224712_10299917 | 3300022467 | Unclassified | 751 |
| 554 | Ga0224572_1000057 | 3300024225 | Bacteria | 7354 |
| 555 | Ga0224572_1005496 | 3300024225 | Unclassified | 2263 |
| 556 | Ga0228598_1000532 | 3300024227 | Bacteria | 7963 |
| 557 | Ga0228598_1002633 | 3300024227 | Bacteria | 3893 |
| 558 | Ga0207697_10327333 | 3300025315 | Unclassified | 680 |
| 559 | Ga0207656_10207527 | 3300025321 | Bacteria | 948 |
| 560 | Ga0207656_10696222 | 3300025321 | Bacteria | 520 |
| 561 | Ga0207692_10024362 | 3300025898 | Bacteria | 2813 |
| 562 | Ga0207692_10030742 | 3300025898 | Bacteria | 2564 |
| 563 | Ga0207692_10036477 | 3300025898 | Archaea | 2398 |
| 564 | Ga0207692_10159615 | 3300025898 | Unclassified | 1298 |
| 565 | Ga0207692_10194657 | 3300025898 | Unclassified | 1189 |
| 566 | Ga0207692_10247151 | 3300025898 | Bacteria | 1068 |
| 567 | Ga0207692_10296502 | 3300025898 | Unclassified | 983 |
| 568 | Ga0207692_11212412 | 3300025898 | Unclassified | 501 |
| 569 | Ga0207642_10055795 | 3300025899 | Bacteria | 1809 |
| 570 | Ga0207642_10075977 | 3300025899 | Bacteria | 1615 |
| 571 | Ga0207680_10170063 | 3300025903 | Bacteria | 1467 |
| 572 | Ga0207680_10618078 | 3300025903 | Unclassified | 775 |
| 573 | Ga0207680_11012540 | 3300025903 | Unclassified | 595 |
| 574 | Ga0207647_10072363 | 3300025904 | Bacteria | 2079 |
| 575 | Ga0207647_10314268 | 3300025904 | Bacteria | 890 |
| 576 | Ga0207685_10020083 | 3300025905 | Unclassified | 2213 |
| 577 | Ga0207685_10051778 | 3300025905 | Bacteria | 1588 |
| 578 | Ga0207685_10307960 | 3300025905 | Unclassified | 786 |
| 579 | Ga0207685_10394294 | 3300025905 | Unclassified | 708 |
| 580 | Ga0207685_10661017 | 3300025905 | Unclassified | 566 |
| 581 | Ga0207699_10005741 | 3300025906 | Bacteria | 5969 |
| 582 | Ga0207699_10007969 | 3300025906 | Bacteria | 5201 |
| 583 | Ga0207699_10059283 | 3300025906 | Bacteria | 2293 |
| 584 | Ga0207699_10066598 | 3300025906 | Bacteria | 2187 |
| 585 | Ga0207699_10089343 | 3300025906 | Bacteria | 1931 |
| 586 | Ga0207699_10091729 | 3300025906 | Unclassified | 1908 |
| 587 | Ga0207699_10128028 | 3300025906 | Unclassified | 1652 |
| 588 | Ga0207699_10202909 | 3300025906 | Bacteria | 1345 |
| 589 | Ga0207699_10286088 | 3300025906 | Bacteria | 1147 |
| 590 | Ga0207699_10530100 | 3300025906 | Bacteria | 852 |
| 591 | Ga0207699_10605446 | 3300025906 | Unclassified | 798 |
| 592 | Ga0207699_10621388 | 3300025906 | Bacteria | 788 |
| 593 | Ga0207645_10337231 | 3300025907 | Bacteria | 1007 |
| 594 | Ga0207643_10170059 | 3300025908 | Bacteria | 1315 |
| 595 | Ga0207705_10279950 | 3300025909 | Bacteria | 1277 |
| 596 | Ga0207684_10000203 | 3300025910 | Bacteria | 91833 |
| 597 | Ga0207684_10004848 | 3300025910 | Bacteria | 12586 |
| 598 | Ga0207684_10122285 | 3300025910 | Unclassified | 2232 |
| 599 | Ga0207684_10198826 | 3300025910 | Bacteria | 1729 |
| 600 | Ga0207684_10269700 | 3300025910 | Bacteria | 1468 |
| 601 | Ga0207684_10309898 | 3300025910 | Bacteria | 1361 |
| 602 | Ga0207684_11114101 | 3300025910 | Unclassified | 657 |
| 603 | Ga0207654_10016998 | 3300025911 | Bacteria | 3796 |
| 604 | Ga0207654_10066550 | 3300025911 | Bacteria | 2126 |
| 605 | Ga0207654_10100466 | 3300025911 | Bacteria | 1782 |
| 606 | Ga0207654_10199404 | 3300025911 | Unclassified | 1317 |
| 607 | Ga0207654_10282791 | 3300025911 | Unclassified | 1123 |
| 608 | Ga0207654_10299407 | 3300025911 | Unclassified | 1093 |
| 609 | Ga0207654_10347099 | 3300025911 | Bacteria | 1021 |
| 610 | Ga0207654_10468398 | 3300025911 | Bacteria | 886 |
| 611 | Ga0207707_10000415 | 3300025912 | Bacteria | 44673 |
| 612 | Ga0207707_10006370 | 3300025912 | Bacteria | 10301 |
| 613 | Ga0207707_10068804 | 3300025912 | Bacteria | 3085 |
| 614 | Ga0207707_10076805 | 3300025912 | Bacteria | 2915 |
| 615 | Ga0207707_10241799 | 3300025912 | Bacteria | 1569 |
| 616 | Ga0207707_10655662 | 3300025912 | Unclassified | 884 |
| 617 | Ga0207695_10007330 | 3300025913 | Bacteria | 14082 |
| 618 | Ga0207695_10036436 | 3300025913 | Bacteria | 5318 |
| 619 | Ga0207695_10096909 | 3300025913 | Bacteria | 2951 |
| 620 | Ga0207695_10101629 | 3300025913 | Bacteria | 2869 |
| 621 | Ga0207695_10108551 | 3300025913 | Bacteria | 2759 |
| 622 | Ga0207695_10342783 | 3300025913 | Bacteria | 1382 |
| 623 | Ga0207671_10055427 | 3300025914 | Bacteria | 2937 |
| 624 | Ga0207671_10082115 | 3300025914 | Bacteria | 2418 |
| 625 | Ga0207671_10119078 | 3300025914 | Unclassified | 2017 |
| 626 | Ga0207671_10961528 | 3300025914 | Unclassified | 674 |
| 627 | Ga0207693_10000053 | 3300025915 | Bacteria | 97139 |
| 628 | Ga0207693_10003984 | 3300025915 | Bacteria | 12547 |
| 629 | Ga0207693_10027262 | 3300025915 | Unclassified | 4518 |
| 630 | Ga0207693_10034774 | 3300025915 | Bacteria | 3974 |
| 631 | Ga0207693_10056821 | 3300025915 | Bacteria | 3068 |
| 632 | Ga0207693_10057484 | 3300025915 | Bacteria | 3048 |
| 633 | Ga0207693_10059052 | 3300025915 | Bacteria | 3004 |
| 634 | Ga0207693_10073867 | 3300025915 | Bacteria | 2670 |
| 635 | Ga0207693_10308638 | 3300025915 | Unclassified | 1239 |
| 636 | Ga0207693_10402806 | 3300025915 | Bacteria | 1070 |
| 637 | Ga0207693_10598530 | 3300025915 | Unclassified | 858 |
| 638 | Ga0207663_10003872 | 3300025916 | Bacteria | 7387 |
| 639 | Ga0207663_10009997 | 3300025916 | Bacteria | 5026 |
| 640 | Ga0207663_10032690 | 3300025916 | Bacteria | 3091 |
| 641 | Ga0207663_10040960 | 3300025916 | Bacteria | 2819 |
| 642 | Ga0207663_10107039 | 3300025916 | Unclassified | 1891 |
| 643 | Ga0207663_10115532 | 3300025916 | Unclassified | 1828 |
| 644 | Ga0207663_10657495 | 3300025916 | Unclassified | 827 |
| 645 | Ga0207663_10767814 | 3300025916 | Bacteria | 766 |
| 646 | Ga0207663_11493447 | 3300025916 | Bacteria | 544 |
| 647 | Ga0207660_10504499 | 3300025917 | Unclassified | 982 |
| 648 | Ga0207660_10558338 | 3300025917 | Unclassified | 931 |
| 649 | Ga0207660_10572446 | 3300025917 | Unclassified | 919 |
| 650 | Ga0207660_11226984 | 3300025917 | Bacteria | 610 |
| 651 | Ga0207662_10043965 | 3300025918 | Unclassified | 2636 |
| 652 | Ga0207657_10001119 | 3300025919 | Bacteria | 28462 |
| 653 | Ga0207657_10016776 | 3300025919 | Bacteria | 7051 |
| 654 | Ga0207649_10390455 | 3300025920 | Bacteria | 1039 |
| 655 | Ga0207649_10391984 | 3300025920 | Bacteria | 1037 |
| 656 | Ga0207649_10856394 | 3300025920 | Bacteria | 711 |
| 657 | Ga0207652_10005392 | 3300025921 | Bacteria | 10374 |
| 658 | Ga0207652_10075116 | 3300025921 | Bacteria | 2944 |
| 659 | Ga0207652_10206123 | 3300025921 | Bacteria | 1770 |
| 660 | Ga0207652_10365408 | 3300025921 | Bacteria | 1302 |
| 661 | Ga0207652_10899401 | 3300025921 | Bacteria | 782 |
| 662 | Ga0207652_11386755 | 3300025921 | Bacteria | 606 |
| 663 | Ga0207646_10008812 | 3300025922 | Bacteria | 10066 |
| 664 | Ga0207646_10014951 | 3300025922 | Bacteria | 7349 |
| 665 | Ga0207646_10038940 | 3300025922 | Bacteria | 4279 |
| 666 | Ga0207646_10123280 | 3300025922 | Bacteria | 2329 |
| 667 | Ga0207646_10158667 | 3300025922 | Bacteria | 2041 |
| 668 | Ga0207646_10178172 | 3300025922 | Bacteria | 1919 |
| 669 | Ga0207646_10436772 | 3300025922 | Bacteria | 1181 |
| 670 | Ga0207646_10574037 | 3300025922 | Bacteria | 1013 |
| 671 | Ga0207681_10089424 | 3300025923 | Bacteria | 2195 |
| 672 | Ga0207694_10001068 | 3300025924 | Bacteria | 23851 |
| 673 | Ga0207694_10094919 | 3300025924 | Bacteria | 2357 |
| 674 | Ga0207694_10223237 | 3300025924 | Unclassified | 1537 |
| 675 | Ga0207694_10378642 | 3300025924 | Unclassified | 1174 |
| 676 | Ga0207694_10908585 | 3300025924 | Unclassified | 744 |
| 677 | Ga0207650_10084453 | 3300025925 | Bacteria | 2414 |
| 678 | Ga0207650_10125070 | 3300025925 | Bacteria | 2006 |
| 679 | Ga0207659_10256770 | 3300025926 | Bacteria | 1420 |
| 680 | Ga0207687_10004129 | 3300025927 | Bacteria | 9725 |
| 681 | Ga0207687_10052231 | 3300025927 | Unclassified | 2852 |
| 682 | Ga0207687_10276848 | 3300025927 | Bacteria | 1343 |
| 683 | Ga0207687_10572016 | 3300025927 | Unclassified | 950 |
| 684 | Ga0207687_10811307 | 3300025927 | Bacteria | 798 |
| 685 | Ga0207700_10002537 | 3300025928 | Bacteria | 10476 |
| 686 | Ga0207700_10018690 | 3300025928 | Bacteria | 4664 |
| 687 | Ga0207700_10026707 | 3300025928 | Bacteria | 4030 |
| 688 | Ga0207700_10032615 | 3300025928 | Bacteria | 3718 |
| 689 | Ga0207700_10071362 | 3300025928 | Bacteria | 2674 |
| 690 | Ga0207700_10088412 | 3300025928 | Unclassified | 2439 |
| 691 | Ga0207700_10160927 | 3300025928 | Unclassified | 1864 |
| 692 | Ga0207700_10205554 | 3300025928 | Unclassified | 1662 |
| 693 | Ga0207700_10256785 | 3300025928 | Unclassified | 1495 |
| 694 | Ga0207700_10283863 | 3300025928 | Unclassified | 1425 |
| 695 | Ga0207700_10320670 | 3300025928 | Bacteria | 1343 |
| 696 | Ga0207700_10853734 | 3300025928 | Unclassified | 815 |
| 697 | Ga0207700_10935994 | 3300025928 | Bacteria | 775 |
| 698 | Ga0207700_11139187 | 3300025928 | Bacteria | 697 |
| 699 | Ga0207700_11562900 | 3300025928 | Unclassified | 584 |
| 700 | Ga0207664_10000029 | 3300025929 | Bacteria | 183815 |
| 701 | Ga0207664_10002385 | 3300025929 | Bacteria | 12418 |
| 702 | Ga0207664_10003181 | 3300025929 | Bacteria | 10913 |
| 703 | Ga0207664_10016937 | 3300025929 | Bacteria | 5330 |
| 704 | Ga0207664_10230885 | 3300025929 | Unclassified | 1608 |
| 705 | Ga0207664_10234504 | 3300025929 | Bacteria | 1596 |
| 706 | Ga0207664_10297903 | 3300025929 | Unclassified | 1418 |
| 707 | Ga0207664_10976005 | 3300025929 | Unclassified | 760 |
| 708 | Ga0207664_11155952 | 3300025929 | Unclassified | 691 |
| 709 | Ga0207644_10092905 | 3300025931 | Unclassified | 2252 |
| 710 | Ga0207690_10209851 | 3300025932 | Bacteria | 1484 |
| 711 | Ga0207690_10347206 | 3300025932 | Bacteria | 1172 |
| 712 | Ga0207690_10628851 | 3300025932 | Unclassified | 878 |
| 713 | Ga0207706_10003873 | 3300025933 | Bacteria | 14242 |
| 714 | Ga0207706_10054283 | 3300025933 | Bacteria | 3537 |
| 715 | Ga0207706_10177338 | 3300025933 | Bacteria | 1872 |
| 716 | Ga0207706_11194178 | 3300025933 | Unclassified | 632 |
| 717 | Ga0207686_10091821 | 3300025934 | Unclassified | 2006 |
| 718 | Ga0207686_10230551 | 3300025934 | Bacteria | 1342 |
| 719 | Ga0207686_10803752 | 3300025934 | Unclassified | 754 |
| 720 | Ga0207709_10294215 | 3300025935 | Bacteria | 1205 |
| 721 | Ga0207670_10058263 | 3300025936 | Bacteria | 2623 |
| 722 | Ga0207670_10058885 | 3300025936 | Bacteria | 2611 |
| 723 | Ga0207669_10127289 | 3300025937 | Unclassified | 1743 |
| 724 | Ga0207704_10183235 | 3300025938 | Unclassified | 1515 |
| 725 | Ga0207704_10200841 | 3300025938 | Bacteria | 1459 |
| 726 | Ga0207704_10260870 | 3300025938 | Bacteria | 1306 |
| 727 | Ga0207704_10398409 | 3300025938 | Bacteria | 1085 |
| 728 | Ga0207704_11738384 | 3300025938 | Bacteria | 536 |
| 729 | Ga0207665_10000088 | 3300025939 | Bacteria | 60223 |
| 730 | Ga0207665_10002497 | 3300025939 | Bacteria | 12387 |
| 731 | Ga0207665_10005205 | 3300025939 | Bacteria | 8686 |
| 732 | Ga0207665_10049913 | 3300025939 | Bacteria | 2813 |
| 733 | Ga0207665_10079761 | 3300025939 | Bacteria | 2250 |
| 734 | Ga0207665_10105540 | 3300025939 | Unclassified | 1973 |
| 735 | Ga0207665_10193829 | 3300025939 | Bacteria | 1477 |
| 736 | Ga0207665_10211978 | 3300025939 | Unclassified | 1415 |
| 737 | Ga0207665_10435011 | 3300025939 | Bacteria | 1004 |
| 738 | Ga0207665_10621158 | 3300025939 | Unclassified | 845 |
| 739 | Ga0207665_11653177 | 3300025939 | Unclassified | 507 |
| 740 | Ga0207711_10004841 | 3300025941 | Bacteria | 11440 |
| 741 | Ga0207711_10139019 | 3300025941 | Bacteria | 2184 |
| 742 | Ga0207711_10164855 | 3300025941 | Bacteria | 2008 |
| 743 | Ga0207711_10764224 | 3300025941 | Unclassified | 900 |
| 744 | Ga0207711_11085504 | 3300025941 | Unclassified | 741 |
| 745 | Ga0207689_10020710 | 3300025942 | Bacteria | 5529 |
| 746 | Ga0207689_10045560 | 3300025942 | Bacteria | 3626 |
| 747 | Ga0207689_10520604 | 3300025942 | Bacteria | 997 |
| 748 | Ga0207661_10393953 | 3300025944 | Bacteria | 1255 |
| 749 | Ga0207661_10820073 | 3300025944 | Bacteria | 856 |
| 750 | Ga0207679_10005016 | 3300025945 | Bacteria | 8267 |
| 751 | Ga0207679_10013773 | 3300025945 | Bacteria | 5304 |
| 752 | Ga0207679_10054327 | 3300025945 | Bacteria | 2948 |
| 753 | Ga0207679_10137466 | 3300025945 | Unclassified | 1970 |
| 754 | Ga0207679_10728103 | 3300025945 | Bacteria | 901 |
| 755 | Ga0207667_10000664 | 3300025949 | Bacteria | 44555 |
| 756 | Ga0207667_10006973 | 3300025949 | Bacteria | 13652 |
| 757 | Ga0207667_10007914 | 3300025949 | Bacteria | 12692 |
| 758 | Ga0207667_10057950 | 3300025949 | Bacteria | 4064 |
| 759 | Ga0207667_10657462 | 3300025949 | Bacteria | 1053 |
| 760 | Ga0207667_10971288 | 3300025949 | Bacteria | 838 |
| 761 | Ga0207667_11110667 | 3300025949 | Bacteria | 774 |
| 762 | Ga0207667_12067561 | 3300025949 | Unclassified | 529 |
| 763 | Ga0207651_10124607 | 3300025960 | Bacteria | 1961 |
| 764 | Ga0207651_10272308 | 3300025960 | Bacteria | 1395 |
| 765 | Ga0207712_10064809 | 3300025961 | Unclassified | 2606 |
| 766 | Ga0207668_10009597 | 3300025972 | Bacteria | 5809 |
| 767 | Ga0207640_10018117 | 3300025981 | Bacteria | 4132 |
| 768 | Ga0207640_10044902 | 3300025981 | Bacteria | 2834 |
| 769 | Ga0207640_10050465 | 3300025981 | Bacteria | 2699 |
| 770 | Ga0207640_10353494 | 3300025981 | Unclassified | 1181 |
| 771 | Ga0207640_10718182 | 3300025981 | Bacteria | 858 |
| 772 | Ga0207658_10651298 | 3300025986 | Unclassified | 949 |
| 773 | Ga0207658_10946284 | 3300025986 | Bacteria | 785 |
| 774 | Ga0207677_10003878 | 3300026023 | Bacteria | 7963 |
| 775 | Ga0207677_10047435 | 3300026023 | Bacteria | 2884 |
| 776 | Ga0207677_10075102 | 3300026023 | Bacteria | 2401 |
| 777 | Ga0207677_10110548 | 3300026023 | Bacteria | 2045 |
| 778 | Ga0207677_10618943 | 3300026023 | Bacteria | 952 |
| 779 | Ga0207703_10028984 | 3300026035 | Bacteria | 4368 |
| 780 | Ga0207703_10082089 | 3300026035 | Bacteria | 2689 |
| 781 | Ga0207703_10207933 | 3300026035 | Bacteria | 1743 |
| 782 | Ga0207703_10214132 | 3300026035 | Bacteria | 1719 |
| 783 | Ga0207703_10892042 | 3300026035 | Unclassified | 851 |
| 784 | Ga0207639_11744496 | 3300026041 | Unclassified | 583 |
| 785 | Ga0207678_10003080 | 3300026067 | Bacteria | 15080 |
| 786 | Ga0207678_10096310 | 3300026067 | Bacteria | 2529 |
| 787 | Ga0207702_10000771 | 3300026078 | Bacteria | 33931 |
| 788 | Ga0207702_10004514 | 3300026078 | Bacteria | 12344 |
| 789 | Ga0207702_10008100 | 3300026078 | Bacteria | 8892 |
| 790 | Ga0207702_10058218 | 3300026078 | Bacteria | 3288 |
| 791 | Ga0207702_10081568 | 3300026078 | Bacteria | 2809 |
| 792 | Ga0207702_10104544 | 3300026078 | Bacteria | 2506 |
| 793 | Ga0207702_10189696 | 3300026078 | Bacteria | 1898 |
| 794 | Ga0207702_10214312 | 3300026078 | Unclassified | 1792 |
| 795 | Ga0207702_10254716 | 3300026078 | Unclassified | 1650 |
| 796 | Ga0207702_10597858 | 3300026078 | Unclassified | 1082 |
| 797 | Ga0207702_11619273 | 3300026078 | Unclassified | 641 |
| 798 | Ga0207641_10011809 | 3300026088 | Bacteria | 7168 |
| 799 | Ga0207641_10049874 | 3300026088 | Bacteria | 3539 |
| 800 | Ga0207641_10104634 | 3300026088 | Bacteria | 2499 |
| 801 | Ga0207641_10337474 | 3300026088 | Bacteria | 1433 |
| 802 | Ga0207641_10559263 | 3300026088 | Bacteria | 1116 |
| 803 | Ga0207641_11228870 | 3300026088 | Bacteria | 749 |
| 804 | Ga0207641_11628958 | 3300026088 | Unclassified | 647 |
| 805 | Ga0207648_10008926 | 3300026089 | Bacteria | 9647 |
| 806 | Ga0207648_10044673 | 3300026089 | Bacteria | 3887 |
| 807 | Ga0207648_10278075 | 3300026089 | Unclassified | 1497 |
| 808 | Ga0207676_10000816 | 3300026095 | Bacteria | 24309 |
| 809 | Ga0207676_10006521 | 3300026095 | Bacteria | 8251 |
| 810 | Ga0207676_10113786 | 3300026095 | Bacteria | 2269 |
| 811 | Ga0207674_10000998 | 3300026116 | Bacteria | 36954 |
| 812 | Ga0207674_10046045 | 3300026116 | Bacteria | 4482 |
| 813 | Ga0207674_10054322 | 3300026116 | Bacteria | 4078 |
| 814 | Ga0207674_10114412 | 3300026116 | Bacteria | 2670 |
| 815 | Ga0207674_11087173 | 3300026116 | Unclassified | 769 |
| 816 | Ga0207675_100105743 | 3300026118 | Bacteria | 2653 |
| 817 | Ga0207675_100235878 | 3300026118 | Bacteria | 1766 |
| 818 | Ga0207675_101606715 | 3300026118 | Bacteria | 670 |
| 819 | Ga0207683_10104234 | 3300026121 | Bacteria | 2534 |
| 820 | Ga0207683_11239932 | 3300026121 | Unclassified | 691 |
| 821 | Ga0207698_10014660 | 3300026142 | Bacteria | 5219 |
| 822 | Ga0207698_10088415 | 3300026142 | Bacteria | 2527 |
| 823 | Ga0207698_10428536 | 3300026142 | Bacteria | 1271 |
| 824 | Ga0209179_1082817 | 3300027512 | Unclassified | 708 |
| 825 | Ga0209588_1225606 | 3300027671 | Unclassified | 578 |
| 826 | Ga0265354_1003383 | 3300028016 | Bacteria | 1795 |
| 827 | Ga0268266_10285015 | 3300028379 | Unclassified | 1537 |
| 828 | Ga0268265_10478987 | 3300028380 | Unclassified | 1168 |
| 829 | Ga0268264_10053284 | 3300028381 | Bacteria | 3375 |
| 830 | Ga0268264_10090403 | 3300028381 | Unclassified | 2638 |
| 831 | Ga0268264_10176661 | 3300028381 | Bacteria | 1936 |
| 832 | Ga0265336_10056102 | 3300028666 | Bacteria | 1184 |
| 833 | Ga0265338_10005126 | 3300028800 | Bacteria | 17258 |
| 834 | Ga0265338_10039895 | 3300028800 | Bacteria | 4419 |
| 835 | Ga0265338_10122149 | 3300028800 | Unclassified | 2073 |
| 836 | Ga0265338_10319337 | 3300028800 | Bacteria | 1124 |
| 837 | Ga0265770_1016020 | 3300030878 | Unclassified | 1146 |
| 838 | Ga0265760_10013805 | 3300031090 | Bacteria | 2313 |
| 839 | Ga0265760_10036506 | 3300031090 | Bacteria | 1457 |
| 840 | Ga0265760_10097705 | 3300031090 | Bacteria | 925 |
| 841 | Ga0265760_10201020 | 3300031090 | Unclassified | 673 |
| 842 | Ga0265760_10211452 | 3300031090 | Unclassified | 658 |
| 843 | Ga0265325_10014145 | 3300031241 | Bacteria | 4519 |
| 844 | Ga0265325_10268906 | 3300031241 | Unclassified | 767 |
| 845 | Ga0265329_10214327 | 3300031242 | Unclassified | 636 |
| 846 | Ga0265340_10092103 | 3300031247 | Unclassified | 1416 |
| 847 | Ga0265339_10022515 | 3300031249 | Unclassified | 3653 |
| 848 | Ga0265339_10076549 | 3300031249 | Bacteria | 1774 |
| 849 | Ga0265316_10047734 | 3300031344 | Bacteria | 3385 |
| 850 | Ga0307408_101333695 | 3300031548 | Bacteria | 673 |
| 851 | Ga0265314_10023155 | 3300031711 | Bacteria | 4743 |
| 852 | Ga0265342_10157779 | 3300031712 | Unclassified | 1256 |
| 853 | Ga0307413_10071379 | 3300031824 | Bacteria | 2188 |
| 854 | Ga0307413_11144567 | 3300031824 | Unclassified | 674 |
| 855 | Ga0307410_10064758 | 3300031852 | Bacteria | 2512 |
| 856 | Ga0307406_10510733 | 3300031901 | Unclassified | 976 |
| 857 | Ga0307412_11105581 | 3300031911 | Unclassified | 705 |
| 858 | Ga0307409_100022670 | 3300031995 | Bacteria | 4332 |
| 859 | Ga0307409_100064162 | 3300031995 | Bacteria | 2884 |
| 860 | Ga0307416_100028286 | 3300032002 | Bacteria | 4166 |
| 861 | Ga0307416_100822960 | 3300032002 | Bacteria | 1025 |
| 862 | Ga0307414_10364235 | 3300032004 | Bacteria | 1245 |
| 863 | Ga0307414_11520046 | 3300032004 | Unclassified | 623 |
| 864 | Ga0307411_10046091 | 3300032005 | Bacteria | 2808 |
| 865 | Ga0316053_108912 | 3300032120 | Unclassified | 684 |
| 866 | Ga0307415_100002600 | 3300032126 | Bacteria | 9009 |
| 867 | Ga0307415_100233135 | 3300032126 | Unclassified | 1484 |
| 868 | Ga0373930_0194704 | 3300034816 | Bacteria | 525 |
| 869 | Ga0373950_0071463 | 3300034818 | Unclassified | 712 |
| 870 | Ga0373926_0030216 | 3300035083 | Bacteria | 1907 |
| 871 | Ga0373926_0245967 | 3300035083 | Unclassified | 693 |
| 872 | Ga0373926_0379039 | 3300035083 | Bacteria | 557 |
| 873 | Ga0373926_0410278 | 3300035083 | Unclassified | 535 |
| 874 | Ga0373928_0046502 | 3300035084 | Bacteria | 1013 |
| 875 | Ga0373929_0020901 | 3300035085 | Unclassified | 1323 |
| 876 | Ga0373929_0046361 | 3300035085 | Bacteria | 982 |
| 877 | Ga0373934_0031677 | 3300035086 | Bacteria | 2071 |
| 878 | Ga0373934_0155789 | 3300035086 | Bacteria | 936 |
| 879 | Ga0373934_0302270 | 3300035086 | Unclassified | 664 |
| 880 | Ga0373934_0319664 | 3300035086 | Unclassified | 645 |
| 881 | Ga0373940_0081705 | 3300035088 | Bacteria | 956 |
| 882 | Ga0373923_0021773 | 3300035111 | Bacteria | 2506 |
| 883 | Ga0373923_0047206 | 3300035111 | Unclassified | 1794 |
| 884 | Ga0373923_0129030 | 3300035111 | Unclassified | 1135 |
| 885 | Ga0373923_0183560 | 3300035111 | Bacteria | 962 |
| 886 | Ga0373936_0003376 | 3300035113 | Bacteria | 5982 |
| 887 | Ga0373936_0073367 | 3300035113 | Unclassified | 1414 |
| 888 | Ga0373941_0118655 | 3300035115 | Unclassified | 941 |
| 889 | Ga0373945_0094485 | 3300035116 | Bacteria | 1162 |
| 890 | Ga0373945_0274400 | 3300035116 | Unclassified | 717 |
| 891 | Ga0373945_0466628 | 3300035116 | Unclassified | 560 |
| 892 | Ga0373954_0002328 | 3300035118 | Bacteria | 7926 |
| 893 | Ga0373954_0483546 | 3300035118 | Unclassified | 613 |
| 894 | Ga0373956_0040729 | 3300035119 | Bacteria | 2061 |
| 895 | Ga0373957_0033466 | 3300035120 | Bacteria | 1898 |
| 896 | Ga0373943_0001897 | 3300035170 | Bacteria | 9455 |
| 897 | Ga0373943_0060843 | 3300035170 | Bacteria | 1886 |
| 898 | Ga0373943_0139187 | 3300035170 | Unclassified | 1306 |
| 899 | Ga0373943_0220186 | 3300035170 | Unclassified | 1057 |
| 900 | Ga0373943_0786862 | 3300035170 | Unclassified | 566 |
| 901 | Ga0373946_0108548 | 3300035171 | Bacteria | 1253 |
| 902 | Ga0373946_0705600 | 3300035171 | Unclassified | 528 |
| 903 | Ga0373955_0063550 | 3300035172 | Unclassified | 2044 |
| 904 | Ga0373955_0087828 | 3300035172 | Bacteria | 1768 |
| 905 | Ga0373955_0515051 | 3300035172 | Unclassified | 731 |
| 906 | Ga0373962_0095078 | 3300035242 | Unclassified | 923 |
| 907 | Ga0373924_0066789 | 3300035410 | Bacteria | 1512 |
| 908 | Ga0373931_0007560 | 3300035691 | Bacteria | 5117 |
| 909 | Ga0373931_0016660 | 3300035691 | Bacteria | 3621 |
| 910 | Ga0373931_0038922 | 3300035691 | Unclassified | 2490 |
| 911 | Ga0373931_0233903 | 3300035691 | Bacteria | 1111 |
| 912 | Ga0373931_0348214 | 3300035691 | Bacteria | 927 |
| 913 | Ga0373935_0002433 | 3300035692 | Bacteria | 10647 |
| 914 | Ga0373935_0045817 | 3300035692 | Unclassified | 2760 |
| 915 | Ga0373935_0063080 | 3300035692 | Bacteria | 2375 |
| 916 | Ga0373935_0355271 | 3300035692 | Unclassified | 1045 |
| 917 | Ga0373935_0475961 | 3300035692 | Unclassified | 904 |
| 918 | Ga0373935_0567222 | 3300035692 | Bacteria | 828 |
| 919 | Ga0373935_0678490 | 3300035692 | Bacteria | 757 |
| 920 | Ga0373935_0680105 | 3300035692 | Bacteria | 756 |
| 921 | Ga0373935_0789398 | 3300035692 | Bacteria | 701 |
| 922 | Ga0373927_0000070 | 3300035695 | Bacteria | 73849 |
| 923 | Ga0373927_0006015 | 3300035695 | Bacteria | 8313 |
| 924 | Ga0373927_0080415 | 3300035695 | Bacteria | 2112 |
| 925 | Ga0373927_0122623 | 3300035695 | Unclassified | 1696 |
| 926 | Ga0373927_0302595 | 3300035695 | Unclassified | 1052 |
| 927 | Ga0373927_0397716 | 3300035695 | Unclassified | 909 |
| 928 | Ga0373933_0061152 | 3300035724 | Unclassified | 2272 |
| 929 | Ga0373933_0067104 | 3300035724 | Unclassified | 2176 |
| 930 | Ga0373933_0389811 | 3300035724 | Bacteria | 908 |
| 931 | Ga0373933_0640396 | 3300035724 | Unclassified | 698 |
| 932 | Ga0373933_0671704 | 3300035724 | Unclassified | 681 |
| 933 | Ga0373933_0777378 | 3300035724 | Unclassified | 630 |
| 934 | Ga0373947_0001681 | 3300035725 | Bacteria | 13546 |
| 935 | Ga0373947_0011692 | 3300035725 | Bacteria | 5032 |
| 936 | Ga0373947_0016155 | 3300035725 | Bacteria | 4290 |
| 937 | Ga0373947_1116224 | 3300035725 | Unclassified | 537 |
| 938 | Ga0373937_0008382 | 3300036401 | Bacteria | 8980 |
| 939 | Ga0373937_0014967 | 3300036401 | Bacteria | 6853 |
| 940 | Ga0373937_0090996 | 3300036401 | Bacteria | 2826 |
| 941 | Ga0373937_0127291 | 3300036401 | Bacteria | 2377 |
| 942 | Ga0373937_0340131 | 3300036401 | Bacteria | 1421 |
| 943 | Ga0373937_0379038 | 3300036401 | Unclassified | 1341 |
| 944 | Ga0373937_0502946 | 3300036401 | Bacteria | 1151 |
| 945 | Ga0373937_0703126 | 3300036401 | Unclassified | 957 |
| 946 | Ga0373937_0943365 | 3300036401 | Unclassified | 812 |
| 947 | Ga0373937_1030850 | 3300036401 | Bacteria | 771 |
| 948 | Ga0373937_1048343 | 3300036401 | Unclassified | 764 |
| 949 | Ga0373937_1180095 | 3300036401 | Unclassified | 714 |
| 950 | Ga0373925_0006506 | 3300037068 | Bacteria | 8592 |
| 951 | Ga0373925_0014812 | 3300037068 | Bacteria | 5636 |
| 952 | Ga0373925_0019836 | 3300037068 | Bacteria | 4891 |
| 953 | Ga0373925_0024998 | 3300037068 | Bacteria | 4362 |
| 954 | Ga0373925_0048932 | 3300037068 | Unclassified | 3151 |
| 955 | Ga0373925_0107672 | 3300037068 | Unclassified | 2150 |
| 956 | Ga0373925_0115960 | 3300037068 | Unclassified | 2074 |
| 957 | Ga0373925_0125766 | 3300037068 | Unclassified | 1994 |
| 958 | Ga0373925_0145935 | 3300037068 | Bacteria | 1855 |
| 959 | Ga0373925_0488489 | 3300037068 | Bacteria | 1010 |
| 960 | Ga0373925_0548233 | 3300037068 | Unclassified | 951 |
| 961 | Ga0395900_0565961 | 3300037418 | Unclassified | 1080 |
| 962 | Ga0395905_0028361 | 3300037471 | Bacteria | 5278 |
| 963 | Ga0395905_0083647 | 3300037471 | Unclassified | 2990 |
| 964 | Ga0395905_0125911 | 3300037471 | Bacteria | 2409 |
| 965 | Ga0395905_0234075 | 3300037471 | Bacteria | 1717 |
| 966 | Ga0395905_0423359 | 3300037471 | Unclassified | 1228 |
| 967 | Ga0395905_0678923 | 3300037471 | Bacteria | 932 |
| 968 | Ga0395905_0894943 | 3300037471 | Bacteria | 791 |
| 969 | Ga0395905_0987123 | 3300037471 | Unclassified | 745 |
| 970 | Ga0436364_0629446 | 3300037853 | Bacteria | 1540 |
| 971 | Ga0395901_0332378 | 3300038443 | Unclassified | 1571 |
| 972 | Ga0395901_0364393 | 3300038443 | Unclassified | 1490 |
| 973 | Ga0395901_0470040 | 3300038443 | Unclassified | 1284 |
| 974 | Ga0395901_1758402 | 3300038443 | Bacteria | 570 |
| 975 | Ga0242420_035866 | 3300038996 | Unclassified | 934 |
| 976 | Ga0436365_0253185 | 3300039437 | Bacteria | 1168 |
| 977 | Ga0436365_0264038 | 3300039437 | Bacteria | 2701 |
| 978 | Ga0436365_1208049 | 3300039437 | Unclassified | 2631 |
| 979 | Ga0436363_1517164 | 3300039450 | Bacteria | 7030 |
| 980 | Ga0436363_1684019 | 3300039450 | Bacteria | 3213 |
| 981 | Ga0436362_0353426 | 3300039453 | Unclassified | 596 |
| 982 | Ga0436362_0734081 | 3300039453 | Bacteria | 5482 |
| 983 | Ga0451839_0979686 | 3300041496 | Unclassified | 1319 |
| 984 | Ga0439448_0354283 | 3300042005 | Bacteria | 523 |
| 985 | Ga0451577_0000294 | 3300042876 | Bacteria | 97046 |
| 986 | Ga0451577_0432649 | 3300042876 | Bacteria | 1195 |
| 987 | Ga0453683_0038130 | 3300044673 | Bacteria | 3022 |
| 988 | Ga0453683_0042647 | 3300044673 | Bacteria | 2849 |
| 989 | Ga0466963_0015599 | 3300044694 | Bacteria | 4709 |
| 990 | Ga0466963_0063444 | 3300044694 | Bacteria | 2473 |
| 991 | Ga0466963_0118050 | 3300044694 | Bacteria | 1824 |
| 992 | Ga0466964_0410934 | 3300044706 | Bacteria | 709 |
| 993 | Ga0453684_0000104 | 3300044712 | Bacteria | 365431 |
| 994 | Ga0466968_0179995 | 3300044735 | Unclassified | 983 |
| 995 | Ga0466957_0564482 | 3300044842 | Bacteria | 794 |
| 996 | Ga0466959_0783492 | 3300045049 | Bacteria | 638 |
| 997 | Ga0451576_0009210 | 3300045051 | Bacteria | 11475 |
| 998 | Ga0451576_0178688 | 3300045051 | Bacteria | 2216 |
| 999 | Ga0451576_0218398 | 3300045051 | Bacteria | 1991 |
| 1000 | Ga0451576_0248273 | 3300045051 | Bacteria | 1860 |
| 1001 | Ga0451576_0293041 | 3300045051 | Bacteria | 1701 |
| 1002 | Ga0451576_0582542 | 3300045051 | Bacteria | 1176 |
| 1003 | Ga0466958_0249051 | 3300045836 | Bacteria | 1136 |
| 1004 | Ga0466967_0028364 | 3300045976 | Bacteria | 4672 |
| 1005 | Ga0466967_0030072 | 3300045976 | Bacteria | 4554 |
| 1006 | Ga0466967_0036443 | 3300045976 | Unclassified | 4199 |
| 1007 | Ga0466967_0261178 | 3300045976 | Bacteria | 1657 |
| 1008 | Ga0466967_1071905 | 3300045976 | Bacteria | 803 |
| 1009 | Ga0466967_1363543 | 3300045976 | Unclassified | 706 |
| 1010 | Ga0466967_1588919 | 3300045976 | Bacteria | 651 |
| 1011 | Ga0495590_0056819 | 3300046457 | Bacteria | 1368 |
| 1012 | Ga0495629_0410282 | 3300046459 | Unclassified | 920 |
| 1013 | Ga0495653_0294950 | 3300046463 | Bacteria | 1059 |
| 1014 | Ga0495653_0860247 | 3300046463 | Unclassified | 542 |
| 1015 | Ga0495580_0003656 | 3300046472 | Bacteria | 13031 |
| 1016 | Ga0495580_0004367 | 3300046472 | Bacteria | 11872 |
| 1017 | Ga0495580_0006878 | 3300046472 | Bacteria | 9188 |
| 1018 | Ga0495580_0008035 | 3300046472 | Bacteria | 8425 |
| 1019 | Ga0495580_0009249 | 3300046472 | Bacteria | 7761 |
| 1020 | Ga0495580_0012091 | 3300046472 | Bacteria | 6643 |
| 1021 | Ga0495580_0017649 | 3300046472 | Bacteria | 5331 |
| 1022 | Ga0495580_0021821 | 3300046472 | Bacteria | 4722 |
| 1023 | Ga0495580_0025061 | 3300046472 | Bacteria | 4361 |
| 1024 | Ga0495580_0134706 | 3300046472 | Unclassified | 1713 |
| 1025 | Ga0495580_0154196 | 3300046472 | Bacteria | 1591 |
| 1026 | Ga0495580_0179013 | 3300046472 | Unclassified | 1464 |
| 1027 | Ga0495580_0198202 | 3300046472 | Unclassified | 1384 |
| 1028 | Ga0495580_0257431 | 3300046472 | Bacteria | 1194 |
| 1029 | Ga0495580_0488177 | 3300046472 | Bacteria | 823 |
| 1030 | Ga0495580_0667651 | 3300046472 | Unclassified | 682 |
| 1031 | Ga0495582_0000515 | 3300046473 | Bacteria | 21279 |
| 1032 | Ga0495582_0000834 | 3300046473 | Bacteria | 17017 |
| 1033 | Ga0495582_0857201 | 3300046473 | Bacteria | 525 |
| 1034 | Ga0495639_0761845 | 3300046475 | Bacteria | 501 |
| 1035 | Ga0495662_0095187 | 3300046476 | Bacteria | 1455 |
| 1036 | Ga0495664_0068543 | 3300046477 | Bacteria | 2117 |
| 1037 | Ga0495664_0123787 | 3300046477 | Bacteria | 1564 |
| 1038 | Ga0495664_0154461 | 3300046477 | Bacteria | 1392 |
| 1039 | Ga0495664_0203047 | 3300046477 | Bacteria | 1201 |
| 1040 | Ga0495594_0349477 | 3300046499 | Bacteria | 842 |
| 1041 | Ga0495608_0126212 | 3300046511 | Unclassified | 1639 |
| 1042 | Ga0495618_0505119 | 3300046514 | Unclassified | 728 |
| 1043 | Ga0495628_0197652 | 3300046516 | Bacteria | 1516 |
| 1044 | Ga0495628_0364718 | 3300046516 | Bacteria | 1060 |
| 1045 | Ga0495630_0101142 | 3300046517 | Unclassified | 2181 |
| 1046 | Ga0495630_0434686 | 3300046517 | Bacteria | 1005 |
| 1047 | Ga0495630_0940406 | 3300046517 | Unclassified | 658 |
| 1048 | Ga0495643_0334435 | 3300046522 | Unclassified | 682 |
| 1049 | Ga0495642_0266244 | 3300046528 | Bacteria | 750 |
| 1050 | Ga0495652_0658041 | 3300046529 | Unclassified | 709 |
| 1051 | Ga0495665_0000769 | 3300046531 | Bacteria | 16703 |
| 1052 | Ga0495665_0079435 | 3300046531 | Bacteria | 1726 |
| 1053 | Ga0495665_0092988 | 3300046531 | Unclassified | 1585 |
| 1054 | Ga0495665_0198197 | 3300046531 | Bacteria | 1041 |
| 1055 | Ga0495640_0397057 | 3300046533 | Unclassified | 847 |
| 1056 | Ga0495640_0971292 | 3300046533 | Unclassified | 501 |
| 1057 | Ga0495586_0212507 | 3300046535 | Unclassified | 1098 |
| 1058 | Ga0495586_0254945 | 3300046535 | Bacteria | 1001 |
| 1059 | Ga0495586_0436913 | 3300046535 | Unclassified | 754 |
| 1060 | Ga0495586_0581987 | 3300046535 | Unclassified | 647 |
| 1061 | Ga0495645_0035180 | 3300046543 | Bacteria | 3653 |
| 1062 | Ga0495645_0182762 | 3300046543 | Bacteria | 1435 |
| 1063 | Ga0495622_0411586 | 3300046557 | Bacteria | 582 |
| 1064 | Ga0495634_0127926 | 3300046642 | Unclassified | 1622 |
| 1065 | Ga0495634_0762149 | 3300046642 | Unclassified | 554 |
| 1066 | Ga0495635_0231308 | 3300046663 | Bacteria | 1249 |
| 1067 | Ga0495635_0649679 | 3300046663 | Unclassified | 686 |
| 1068 | Ga0495659_0011349 | 3300046664 | Bacteria | 2871 |
| 1069 | Ga0495659_0086125 | 3300046664 | Bacteria | 1200 |
| 1070 | Ga0495657_0208142 | 3300046675 | Bacteria | 1190 |
| 1071 | Ga0495657_0282042 | 3300046675 | Unclassified | 994 |
| 1072 | Ga0495599_0491643 | 3300046678 | Unclassified | 723 |
| 1073 | Ga0495623_0015636 | 3300046679 | Unclassified | 4906 |
| 1074 | Ga0495623_0151741 | 3300046679 | Bacteria | 1369 |
| 1075 | Ga0495623_0319065 | 3300046679 | Bacteria | 854 |
| 1076 | Ga0495623_0416825 | 3300046679 | Unclassified | 720 |
| 1077 | Ga0495646_0170006 | 3300046680 | Bacteria | 1202 |
| 1078 | Ga0495647_0022962 | 3300046681 | Bacteria | 2258 |
| 1079 | Ga0495658_0024784 | 3300046683 | Bacteria | 3200 |
| 1080 | Ga0495658_0079364 | 3300046683 | Unclassified | 1923 |
| 1081 | Ga0495669_0063429 | 3300046684 | Bacteria | 1676 |
| 1082 | Ga0495669_0081642 | 3300046684 | Bacteria | 1484 |
| 1083 | Ga0495613_0950401 | 3300046689 | Unclassified | 554 |
| 1084 | Ga0495624_0267774 | 3300046690 | Bacteria | 1032 |
| 1085 | Ga0495624_0302779 | 3300046690 | Unclassified | 964 |
| 1086 | Ga0495624_0424902 | 3300046690 | Unclassified | 797 |
| 1087 | Ga0495649_0293334 | 3300046694 | Bacteria | 829 |
| 1088 | Ga0495581_0320205 | 3300047315 | Unclassified | 906 |
| 1089 | Ga0495581_0840897 | 3300047315 | Unclassified | 526 |
| 1090 | Ga0495581_0900772 | 3300047315 | Viruses | 505 |
| 1091 | Ga0495604_0112104 | 3300047317 | Unclassified | 1988 |
| 1092 | Ga0495604_0180536 | 3300047317 | Bacteria | 1477 |
| 1093 | Ga0495636_0321839 | 3300047318 | Bacteria | 726 |
| 1094 | Ga0495674_0007954 | 3300047319 | Bacteria | 10121 |
| 1095 | Ga0495674_0045321 | 3300047319 | Bacteria | 3905 |
| 1096 | Ga0495674_0445378 | 3300047319 | Bacteria | 1041 |
| 1097 | Ga0495674_0638743 | 3300047319 | Unclassified | 840 |
| 1098 | Ga0495675_0052719 | 3300047444 | Bacteria | 2582 |
| 1099 | Ga0495675_0080668 | 3300047444 | Bacteria | 2049 |
| 1100 | Ga0495684_0140079 | 3300047471 | Bacteria | 1814 |
| 1101 | Ga0495593_0082392 | 3300047673 | Bacteria | 1663 |
| 1102 | Ga0495593_0362560 | 3300047673 | Unclassified | 724 |
| 1103 | Ga0495602_0086948 | 3300048088 | Unclassified | 2608 |
| 1104 | Ga0495602_0205520 | 3300048088 | Unclassified | 1499 |
| 1105 | Ga0495602_0417813 | 3300048088 | Bacteria | 953 |
| 1106 | Ga0496100_0024739 | 3300048903 | Unclassified | 3665 |
| 1107 | Ga0496100_0420301 | 3300048903 | Unclassified | 1021 |
| 1108 | Ga0496100_0797369 | 3300048903 | Unclassified | 740 |
| 1109 | Ga0496101_0014467 | 3300048904 | Bacteria | 5304 |
| 1110 | Ga0496101_0038854 | 3300048904 | Bacteria | 3382 |
| 1111 | Ga0496101_0044530 | 3300048904 | Unclassified | 3176 |
| 1112 | Ga0496101_0150170 | 3300048904 | Bacteria | 1782 |
| 1113 | Ga0496102_0001660 | 3300048905 | Bacteria | 19565 |
| 1114 | Ga0496102_0152305 | 3300048905 | Bacteria | 2173 |
| 1115 | Ga0496102_0235734 | 3300048905 | Bacteria | 1725 |
| 1116 | Ga0496102_0299543 | 3300048905 | Bacteria | 1515 |
| 1117 | Ga0496102_0511266 | 3300048905 | Bacteria | 1123 |
| 1118 | Ga0496102_0552341 | 3300048905 | Unclassified | 1074 |
| 1119 | Ga0496102_0727729 | 3300048905 | Bacteria | 915 |
| 1120 | Ga0496102_0881010 | 3300048905 | Unclassified | 817 |
| 1121 | Ga0496103_0011530 | 3300048906 | Bacteria | 5239 |
| 1122 | Ga0496103_0046208 | 3300048906 | Bacteria | 2688 |
| 1123 | Ga0496103_0080138 | 3300048906 | Unclassified | 2053 |
| 1124 | Ga0496103_0091072 | 3300048906 | Bacteria | 1924 |
| 1125 | Ga0496104_0006621 | 3300048907 | Bacteria | 10195 |
| 1126 | Ga0496104_0083550 | 3300048907 | Bacteria | 3045 |
| 1127 | Ga0496104_0160764 | 3300048907 | Unclassified | 2154 |
| 1128 | Ga0496104_0259602 | 3300048907 | Bacteria | 1650 |
| 1129 | Ga0496104_1234971 | 3300048907 | Unclassified | 650 |
| 1130 | Ga0496105_0035009 | 3300048908 | Bacteria | 4132 |
| 1131 | Ga0496105_0059306 | 3300048908 | Bacteria | 3158 |
| 1132 | Ga0496105_0078397 | 3300048908 | Unclassified | 2728 |
| 1133 | Ga0496105_1377113 | 3300048908 | Bacteria | 512 |
| 1134 | Ga0496105_1419642 | 3300048908 | Unclassified | 502 |
| 1135 | Ga0496106_0023432 | 3300048909 | Bacteria | 4586 |
| 1136 | Ga0496106_0041099 | 3300048909 | Archaea | 3465 |
| 1137 | Ga0496106_0102772 | 3300048909 | Bacteria | 2217 |
| 1138 | Ga0496106_0484455 | 3300048909 | Bacteria | 994 |
| 1139 | Ga0496106_0596477 | 3300048909 | Unclassified | 885 |
| 1140 | Ga0496107_0050348 | 3300048910 | Unclassified | 3003 |
| 1141 | Ga0496107_0084614 | 3300048910 | Unclassified | 2314 |
| 1142 | Ga0496107_1285510 | 3300048910 | Unclassified | 524 |
| 1143 | Ga0496108_0110256 | 3300048911 | Unclassified | 2353 |
| 1144 | Ga0496108_1059086 | 3300048911 | Unclassified | 691 |
| 1145 | Ga0496109_0060855 | 3300048912 | Bacteria | 3451 |
| 1146 | Ga0496109_1516764 | 3300048912 | Bacteria | 605 |
| 1147 | Ga0496109_1985844 | 3300048912 | Unclassified | 514 |
| 1148 | Ga0496110_0043246 | 3300048913 | Bacteria | 3933 |
| 1149 | Ga0496110_1211985 | 3300048913 | Bacteria | 664 |
| 1150 | Ga0496111_1037576 | 3300048914 | Unclassified | 586 |
| 1151 | Ga0496112_0000416 | 3300048915 | Bacteria | 28089 |
| 1152 | Ga0496112_0007562 | 3300048915 | Bacteria | 9652 |
| 1153 | Ga0496112_0058151 | 3300048915 | Unclassified | 3808 |
| 1154 | Ga0496112_0147554 | 3300048915 | Bacteria | 2320 |
| 1155 | Ga0496112_0202466 | 3300048915 | Unclassified | 1944 |
| 1156 | Ga0496112_0261437 | 3300048915 | Bacteria | 1680 |
| 1157 | Ga0496112_0266445 | 3300048915 | Bacteria | 1662 |
| 1158 | Ga0496112_0293065 | 3300048915 | Bacteria | 1573 |
| 1159 | Ga0496112_0698454 | 3300048915 | Unclassified | 942 |
| 1160 | Ga0496112_0898543 | 3300048915 | Bacteria | 808 |
| 1161 | Ga0496112_1095191 | 3300048915 | Unclassified | 715 |
| 1162 | Ga0496112_1126510 | 3300048915 | Bacteria | 702 |
| 1163 | Ga0496113_0017141 | 3300048916 | Bacteria | 5021 |
| 1164 | Ga0496113_0191979 | 3300048916 | Bacteria | 1621 |
| 1165 | Ga0496113_0243274 | 3300048916 | Unclassified | 1436 |
| 1166 | Ga0496113_1491062 | 3300048916 | Unclassified | 522 |
| 1167 | Ga0496114_0034517 | 3300048917 | Bacteria | 4174 |
| 1168 | Ga0496115_0027928 | 3300048918 | Bacteria | 4417 |
| 1169 | Ga0496115_0040303 | 3300048918 | Bacteria | 3712 |
| 1170 | Ga0501291_046206 | 3300049514 | Unclassified | 780 |
| 1171 | Ga0501297_004060 | 3300049520 | Unclassified | 1481 |
| 1172 | Ga0501298_083417 | 3300049521 | Unclassified | 706 |
| 1173 | Ga0501302_016746 | 3300049525 | Unclassified | 596 |
| 1174 | Ga0501217_220868 | 3300049661 | Bacteria | 599 |
| 1175 | Ga0501258_011561 | 3300049687 | Unclassified | 947 |
| 1176 | Ga0501083_0332993 | 3300049744 | Bacteria | 987 |
| 1177 | Ga0501263_058476 | 3300049760 | Unclassified | 600 |
| 1178 | Ga0501283_010918 | 3300049779 | Bacteria | 1343 |
| 1179 | nmdc:mga05p37_147380_c2 | 3300050507 | Bacteria | 2222 |
| 1180 | nmdc:mga05p37_1812445_c1 | 3300050507 | Unclassified | 588 |
| 1181 | nmdc:mga0n895_1210889_c1 | 3300050512 | Unclassified | 729 |
| 1182 | nmdc:mga0n895_254385_c1 | 3300050512 | Unclassified | 1782 |
| 1183 | nmdc:mga0n895_36681_c1 | 3300050512 | Bacteria | 4735 |
| 1184 | nmdc:mga0n895_47_c1 | 3300050512 | Bacteria | 73703 |
| 1185 | nmdc:mga0n895_83393_c1 | 3300050512 | Unclassified | 3188 |
| 1186 | nmdc:mga0rr50_1285_c1 | 3300050513 | Bacteria | 13678 |
| 1187 | nmdc:mga0rr50_633737_c1 | 3300050513 | Unclassified | 912 |
| 1188 | nmdc:mga0rr50_935_c1 | 3300050513 | Bacteria | 15786 |
| 1189 | nmdc:mga08x19_1786_c1 | 3300050514 | Bacteria | 13221 |
| 1190 | nmdc:mga08x19_186645_c1 | 3300050514 | Unclassified | 1417 |
| 1191 | nmdc:mga08x19_21944_c1 | 3300050514 | Unclassified | 3948 |
| 1192 | nmdc:mga08x19_37766_c1 | 3300050514 | Bacteria | 3066 |
| 1193 | nmdc:mga08x19_774837_c1 | 3300050514 | Unclassified | 681 |
| 1194 | nmdc:mga08x19_8425_c1 | 3300050514 | Bacteria | 6142 |
| 1195 | nmdc:mga08x19_865461_c1 | 3300050514 | Bacteria | 642 |
| 1196 | nmdc:mga08x19_910282_c1 | 3300050514 | Unclassified | 625 |
| 1197 | nmdc:mga0a205_1652_c1 | 3300050515 | Bacteria | 19181 |
| 1198 | nmdc:mga0a205_666311_c1 | 3300050515 | Unclassified | 596 |
| 1199 | Ga0495601_0129516 | 3300053077 | Bacteria | 1643 |
| 1200 | Ga0495612_0103311 | 3300053078 | Unclassified | 1215 |
| 1201 | Ga0495612_0117576 | 3300053078 | Unclassified | 1142 |
| 1202 | Ga0495612_0246128 | 3300053078 | Bacteria | 795 |
| 1203 | Ga0495595_0480859 | 3300053084 | Unclassified | 632 |
| 1204 | Ga0495619_0055971 | 3300053085 | Bacteria | 2614 |
| 1205 | Ga0587093_011388 | 3300059478 | Bacteria | 1063 |
| 1206 | Ga0587066_061687 | 3300059490 | Bacteria | 767 |
| 1207 | Ga0587066_097348 | 3300059490 | Unclassified | 663 |
| 1208 | Ga0587070_071344 | 3300059491 | Bacteria | 742 |
| 1209 | Ga0587070_137214 | 3300059491 | Bacteria | 601 |
| 1210 | Ga0587070_211589 | 3300059491 | Unclassified | 521 |
| 1211 | Ga0587073_0090466 | 3300059492 | Bacteria | 777 |
| 1212 | Ga0587073_0308533 | 3300059492 | Unclassified | 518 |
| 1213 | Ga0587080_072503 | 3300059503 | Bacteria | 692 |
| 1214 | Ga0587083_0112775 | 3300059505 | Bacteria | 693 |
| 1215 | Ga0587083_0206561 | 3300059505 | Unclassified | 564 |
| 1216 | Ga0587086_081006 | 3300059507 | Bacteria | 572 |
| 1217 | Ga0587088_106060 | 3300059508 | Bacteria | 633 |
| 1218 | Ga0587088_177834 | 3300059508 | Bacteria | 531 |
| 1219 | Ga0587089_039513 | 3300059509 | Bacteria | 726 |
| 1220 | Ga0587089_087386 | 3300059509 | Bacteria | 550 |
| 1221 | Ga0587091_033068 | 3300059511 | Bacteria | 981 |
| 1222 | Ga0587092_058961 | 3300059512 | Bacteria | 714 |
| 1223 | Ga0587092_087778 | 3300059512 | Bacteria | 624 |
| 1224 | Ga0587106_079402 | 3300059605 | Unclassified | 637 |
| 1225 | Ga0587115_052603 | 3300059626 | Bacteria | 665 |
| 1226 | Ga0587117_022850 | 3300059627 | Bacteria | 887 |
| 1227 | Ga0587128_031337 | 3300059630 | Unclassified | 882 |
| 1228 | Ga0587062_037121 | 3300059639 | Bacteria | 774 |
| 1229 | Ga0587067_103399 | 3300059640 | Bacteria | 662 |
| 1230 | Ga0587069_019601 | 3300059642 | Bacteria | 1001 |
| 1231 | Ga0587075_034410 | 3300059644 | Unclassified | 822 |
| 1232 | Ga0587075_053210 | 3300059644 | Unclassified | 712 |
| 1233 | Ga0587076_082469 | 3300059645 | Bacteria | 688 |
| 1234 | Ga0587079_041380 | 3300059647 | Bacteria | 932 |
| 1235 | Ga0587079_080678 | 3300059647 | Bacteria | 744 |
| 1236 | Ga0587110_035851 | 3300059654 | Unclassified | 622 |
| 1237 | Ga0587060_021141 | 3300060243 | Bacteria | 621 |
| 1238 | Ga0587071_032119 | 3300060344 | Bacteria | 1016 |
| 1239 | Ga0587071_176522 | |||
| 1240 | LJNas_1000310 | |||
| 1241 | Ga0058862_12711097 | |||
| 1242 | Ga0065715_10010352 | |||
| 1243 | Ga0065715_11112907 | |||
| 1244 | Ga0070658_10073182 | |||
| 1245 | Ga0070676_10531894 | |||
| 1246 | Ga0070676_10626270 | |||
| 1247 | Ga0070683_100088414 | |||
| 1248 | Ga0070683_100358095 | |||
| 1249 | Ga0070683_100395472 | |||
| 1250 | Ga0070683_100499807 | |||
| 1251 | Ga0070683_100670637 | |||
| 1252 | Ga0070683_101588934 | |||
| 1253 | Ga0070683_102163289 | |||
| 1254 | Ga0070670_100011513 | |||
| 1255 | Ga0070670_100136415 | |||
| 1256 | Ga0070670_100630290 | |||
| 1257 | Ga0068869_100015088 | |||
| 1258 | Ga0068869_100035967 | |||
| 1259 | Ga0068869_100646857 | |||
| 1260 | Ga0070666_10170669 | |||
| 1261 | Ga0070666_10222524 | |||
| 1262 | Ga0070666_10291617 | |||
| 1263 | Ga0070666_10512178 | |||
| 1264 | Ga0070680_100088831 | |||
| 1265 | Ga0070680_100213176 | |||
| 1266 | Ga0070680_100279750 | |||
| 1267 | Ga0070680_100757116 | |||
| 1268 | Ga0070680_100886235 | |||
| 1269 | Ga0070682_100041777 | |||
| 1270 | Ga0070682_100930960 | |||
| 1271 | Ga0068868_100001354 | |||
| 1272 | Ga0068868_100006887 | |||
| 1273 | Ga0068868_100022322 | |||
| 1274 | Ga0068868_100081667 | |||
| 1275 | Ga0068868_100096506 | |||
| 1276 | Ga0068868_100225742 | |||
| 1277 | Ga0070660_100016337 | |||
| 1278 | Ga0070689_100041444 | |||
| 1279 | Ga0070689_100153738 | |||
| 1280 | Ga0070691_10225582 | |||
| 1281 | Ga0070691_10551439 | |||
| 1282 | Ga0070687_100036507 | |||
| 1283 | Ga0070661_100123139 | |||
| 1284 | Ga0070661_100128455 | |||
| 1285 | Ga0070661_100442807 | |||
| 1286 | Ga0070661_101949487 | |||
| 1287 | Ga0070668_100200689 | |||
| 1288 | Ga0070669_100071693 | |||
| 1289 | Ga0070669_100873618 | |||
| 1290 | Ga0070675_100237366 | |||
| 1291 | Ga0070671_100312420 | |||
| 1292 | Ga0070674_100238546 | |||
| 1293 | Ga0070674_100718364 | |||
| 1294 | Ga0070673_100072247 | |||
| 1295 | Ga0070688_100876914 | |||
| 1296 | Ga0070659_100018797 | |||
| 1297 | Ga0070659_100062532 | |||
| 1298 | Ga0070659_100401533 | |||
| 1299 | Ga0070659_102046803 | |||
| 1300 | Ga0070667_100380862 | |||
| 1301 | Ga0070667_100503949 | |||
| 1302 | Ga0070709_10009444 | |||
| 1303 | Ga0070709_10038448 | |||
| 1304 | Ga0070709_10053950 | |||
| 1305 | Ga0070709_10101779 | |||
| 1306 | Ga0070709_10109346 | |||
| 1307 | Ga0070709_10121244 | |||
| 1308 | Ga0070709_10223534 | |||
| 1309 | Ga0070709_10294419 | |||
| 1310 | Ga0070709_10764660 | |||
| 1311 | Ga0070709_10803849 | |||
| 1312 | Ga0070714_100000040 | |||
| 1313 | Ga0070714_100006319 | |||
| 1314 | Ga0070714_100007393 | |||
| 1315 | Ga0070714_100009776 | |||
| 1316 | Ga0070714_100318628 | |||
| 1317 | Ga0070714_100403887 | |||
| 1318 | Ga0070714_100557105 | |||
| 1319 | Ga0070714_100678805 | |||
| 1320 | Ga0070714_101412334 | |||
| 1321 | Ga0070714_101447092 | |||
| 1322 | Ga0070713_100000302 | |||
| 1323 | Ga0070713_100034144 | |||
| 1324 | Ga0070713_100065351 | |||
| 1325 | Ga0070713_100068959 | |||
| 1326 | Ga0070713_100190215 | |||
| 1327 | Ga0070713_100217087 | |||
| 1328 | Ga0070713_100232115 | |||
| 1329 | Ga0070713_100269201 | |||
| 1330 | Ga0070713_100313698 | |||
| 1331 | Ga0070713_100349914 | |||
| 1332 | Ga0070713_100425284 | |||
| 1333 | Ga0070713_100695116 | |||
| 1334 | Ga0070713_100736488 | |||
| 1335 | Ga0070713_100805039 | |||
| 1336 | Ga0070713_100812550 | |||
| 1337 | Ga0070713_101570694 | |||
| 1338 | Ga0070713_101783824 | |||
| 1339 | Ga0070710_10003267 | |||
| 1340 | Ga0070710_10021693 | |||
| 1341 | Ga0070710_10024132 | |||
| 1342 | Ga0070710_10032022 | |||
| 1343 | Ga0070710_10201898 | |||
| 1344 | Ga0070710_10220004 | |||
| 1345 | Ga0070710_10352339 | |||
| 1346 | Ga0070701_10532247 | |||
| 1347 | Ga0070711_100000549 | |||
| 1348 | Ga0070711_100000903 | |||
| 1349 | Ga0070711_100005691 | |||
| 1350 | Ga0070711_100043050 | |||
| 1351 | Ga0070711_100119098 | |||
| 1352 | Ga0070711_100125793 | |||
| 1353 | Ga0070711_100132347 | |||
| 1354 | Ga0070711_100189961 | |||
| 1355 | Ga0070711_100458328 | |||
| 1356 | Ga0070711_100559674 | |||
| 1357 | Ga0070711_100582797 | |||
| 1358 | Ga0070711_101786778 | |||
| 1359 | Ga0070708_100000920 | |||
| 1360 | Ga0070708_100004665 | |||
| 1361 | Ga0070708_100005861 | |||
| 1362 | Ga0070708_100008905 | |||
| 1363 | Ga0070708_100013098 | |||
| 1364 | Ga0070708_100026864 | |||
| 1365 | Ga0070708_100049935 | |||
| 1366 | Ga0070708_100151217 | |||
| 1367 | Ga0070708_100166629 | |||
| 1368 | Ga0070708_100196726 | |||
| 1369 | Ga0070708_100987516 | |||
| 1370 | Ga0070708_101212755 | |||
| 1371 | Ga0070708_101259776 | |||
| 1372 | Ga0070708_101737638 | |||
| 1373 | Ga0070663_100255075 | |||
| 1374 | Ga0070678_100408896 | |||
| 1375 | Ga0070678_100693520 | |||
| 1376 | Ga0070678_101700841 | |||
| 1377 | Ga0070662_100011735 | |||
| 1378 | Ga0070662_100066738 | |||
| 1379 | Ga0070662_100939018 | |||
| 1380 | Ga0070662_101072476 | |||
| 1381 | Ga0070681_10000070 | |||
| 1382 | Ga0070681_10062741 | |||
| 1383 | Ga0070681_10114716 | |||
| 1384 | Ga0070681_10298045 | |||
| 1385 | Ga0070681_10368092 | |||
| 1386 | Ga0070681_11376430 | |||
| 1387 | Ga0068867_100009658 | |||
| 1388 | Ga0068867_100217136 | |||
| 1389 | Ga0068867_101064717 | |||
| 1390 | Ga0068867_101537578 | |||
| 1391 | Ga0070685_10273989 | |||
| 1392 | Ga0070685_10291040 | |||
| 1393 | Ga0070706_100000472 | |||
| 1394 | Ga0070706_100004575 | |||
| 1395 | Ga0070706_100013246 | |||
| 1396 | Ga0070706_100045502 | |||
| 1397 | Ga0070706_100136575 | |||
| 1398 | Ga0070706_100285891 | |||
| 1399 | Ga0070706_100407949 | |||
| 1400 | Ga0070706_100434977 | |||
| 1401 | Ga0070707_100000270 | |||
| 1402 | Ga0070707_100012494 | |||
| 1403 | Ga0070707_100029580 | |||
| 1404 | Ga0070707_100141925 | |||
| 1405 | Ga0070707_100396977 | |||
| 1406 | Ga0070707_100421745 | |||
| 1407 | Ga0070707_100528072 | |||
| 1408 | Ga0070707_100812614 | |||
| 1409 | Ga0070707_101097954 | |||
| 1410 | Ga0070707_101343430 | |||
| 1411 | Ga0070707_101425450 | |||
| 1412 | Ga0070698_100000336 | |||
| 1413 | Ga0070698_100011858 | |||
| 1414 | Ga0070698_100148712 | |||
| 1415 | Ga0070698_100547237 | |||
| 1416 | Ga0070698_100726536 | |||
| 1417 | Ga0070698_100747791 | |||
| 1418 | Ga0070699_100000579 | |||
| 1419 | Ga0070699_100019389 | |||
| 1420 | Ga0070699_100046777 | |||
| 1421 | Ga0070699_100076363 | |||
| 1422 | Ga0070699_100190241 | |||
| 1423 | Ga0070699_100238983 | |||
| 1424 | Ga0070699_100523165 | |||
| 1425 | Ga0070699_101267387 | |||
| 1426 | Ga0070679_100027510 | |||
| 1427 | Ga0070679_100046228 | |||
| 1428 | Ga0070679_100184424 | |||
| 1429 | Ga0070679_100193523 | |||
| 1430 | Ga0070679_100300412 | |||
| 1431 | Ga0070684_100031997 | |||
| 1432 | Ga0070684_100111030 | |||
| 1433 | Ga0070684_100211468 | |||
| 1434 | Ga0070684_100213470 | |||
| 1435 | Ga0070684_100309027 | |||
| 1436 | Ga0070684_100557295 | |||
| 1437 | Ga0070697_100000017 | |||
| 1438 | Ga0070697_100000827 | |||
| 1439 | Ga0070697_100006743 | |||
| 1440 | Ga0070697_100011320 | |||
| 1441 | Ga0070697_100017160 | |||
| 1442 | Ga0070697_100147819 | |||
| 1443 | Ga0070697_100525916 | |||
| 1444 | Ga0070697_100733687 | |||
| 1445 | Ga0070697_101430477 | |||
| 1446 | Ga0068853_100073438 | |||
| 1447 | Ga0068853_100264108 | |||
| 1448 | Ga0070672_101035161 | |||
| 1449 | Ga0070672_101408953 | |||
| 1450 | Ga0070686_100157519 | |||
| 1451 | Ga0070686_100203529 | |||
| 1452 | Ga0070686_100463180 | |||
| 1453 | Ga0070695_100133438 | |||
| 1454 | Ga0070695_100368591 | |||
| 1455 | Ga0070695_100609247 | |||
| 1456 | Ga0070695_101282804 | |||
| 1457 | Ga0070696_100006097 | |||
| 1458 | Ga0070696_100056636 | |||
| 1459 | Ga0070696_100699948 | |||
| 1460 | Ga0070696_101874982 | |||
| 1461 | Ga0070693_100028654 | |||
| 1462 | Ga0070693_100159719 | |||
| 1463 | Ga0070693_100190046 | |||
| 1464 | Ga0070693_100757866 | |||
| 1465 | Ga0070693_100851750 | |||
| 1466 | Ga0070665_100061903 | |||
| 1467 | Ga0070665_100275088 | |||
| 1468 | Ga0068855_100000492 | |||
| 1469 | Ga0068855_100004432 | |||
| 1470 | Ga0068855_100005794 | |||
| 1471 | Ga0068855_100092224 | |||
| 1472 | Ga0068855_100675230 | |||
| 1473 | Ga0068855_101506433 | |||
| 1474 | Ga0068855_101800997 | |||
| 1475 | Ga0068855_102193222 | |||
| 1476 | Ga0070664_100000862 | |||
| 1477 | Ga0070664_100060831 | |||
| 1478 | Ga0070664_100079874 | |||
| 1479 | Ga0070664_100111678 | |||
| 1480 | Ga0070664_100869612 | |||
| 1481 | Ga0068857_100006961 | |||
| 1482 | Ga0068857_100085853 | |||
| 1483 | Ga0068857_100101302 | |||
| 1484 | Ga0068857_100428431 | |||
| 1485 | Ga0068854_100003250 | |||
| 1486 | Ga0068854_100004359 | |||
| 1487 | Ga0068854_100040833 | |||
| 1488 | Ga0068854_100158689 | |||
| 1489 | Ga0068854_101211807 | |||
| 1490 | Ga0068856_100000114 | |||
| 1491 | Ga0068856_100000693 | |||
| 1492 | Ga0068856_100005568 | |||
| 1493 | Ga0068856_100010824 | |||
| 1494 | Ga0068856_100011573 | |||
| 1495 | Ga0068856_100065703 | |||
| 1496 | Ga0068856_100208021 | |||
| 1497 | Ga0068856_100219338 | |||
| 1498 | Ga0068856_100238480 | |||
| 1499 | Ga0068856_100620974 | |||
| 1500 | Ga0068856_101948067 | |||
| 1501 | Ga0068856_102106689 | |||
| 1502 | Ga0068856_102116281 | |||
| 1503 | Ga0070702_100431122 | |||
| 1504 | Ga0068852_100101107 | |||
| 1505 | Ga0068852_100130996 | |||
| 1506 | Ga0068852_100277740 | |||
| 1507 | Ga0068852_100969053 | |||
| 1508 | Ga0068859_100000657 | |||
| 1509 | Ga0068859_100007007 | |||
| 1510 | Ga0068859_100398093 | |||
| 1511 | Ga0068864_100001871 | |||
| 1512 | Ga0068864_100043099 | |||
| 1513 | Ga0068864_100084201 | |||
| 1514 | Ga0068866_10027522 | |||
| 1515 | Ga0068866_10076804 | |||
| 1516 | Ga0068866_10106878 | |||
| 1517 | Ga0068866_10731623 | |||
| 1518 | Ga0068861_100118273 | |||
| 1519 | Ga0068861_100219595 | |||
| 1520 | Ga0068861_101529936 | |||
| 1521 | Ga0068861_101800829 | |||
| 1522 | Ga0068851_10013620 | |||
| 1523 | Ga0068851_10021584 | |||
| 1524 | Ga0068851_10148156 | |||
| 1525 | Ga0068851_10423855 | |||
| 1526 | Ga0068870_10324989 | |||
| 1527 | Ga0068863_100063381 | |||
| 1528 | Ga0068863_100102242 | |||
| 1529 | Ga0068863_100282919 | |||
| 1530 | Ga0068863_100431304 | |||
| 1531 | Ga0068863_101221775 | |||
| 1532 | Ga0068863_101419547 | |||
| 1533 | Ga0068863_101440995 | |||
| 1534 | Ga0068863_101967770 | |||
| 1535 | Ga0068863_102423833 | |||
| 1536 | Ga0068858_100005644 | |||
| 1537 | Ga0068858_100039760 | |||
| 1538 | Ga0068858_100044039 | |||
| 1539 | Ga0068858_100210161 | |||
| 1540 | Ga0068858_100329829 | |||
| 1541 | Ga0068858_100445441 | |||
| 1542 | Ga0068860_100038215 | |||
| 1543 | Ga0068860_100097154 | |||
| 1544 | Ga0068860_101940302 | |||
| 1545 | Ga0068862_100044378 | |||
| 1546 | Ga0070717_10002921 | |||
| 1547 | Ga0070717_10006862 | |||
| 1548 | Ga0070717_10008345 | |||
| 1549 | Ga0070717_10008866 | |||
| 1550 | Ga0070717_10010635 | |||
| 1551 | Ga0070717_10013761 | |||
| 1552 | Ga0070717_10024769 | |||
| 1553 | Ga0070717_10034165 | |||
| 1554 | Ga0070717_10045101 | |||
| 1555 | Ga0070717_10073244 | |||
| 1556 | Ga0070717_10094766 | |||
| 1557 | Ga0070717_10146155 | |||
| 1558 | Ga0070717_10321089 | |||
| 1559 | Ga0070717_10396529 | |||
| 1560 | Ga0070717_10557803 | |||
| 1561 | Ga0070717_10930472 | |||
| 1562 | Ga0070717_11095402 | |||
| 1563 | Ga0070717_11633731 | |||
| 1564 | Ga0070717_12134355 | |||
| 1565 | Ga0070715_10033303 | |||
| 1566 | Ga0070715_10043901 | |||
| 1567 | Ga0070715_10148350 | |||
| 1568 | Ga0070715_10767031 | |||
| 1569 | Ga0070716_100000092 | |||
| 1570 | Ga0070716_100001536 | |||
| 1571 | Ga0070716_100006363 | |||
| 1572 | Ga0070716_100021384 | |||
| 1573 | Ga0070716_100048892 | |||
| 1574 | Ga0070716_100142544 | |||
| 1575 | Ga0070716_100634371 | |||
| 1576 | Ga0070716_100635230 | |||
| 1577 | Ga0070716_100770035 | |||
| 1578 | Ga0070716_101359244 | |||
| 1579 | Ga0070716_101755969 | |||
| 1580 | Ga0070712_100000273 | |||
| 1581 | Ga0070712_100001148 | |||
| 1582 | Ga0070712_100044003 | |||
| 1583 | Ga0070712_100050284 | |||
| 1584 | Ga0070712_100065839 | |||
| 1585 | Ga0070712_100135644 | |||
| 1586 | Ga0070712_100182475 | |||
| 1587 | Ga0070712_100189625 | |||
| 1588 | Ga0070712_100207341 | |||
| 1589 | Ga0070712_100324752 | |||
| 1590 | Ga0070712_101019947 | |||
| 1591 | Ga0070712_101667280 | |||
| 1592 | Ga0097621_100000454 | |||
| 1593 | Ga0097621_100000912 | |||
| 1594 | Ga0097621_100008230 | |||
| 1595 | Ga0097621_100036892 | |||
| 1596 | Ga0097621_100041946 | |||
| 1597 | Ga0097621_100128500 | |||
| 1598 | Ga0097621_100151643 | |||
| 1599 | Ga0097621_100315068 | |||
| 1600 | Ga0097621_100947790 | |||
| 1601 | Ga0097621_100998742 | |||
| 1602 | Ga0068871_100000262 | |||
| 1603 | Ga0068871_100000689 | |||
| 1604 | Ga0068871_100010069 | |||
| 1605 | Ga0068871_100060620 | |||
| 1606 | Ga0068871_100203599 | |||
| 1607 | Ga0068871_100218126 | |||
| 1608 | Ga0068871_100278584 | |||
| 1609 | Ga0068871_100289763 | |||
| 1610 | Ga0068871_100371633 | |||
| 1611 | Ga0068871_100838043 | |||
| 1612 | Ga0068871_101046780 | |||
| 1613 | Ga0068871_101327039 | |||
| 1614 | Ga0068871_101800241 | |||
| 1615 | Ga0075434_100000654 | |||
| 1616 | Ga0075434_100082356 | |||
| 1617 | Ga0075434_100085518 | |||
| 1618 | Ga0075434_100722701 | |||
| 1619 | Ga0068865_100016416 | |||
| 1620 | Ga0068865_100246993 | |||
| 1621 | Ga0068865_100281216 | |||
| 1622 | Ga0068865_100674401 | |||
| 1623 | Ga0068865_101053013 | |||
| 1624 | Ga0075436_100000809 | |||
| 1625 | Ga0075436_100027070 | |||
| 1626 | Ga0075436_100066582 | |||
| 1627 | Ga0075436_100215996 | |||
| 1628 | Ga0097620_100000657 | |||
| 1629 | Ga0097620_100007007 | |||
| 1630 | Ga0097620_100398080 | |||
| 1631 | Ga0075435_100000231 | |||
| 1632 | Ga0075435_100002901 | |||
| 1633 | Ga0075435_100164226 | |||
| 1634 | Ga0075435_100622033 | |||
| 1635 | Ga0075435_101098968 | |||
| 1636 | Ga0099794_10380753 | |||
| 1637 | Ga0099795_10036590 | |||
| 1638 | Ga0099795_10202484 | |||
| 1639 | Ga0105250_10032276 | |||
| 1640 | Ga0105240_10062373 | |||
| 1641 | Ga0105240_10110102 | |||
| 1642 | Ga0105240_10117779 | |||
| 1643 | Ga0105240_10204205 | |||
| 1644 | Ga0105240_10401783 | |||
| 1645 | Ga0105240_10668931 | |||
| 1646 | Ga0105240_11554318 | |||
| 1647 | Ga0105240_12346328 | |||
| 1648 | Ga0105245_10000435 | |||
| 1649 | Ga0105245_10079432 | |||
| 1650 | Ga0105245_10216732 | |||
| 1651 | Ga0105245_10934663 | |||
| 1652 | Ga0105247_10011644 | |||
| 1653 | Ga0105247_10031638 | |||
| 1654 | Ga0105247_10280750 | |||
| 1655 | Ga0105247_10836176 | |||
| 1656 | Ga0114129_10271029 | |||
| 1657 | Ga0114129_11490867 | |||
| 1658 | Ga0105243_10355811 | |||
| 1659 | Ga0105241_10027902 | |||
| 1660 | Ga0105241_10083427 | |||
| 1661 | Ga0105241_10124304 | |||
| 1662 | Ga0105241_10134890 | |||
| 1663 | Ga0105241_10135042 | |||
| 1664 | Ga0105241_10155093 | |||
| 1665 | Ga0105241_10288076 | |||
| 1666 | Ga0105241_10641021 | |||
| 1667 | Ga0105241_10783091 | |||
| 1668 | Ga0105241_10992723 | |||
| 1669 | Ga0105242_10018808 | |||
| 1670 | Ga0105242_10092452 | |||
| 1671 | Ga0105242_10408364 | |||
| 1672 | Ga0105248_10013447 | |||
| 1673 | Ga0105248_10036290 | |||
| 1674 | Ga0105248_10076358 | |||
| 1675 | Ga0105248_13250575 | |||
| 1676 | Ga0105237_10024086 | |||
| 1677 | Ga0105237_10071399 | |||
| 1678 | Ga0105237_10200887 | |||
| 1679 | Ga0105237_10380096 | |||
| 1680 | Ga0105237_10526824 | |||
| 1681 | Ga0105237_10738573 | |||
| 1682 | Ga0105237_10871935 | |||
| 1683 | Ga0105238_10003235 | |||
| 1684 | Ga0105238_10028319 | |||
| 1685 | Ga0105238_10149058 | |||
| 1686 | Ga0105238_10410837 | |||
| 1687 | Ga0105238_10778789 | |||
| 1688 | Ga0105249_10017700 | |||
| 1689 | Ga0105249_11482585 | |||
| 1690 | Ga0099796_10042229 | |||
| 1691 | Ga0099796_10290270 | |||
| 1692 | Ga0105239_10014341 | |||
| 1693 | Ga0105239_10095211 | |||
| 1694 | Ga0105239_10276770 | |||
| 1695 | Ga0105239_10609523 | |||
| 1696 | Ga0105239_10959651 | |||
| 1697 | Ga0105239_11801808 | |||
| 1698 | Ga0105239_12884188 | |||
| 1699 | Ga0105239_13238786 | |||
| 1700 | Ga0105246_10185134 | |||
| 1701 | Ga0105246_11796462 | |||
| 1702 | Ga0157373_10002689 | |||
| 1703 | Ga0157373_10083838 | |||
| 1704 | Ga0157373_10118343 | |||
| 1705 | Ga0157373_10255496 | |||
| 1706 | Ga0157373_10406457 | |||
| 1707 | Ga0157373_10755771 | |||
| 1708 | Ga0157373_11271866 | |||
| 1709 | Ga0157371_10009228 | |||
| 1710 | Ga0157371_10027534 | |||
| 1711 | Ga0157371_10172653 | |||
| 1712 | Ga0157370_10041301 | |||
| 1713 | Ga0157370_10333694 | |||
| 1714 | Ga0157370_10760049 | |||
| 1715 | Ga0157369_10000487 | |||
| 1716 | Ga0157369_10025043 | |||
| 1717 | Ga0157369_10041153 | |||
| 1718 | Ga0157369_10042625 | |||
| 1719 | Ga0157369_10062526 | |||
| 1720 | Ga0157369_10079189 | |||
| 1721 | Ga0157369_10208223 | |||
| 1722 | Ga0157369_10290250 | |||
| 1723 | Ga0157369_10512119 | |||
| 1724 | Ga0157369_10919460 | |||
| 1725 | Ga0157374_10000243 | |||
| 1726 | Ga0157374_10000751 | |||
| 1727 | Ga0157374_10057111 | |||
| 1728 | Ga0157374_10123731 | |||
| 1729 | Ga0157374_10139405 | |||
| 1730 | Ga0157374_10306864 | |||
| 1731 | Ga0157374_10331705 | |||
| 1732 | Ga0157374_10583985 | |||
| 1733 | Ga0157374_10760931 | |||
| 1734 | Ga0157374_10856485 | |||
| 1735 | Ga0157374_10860148 | |||
| 1736 | Ga0157378_10000183 | |||
| 1737 | Ga0157378_10000201 | |||
| 1738 | Ga0157378_10000288 | |||
| 1739 | Ga0157378_10002198 | |||
| 1740 | Ga0157378_10014399 | |||
| 1741 | Ga0157378_10033557 | |||
| 1742 | Ga0157378_10210324 | |||
| 1743 | Ga0157378_10817031 | |||
| 1744 | Ga0157378_10999856 | |||
| 1745 | Ga0157378_11755096 | |||
| 1746 | Ga0163162_10003496 | |||
| 1747 | Ga0163162_10049078 | |||
| 1748 | Ga0163162_10098209 | |||
| 1749 | Ga0157372_10000234 | |||
| 1750 | Ga0157372_10000558 | |||
| 1751 | Ga0157372_10001354 | |||
| 1752 | Ga0157372_10001584 | |||
| 1753 | Ga0157372_10003500 | |||
| 1754 | Ga0157372_10056481 | |||
| 1755 | Ga0157372_10072958 | |||
| 1756 | Ga0157372_10080541 | |||
| 1757 | Ga0157372_10221558 | |||
| 1758 | Ga0157372_10223841 | |||
| 1759 | Ga0157372_10605264 | |||
| 1760 | Ga0157372_10741718 | |||
| 1761 | Ga0157372_10925656 | |||
| 1762 | Ga0157372_11511443 | |||
| 1763 | Ga0157372_11967349 | |||
| 1764 | Ga0157375_10008727 | |||
| 1765 | Ga0157375_10031893 | |||
| 1766 | Ga0163163_10241139 | |||
| 1767 | Ga0163163_10311263 | |||
| 1768 | Ga0163163_10599299 | |||
| 1769 | Ga0163163_12788505 | |||
| 1770 | Ga0182008_10042616 | |||
| 1771 | Ga0182008_10595811 | |||
| 1772 | Ga0157379_10037014 | |||
| 1773 | Ga0157379_10043289 | |||
| 1774 | Ga0157379_10108897 | |||
| 1775 | Ga0157379_10449288 | |||
| 1776 | Ga0157379_12547628 | |||
| 1777 | Ga0157376_10000884 | |||
| 1778 | Ga0157376_10013897 | |||
| 1779 | Ga0157376_10070444 | |||
| 1780 | Ga0157376_10081007 | |||
| 1781 | Ga0157376_10406923 | |||
| 1782 | Ga0182007_10002598 | |||
| 1783 | Ga0182005_1010452 | |||
| 1784 | Ga0206356_11763600 | |||
| 1785 | Ga0206352_10528900 | |||
| 1786 | Ga0206352_11322468 | |||
| 1787 | Ga0206350_11263534 | |||
| 1788 | Ga0213876_10183762 | |||
| 1789 | Ga0213876_10382871 | |||
| 1790 | Ga0213875_10275513 | |||
| 1791 | Ga0224712_10299917 | |||
| 1792 | Ga0224572_1000057 | |||
| 1793 | Ga0224572_1005496 | |||
| 1794 | Ga0228598_1000532 | |||
| 1795 | Ga0228598_1002633 | |||
| 1796 | Ga0207697_10327333 | |||
| 1797 | Ga0207656_10207527 | |||
| 1798 | Ga0207656_10696222 | |||
| 1799 | Ga0207692_10024362 | |||
| 1800 | Ga0207692_10030742 | |||
| 1801 | Ga0207692_10036477 | |||
| 1802 | Ga0207692_10159615 | |||
| 1803 | Ga0207692_10194657 | |||
| 1804 | Ga0207692_10247151 | |||
| 1805 | Ga0207692_10296502 | |||
| 1806 | Ga0207692_11212412 | |||
| 1807 | Ga0207642_10055795 | |||
| 1808 | Ga0207642_10075977 | |||
| 1809 | Ga0207680_10170063 | |||
| 1810 | Ga0207680_10618078 | |||
| 1811 | Ga0207680_11012540 | |||
| 1812 | Ga0207647_10072363 | |||
| 1813 | Ga0207647_10314268 | |||
| 1814 | Ga0207685_10020083 | |||
| 1815 | Ga0207685_10051778 | |||
| 1816 | Ga0207685_10307960 | |||
| 1817 | Ga0207685_10394294 | |||
| 1818 | Ga0207685_10661017 | |||
| 1819 | Ga0207699_10005741 | |||
| 1820 | Ga0207699_10007969 | |||
| 1821 | Ga0207699_10059283 | |||
| 1822 | Ga0207699_10066598 | |||
| 1823 | Ga0207699_10089343 | |||
| 1824 | Ga0207699_10091729 | |||
| 1825 | Ga0207699_10128028 | |||
| 1826 | Ga0207699_10202909 | |||
| 1827 | Ga0207699_10286088 | |||
| 1828 | Ga0207699_10530100 | |||
| 1829 | Ga0207699_10605446 | |||
| 1830 | Ga0207699_10621388 | |||
| 1831 | Ga0207645_10337231 | |||
| 1832 | Ga0207643_10170059 | |||
| 1833 | Ga0207705_10279950 | |||
| 1834 | Ga0207684_10000203 | |||
| 1835 | Ga0207684_10004848 | |||
| 1836 | Ga0207684_10122285 | |||
| 1837 | Ga0207684_10198826 | |||
| 1838 | Ga0207684_10269700 | |||
| 1839 | Ga0207684_10309898 | |||
| 1840 | Ga0207684_11114101 | |||
| 1841 | Ga0207654_10016998 | |||
| 1842 | Ga0207654_10066550 | |||
| 1843 | Ga0207654_10100466 | |||
| 1844 | Ga0207654_10199404 | |||
| 1845 | Ga0207654_10282791 | |||
| 1846 | Ga0207654_10299407 | |||
| 1847 | Ga0207654_10347099 | |||
| 1848 | Ga0207654_10468398 | |||
| 1849 | Ga0207707_10000415 | |||
| 1850 | Ga0207707_10006370 | |||
| 1851 | Ga0207707_10068804 | |||
| 1852 | Ga0207707_10076805 | |||
| 1853 | Ga0207707_10241799 | |||
| 1854 | Ga0207707_10655662 | |||
| 1855 | Ga0207695_10007330 | |||
| 1856 | Ga0207695_10036436 | |||
| 1857 | Ga0207695_10096909 | |||
| 1858 | Ga0207695_10101629 | |||
| 1859 | Ga0207695_10108551 | |||
| 1860 | Ga0207695_10342783 | |||
| 1861 | Ga0207671_10055427 | |||
| 1862 | Ga0207671_10082115 | |||
| 1863 | Ga0207671_10119078 | |||
| 1864 | Ga0207671_10961528 | |||
| 1865 | Ga0207693_10000053 | |||
| 1866 | Ga0207693_10003984 | |||
| 1867 | Ga0207693_10027262 | |||
| 1868 | Ga0207693_10034774 | |||
| 1869 | Ga0207693_10056821 | |||
| 1870 | Ga0207693_10057484 | |||
| 1871 | Ga0207693_10059052 | |||
| 1872 | Ga0207693_10073867 | |||
| 1873 | Ga0207693_10308638 | |||
| 1874 | Ga0207693_10402806 | |||
| 1875 | Ga0207693_10598530 | |||
| 1876 | Ga0207663_10003872 | |||
| 1877 | Ga0207663_10009997 | |||
| 1878 | Ga0207663_10032690 | |||
| 1879 | Ga0207663_10040960 | |||
| 1880 | Ga0207663_10107039 | |||
| 1881 | Ga0207663_10115532 | |||
| 1882 | Ga0207663_10657495 | |||
| 1883 | Ga0207663_10767814 | |||
| 1884 | Ga0207663_11493447 | |||
| 1885 | Ga0207660_10504499 | |||
| 1886 | Ga0207660_10558338 | |||
| 1887 | Ga0207660_10572446 | |||
| 1888 | Ga0207660_11226984 | |||
| 1889 | Ga0207662_10043965 | |||
| 1890 | Ga0207657_10001119 | |||
| 1891 | Ga0207657_10016776 | |||
| 1892 | Ga0207649_10390455 | |||
| 1893 | Ga0207649_10391984 | |||
| 1894 | Ga0207649_10856394 | |||
| 1895 | Ga0207652_10005392 | |||
| 1896 | Ga0207652_10075116 | |||
| 1897 | Ga0207652_10206123 | |||
| 1898 | Ga0207652_10365408 | |||
| 1899 | Ga0207652_10899401 | |||
| 1900 | Ga0207652_11386755 | |||
| 1901 | Ga0207646_10008812 | |||
| 1902 | Ga0207646_10014951 | |||
| 1903 | Ga0207646_10038940 | |||
| 1904 | Ga0207646_10123280 | |||
| 1905 | Ga0207646_10158667 | |||
| 1906 | Ga0207646_10178172 | |||
| 1907 | Ga0207646_10436772 | |||
| 1908 | Ga0207646_10574037 | |||
| 1909 | Ga0207681_10089424 | |||
| 1910 | Ga0207694_10001068 | |||
| 1911 | Ga0207694_10094919 | |||
| 1912 | Ga0207694_10223237 | |||
| 1913 | Ga0207694_10378642 | |||
| 1914 | Ga0207694_10908585 | |||
| 1915 | Ga0207650_10084453 | |||
| 1916 | Ga0207650_10125070 | |||
| 1917 | Ga0207659_10256770 | |||
| 1918 | Ga0207687_10004129 | |||
| 1919 | Ga0207687_10052231 | |||
| 1920 | Ga0207687_10276848 | |||
| 1921 | Ga0207687_10572016 | |||
| 1922 | Ga0207687_10811307 | |||
| 1923 | Ga0207700_10002537 | |||
| 1924 | Ga0207700_10018690 | |||
| 1925 | Ga0207700_10026707 | |||
| 1926 | Ga0207700_10032615 | |||
| 1927 | Ga0207700_10071362 | |||
| 1928 | Ga0207700_10088412 | |||
| 1929 | Ga0207700_10160927 | |||
| 1930 | Ga0207700_10205554 | |||
| 1931 | Ga0207700_10256785 | |||
| 1932 | Ga0207700_10283863 | |||
| 1933 | Ga0207700_10320670 | |||
| 1934 | Ga0207700_10853734 | |||
| 1935 | Ga0207700_10935994 | |||
| 1936 | Ga0207700_11139187 | |||
| 1937 | Ga0207700_11562900 | |||
| 1938 | Ga0207664_10000029 | |||
| 1939 | Ga0207664_10002385 | |||
| 1940 | Ga0207664_10003181 | |||
| 1941 | Ga0207664_10016937 | |||
| 1942 | Ga0207664_10230885 | |||
| 1943 | Ga0207664_10234504 | |||
| 1944 | Ga0207664_10297903 | |||
| 1945 | Ga0207664_10976005 | |||
| 1946 | Ga0207664_11155952 | |||
| 1947 | Ga0207644_10092905 | |||
| 1948 | Ga0207690_10209851 | |||
| 1949 | Ga0207690_10347206 | |||
| 1950 | Ga0207690_10628851 | |||
| 1951 | Ga0207706_10003873 | |||
| 1952 | Ga0207706_10054283 | |||
| 1953 | Ga0207706_10177338 | |||
| 1954 | Ga0207706_11194178 | |||
| 1955 | Ga0207686_10091821 | |||
| 1956 | Ga0207686_10230551 | |||
| 1957 | Ga0207686_10803752 | |||
| 1958 | Ga0207709_10294215 | |||
| 1959 | Ga0207670_10058263 | |||
| 1960 | Ga0207670_10058885 | |||
| 1961 | Ga0207669_10127289 | |||
| 1962 | Ga0207704_10183235 | |||
| 1963 | Ga0207704_10200841 | |||
| 1964 | Ga0207704_10260870 | |||
| 1965 | Ga0207704_10398409 | |||
| 1966 | Ga0207704_11738384 | |||
| 1967 | Ga0207665_10000088 | |||
| 1968 | Ga0207665_10002497 | |||
| 1969 | Ga0207665_10005205 | |||
| 1970 | Ga0207665_10049913 | |||
| 1971 | Ga0207665_10079761 | |||
| 1972 | Ga0207665_10105540 | |||
| 1973 | Ga0207665_10193829 | |||
| 1974 | Ga0207665_10211978 | |||
| 1975 | Ga0207665_10435011 | |||
| 1976 | Ga0207665_10621158 | |||
| 1977 | Ga0207665_11653177 | |||
| 1978 | Ga0207711_10004841 | |||
| 1979 | Ga0207711_10139019 | |||
| 1980 | Ga0207711_10164855 | |||
| 1981 | Ga0207711_10764224 | |||
| 1982 | Ga0207711_11085504 | |||
| 1983 | Ga0207689_10020710 | |||
| 1984 | Ga0207689_10045560 | |||
| 1985 | Ga0207689_10520604 | |||
| 1986 | Ga0207661_10393953 | |||
| 1987 | Ga0207661_10820073 | |||
| 1988 | Ga0207679_10005016 | |||
| 1989 | Ga0207679_10013773 | |||
| 1990 | Ga0207679_10054327 | |||
| 1991 | Ga0207679_10137466 | |||
| 1992 | Ga0207679_10728103 | |||
| 1993 | Ga0207667_10000664 | |||
| 1994 | Ga0207667_10006973 | |||
| 1995 | Ga0207667_10007914 | |||
| 1996 | Ga0207667_10057950 | |||
| 1997 | Ga0207667_10657462 | |||
| 1998 | Ga0207667_10971288 | |||
| 1999 | Ga0207667_11110667 | |||
| 2000 | Ga0207667_12067561 | |||
| 2001 | Ga0207651_10124607 | |||
| 2002 | Ga0207651_10272308 | |||
| 2003 | Ga0207712_10064809 | |||
| 2004 | Ga0207668_10009597 | |||
| 2005 | Ga0207640_10018117 | |||
| 2006 | Ga0207640_10044902 | |||
| 2007 | Ga0207640_10050465 | |||
| 2008 | Ga0207640_10353494 | |||
| 2009 | Ga0207640_10718182 | |||
| 2010 | Ga0207658_10651298 | |||
| 2011 | Ga0207658_10946284 | |||
| 2012 | Ga0207677_10003878 | |||
| 2013 | Ga0207677_10047435 | |||
| 2014 | Ga0207677_10075102 | |||
| 2015 | Ga0207677_10110548 | |||
| 2016 | Ga0207677_10618943 | |||
| 2017 | Ga0207703_10028984 | |||
| 2018 | Ga0207703_10082089 | |||
| 2019 | Ga0207703_10207933 | |||
| 2020 | Ga0207703_10214132 | |||
| 2021 | Ga0207703_10892042 | |||
| 2022 | Ga0207639_11744496 | |||
| 2023 | Ga0207678_10003080 | |||
| 2024 | Ga0207678_10096310 | |||
| 2025 | Ga0207702_10000771 | |||
| 2026 | Ga0207702_10004514 | |||
| 2027 | Ga0207702_10008100 | |||
| 2028 | Ga0207702_10058218 | |||
| 2029 | Ga0207702_10081568 | |||
| 2030 | Ga0207702_10104544 | |||
| 2031 | Ga0207702_10189696 | |||
| 2032 | Ga0207702_10214312 | |||
| 2033 | Ga0207702_10254716 | |||
| 2034 | Ga0207702_10597858 | |||
| 2035 | Ga0207702_11619273 | |||
| 2036 | Ga0207641_10011809 | |||
| 2037 | Ga0207641_10049874 | |||
| 2038 | Ga0207641_10104634 | |||
| 2039 | Ga0207641_10337474 | |||
| 2040 | Ga0207641_10559263 | |||
| 2041 | Ga0207641_11228870 | |||
| 2042 | Ga0207641_11628958 | |||
| 2043 | Ga0207648_10008926 | |||
| 2044 | Ga0207648_10044673 | |||
| 2045 | Ga0207648_10278075 | |||
| 2046 | Ga0207676_10000816 | |||
| 2047 | Ga0207676_10006521 | |||
| 2048 | Ga0207676_10113786 | |||
| 2049 | Ga0207674_10000998 | |||
| 2050 | Ga0207674_10046045 | |||
| 2051 | Ga0207674_10054322 | |||
| 2052 | Ga0207674_10114412 | |||
| 2053 | Ga0207674_11087173 | |||
| 2054 | Ga0207675_100105743 | |||
| 2055 | Ga0207675_100235878 | |||
| 2056 | Ga0207675_101606715 | |||
| 2057 | Ga0207683_10104234 | |||
| 2058 | Ga0207683_11239932 | |||
| 2059 | Ga0207698_10014660 | |||
| 2060 | Ga0207698_10088415 | |||
| 2061 | Ga0207698_10428536 | |||
| 2062 | Ga0209179_1082817 | |||
| 2063 | Ga0209588_1225606 | |||
| 2064 | Ga0265354_1003383 | |||
| 2065 | Ga0268266_10285015 | |||
| 2066 | Ga0268265_10478987 | |||
| 2067 | Ga0268264_10053284 | |||
| 2068 | Ga0268264_10090403 | |||
| 2069 | Ga0268264_10176661 | |||
| 2070 | Ga0265336_10056102 | |||
| 2071 | Ga0265338_10005126 | |||
| 2072 | Ga0265338_10039895 | |||
| 2073 | Ga0265338_10122149 | |||
| 2074 | Ga0265338_10319337 | |||
| 2075 | Ga0265770_1016020 | |||
| 2076 | Ga0265760_10013805 | |||
| 2077 | Ga0265760_10036506 | |||
| 2078 | Ga0265760_10097705 | |||
| 2079 | Ga0265760_10201020 | |||
| 2080 | Ga0265760_10211452 | |||
| 2081 | Ga0265325_10014145 | |||
| 2082 | Ga0265325_10268906 | |||
| 2083 | Ga0265329_10214327 | |||
| 2084 | Ga0265340_10092103 | |||
| 2085 | Ga0265339_10022515 | |||
| 2086 | Ga0265339_10076549 | |||
| 2087 | Ga0265316_10047734 | |||
| 2088 | Ga0307408_101333695 | |||
| 2089 | Ga0265314_10023155 | |||
| 2090 | Ga0265342_10157779 | |||
| 2091 | Ga0307413_10071379 | |||
| 2092 | Ga0307413_11144567 | |||
| 2093 | Ga0307410_10064758 | |||
| 2094 | Ga0307406_10510733 | |||
| 2095 | Ga0307412_11105581 | |||
| 2096 | Ga0307409_100022670 | |||
| 2097 | Ga0307409_100064162 | |||
| 2098 | Ga0307416_100028286 | |||
| 2099 | Ga0307416_100822960 | |||
| 2100 | Ga0307414_10364235 | |||
| 2101 | Ga0307414_11520046 | |||
| 2102 | Ga0307411_10046091 | |||
| 2103 | Ga0316053_108912 | |||
| 2104 | Ga0307415_100002600 | |||
| 2105 | Ga0307415_100233135 | |||
| 2106 | Ga0373930_0194704 | |||
| 2107 | Ga0373950_0071463 | |||
| 2108 | Ga0373926_0030216 | |||
| 2109 | Ga0373926_0245967 | |||
| 2110 | Ga0373926_0379039 | |||
| 2111 | Ga0373926_0410278 | |||
| 2112 | Ga0373928_0046502 | |||
| 2113 | Ga0373929_0020901 | |||
| 2114 | Ga0373929_0046361 | |||
| 2115 | Ga0373934_0031677 | |||
| 2116 | Ga0373934_0155789 | |||
| 2117 | Ga0373934_0302270 | |||
| 2118 | Ga0373934_0319664 | |||
| 2119 | Ga0373940_0081705 | |||
| 2120 | Ga0373923_0021773 | |||
| 2121 | Ga0373923_0047206 | |||
| 2122 | Ga0373923_0129030 | |||
| 2123 | Ga0373923_0183560 | |||
| 2124 | Ga0373936_0003376 | |||
| 2125 | Ga0373936_0073367 | |||
| 2126 | Ga0373941_0118655 | |||
| 2127 | Ga0373945_0094485 | |||
| 2128 | Ga0373945_0274400 | |||
| 2129 | Ga0373945_0466628 | |||
| 2130 | Ga0373954_0002328 | |||
| 2131 | Ga0373954_0483546 | |||
| 2132 | Ga0373956_0040729 | |||
| 2133 | Ga0373957_0033466 | |||
| 2134 | Ga0373943_0001897 | |||
| 2135 | Ga0373943_0060843 | |||
| 2136 | Ga0373943_0139187 | |||
| 2137 | Ga0373943_0220186 | |||
| 2138 | Ga0373943_0786862 | |||
| 2139 | Ga0373946_0108548 | |||
| 2140 | Ga0373946_0705600 | |||
| 2141 | Ga0373955_0063550 | |||
| 2142 | Ga0373955_0087828 | |||
| 2143 | Ga0373955_0515051 | |||
| 2144 | Ga0373962_0095078 | |||
| 2145 | Ga0373924_0066789 | |||
| 2146 | Ga0373931_0007560 | |||
| 2147 | Ga0373931_0016660 | |||
| 2148 | Ga0373931_0038922 | |||
| 2149 | Ga0373931_0233903 | |||
| 2150 | Ga0373931_0348214 | |||
| 2151 | Ga0373935_0002433 | |||
| 2152 | Ga0373935_0045817 | |||
| 2153 | Ga0373935_0063080 | |||
| 2154 | Ga0373935_0355271 | |||
| 2155 | Ga0373935_0475961 | |||
| 2156 | Ga0373935_0567222 | |||
| 2157 | Ga0373935_0678490 | |||
| 2158 | Ga0373935_0680105 | |||
| 2159 | Ga0373935_0789398 | |||
| 2160 | Ga0373927_0000070 | |||
| 2161 | Ga0373927_0006015 | |||
| 2162 | Ga0373927_0080415 | |||
| 2163 | Ga0373927_0122623 | |||
| 2164 | Ga0373927_0302595 | |||
| 2165 | Ga0373927_0397716 | |||
| 2166 | Ga0373933_0061152 | |||
| 2167 | Ga0373933_0067104 | |||
| 2168 | Ga0373933_0389811 | |||
| 2169 | Ga0373933_0640396 | |||
| 2170 | Ga0373933_0671704 | |||
| 2171 | Ga0373933_0777378 | |||
| 2172 | Ga0373947_0001681 | |||
| 2173 | Ga0373947_0011692 | |||
| 2174 | Ga0373947_0016155 | |||
| 2175 | Ga0373947_1116224 | |||
| 2176 | Ga0373937_0008382 | |||
| 2177 | Ga0373937_0014967 | |||
| 2178 | Ga0373937_0090996 | |||
| 2179 | Ga0373937_0127291 | |||
| 2180 | Ga0373937_0340131 | |||
| 2181 | Ga0373937_0379038 | |||
| 2182 | Ga0373937_0502946 | |||
| 2183 | Ga0373937_0703126 | |||
| 2184 | Ga0373937_0943365 | |||
| 2185 | Ga0373937_1030850 | |||
| 2186 | Ga0373937_1048343 | |||
| 2187 | Ga0373937_1180095 | |||
| 2188 | Ga0373925_0006506 | |||
| 2189 | Ga0373925_0014812 | |||
| 2190 | Ga0373925_0019836 | |||
| 2191 | Ga0373925_0024998 | |||
| 2192 | Ga0373925_0048932 | |||
| 2193 | Ga0373925_0107672 | |||
| 2194 | Ga0373925_0115960 | |||
| 2195 | Ga0373925_0125766 | |||
| 2196 | Ga0373925_0145935 | |||
| 2197 | Ga0373925_0488489 | |||
| 2198 | Ga0373925_0548233 | |||
| 2199 | Ga0395900_0565961 | |||
| 2200 | Ga0395905_0028361 | |||
| 2201 | Ga0395905_0083647 | |||
| 2202 | Ga0395905_0125911 | |||
| 2203 | Ga0395905_0234075 | |||
| 2204 | Ga0395905_0423359 | |||
| 2205 | Ga0395905_0678923 | |||
| 2206 | Ga0395905_0894943 | |||
| 2207 | Ga0395905_0987123 | |||
| 2208 | Ga0436364_0629446 | |||
| 2209 | Ga0395901_0332378 | |||
| 2210 | Ga0395901_0364393 | |||
| 2211 | Ga0395901_0470040 | |||
| 2212 | Ga0395901_1758402 | |||
| 2213 | Ga0242420_035866 | |||
| 2214 | Ga0436365_0253185 | |||
| 2215 | Ga0436365_0264038 | |||
| 2216 | Ga0436365_1208049 | |||
| 2217 | Ga0436363_1517164 | |||
| 2218 | Ga0436363_1684019 | |||
| 2219 | Ga0436362_0353426 | |||
| 2220 | Ga0436362_0734081 | |||
| 2221 | Ga0451839_0979686 | |||
| 2222 | Ga0439448_0354283 | |||
| 2223 | Ga0451577_0000294 | |||
| 2224 | Ga0451577_0432649 | |||
| 2225 | Ga0453683_0038130 | |||
| 2226 | Ga0453683_0042647 | |||
| 2227 | Ga0466963_0015599 | |||
| 2228 | Ga0466963_0063444 | |||
| 2229 | Ga0466963_0118050 | |||
| 2230 | Ga0466964_0410934 | |||
| 2231 | Ga0453684_0000104 | |||
| 2232 | Ga0466968_0179995 | |||
| 2233 | Ga0466957_0564482 | |||
| 2234 | Ga0466959_0783492 | |||
| 2235 | Ga0451576_0009210 | |||
| 2236 | Ga0451576_0178688 | |||
| 2237 | Ga0451576_0218398 | |||
| 2238 | Ga0451576_0248273 | |||
| 2239 | Ga0451576_0293041 | |||
| 2240 | Ga0451576_0582542 | |||
| 2241 | Ga0466958_0249051 | |||
| 2242 | Ga0466967_0028364 | |||
| 2243 | Ga0466967_0030072 | |||
| 2244 | Ga0466967_0036443 | |||
| 2245 | Ga0466967_0261178 | |||
| 2246 | Ga0466967_1071905 | |||
| 2247 | Ga0466967_1363543 | |||
| 2248 | Ga0466967_1588919 | |||
| 2249 | Ga0495590_0056819 | |||
| 2250 | Ga0495629_0410282 | |||
| 2251 | Ga0495653_0294950 | |||
| 2252 | Ga0495653_0860247 | |||
| 2253 | Ga0495580_0003656 | |||
| 2254 | Ga0495580_0004367 | |||
| 2255 | Ga0495580_0006878 | |||
| 2256 | Ga0495580_0008035 | |||
| 2257 | Ga0495580_0009249 | |||
| 2258 | Ga0495580_0012091 | |||
| 2259 | Ga0495580_0017649 | |||
| 2260 | Ga0495580_0021821 | |||
| 2261 | Ga0495580_0025061 | |||
| 2262 | Ga0495580_0134706 | |||
| 2263 | Ga0495580_0154196 | |||
| 2264 | Ga0495580_0179013 | |||
| 2265 | Ga0495580_0198202 | |||
| 2266 | Ga0495580_0257431 | |||
| 2267 | Ga0495580_0488177 | |||
| 2268 | Ga0495580_0667651 | |||
| 2269 | Ga0495582_0000515 | |||
| 2270 | Ga0495582_0000834 | |||
| 2271 | Ga0495582_0857201 | |||
| 2272 | Ga0495639_0761845 | |||
| 2273 | Ga0495662_0095187 | |||
| 2274 | Ga0495664_0068543 | |||
| 2275 | Ga0495664_0123787 | |||
| 2276 | Ga0495664_0154461 | |||
| 2277 | Ga0495664_0203047 | |||
| 2278 | Ga0495594_0349477 | |||
| 2279 | Ga0495608_0126212 | |||
| 2280 | Ga0495618_0505119 | |||
| 2281 | Ga0495628_0197652 | |||
| 2282 | Ga0495628_0364718 | |||
| 2283 | Ga0495630_0101142 | |||
| 2284 | Ga0495630_0434686 | |||
| 2285 | Ga0495630_0940406 | |||
| 2286 | Ga0495643_0334435 | |||
| 2287 | Ga0495642_0266244 | |||
| 2288 | Ga0495652_0658041 | |||
| 2289 | Ga0495665_0000769 | |||
| 2290 | Ga0495665_0079435 | |||
| 2291 | Ga0495665_0092988 | |||
| 2292 | Ga0495665_0198197 | |||
| 2293 | Ga0495640_0397057 | |||
| 2294 | Ga0495640_0971292 | |||
| 2295 | Ga0495586_0212507 | |||
| 2296 | Ga0495586_0254945 | |||
| 2297 | Ga0495586_0436913 | |||
| 2298 | Ga0495586_0581987 | |||
| 2299 | Ga0495645_0035180 | |||
| 2300 | Ga0495645_0182762 | |||
| 2301 | Ga0495622_0411586 | |||
| 2302 | Ga0495634_0127926 | |||
| 2303 | Ga0495634_0762149 | |||
| 2304 | Ga0495635_0231308 | |||
| 2305 | Ga0495635_0649679 | |||
| 2306 | Ga0495659_0011349 | |||
| 2307 | Ga0495659_0086125 | |||
| 2308 | Ga0495657_0208142 | |||
| 2309 | Ga0495657_0282042 | |||
| 2310 | Ga0495599_0491643 | |||
| 2311 | Ga0495623_0015636 | |||
| 2312 | Ga0495623_0151741 | |||
| 2313 | Ga0495623_0319065 | |||
| 2314 | Ga0495623_0416825 | |||
| 2315 | Ga0495646_0170006 | |||
| 2316 | Ga0495647_0022962 | |||
| 2317 | Ga0495658_0024784 | |||
| 2318 | Ga0495658_0079364 | |||
| 2319 | Ga0495669_0063429 | |||
| 2320 | Ga0495669_0081642 | |||
| 2321 | Ga0495613_0950401 | |||
| 2322 | Ga0495624_0267774 | |||
| 2323 | Ga0495624_0302779 | |||
| 2324 | Ga0495624_0424902 | |||
| 2325 | Ga0495649_0293334 | |||
| 2326 | Ga0495581_0320205 | |||
| 2327 | Ga0495581_0840897 | |||
| 2328 | Ga0495581_0900772 | |||
| 2329 | Ga0495604_0112104 | |||
| 2330 | Ga0495604_0180536 | |||
| 2331 | Ga0495636_0321839 | |||
| 2332 | Ga0495674_0007954 | |||
| 2333 | Ga0495674_0045321 | |||
| 2334 | Ga0495674_0445378 | |||
| 2335 | Ga0495674_0638743 | |||
| 2336 | Ga0495675_0052719 | |||
| 2337 | Ga0495675_0080668 | |||
| 2338 | Ga0495684_0140079 | |||
| 2339 | Ga0495593_0082392 | |||
| 2340 | Ga0495593_0362560 | |||
| 2341 | Ga0495602_0086948 | |||
| 2342 | Ga0495602_0205520 | |||
| 2343 | Ga0495602_0417813 | |||
| 2344 | Ga0496100_0024739 | |||
| 2345 | Ga0496100_0420301 | |||
| 2346 | Ga0496100_0797369 | |||
| 2347 | Ga0496101_0014467 | |||
| 2348 | Ga0496101_0038854 | |||
| 2349 | Ga0496101_0044530 | |||
| 2350 | Ga0496101_0150170 | |||
| 2351 | Ga0496102_0001660 | |||
| 2352 | Ga0496102_0152305 | |||
| 2353 | Ga0496102_0235734 | |||
| 2354 | Ga0496102_0299543 | |||
| 2355 | Ga0496102_0511266 | |||
| 2356 | Ga0496102_0552341 | |||
| 2357 | Ga0496102_0727729 | |||
| 2358 | Ga0496102_0881010 | |||
| 2359 | Ga0496103_0011530 | |||
| 2360 | Ga0496103_0046208 | |||
| 2361 | Ga0496103_0080138 | |||
| 2362 | Ga0496103_0091072 | |||
| 2363 | Ga0496104_0006621 | |||
| 2364 | Ga0496104_0083550 | |||
| 2365 | Ga0496104_0160764 | |||
| 2366 | Ga0496104_0259602 | |||
| 2367 | Ga0496104_1234971 | |||
| 2368 | Ga0496105_0035009 | |||
| 2369 | Ga0496105_0059306 | |||
| 2370 | Ga0496105_0078397 | |||
| 2371 | Ga0496105_1377113 | |||
| 2372 | Ga0496105_1419642 | |||
| 2373 | Ga0496106_0023432 | |||
| 2374 | Ga0496106_0041099 | |||
| 2375 | Ga0496106_0102772 | |||
| 2376 | Ga0496106_0484455 | |||
| 2377 | Ga0496106_0596477 | |||
| 2378 | Ga0496107_0050348 | |||
| 2379 | Ga0496107_0084614 | |||
| 2380 | Ga0496107_1285510 | |||
| 2381 | Ga0496108_0110256 | |||
| 2382 | Ga0496108_1059086 | |||
| 2383 | Ga0496109_0060855 | |||
| 2384 | Ga0496109_1516764 | |||
| 2385 | Ga0496109_1985844 | |||
| 2386 | Ga0496110_0043246 | |||
| 2387 | Ga0496110_1211985 | |||
| 2388 | Ga0496111_1037576 | |||
| 2389 | Ga0496112_0000416 | |||
| 2390 | Ga0496112_0007562 | |||
| 2391 | Ga0496112_0058151 | |||
| 2392 | Ga0496112_0147554 | |||
| 2393 | Ga0496112_0202466 | |||
| 2394 | Ga0496112_0261437 | |||
| 2395 | Ga0496112_0266445 | |||
| 2396 | Ga0496112_0293065 | |||
| 2397 | Ga0496112_0698454 | |||
| 2398 | Ga0496112_0898543 | |||
| 2399 | Ga0496112_1095191 | |||
| 2400 | Ga0496112_1126510 | |||
| 2401 | Ga0496113_0017141 | |||
| 2402 | Ga0496113_0191979 | |||
| 2403 | Ga0496113_0243274 | |||
| 2404 | Ga0496113_1491062 | |||
| 2405 | Ga0496114_0034517 | |||
| 2406 | Ga0496115_0027928 | |||
| 2407 | Ga0496115_0040303 | |||
| 2408 | Ga0501291_046206 | |||
| 2409 | Ga0501297_004060 | |||
| 2410 | Ga0501298_083417 | |||
| 2411 | Ga0501302_016746 | |||
| 2412 | Ga0501217_220868 | |||
| 2413 | Ga0501258_011561 | |||
| 2414 | Ga0501083_0332993 | |||
| 2415 | Ga0501263_058476 | |||
| 2416 | Ga0501283_010918 | |||
| 2417 | nmdc:mga05p37_147380_c2 | |||
| 2418 | nmdc:mga05p37_1812445_c1 | |||
| 2419 | nmdc:mga0n895_1210889_c1 | |||
| 2420 | nmdc:mga0n895_254385_c1 | |||
| 2421 | nmdc:mga0n895_36681_c1 | |||
| 2422 | nmdc:mga0n895_47_c1 | |||
| 2423 | nmdc:mga0n895_83393_c1 | |||
| 2424 | nmdc:mga0rr50_1285_c1 | |||
| 2425 | nmdc:mga0rr50_633737_c1 | |||
| 2426 | nmdc:mga0rr50_935_c1 | |||
| 2427 | nmdc:mga08x19_1786_c1 | |||
| 2428 | nmdc:mga08x19_186645_c1 | |||
| 2429 | nmdc:mga08x19_21944_c1 | |||
| 2430 | nmdc:mga08x19_37766_c1 | |||
| 2431 | nmdc:mga08x19_774837_c1 | |||
| 2432 | nmdc:mga08x19_8425_c1 | |||
| 2433 | nmdc:mga08x19_865461_c1 | |||
| 2434 | nmdc:mga08x19_910282_c1 | |||
| 2435 | nmdc:mga0a205_1652_c1 | |||
| 2436 | nmdc:mga0a205_666311_c1 | |||
| 2437 | Ga0495601_0129516 | |||
| 2438 | Ga0495612_0103311 | |||
| 2439 | Ga0495612_0117576 | |||
| 2440 | Ga0495612_0246128 | |||
| 2441 | Ga0495595_0480859 | |||
| 2442 | Ga0495619_0055971 | |||
| 2443 | Ga0587093_011388 | |||
| 2444 | Ga0587066_061687 | |||
| 2445 | Ga0587066_097348 | |||
| 2446 | Ga0587070_071344 | |||
| 2447 | Ga0587070_137214 | |||
| 2448 | Ga0587070_211589 | |||
| 2449 | Ga0587073_0090466 | |||
| 2450 | Ga0587073_0308533 | |||
| 2451 | Ga0587080_072503 | |||
| 2452 | Ga0587083_0112775 | |||
| 2453 | Ga0587083_0206561 | |||
| 2454 | Ga0587086_081006 | |||
| 2455 | Ga0587088_106060 | |||
| 2456 | Ga0587088_177834 | |||
| 2457 | Ga0587089_039513 | |||
| 2458 | Ga0587089_087386 | |||
| 2459 | Ga0587091_033068 | |||
| 2460 | Ga0587092_058961 | |||
| 2461 | Ga0587092_087778 | |||
| 2462 | Ga0587106_079402 | |||
| 2463 | Ga0587115_052603 | |||
| 2464 | Ga0587117_022850 | |||
| 2465 | Ga0587128_031337 | |||
| 2466 | Ga0587062_037121 | |||
| 2467 | Ga0587067_103399 | |||
| 2468 | Ga0587069_019601 | |||
| 2469 | Ga0587075_034410 | |||
| 2470 | Ga0587075_053210 | |||
| 2471 | Ga0587076_082469 | |||
| 2472 | Ga0587079_041380 | |||
| 2473 | Ga0587079_080678 | |||
| 2474 | Ga0587110_035851 | |||
| 2475 | Ga0587060_021141 | |||
| 2476 | Ga0587071_032119 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy