F492027
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1234 | 541 | 2468 | 529 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2728369276|2729906767 |
| Length | 624 |
| Sequence | TNSPVTAPVLVEPVLEAVEAPVDTPVSTPVDLLVQAPAETPAGALVDAPAEVSDLSEVLDAKKSEVPAQSRAKKAAGRSGSKAARSSEKTLKGDKTDKDLGHVSFVGAGPGDPGLLTVRAVDLLGAADVVVLDQGSREDLVARFARPGVEVLDAAFGDDGQPLARAARAKLVVRAAKAGGRVVRLMDGDPSTFTGLVDEVAACRKAGVTFDVVPGVSAVNAVPTYAGIPMTTPGTSSVNVVHPAGRSLDWSRHADADATVVVLGSGDDIAAAAAGLLGAGRGAATPVALTSHGTTTGQTTTTTTLGKLAAAVAGLDSSPTTAVVGDVVALREQNSWYETKPLFGWRVLVPRTKEQAGGITARLSGHGATAEVVPTISVEPPRTPQQMEKAVKGLVTGRYEWIGFTSVNAVKAVREKFTEYGLDARAFSGLKVAAVGGVTAEALREWGIEPDLLPETEQSAAGLLEAWPPYDDVLDPINRVFLPRADIATDTLVAGLVENGWEVDDVTAYRTVRAAPPAAPVRDAIKTGAFDAVVFTSSSTVRNLVGIAGKPHPSTVVACIGPATAKTAEEHGLRVDVLAAEPSAESLVEALASYGNVLRAAAVEAGEPVLRPSQKKSSARRRAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 59 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 161 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 167 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 171 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 182 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 183 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 184 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 185 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 186 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 201 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 202 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 204 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 205 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 206 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 208 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 209 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 212 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 214 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 215 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 216 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 222 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 226 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 227 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 230 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 231 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 232 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 233 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 234 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 235 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 236 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 237 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 240 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 241 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 245 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 248 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 249 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 250 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 251 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 252 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 253 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 254 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 255 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 256 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 257 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 258 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 259 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 260 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 267 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 273 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 353 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 354 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 355 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 356 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 359 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 360 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 393 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 394 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 406 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 407 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 408 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 410 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 414 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 415 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 416 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 417 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 418 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 419 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 420 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 421 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 422 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 423 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 424 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 425 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 426 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 427 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 428 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 429 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 430 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 431 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 432 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 433 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 434 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 435 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 436 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 437 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 438 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 439 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 440 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 441 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 442 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 443 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 444 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 445 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 446 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 447 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 448 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 449 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 450 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 451 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 452 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 453 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 454 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 455 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 456 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 457 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 458 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 459 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 460 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 461 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 462 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 463 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 464 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 465 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 466 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 467 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 468 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 469 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 470 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 471 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 472 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 473 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 474 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 475 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 476 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 477 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 478 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 479 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 480 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 481 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 482 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 483 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 484 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 485 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 486 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 487 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 488 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 489 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 490 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 491 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 492 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 493 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 494 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 495 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 496 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 497 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 498 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 499 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 500 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 501 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 502 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 503 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 504 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 505 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 506 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 507 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 508 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 509 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 510 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 511 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 512 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 513 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 514 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 515 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 516 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 517 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 518 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 519 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 520 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 521 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 522 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 523 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 524 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 525 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 526 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 527 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 528 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 529 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 530 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 531 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 532 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 533 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 534 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 535 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 536 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 537 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 538 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
| 539 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 540 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 541 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.93 |
| Metatranscriptomes | 1.78 |
| Isolates | 10.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.97 |
| Nodule | 0.24 |
| Rhizoplane | 5.11 |
| Rhizosphere | 85.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10000341 | 3300005327 | Bacteria | 40344 |
| 2 | Ga0070658_10005154 | 3300005327 | Bacteria | 10635 |
| 3 | Ga0070658_10019961 | 3300005327 | Bacteria | 5368 |
| 4 | Ga0070658_10036087 | 3300005327 | Bacteria | 3984 |
| 5 | Ga0070658_10120314 | 3300005327 | Bacteria | 2181 |
| 6 | Ga0070683_100004700 | 3300005329 | Bacteria | 11288 |
| 7 | Ga0070683_100018153 | 3300005329 | Bacteria | 6226 |
| 8 | Ga0070683_100053662 | 3300005329 | Bacteria | 3735 |
| 9 | Ga0070690_100060284 | 3300005330 | Bacteria | 2442 |
| 10 | Ga0068869_100028900 | 3300005334 | Bacteria | 3878 |
| 11 | Ga0070666_10076702 | 3300005335 | Bacteria | 2281 |
| 12 | Ga0070680_100000142 | 3300005336 | Bacteria | 43698 |
| 13 | Ga0070680_100028494 | 3300005336 | Bacteria | 4480 |
| 14 | Ga0070680_100032455 | 3300005336 | Bacteria | 4204 |
| 15 | Ga0070682_100007342 | 3300005337 | Bacteria | 6214 |
| 16 | Ga0070682_100009822 | 3300005337 | Bacteria | 5418 |
| 17 | Ga0068868_100019689 | 3300005338 | Bacteria | 5060 |
| 18 | Ga0070660_100005421 | 3300005339 | Bacteria | 8833 |
| 19 | Ga0070660_100046731 | 3300005339 | Bacteria | 3319 |
| 20 | Ga0070691_10017887 | 3300005341 | Bacteria | 3262 |
| 21 | Ga0070691_10024103 | 3300005341 | Bacteria | 2827 |
| 22 | Ga0070675_100070224 | 3300005354 | Bacteria | 2902 |
| 23 | Ga0070671_100077253 | 3300005355 | Bacteria | 2782 |
| 24 | Ga0070659_100000340 | 3300005366 | Bacteria | 36008 |
| 25 | Ga0070659_100002562 | 3300005366 | Bacteria | 12923 |
| 26 | Ga0070659_100085970 | 3300005366 | Bacteria | 2516 |
| 27 | Ga0070667_100011293 | 3300005367 | Bacteria | 7388 |
| 28 | Ga0070709_10000148 | 3300005434 | Bacteria | 46542 |
| 29 | Ga0070709_10011079 | 3300005434 | Bacteria | 5013 |
| 30 | Ga0070709_10014133 | 3300005434 | Bacteria | 4509 |
| 31 | Ga0070714_100000241 | 3300005435 | Bacteria | 42677 |
| 32 | Ga0070714_100001408 | 3300005435 | Bacteria | 17443 |
| 33 | Ga0070714_100020693 | 3300005435 | Bacteria | 5377 |
| 34 | Ga0070714_100037623 | 3300005435 | Bacteria | 4067 |
| 35 | Ga0070714_100044891 | 3300005435 | Bacteria | 3743 |
| 36 | Ga0070714_100108150 | 3300005435 | Bacteria | 2458 |
| 37 | Ga0070714_100188960 | 3300005435 | Bacteria | 1878 |
| 38 | Ga0070713_100031003 | 3300005436 | Bacteria | 4253 |
| 39 | Ga0070713_100045812 | 3300005436 | Bacteria | 3586 |
| 40 | Ga0070713_100098361 | 3300005436 | Bacteria | 2530 |
| 41 | Ga0070710_10000288 | 3300005437 | Bacteria | 23860 |
| 42 | Ga0070710_10000754 | 3300005437 | Bacteria | 15430 |
| 43 | Ga0070701_10098354 | 3300005438 | Bacteria | 1616 |
| 44 | Ga0070711_100001415 | 3300005439 | Bacteria | 13168 |
| 45 | Ga0070711_100036987 | 3300005439 | Bacteria | 3273 |
| 46 | Ga0070711_100103016 | 3300005439 | Bacteria | 2079 |
| 47 | Ga0070700_100000064 | 3300005441 | Bacteria | 78318 |
| 48 | Ga0070694_100040214 | 3300005444 | Bacteria | 3117 |
| 49 | Ga0070708_100006850 | 3300005445 | Bacteria | 9088 |
| 50 | Ga0070708_100012378 | 3300005445 | Bacteria | 6961 |
| 51 | Ga0070708_100052431 | 3300005445 | Bacteria | 3618 |
| 52 | Ga0070708_100090504 | 3300005445 | Bacteria | 2785 |
| 53 | Ga0070708_100171158 | 3300005445 | Bacteria | 2028 |
| 54 | Ga0070663_100033990 | 3300005455 | Bacteria | 3527 |
| 55 | Ga0070663_100130357 | 3300005455 | Bacteria | 1909 |
| 56 | Ga0070678_100042234 | 3300005456 | Bacteria | 3240 |
| 57 | Ga0070678_100083879 | 3300005456 | Bacteria | 2424 |
| 58 | Ga0070678_100105459 | 3300005456 | Bacteria | 2194 |
| 59 | Ga0070678_100130995 | 3300005456 | Bacteria | 1992 |
| 60 | Ga0070681_10025573 | 3300005458 | Bacteria | 5938 |
| 61 | Ga0070681_10028817 | 3300005458 | Bacteria | 5580 |
| 62 | Ga0070681_10047180 | 3300005458 | Bacteria | 4306 |
| 63 | Ga0070706_100002380 | 3300005467 | Bacteria | 18992 |
| 64 | Ga0070706_100003532 | 3300005467 | Bacteria | 15370 |
| 65 | Ga0070706_100005976 | 3300005467 | Bacteria | 11513 |
| 66 | Ga0070706_100010066 | 3300005467 | Bacteria | 8784 |
| 67 | Ga0070706_100010721 | 3300005467 | Bacteria | 8506 |
| 68 | Ga0070706_100023725 | 3300005467 | Bacteria | 5647 |
| 69 | Ga0070706_100039669 | 3300005467 | Bacteria | 4346 |
| 70 | Ga0070706_100083189 | 3300005467 | Bacteria | 2965 |
| 71 | Ga0070707_100000213 | 3300005468 | Bacteria | 58009 |
| 72 | Ga0070707_100003232 | 3300005468 | Bacteria | 15432 |
| 73 | Ga0070707_100003789 | 3300005468 | Bacteria | 14265 |
| 74 | Ga0070707_100012139 | 3300005468 | Bacteria | 8042 |
| 75 | Ga0070707_100030838 | 3300005468 | Bacteria | 5107 |
| 76 | Ga0070707_100039951 | 3300005468 | Bacteria | 4487 |
| 77 | Ga0070698_100000205 | 3300005471 | Bacteria | 56962 |
| 78 | Ga0070698_100000527 | 3300005471 | Bacteria | 40863 |
| 79 | Ga0070698_100000706 | 3300005471 | Bacteria | 35678 |
| 80 | Ga0070698_100000992 | 3300005471 | Bacteria | 31252 |
| 81 | Ga0070698_100001093 | 3300005471 | Bacteria | 29814 |
| 82 | Ga0070698_100001437 | 3300005471 | Bacteria | 26406 |
| 83 | Ga0070698_100004321 | 3300005471 | Bacteria | 15616 |
| 84 | Ga0070698_100006891 | 3300005471 | Bacteria | 12313 |
| 85 | Ga0070698_100031580 | 3300005471 | Bacteria | 5489 |
| 86 | Ga0070698_100032056 | 3300005471 | Bacteria | 5446 |
| 87 | Ga0070698_100059041 | 3300005471 | Bacteria | 3876 |
| 88 | Ga0070699_100038999 | 3300005518 | Bacteria | 4112 |
| 89 | Ga0070699_100062759 | 3300005518 | Bacteria | 3221 |
| 90 | Ga0070679_100000016 | 3300005530 | Bacteria | 139454 |
| 91 | Ga0070679_100002098 | 3300005530 | Bacteria | 17957 |
| 92 | Ga0070679_100039772 | 3300005530 | Bacteria | 4675 |
| 93 | Ga0070679_100124948 | 3300005530 | Bacteria | 2556 |
| 94 | Ga0070679_100131620 | 3300005530 | Bacteria | 2482 |
| 95 | Ga0070684_100205297 | 3300005535 | Bacteria | 1795 |
| 96 | Ga0070697_100024392 | 3300005536 | Bacteria | 4815 |
| 97 | Ga0068853_100034386 | 3300005539 | Bacteria | 4302 |
| 98 | Ga0068853_100035256 | 3300005539 | Bacteria | 4248 |
| 99 | Ga0070672_100087525 | 3300005543 | Bacteria | 2507 |
| 100 | Ga0070686_100017464 | 3300005544 | Bacteria | 4193 |
| 101 | Ga0070695_100055470 | 3300005545 | Bacteria | 2554 |
| 102 | Ga0070696_100000953 | 3300005546 | Bacteria | 18773 |
| 103 | Ga0070696_100096537 | 3300005546 | Bacteria | 2112 |
| 104 | Ga0070693_100014101 | 3300005547 | Bacteria | 4086 |
| 105 | Ga0070665_100012640 | 3300005548 | Bacteria | 8501 |
| 106 | Ga0068855_100004743 | 3300005563 | Bacteria | 16597 |
| 107 | Ga0068857_100055007 | 3300005577 | Bacteria | 3532 |
| 108 | Ga0068857_100109438 | 3300005577 | Bacteria | 2483 |
| 109 | Ga0068854_100002563 | 3300005578 | Bacteria | 11246 |
| 110 | Ga0068854_100081603 | 3300005578 | Bacteria | 2389 |
| 111 | Ga0068856_100012896 | 3300005614 | Bacteria | 8090 |
| 112 | Ga0068856_100032085 | 3300005614 | Bacteria | 5141 |
| 113 | Ga0068856_100080477 | 3300005614 | Bacteria | 3231 |
| 114 | Ga0068856_100084252 | 3300005614 | Bacteria | 3158 |
| 115 | Ga0070702_100000181 | 3300005615 | Bacteria | 20246 |
| 116 | Ga0068852_100007081 | 3300005616 | Bacteria | 8170 |
| 117 | Ga0068852_100035620 | 3300005616 | Bacteria | 4154 |
| 118 | Ga0068859_100021021 | 3300005617 | Bacteria | 6551 |
| 119 | Ga0068859_100079889 | 3300005617 | Bacteria | 3311 |
| 120 | Ga0068859_100155550 | 3300005617 | Bacteria | 2363 |
| 121 | Ga0068864_100003646 | 3300005618 | Bacteria | 12733 |
| 122 | Ga0068864_100137313 | 3300005618 | Bacteria | 2203 |
| 123 | Ga0068861_100017783 | 3300005719 | Bacteria | 5051 |
| 124 | Ga0068861_100028258 | 3300005719 | Bacteria | 4092 |
| 125 | Ga0068870_10007494 | 3300005840 | Bacteria | 4869 |
| 126 | Ga0068858_100050056 | 3300005842 | Bacteria | 3867 |
| 127 | Ga0068860_100108652 | 3300005843 | Bacteria | 2651 |
| 128 | Ga0081455_10001759 | 3300005937 | Bacteria | 26177 |
| 129 | Ga0081455_10011389 | 3300005937 | Bacteria | 8940 |
| 130 | Ga0081455_10027242 | 3300005937 | Bacteria | 5238 |
| 131 | Ga0081455_10071494 | 3300005937 | Bacteria | 2876 |
| 132 | Ga0081538_10001441 | 3300005981 | Bacteria | 24455 |
| 133 | Ga0081540_1000097 | 3300005983 | Bacteria | 92047 |
| 134 | Ga0081540_1009149 | 3300005983 | Bacteria | 6836 |
| 135 | Ga0081540_1031284 | 3300005983 | Bacteria | 2929 |
| 136 | Ga0081539_10000015 | 3300005985 | Bacteria | 395781 |
| 137 | Ga0081539_10000717 | 3300005985 | Bacteria | 66511 |
| 138 | Ga0081539_10014229 | 3300005985 | Bacteria | 5906 |
| 139 | Ga0081539_10023013 | 3300005985 | Bacteria | 4096 |
| 140 | Ga0070717_10019268 | 3300006028 | Bacteria | 5349 |
| 141 | Ga0070717_10022123 | 3300006028 | Bacteria | 5020 |
| 142 | Ga0075363_100048012 | 3300006048 | Bacteria | 2269 |
| 143 | Ga0075432_10000184 | 3300006058 | Bacteria | 15938 |
| 144 | Ga0075432_10003361 | 3300006058 | Bacteria | 5407 |
| 145 | Ga0070715_10009603 | 3300006163 | Bacteria | 3416 |
| 146 | Ga0070715_10010578 | 3300006163 | Bacteria | 3293 |
| 147 | Ga0070716_100000186 | 3300006173 | Bacteria | 24421 |
| 148 | Ga0070716_100001102 | 3300006173 | Bacteria | 11878 |
| 149 | Ga0070716_100037136 | 3300006173 | Bacteria | 2690 |
| 150 | Ga0070712_100005948 | 3300006175 | Bacteria | 7542 |
| 151 | Ga0070712_100036038 | 3300006175 | Bacteria | 3363 |
| 152 | Ga0075367_10009815 | 3300006178 | Bacteria | 5016 |
| 153 | Ga0075427_10002845 | 3300006194 | Bacteria | 2351 |
| 154 | Ga0097621_100052980 | 3300006237 | Bacteria | 3306 |
| 155 | Ga0068871_100037584 | 3300006358 | Bacteria | 3862 |
| 156 | Ga0075428_100000285 | 3300006844 | Bacteria | 49638 |
| 157 | Ga0075428_100008245 | 3300006844 | Bacteria | 11552 |
| 158 | Ga0075428_100023028 | 3300006844 | Bacteria | 6894 |
| 159 | Ga0075428_100029819 | 3300006844 | Bacteria | 6035 |
| 160 | Ga0075430_100004937 | 3300006846 | Bacteria | 11219 |
| 161 | Ga0075431_100006189 | 3300006847 | Bacteria | 11879 |
| 162 | Ga0075433_10002351 | 3300006852 | Bacteria | 14387 |
| 163 | Ga0075433_10002630 | 3300006852 | Bacteria | 13710 |
| 164 | Ga0075433_10158999 | 3300006852 | Bacteria | 2011 |
| 165 | Ga0075434_100003332 | 3300006871 | Bacteria | 14373 |
| 166 | Ga0075434_100057478 | 3300006871 | Bacteria | 3866 |
| 167 | Ga0075434_100105815 | 3300006871 | Bacteria | 2823 |
| 168 | Ga0075429_100000714 | 3300006880 | Bacteria | 26009 |
| 169 | Ga0075429_100033608 | 3300006880 | Bacteria | 4457 |
| 170 | Ga0075436_100008179 | 3300006914 | Bacteria | 7159 |
| 171 | Ga0075436_100084447 | 3300006914 | Bacteria | 2204 |
| 172 | Ga0097620_100021021 | 3300006931 | Bacteria | 6551 |
| 173 | Ga0097620_100079891 | 3300006931 | Bacteria | 3311 |
| 174 | Ga0097620_100155544 | 3300006931 | Bacteria | 2363 |
| 175 | Ga0075435_100001797 | 3300007076 | Bacteria | 13948 |
| 176 | Ga0075435_100014600 | 3300007076 | Bacteria | 5878 |
| 177 | Ga0075435_100028736 | 3300007076 | Bacteria | 4362 |
| 178 | Ga0075435_100053244 | 3300007076 | Bacteria | 3263 |
| 179 | Ga0105240_10026684 | 3300009093 | Bacteria | 7578 |
| 180 | Ga0105240_10159410 | 3300009093 | Bacteria | 2682 |
| 181 | Ga0111539_10009361 | 3300009094 | Bacteria | 12367 |
| 182 | Ga0111539_10015527 | 3300009094 | Bacteria | 9468 |
| 183 | Ga0105245_10061047 | 3300009098 | Bacteria | 3397 |
| 184 | Ga0105245_10131086 | 3300009098 | Bacteria | 2351 |
| 185 | Ga0114129_10000278 | 3300009147 | Bacteria | 58533 |
| 186 | Ga0114129_10001404 | 3300009147 | Bacteria | 32492 |
| 187 | Ga0114129_10002476 | 3300009147 | Bacteria | 25644 |
| 188 | Ga0114129_10004135 | 3300009147 | Bacteria | 20508 |
| 189 | Ga0114129_10070705 | 3300009147 | Bacteria | 4866 |
| 190 | Ga0105243_10000176 | 3300009148 | Bacteria | 73715 |
| 191 | Ga0105243_10003944 | 3300009148 | Bacteria | 11845 |
| 192 | Ga0105243_10005949 | 3300009148 | Bacteria | 9449 |
| 193 | Ga0105241_10005275 | 3300009174 | Bacteria | 9545 |
| 194 | Ga0105248_10069469 | 3300009177 | Bacteria | 3955 |
| 195 | Ga0105238_10022283 | 3300009551 | Bacteria | 6456 |
| 196 | Ga0105238_10183891 | 3300009551 | Bacteria | 2067 |
| 197 | Ga0105249_10062449 | 3300009553 | Bacteria | 3421 |
| 198 | Ga0105249_10226043 | 3300009553 | Bacteria | 1844 |
| 199 | Ga0105239_10047982 | 3300010375 | Bacteria | 4681 |
| 200 | Ga0105246_10000307 | 3300011119 | Bacteria | 25935 |
| 201 | Ga0157371_10021854 | 3300013102 | Bacteria | 4694 |
| 202 | Ga0157370_10035408 | 3300013104 | Bacteria | 4852 |
| 203 | Ga0157369_10000890 | 3300013105 | Bacteria | 38122 |
| 204 | Ga0157369_10001482 | 3300013105 | Bacteria | 28790 |
| 205 | Ga0157369_10022930 | 3300013105 | Bacteria | 6961 |
| 206 | Ga0157369_10044670 | 3300013105 | Bacteria | 4821 |
| 207 | Ga0157374_10123096 | 3300013296 | Bacteria | 2505 |
| 208 | Ga0157375_10047169 | 3300013308 | Bacteria | 4205 |
| 209 | Ga0157375_10217292 | 3300013308 | Bacteria | 2070 |
| 210 | Ga0163163_10077534 | 3300014325 | Bacteria | 3318 |
| 211 | Ga0163163_10183773 | 3300014325 | Bacteria | 2138 |
| 212 | Ga0157380_10062562 | 3300014326 | Bacteria | 2981 |
| 213 | Ga0157380_10193111 | 3300014326 | Bacteria | 1799 |
| 214 | Ga0182008_10000943 | 3300014497 | Bacteria | 20240 |
| 215 | Ga0157377_10020979 | 3300014745 | Bacteria | 3430 |
| 216 | Ga0157379_10015119 | 3300014968 | Bacteria | 6769 |
| 217 | Ga0182006_1009402 | 3300015261 | Bacteria | 4382 |
| 218 | Ga0182007_10002092 | 3300015262 | Bacteria | 10249 |
| 219 | Ga0183367_1002 | 3300015688 | Bacteria | 1101531 |
| 220 | Ga0163161_10060911 | 3300017792 | Bacteria | 2748 |
| 221 | Ga0197907_10936403 | 3300020069 | Bacteria | 3304 |
| 222 | Ga0206356_10751802 | 3300020070 | Bacteria | 2543 |
| 223 | Ga0206356_11783545 | 3300020070 | Bacteria | 2133 |
| 224 | Ga0206351_10212682 | 3300020077 | Bacteria | 3673 |
| 225 | Ga0206352_10890638 | 3300020078 | Bacteria | 2388 |
| 226 | Ga0206350_10197218 | 3300020080 | Bacteria | 3025 |
| 227 | Ga0206350_10690641 | 3300020080 | Bacteria | 2654 |
| 228 | Ga0206350_11609180 | 3300020080 | Bacteria | 2386 |
| 229 | Ga0206354_10851720 | 3300020081 | Bacteria | 2709 |
| 230 | Ga0206353_10420202 | 3300020082 | Bacteria | 2286 |
| 231 | Ga0206353_10790204 | 3300020082 | Bacteria | 2738 |
| 232 | Ga0206353_10942493 | 3300020082 | Bacteria | 2911 |
| 233 | Ga0206353_11803527 | 3300020082 | Bacteria | 3309 |
| 234 | Ga0213876_10003347 | 3300021384 | Bacteria | 9178 |
| 235 | Ga0213875_10000547 | 3300021388 | Bacteria | 30798 |
| 236 | Ga0213875_10000781 | 3300021388 | Bacteria | 23756 |
| 237 | Ga0213875_10012233 | 3300021388 | Bacteria | 4244 |
| 238 | Ga0213875_10038392 | 3300021388 | Bacteria | 2256 |
| 239 | Ga0224712_10001180 | 3300022467 | Bacteria | 5857 |
| 240 | Ga0224712_10001750 | 3300022467 | Bacteria | 5168 |
| 241 | Ga0224712_10001854 | 3300022467 | Bacteria | 5068 |
| 242 | Ga0224712_10005293 | 3300022467 | Bacteria | 3578 |
| 243 | Ga0224712_10010884 | 3300022467 | Bacteria | 2799 |
| 244 | Ga0224712_10022844 | 3300022467 | Bacteria | 2162 |
| 245 | Ga0224572_1008564 | 3300024225 | Bacteria | 1894 |
| 246 | Ga0209758_1004169 | 3300025297 | Bacteria | 12292 |
| 247 | Ga0207692_10000819 | 3300025898 | Bacteria | 11132 |
| 248 | Ga0207692_10001032 | 3300025898 | Bacteria | 10175 |
| 249 | Ga0207688_10007902 | 3300025901 | Bacteria | 5790 |
| 250 | Ga0207688_10016234 | 3300025901 | Bacteria | 4037 |
| 251 | Ga0207647_10004731 | 3300025904 | Bacteria | 10081 |
| 252 | Ga0207647_10011050 | 3300025904 | Bacteria | 6348 |
| 253 | Ga0207647_10039342 | 3300025904 | Bacteria | 2984 |
| 254 | Ga0207685_10000849 | 3300025905 | Bacteria | 5730 |
| 255 | Ga0207685_10007109 | 3300025905 | Bacteria | 3098 |
| 256 | Ga0207699_10000338 | 3300025906 | Bacteria | 24924 |
| 257 | Ga0207699_10000737 | 3300025906 | Bacteria | 15603 |
| 258 | Ga0207699_10002992 | 3300025906 | Bacteria | 8036 |
| 259 | Ga0207699_10004669 | 3300025906 | Bacteria | 6549 |
| 260 | Ga0207705_10000550 | 3300025909 | Bacteria | 31517 |
| 261 | Ga0207705_10005392 | 3300025909 | Bacteria | 9566 |
| 262 | Ga0207705_10021321 | 3300025909 | Bacteria | 4623 |
| 263 | Ga0207684_10015231 | 3300025910 | Bacteria | 6623 |
| 264 | Ga0207684_10019463 | 3300025910 | Bacteria | 5808 |
| 265 | Ga0207684_10032533 | 3300025910 | Bacteria | 4434 |
| 266 | Ga0207654_10001414 | 3300025911 | Bacteria | 12729 |
| 267 | Ga0207707_10075370 | 3300025912 | Bacteria | 2943 |
| 268 | Ga0207707_10099957 | 3300025912 | Bacteria | 2535 |
| 269 | Ga0207695_10000957 | 3300025913 | Bacteria | 51431 |
| 270 | Ga0207671_10000405 | 3300025914 | Bacteria | 60326 |
| 271 | Ga0207693_10012722 | 3300025915 | Bacteria | 6795 |
| 272 | Ga0207693_10023030 | 3300025915 | Bacteria | 4946 |
| 273 | Ga0207693_10053010 | 3300025915 | Bacteria | 3182 |
| 274 | Ga0207663_10002971 | 3300025916 | Bacteria | 8202 |
| 275 | Ga0207663_10010608 | 3300025916 | Bacteria | 4911 |
| 276 | Ga0207660_10008750 | 3300025917 | Bacteria | 6544 |
| 277 | Ga0207660_10014961 | 3300025917 | Bacteria | 5113 |
| 278 | Ga0207662_10020710 | 3300025918 | Bacteria | 3753 |
| 279 | Ga0207657_10006528 | 3300025919 | Bacteria | 12082 |
| 280 | Ga0207657_10028947 | 3300025919 | Bacteria | 5047 |
| 281 | Ga0207657_10042748 | 3300025919 | Bacteria | 3996 |
| 282 | Ga0207652_10000015 | 3300025921 | Bacteria | 193042 |
| 283 | Ga0207652_10003427 | 3300025921 | Bacteria | 13087 |
| 284 | Ga0207652_10016038 | 3300025921 | Bacteria | 6110 |
| 285 | Ga0207652_10055066 | 3300025921 | Bacteria | 3420 |
| 286 | Ga0207646_10000105 | 3300025922 | Bacteria | 114126 |
| 287 | Ga0207646_10001355 | 3300025922 | Bacteria | 30398 |
| 288 | Ga0207646_10007603 | 3300025922 | Bacteria | 10978 |
| 289 | Ga0207646_10018738 | 3300025922 | Bacteria | 6451 |
| 290 | Ga0207646_10025959 | 3300025922 | Bacteria | 5355 |
| 291 | Ga0207646_10086177 | 3300025922 | Bacteria | 2810 |
| 292 | Ga0207694_10002983 | 3300025924 | Bacteria | 13570 |
| 293 | Ga0207694_10077156 | 3300025924 | Bacteria | 2610 |
| 294 | Ga0207687_10100117 | 3300025927 | Bacteria | 2131 |
| 295 | Ga0207687_10125859 | 3300025927 | Bacteria | 1924 |
| 296 | Ga0207700_10000737 | 3300025928 | Bacteria | 18884 |
| 297 | Ga0207700_10002110 | 3300025928 | Bacteria | 11354 |
| 298 | Ga0207700_10003804 | 3300025928 | Bacteria | 8816 |
| 299 | Ga0207700_10014056 | 3300025928 | Bacteria | 5233 |
| 300 | Ga0207700_10022870 | 3300025928 | Bacteria | 4296 |
| 301 | Ga0207700_10048216 | 3300025928 | Bacteria | 3162 |
| 302 | Ga0207700_10054712 | 3300025928 | Bacteria | 2997 |
| 303 | Ga0207664_10000171 | 3300025929 | Bacteria | 51218 |
| 304 | Ga0207664_10000683 | 3300025929 | Bacteria | 23312 |
| 305 | Ga0207664_10000992 | 3300025929 | Bacteria | 19046 |
| 306 | Ga0207664_10003484 | 3300025929 | Bacteria | 10499 |
| 307 | Ga0207664_10006127 | 3300025929 | Bacteria | 8242 |
| 308 | Ga0207664_10009752 | 3300025929 | Bacteria | 6753 |
| 309 | Ga0207664_10016628 | 3300025929 | Bacteria | 5372 |
| 310 | Ga0207664_10028888 | 3300025929 | Bacteria | 4219 |
| 311 | Ga0207664_10044380 | 3300025929 | Bacteria | 3481 |
| 312 | Ga0207664_10105998 | 3300025929 | Bacteria | 2330 |
| 313 | Ga0207664_10124222 | 3300025929 | Bacteria | 2165 |
| 314 | Ga0207690_10001323 | 3300025932 | Bacteria | 15573 |
| 315 | Ga0207690_10118954 | 3300025932 | Bacteria | 1916 |
| 316 | Ga0207706_10001492 | 3300025933 | Bacteria | 23254 |
| 317 | Ga0207686_10044246 | 3300025934 | Bacteria | 2733 |
| 318 | Ga0207709_10027016 | 3300025935 | Bacteria | 3302 |
| 319 | Ga0207709_10035623 | 3300025935 | Bacteria | 2944 |
| 320 | Ga0207670_10011841 | 3300025936 | Bacteria | 5078 |
| 321 | Ga0207704_10087528 | 3300025938 | Bacteria | 2035 |
| 322 | Ga0207665_10000278 | 3300025939 | Bacteria | 35536 |
| 323 | Ga0207665_10000650 | 3300025939 | Bacteria | 23346 |
| 324 | Ga0207665_10002702 | 3300025939 | Bacteria | 11894 |
| 325 | Ga0207665_10104683 | 3300025939 | Bacteria | 1981 |
| 326 | Ga0207691_10033704 | 3300025940 | Bacteria | 4768 |
| 327 | Ga0207689_10018433 | 3300025942 | Bacteria | 5890 |
| 328 | Ga0207661_10057216 | 3300025944 | Bacteria | 3134 |
| 329 | Ga0207667_10060147 | 3300025949 | Bacteria | 3977 |
| 330 | Ga0207668_10047607 | 3300025972 | Bacteria | 2937 |
| 331 | Ga0207640_10005196 | 3300025981 | Bacteria | 7083 |
| 332 | Ga0207640_10100034 | 3300025981 | Bacteria | 2031 |
| 333 | Ga0207658_10024425 | 3300025986 | Bacteria | 4229 |
| 334 | Ga0207677_10004838 | 3300026023 | Bacteria | 7268 |
| 335 | Ga0207678_10050248 | 3300026067 | Bacteria | 3603 |
| 336 | Ga0207708_10000076 | 3300026075 | Bacteria | 78340 |
| 337 | Ga0207708_10017836 | 3300026075 | Bacteria | 5342 |
| 338 | Ga0207702_10018909 | 3300026078 | Bacteria | 5700 |
| 339 | Ga0207702_10030308 | 3300026078 | Bacteria | 4508 |
| 340 | Ga0207702_10051423 | 3300026078 | Bacteria | 3482 |
| 341 | Ga0207702_10111984 | 3300026078 | Bacteria | 2428 |
| 342 | Ga0207648_10148255 | 3300026089 | Bacteria | 2070 |
| 343 | Ga0207676_10009004 | 3300026095 | Bacteria | 7104 |
| 344 | Ga0207674_10004920 | 3300026116 | Bacteria | 15972 |
| 345 | Ga0207674_10005169 | 3300026116 | Bacteria | 15556 |
| 346 | Ga0207674_10043356 | 3300026116 | Bacteria | 4639 |
| 347 | Ga0207675_100018820 | 3300026118 | Bacteria | 6444 |
| 348 | Ga0207683_10029753 | 3300026121 | Bacteria | 4729 |
| 349 | Ga0207683_10030781 | 3300026121 | Bacteria | 4653 |
| 350 | Ga0207683_10051377 | 3300026121 | Bacteria | 3611 |
| 351 | Ga0207683_10137904 | 3300026121 | Bacteria | 2196 |
| 352 | Ga0207683_10148086 | 3300026121 | Bacteria | 2118 |
| 353 | Ga0207698_10007766 | 3300026142 | Bacteria | 6738 |
| 354 | Ga0207698_10140480 | 3300026142 | Bacteria | 2080 |
| 355 | Ga0207428_10003495 | 3300027907 | Bacteria | 15231 |
| 356 | Ga0207428_10019672 | 3300027907 | Bacteria | 5754 |
| 357 | Ga0265337_1000014 | 3300028556 | Bacteria | 81870 |
| 358 | Ga0265326_10000789 | 3300028558 | Bacteria | 11730 |
| 359 | Ga0265319_1004236 | 3300028563 | Bacteria | 7162 |
| 360 | Ga0265334_10000160 | 3300028573 | Bacteria | 41820 |
| 361 | Ga0265334_10001483 | 3300028573 | Bacteria | 11317 |
| 362 | Ga0265323_10004706 | 3300028653 | Bacteria | 5853 |
| 363 | Ga0265336_10003919 | 3300028666 | Bacteria | 5703 |
| 364 | Ga0307515_10058339 | 3300028794 | Bacteria | 5561 |
| 365 | Ga0307515_10131999 | 3300028794 | Bacteria | 2743 |
| 366 | Ga0265338_10000148 | 3300028800 | Bacteria | 128839 |
| 367 | Ga0265338_10000577 | 3300028800 | Bacteria | 64591 |
| 368 | Ga0265338_10004722 | 3300028800 | Bacteria | 18243 |
| 369 | Ga0265338_10014617 | 3300028800 | Bacteria | 8711 |
| 370 | Ga0265324_10002464 | 3300029957 | Bacteria | 9412 |
| 371 | Ga0268256_1011284 | 3300030500 | Bacteria | 2840 |
| 372 | Ga0307511_10067650 | 3300030521 | Bacteria | 2648 |
| 373 | Ga0316181_1252189 | 3300030744 | Bacteria | 2834 |
| 374 | Ga0265332_10000443 | 3300031238 | Bacteria | 29217 |
| 375 | Ga0265320_10001651 | 3300031240 | Bacteria | 15876 |
| 376 | Ga0265325_10002380 | 3300031241 | Bacteria | 12708 |
| 377 | Ga0265340_10001774 | 3300031247 | Bacteria | 12312 |
| 378 | Ga0265339_10027146 | 3300031249 | Bacteria | 3273 |
| 379 | Ga0265316_10009251 | 3300031344 | Bacteria | 9071 |
| 380 | Ga0265316_10082874 | 3300031344 | Bacteria | 2457 |
| 381 | Ga0307513_10023311 | 3300031456 | Bacteria | 7235 |
| 382 | Ga0307513_10026989 | 3300031456 | Bacteria | 6605 |
| 383 | Ga0307408_100014447 | 3300031548 | Bacteria | 5246 |
| 384 | Ga0265313_10009246 | 3300031595 | Bacteria | 6420 |
| 385 | Ga0307508_10016684 | 3300031616 | Bacteria | 6682 |
| 386 | Ga0307508_10018583 | 3300031616 | Bacteria | 6317 |
| 387 | Ga0307508_10020494 | 3300031616 | Bacteria | 6004 |
| 388 | Ga0307508_10025970 | 3300031616 | Bacteria | 5311 |
| 389 | Ga0307514_10005681 | 3300031649 | Bacteria | 11048 |
| 390 | Ga0307514_10033883 | 3300031649 | Bacteria | 4071 |
| 391 | Ga0307514_10083453 | 3300031649 | Bacteria | 2355 |
| 392 | Ga0316575_10001367 | 3300031665 | Bacteria | 7834 |
| 393 | Ga0316575_10040892 | 3300031665 | Bacteria | 1833 |
| 394 | Ga0316579_10000001 | 3300031691 | Bacteria | 77478 |
| 395 | Ga0316579_10013526 | 3300031691 | Bacteria | 3511 |
| 396 | Ga0316579_10019729 | 3300031691 | Bacteria | 2982 |
| 397 | Ga0265314_10005926 | 3300031711 | Bacteria | 10933 |
| 398 | Ga0265314_10007762 | 3300031711 | Bacteria | 9277 |
| 399 | Ga0316576_10002620 | 3300031727 | Bacteria | 10287 |
| 400 | Ga0316576_10006560 | 3300031727 | Bacteria | 7258 |
| 401 | Ga0316576_10020489 | 3300031727 | Bacteria | 4554 |
| 402 | Ga0316578_10003178 | 3300031728 | Bacteria | 7439 |
| 403 | Ga0316578_10006131 | 3300031728 | Bacteria | 5905 |
| 404 | Ga0316578_10012533 | 3300031728 | Bacteria | 4473 |
| 405 | Ga0316578_10023272 | 3300031728 | Bacteria | 3466 |
| 406 | Ga0307516_10014655 | 3300031730 | Bacteria | 8283 |
| 407 | Ga0307516_10085636 | 3300031730 | Bacteria | 2989 |
| 408 | Ga0307405_10015926 | 3300031731 | Bacteria | 4086 |
| 409 | Ga0307405_10020321 | 3300031731 | Bacteria | 3708 |
| 410 | Ga0307405_10052481 | 3300031731 | Bacteria | 2535 |
| 411 | Ga0316577_10044242 | 3300031733 | Bacteria | 2490 |
| 412 | Ga0307413_10003683 | 3300031824 | Bacteria | 6511 |
| 413 | Ga0307410_10000043 | 3300031852 | Bacteria | 43864 |
| 414 | Ga0307410_10006019 | 3300031852 | Bacteria | 6501 |
| 415 | Ga0307410_10038838 | 3300031852 | Bacteria | 3121 |
| 416 | Ga0307410_10057397 | 3300031852 | Bacteria | 2651 |
| 417 | Ga0307410_10111175 | 3300031852 | Bacteria | 1982 |
| 418 | Ga0307406_10000008 | 3300031901 | Bacteria | 120233 |
| 419 | Ga0307406_10006451 | 3300031901 | Bacteria | 6476 |
| 420 | Ga0307407_10000710 | 3300031903 | Bacteria | 10840 |
| 421 | Ga0307407_10019224 | 3300031903 | Bacteria | 3474 |
| 422 | Ga0307409_100000014 | 3300031995 | Bacteria | 62867 |
| 423 | Ga0307409_100000561 | 3300031995 | Bacteria | 16158 |
| 424 | Ga0307409_100011137 | 3300031995 | Bacteria | 5647 |
| 425 | Ga0307409_100097597 | 3300031995 | Bacteria | 2427 |
| 426 | Ga0307409_100120252 | 3300031995 | Bacteria | 2223 |
| 427 | Ga0307416_100000088 | 3300032002 | Bacteria | 62911 |
| 428 | Ga0307416_100002704 | 3300032002 | Bacteria | 10272 |
| 429 | Ga0307416_100009589 | 3300032002 | Bacteria | 6346 |
| 430 | Ga0307416_100017669 | 3300032002 | Bacteria | 4999 |
| 431 | Ga0307416_100022381 | 3300032002 | Bacteria | 4561 |
| 432 | Ga0307416_100069765 | 3300032002 | Bacteria | 2910 |
| 433 | Ga0307414_10005251 | 3300032004 | Bacteria | 7120 |
| 434 | Ga0307411_10000384 | 3300032005 | Bacteria | 15110 |
| 435 | Ga0307411_10125395 | 3300032005 | Bacteria | 1866 |
| 436 | Ga0307415_100000019 | 3300032126 | Bacteria | 70406 |
| 437 | Ga0307415_100005409 | 3300032126 | Bacteria | 6779 |
| 438 | Ga0307415_100020493 | 3300032126 | Bacteria | 4038 |
| 439 | Ga0307415_100027411 | 3300032126 | Bacteria | 3609 |
| 440 | Ga0307507_10000009 | 3300033179 | Bacteria | 265992 |
| 441 | Ga0307510_10017401 | 3300033180 | Bacteria | 8477 |
| 442 | Ga0316596_1003704 | 3300033541 | Bacteria | 3375 |
| 443 | Ga0316596_1010369 | 3300033541 | Bacteria | 2253 |
| 444 | Ga0316212_1003286 | 3300033547 | Bacteria | 2327 |
| 445 | Ga0373930_0008290 | 3300034816 | Bacteria | 1816 |
| 446 | Ga0373926_0000105 | 3300035083 | Bacteria | 16863 |
| 447 | Ga0373926_0000466 | 3300035083 | Bacteria | 10642 |
| 448 | Ga0373926_0005218 | 3300035083 | Bacteria | 4277 |
| 449 | Ga0373934_0000054 | 3300035086 | Bacteria | 38975 |
| 450 | Ga0373934_0002514 | 3300035086 | Bacteria | 6739 |
| 451 | Ga0373934_0007077 | 3300035086 | Bacteria | 4163 |
| 452 | Ga0373944_0023275 | 3300035089 | Bacteria | 1806 |
| 453 | Ga0373923_0007771 | 3300035111 | Bacteria | 3788 |
| 454 | Ga0373923_0009106 | 3300035111 | Bacteria | 3571 |
| 455 | Ga0373936_0001451 | 3300035113 | Bacteria | 8603 |
| 456 | Ga0373936_0002308 | 3300035113 | Bacteria | 7137 |
| 457 | Ga0373936_0004305 | 3300035113 | Bacteria | 5378 |
| 458 | Ga0373945_0000026 | 3300035116 | Bacteria | 29970 |
| 459 | Ga0373953_0000343 | 3300035117 | Bacteria | 12556 |
| 460 | Ga0373953_0013819 | 3300035117 | Bacteria | 2891 |
| 461 | Ga0373953_0034317 | 3300035117 | Bacteria | 1988 |
| 462 | Ga0373954_0001747 | 3300035118 | Bacteria | 8921 |
| 463 | Ga0373954_0031614 | 3300035118 | Bacteria | 2444 |
| 464 | Ga0373956_0000083 | 3300035119 | Bacteria | 31785 |
| 465 | Ga0373956_0011130 | 3300035119 | Bacteria | 3704 |
| 466 | Ga0373957_0000013 | 3300035120 | Bacteria | 44715 |
| 467 | Ga0373943_0000073 | 3300035170 | Bacteria | 35361 |
| 468 | Ga0373943_0004602 | 3300035170 | Bacteria | 6235 |
| 469 | Ga0373943_0013902 | 3300035170 | Bacteria | 3639 |
| 470 | Ga0373943_0059990 | 3300035170 | Bacteria | 1898 |
| 471 | Ga0373946_0000103 | 3300035171 | Bacteria | 23988 |
| 472 | Ga0373955_0000009 | 3300035172 | Bacteria | 81129 |
| 473 | Ga0373955_0030449 | 3300035172 | Bacteria | 2817 |
| 474 | Ga0373955_0052417 | 3300035172 | Bacteria | 2225 |
| 475 | Ga0316574_0016554 | 3300035398 | Bacteria | 4299 |
| 476 | Ga0316574_0018770 | 3300035398 | Bacteria | 4069 |
| 477 | Ga0373924_0002152 | 3300035410 | Bacteria | 6595 |
| 478 | Ga0373924_0015170 | 3300035410 | Bacteria | 2924 |
| 479 | Ga0373935_0001433 | 3300035692 | Bacteria | 13214 |
| 480 | Ga0373935_0045885 | 3300035692 | Bacteria | 2758 |
| 481 | Ga0373935_0056507 | 3300035692 | Bacteria | 2502 |
| 482 | Ga0373927_0027780 | 3300035695 | Bacteria | 3694 |
| 483 | Ga0373927_0086844 | 3300035695 | Bacteria | 2030 |
| 484 | Ga0373933_0000006 | 3300035724 | Bacteria | 125141 |
| 485 | Ga0373933_0007416 | 3300035724 | Bacteria | 5982 |
| 486 | Ga0373933_0030297 | 3300035724 | Bacteria | 3132 |
| 487 | Ga0373933_0033312 | 3300035724 | Bacteria | 2996 |
| 488 | Ga0373947_0001176 | 3300035725 | Bacteria | 16097 |
| 489 | Ga0373947_0003755 | 3300035725 | Bacteria | 8962 |
| 490 | Ga0373947_0013107 | 3300035725 | Bacteria | 4752 |
| 491 | Ga0373937_0000148 | 3300036401 | Bacteria | 67378 |
| 492 | Ga0373937_0008996 | 3300036401 | Bacteria | 8671 |
| 493 | Ga0373937_0018307 | 3300036401 | Bacteria | 6253 |
| 494 | Ga0373937_0094415 | 3300036401 | Bacteria | 2773 |
| 495 | Ga0372808_000487 | 3300036459 | Bacteria | 3160 |
| 496 | Ga0316582_0009314 | 3300036647 | Bacteria | 5324 |
| 497 | Ga0316582_0036417 | 3300036647 | Bacteria | 3046 |
| 498 | Ga0316582_0073043 | 3300036647 | Bacteria | 2225 |
| 499 | Ga0316584_0003561 | 3300036712 | Bacteria | 10167 |
| 500 | Ga0316584_0052020 | 3300036712 | Bacteria | 3063 |
| 501 | Ga0316584_0056574 | 3300036712 | Bacteria | 2936 |
| 502 | Ga0316584_0066535 | 3300036712 | Bacteria | 2700 |
| 503 | Ga0373925_0000004 | 3300037068 | Bacteria | 361597 |
| 504 | Ga0373925_0002932 | 3300037068 | Bacteria | 13456 |
| 505 | Ga0373925_0006283 | 3300037068 | Bacteria | 8756 |
| 506 | Ga0373925_0010217 | 3300037068 | Bacteria | 6813 |
| 507 | Ga0373925_0057438 | 3300037068 | Bacteria | 2916 |
| 508 | Ga0373925_0095847 | 3300037068 | Bacteria | 2273 |
| 509 | Ga0373925_0128967 | 3300037068 | Bacteria | 1970 |
| 510 | Ga0395899_0003357 | 3300037312 | Bacteria | 12697 |
| 511 | Ga0395899_0037552 | 3300037312 | Bacteria | 3631 |
| 512 | Ga0395900_0033916 | 3300037418 | Bacteria | 5254 |
| 513 | Ga0395900_0062817 | 3300037418 | Bacteria | 3818 |
| 514 | Ga0395898_0003223 | 3300037466 | Bacteria | 18359 |
| 515 | Ga0395898_0012248 | 3300037466 | Bacteria | 8867 |
| 516 | Ga0395898_0013671 | 3300037466 | Bacteria | 8351 |
| 517 | Ga0395898_0019426 | 3300037466 | Bacteria | 6915 |
| 518 | Ga0395898_0046997 | 3300037466 | Bacteria | 4238 |
| 519 | Ga0395898_0099821 | 3300037466 | Bacteria | 2788 |
| 520 | Ga0395898_0169238 | 3300037466 | Bacteria | 2089 |
| 521 | Ga0436364_0112641 | 3300037853 | Bacteria | 82637 |
| 522 | Ga0436364_0195638 | 3300037853 | Bacteria | 19495 |
| 523 | Ga0436364_0531653 | 3300037853 | Bacteria | 5078 |
| 524 | Ga0436364_1133930 | 3300037853 | Bacteria | 44830 |
| 525 | Ga0436364_1202907 | 3300037853 | Bacteria | 10551 |
| 526 | Ga0395901_0014343 | 3300038443 | Bacteria | 8069 |
| 527 | Ga0395901_0045839 | 3300038443 | Bacteria | 4539 |
| 528 | Ga0395901_0060892 | 3300038443 | Bacteria | 3928 |
| 529 | Ga0400485_08073 | 3300038735 | Bacteria | 15156 |
| 530 | Ga0400488_53579 | 3300038741 | Bacteria | 13182 |
| 531 | Ga0400486_26016 | 3300038742 | Bacteria | 85615 |
| 532 | Ga0436365_0567091 | 3300039437 | Bacteria | 46375 |
| 533 | Ga0436363_0661712 | 3300039450 | Bacteria | 1536 |
| 534 | Ga0439436_0000557 | 3300041404 | Bacteria | 9817 |
| 535 | Ga0439439_0000765 | 3300041406 | Bacteria | 5795 |
| 536 | Ga0451789_0138174 | 3300041443 | Bacteria | 2208 |
| 537 | Ga0451791_0734773 | 3300041451 | Bacteria | 4078 |
| 538 | Ga0451795_0548267 | 3300041456 | Bacteria | 1952 |
| 539 | Ga0451849_0159173 | 3300041505 | Bacteria | 1939 |
| 540 | Ga0451843_1177035 | 3300041509 | Bacteria | 3599 |
| 541 | Ga0451853_2494527 | 3300041512 | Bacteria | 8272 |
| 542 | Ga0439433_0013858 | 3300041999 | Bacteria | 1773 |
| 543 | Ga0439442_014674 | 3300042002 | Bacteria | 1613 |
| 544 | Ga0439448_0007405 | 3300042005 | Bacteria | 3182 |
| 545 | Ga0439455_0002672 | 3300042012 | Bacteria | 3284 |
| 546 | Ga0439457_000323 | 3300042014 | Bacteria | 13227 |
| 547 | Ga0439457_001128 | 3300042014 | Bacteria | 8031 |
| 548 | Ga0439463_000980 | 3300042016 | Bacteria | 7776 |
| 549 | Ga0450894_000618 | 3300042131 | Bacteria | 5988 |
| 550 | Ga0450898_002268 | 3300042134 | Bacteria | 2674 |
| 551 | Ga0450899_000145 | 3300042135 | Bacteria | 6779 |
| 552 | Ga0450903_000727 | 3300042138 | Bacteria | 6505 |
| 553 | Ga0450906_004155 | 3300042145 | Bacteria | 3059 |
| 554 | Ga0450908_005005 | 3300042184 | Bacteria | 2544 |
| 555 | Ga0466969_0001092 | 3300044656 | Bacteria | 14655 |
| 556 | Ga0466969_0001548 | 3300044656 | Bacteria | 12356 |
| 557 | Ga0466969_0003332 | 3300044656 | Bacteria | 8553 |
| 558 | Ga0466969_0003795 | 3300044656 | Bacteria | 8028 |
| 559 | Ga0466969_0009388 | 3300044656 | Bacteria | 5184 |
| 560 | Ga0466969_0021457 | 3300044656 | Bacteria | 3339 |
| 561 | Ga0466969_0030450 | 3300044656 | Bacteria | 2750 |
| 562 | Ga0466972_0003101 | 3300044658 | Bacteria | 8245 |
| 563 | Ga0466965_0000974 | 3300044683 | Bacteria | 11085 |
| 564 | Ga0466966_0002114 | 3300044684 | Bacteria | 12908 |
| 565 | Ga0466966_0002908 | 3300044684 | Bacteria | 11285 |
| 566 | Ga0466966_0016563 | 3300044684 | Bacteria | 4867 |
| 567 | Ga0466966_0026217 | 3300044684 | Bacteria | 3806 |
| 568 | Ga0466966_0082745 | 3300044684 | Bacteria | 1997 |
| 569 | Ga0466961_0001308 | 3300044693 | Bacteria | 15365 |
| 570 | Ga0466961_0001396 | 3300044693 | Bacteria | 14959 |
| 571 | Ga0466961_0002697 | 3300044693 | Bacteria | 11019 |
| 572 | Ga0466961_0004026 | 3300044693 | Bacteria | 9205 |
| 573 | Ga0466961_0005970 | 3300044693 | Bacteria | 7717 |
| 574 | Ga0466961_0008148 | 3300044693 | Bacteria | 6676 |
| 575 | Ga0466961_0008920 | 3300044693 | Bacteria | 6398 |
| 576 | Ga0466961_0022167 | 3300044693 | Bacteria | 4086 |
| 577 | Ga0466961_0025205 | 3300044693 | Bacteria | 3825 |
| 578 | Ga0466961_0052646 | 3300044693 | Bacteria | 2598 |
| 579 | Ga0466963_0004535 | 3300044694 | Bacteria | 8084 |
| 580 | Ga0466963_0005648 | 3300044694 | Bacteria | 7345 |
| 581 | Ga0466963_0047849 | 3300044694 | Bacteria | 2824 |
| 582 | Ga0466964_0001929 | 3300044706 | Bacteria | 7260 |
| 583 | Ga0466971_0000220 | 3300044719 | Bacteria | 21963 |
| 584 | Ga0466971_0005159 | 3300044719 | Bacteria | 5654 |
| 585 | Ga0466970_0001370 | 3300044765 | Bacteria | 11744 |
| 586 | Ga0466957_0000798 | 3300044842 | Bacteria | 16086 |
| 587 | Ga0466957_0014746 | 3300044842 | Bacteria | 4552 |
| 588 | Ga0466957_0023644 | 3300044842 | Bacteria | 3633 |
| 589 | Ga0466957_0131321 | 3300044842 | Bacteria | 1605 |
| 590 | Ga0466960_0002037 | 3300044901 | Bacteria | 7504 |
| 591 | Ga0466960_0013305 | 3300044901 | Bacteria | 3493 |
| 592 | Ga0466959_0004898 | 3300045049 | Bacteria | 9065 |
| 593 | Ga0466959_0010580 | 3300045049 | Bacteria | 6603 |
| 594 | Ga0466959_0011045 | 3300045049 | Bacteria | 6481 |
| 595 | Ga0466959_0020304 | 3300045049 | Bacteria | 4893 |
| 596 | Ga0466959_0031253 | 3300045049 | Bacteria | 3940 |
| 597 | Ga0466959_0036140 | 3300045049 | Bacteria | 3649 |
| 598 | Ga0466959_0103213 | 3300045049 | Bacteria | 2040 |
| 599 | Ga0466958_0012778 | 3300045836 | Bacteria | 4763 |
| 600 | Ga0466958_0014558 | 3300045836 | Bacteria | 4489 |
| 601 | Ga0466958_0018195 | 3300045836 | Bacteria | 4074 |
| 602 | Ga0466958_0024515 | 3300045836 | Bacteria | 3550 |
| 603 | Ga0466958_0035590 | 3300045836 | Bacteria | 2975 |
| 604 | Ga0466967_0002536 | 3300045976 | Bacteria | 11434 |
| 605 | Ga0466967_0005065 | 3300045976 | Bacteria | 9040 |
| 606 | Ga0466967_0007108 | 3300045976 | Bacteria | 8033 |
| 607 | Ga0466967_0014770 | 3300045976 | Bacteria | 6101 |
| 608 | Ga0466967_0048027 | 3300045976 | Bacteria | 3725 |
| 609 | Ga0466967_0051928 | 3300045976 | Bacteria | 3596 |
| 610 | Ga0466967_0054843 | 3300045976 | Bacteria | 3510 |
| 611 | Ga0466967_0138981 | 3300045976 | Bacteria | 2261 |
| 612 | Ga0466967_0200255 | 3300045976 | Bacteria | 1891 |
| 613 | Ga0495617_012501 | 3300046452 | Bacteria | 2893 |
| 614 | Ga0495627_008465 | 3300046453 | Bacteria | 3855 |
| 615 | Ga0495592_0000189 | 3300046454 | Bacteria | 54324 |
| 616 | Ga0495592_0006449 | 3300046454 | Bacteria | 8735 |
| 617 | Ga0495592_0008293 | 3300046454 | Bacteria | 7798 |
| 618 | Ga0495592_0019414 | 3300046454 | Bacteria | 5169 |
| 619 | Ga0495592_0031081 | 3300046454 | Bacteria | 4037 |
| 620 | Ga0495592_0038942 | 3300046454 | Bacteria | 3573 |
| 621 | Ga0495603_0000082 | 3300046455 | Bacteria | 42500 |
| 622 | Ga0495603_0005180 | 3300046455 | Bacteria | 7784 |
| 623 | Ga0495603_0007827 | 3300046455 | Bacteria | 6441 |
| 624 | Ga0495603_0010487 | 3300046455 | Bacteria | 5615 |
| 625 | Ga0495603_0012953 | 3300046455 | Bacteria | 5042 |
| 626 | Ga0495629_0003195 | 3300046459 | Bacteria | 12402 |
| 627 | Ga0495629_0008790 | 3300046459 | Bacteria | 7428 |
| 628 | Ga0495629_0010724 | 3300046459 | Bacteria | 6665 |
| 629 | Ga0495629_0053734 | 3300046459 | Bacteria | 2817 |
| 630 | Ga0495629_0083662 | 3300046459 | Bacteria | 2227 |
| 631 | Ga0495629_0085769 | 3300046459 | Bacteria | 2197 |
| 632 | Ga0495638_0025505 | 3300046460 | Bacteria | 3841 |
| 633 | Ga0495638_0044571 | 3300046460 | Bacteria | 2794 |
| 634 | Ga0495651_0000071 | 3300046462 | Bacteria | 73914 |
| 635 | Ga0495651_0000708 | 3300046462 | Bacteria | 25865 |
| 636 | Ga0495651_0003342 | 3300046462 | Bacteria | 12315 |
| 637 | Ga0495651_0004996 | 3300046462 | Bacteria | 10132 |
| 638 | Ga0495651_0009515 | 3300046462 | Bacteria | 7463 |
| 639 | Ga0495651_0009985 | 3300046462 | Bacteria | 7298 |
| 640 | Ga0495651_0015296 | 3300046462 | Bacteria | 5931 |
| 641 | Ga0495651_0019398 | 3300046462 | Bacteria | 5270 |
| 642 | Ga0495651_0023269 | 3300046462 | Bacteria | 4818 |
| 643 | Ga0495651_0026171 | 3300046462 | Bacteria | 4543 |
| 644 | Ga0495653_0009372 | 3300046463 | Bacteria | 8009 |
| 645 | Ga0495653_0010877 | 3300046463 | Bacteria | 7449 |
| 646 | Ga0495653_0016368 | 3300046463 | Bacteria | 6040 |
| 647 | Ga0495653_0032484 | 3300046463 | Bacteria | 4142 |
| 648 | Ga0495653_0069571 | 3300046463 | Bacteria | 2636 |
| 649 | Ga0495653_0073881 | 3300046463 | Bacteria | 2543 |
| 650 | Ga0495653_0105727 | 3300046463 | Bacteria | 2031 |
| 651 | Ga0495580_0053431 | 3300046472 | Bacteria | 2850 |
| 652 | Ga0495582_0002562 | 3300046473 | Bacteria | 10116 |
| 653 | Ga0495582_0008071 | 3300046473 | Bacteria | 5810 |
| 654 | Ga0495582_0010553 | 3300046473 | Bacteria | 5081 |
| 655 | Ga0495605_0009406 | 3300046474 | Bacteria | 5489 |
| 656 | Ga0495639_0003116 | 3300046475 | Bacteria | 7206 |
| 657 | Ga0495639_0062747 | 3300046475 | Bacteria | 1705 |
| 658 | Ga0495662_0002994 | 3300046476 | Bacteria | 8525 |
| 659 | Ga0495662_0007814 | 3300046476 | Bacteria | 5265 |
| 660 | Ga0495662_0009305 | 3300046476 | Bacteria | 4819 |
| 661 | Ga0495662_0057986 | 3300046476 | Bacteria | 1870 |
| 662 | Ga0495664_0003163 | 3300046477 | Bacteria | 8938 |
| 663 | Ga0495664_0004338 | 3300046477 | Bacteria | 7746 |
| 664 | Ga0495664_0005713 | 3300046477 | Bacteria | 6848 |
| 665 | Ga0495664_0024459 | 3300046477 | Bacteria | 3511 |
| 666 | Ga0495664_0032644 | 3300046477 | Bacteria | 3056 |
| 667 | Ga0495664_0040472 | 3300046477 | Bacteria | 2756 |
| 668 | Ga0495585_0081628 | 3300046492 | Bacteria | 1751 |
| 669 | Ga0495594_0012643 | 3300046499 | Bacteria | 4401 |
| 670 | Ga0495607_0021059 | 3300046501 | Bacteria | 4107 |
| 671 | Ga0495608_0000107 | 3300046511 | Bacteria | 59326 |
| 672 | Ga0495608_0002791 | 3300046511 | Bacteria | 12531 |
| 673 | Ga0495608_0004680 | 3300046511 | Bacteria | 9788 |
| 674 | Ga0495608_0006891 | 3300046511 | Bacteria | 8049 |
| 675 | Ga0495608_0040533 | 3300046511 | Bacteria | 3119 |
| 676 | Ga0495608_0093597 | 3300046511 | Bacteria | 1941 |
| 677 | Ga0495610_0025302 | 3300046512 | Bacteria | 3187 |
| 678 | Ga0495616_0005670 | 3300046513 | Bacteria | 7647 |
| 679 | Ga0495618_0003261 | 3300046514 | Bacteria | 10158 |
| 680 | Ga0495618_0006446 | 3300046514 | Bacteria | 7125 |
| 681 | Ga0495618_0006640 | 3300046514 | Bacteria | 7010 |
| 682 | Ga0495618_0010914 | 3300046514 | Bacteria | 5501 |
| 683 | Ga0495618_0023583 | 3300046514 | Bacteria | 3806 |
| 684 | Ga0495618_0060827 | 3300046514 | Bacteria | 2395 |
| 685 | Ga0495620_0016027 | 3300046515 | Bacteria | 3771 |
| 686 | Ga0495628_0000136 | 3300046516 | Bacteria | 62431 |
| 687 | Ga0495628_0003511 | 3300046516 | Bacteria | 14030 |
| 688 | Ga0495628_0025864 | 3300046516 | Bacteria | 4792 |
| 689 | Ga0495628_0062539 | 3300046516 | Bacteria | 2917 |
| 690 | Ga0495628_0106628 | 3300046516 | Bacteria | 2157 |
| 691 | Ga0495630_0005518 | 3300046517 | Bacteria | 8924 |
| 692 | Ga0495630_0069945 | 3300046517 | Bacteria | 2640 |
| 693 | Ga0495631_0018871 | 3300046518 | Bacteria | 3241 |
| 694 | Ga0495637_0057332 | 3300046520 | Bacteria | 1609 |
| 695 | Ga0495643_0010414 | 3300046522 | Bacteria | 5725 |
| 696 | Ga0495666_0003956 | 3300046526 | Bacteria | 7494 |
| 697 | Ga0495666_0015376 | 3300046526 | Bacteria | 3810 |
| 698 | Ga0495666_0057347 | 3300046526 | Bacteria | 1864 |
| 699 | Ga0495652_0000732 | 3300046529 | Bacteria | 37991 |
| 700 | Ga0495652_0001718 | 3300046529 | Bacteria | 23592 |
| 701 | Ga0495652_0012349 | 3300046529 | Bacteria | 7708 |
| 702 | Ga0495652_0020541 | 3300046529 | Bacteria | 5870 |
| 703 | Ga0495652_0043078 | 3300046529 | Bacteria | 3890 |
| 704 | Ga0495652_0055605 | 3300046529 | Bacteria | 3364 |
| 705 | Ga0495652_0077057 | 3300046529 | Bacteria | 2764 |
| 706 | Ga0495654_0016160 | 3300046530 | Bacteria | 3951 |
| 707 | Ga0495665_0009647 | 3300046531 | Bacteria | 5229 |
| 708 | Ga0495665_0009885 | 3300046531 | Bacteria | 5164 |
| 709 | Ga0495665_0037121 | 3300046531 | Bacteria | 2600 |
| 710 | Ga0495640_0006120 | 3300046533 | Bacteria | 9537 |
| 711 | Ga0495640_0007093 | 3300046533 | Bacteria | 8816 |
| 712 | Ga0495640_0010766 | 3300046533 | Bacteria | 7055 |
| 713 | Ga0495640_0025636 | 3300046533 | Bacteria | 4272 |
| 714 | Ga0495640_0035637 | 3300046533 | Bacteria | 3520 |
| 715 | Ga0495640_0072223 | 3300046533 | Bacteria | 2312 |
| 716 | Ga0495586_0009559 | 3300046535 | Bacteria | 5166 |
| 717 | Ga0495587_0000070 | 3300046536 | Bacteria | 85402 |
| 718 | Ga0495587_0003232 | 3300046536 | Bacteria | 10899 |
| 719 | Ga0495587_0003909 | 3300046536 | Bacteria | 9885 |
| 720 | Ga0495587_0020513 | 3300046536 | Bacteria | 4079 |
| 721 | Ga0495587_0031829 | 3300046536 | Bacteria | 3191 |
| 722 | Ga0495597_0026695 | 3300046542 | Bacteria | 2652 |
| 723 | Ga0495645_0003283 | 3300046543 | Bacteria | 10963 |
| 724 | Ga0495645_0009696 | 3300046543 | Bacteria | 6734 |
| 725 | Ga0495645_0019011 | 3300046543 | Bacteria | 4944 |
| 726 | Ga0495645_0020301 | 3300046543 | Bacteria | 4791 |
| 727 | Ga0495645_0021409 | 3300046543 | Bacteria | 4673 |
| 728 | Ga0495645_0037195 | 3300046543 | Bacteria | 3547 |
| 729 | Ga0495645_0063535 | 3300046543 | Bacteria | 2672 |
| 730 | Ga0495622_0011931 | 3300046557 | Bacteria | 4019 |
| 731 | Ga0495667_0000048 | 3300046559 | Bacteria | 117509 |
| 732 | Ga0495667_0015266 | 3300046559 | Bacteria | 5186 |
| 733 | Ga0495667_0033993 | 3300046559 | Bacteria | 3409 |
| 734 | Ga0495667_0041363 | 3300046559 | Bacteria | 3057 |
| 735 | Ga0495667_0135700 | 3300046559 | Bacteria | 1586 |
| 736 | Ga0495656_0045734 | 3300046615 | Bacteria | 1849 |
| 737 | Ga0495668_0005137 | 3300046616 | Bacteria | 8996 |
| 738 | Ga0495634_0002233 | 3300046642 | Bacteria | 16223 |
| 739 | Ga0495634_0010992 | 3300046642 | Bacteria | 6606 |
| 740 | Ga0495634_0013252 | 3300046642 | Bacteria | 5961 |
| 741 | Ga0495634_0072588 | 3300046642 | Bacteria | 2263 |
| 742 | Ga0495634_0079036 | 3300046642 | Bacteria | 2154 |
| 743 | Ga0495634_0083437 | 3300046642 | Bacteria | 2085 |
| 744 | Ga0495625_0118444 | 3300046660 | Bacteria | 1804 |
| 745 | Ga0495635_0001155 | 3300046663 | Bacteria | 17613 |
| 746 | Ga0495635_0008954 | 3300046663 | Bacteria | 6986 |
| 747 | Ga0495635_0034387 | 3300046663 | Bacteria | 3514 |
| 748 | Ga0495635_0057588 | 3300046663 | Bacteria | 2673 |
| 749 | Ga0495635_0066146 | 3300046663 | Bacteria | 2479 |
| 750 | Ga0495661_0023753 | 3300046665 | Bacteria | 3974 |
| 751 | Ga0495588_0000889 | 3300046674 | Bacteria | 13194 |
| 752 | Ga0495657_0000046 | 3300046675 | Bacteria | 106064 |
| 753 | Ga0495657_0004680 | 3300046675 | Bacteria | 10911 |
| 754 | Ga0495657_0008676 | 3300046675 | Bacteria | 7759 |
| 755 | Ga0495657_0009724 | 3300046675 | Bacteria | 7266 |
| 756 | Ga0495657_0012224 | 3300046675 | Bacteria | 6383 |
| 757 | Ga0495657_0018394 | 3300046675 | Bacteria | 5059 |
| 758 | Ga0495657_0026036 | 3300046675 | Bacteria | 4147 |
| 759 | Ga0495657_0031609 | 3300046675 | Bacteria | 3698 |
| 760 | Ga0495599_0000023 | 3300046678 | Bacteria | 125139 |
| 761 | Ga0495599_0002361 | 3300046678 | Bacteria | 10962 |
| 762 | Ga0495599_0033068 | 3300046678 | Bacteria | 3248 |
| 763 | Ga0495599_0072170 | 3300046678 | Bacteria | 2154 |
| 764 | Ga0495623_0000157 | 3300046679 | Bacteria | 42271 |
| 765 | Ga0495623_0009340 | 3300046679 | Bacteria | 6369 |
| 766 | Ga0495623_0011858 | 3300046679 | Bacteria | 5647 |
| 767 | Ga0495623_0016802 | 3300046679 | Bacteria | 4728 |
| 768 | Ga0495623_0020578 | 3300046679 | Bacteria | 4264 |
| 769 | Ga0495623_0081380 | 3300046679 | Bacteria | 2002 |
| 770 | Ga0495646_0012336 | 3300046680 | Bacteria | 5435 |
| 771 | Ga0495658_0003148 | 3300046683 | Bacteria | 8224 |
| 772 | Ga0495658_0007177 | 3300046683 | Bacteria | 5504 |
| 773 | Ga0495658_0043113 | 3300046683 | Bacteria | 2522 |
| 774 | Ga0495658_0055501 | 3300046683 | Bacteria | 2257 |
| 775 | Ga0495669_0002176 | 3300046684 | Bacteria | 8042 |
| 776 | Ga0495613_0004199 | 3300046689 | Bacteria | 10782 |
| 777 | Ga0495613_0008146 | 3300046689 | Bacteria | 7796 |
| 778 | Ga0495613_0009441 | 3300046689 | Bacteria | 7235 |
| 779 | Ga0495613_0011261 | 3300046689 | Bacteria | 6643 |
| 780 | Ga0495613_0011520 | 3300046689 | Bacteria | 6577 |
| 781 | Ga0495613_0144616 | 3300046689 | Bacteria | 1697 |
| 782 | Ga0495624_0003948 | 3300046690 | Bacteria | 10918 |
| 783 | Ga0495624_0013782 | 3300046690 | Bacteria | 5506 |
| 784 | Ga0495649_0046669 | 3300046694 | Bacteria | 2358 |
| 785 | Ga0495589_0020249 | 3300046794 | Bacteria | 3403 |
| 786 | Ga0495600_0014154 | 3300046809 | Bacteria | 5025 |
| 787 | Ga0495600_0045073 | 3300046809 | Bacteria | 2877 |
| 788 | Ga0495660_0048292 | 3300046810 | Bacteria | 2328 |
| 789 | Ga0495660_0072239 | 3300046810 | Bacteria | 1827 |
| 790 | Ga0495581_0007738 | 3300047315 | Bacteria | 6218 |
| 791 | Ga0495581_0009120 | 3300047315 | Bacteria | 5740 |
| 792 | Ga0495581_0011441 | 3300047315 | Bacteria | 5136 |
| 793 | Ga0495581_0044450 | 3300047315 | Bacteria | 2568 |
| 794 | Ga0495604_0000037 | 3300047317 | Bacteria | 125140 |
| 795 | Ga0495604_0003252 | 3300047317 | Bacteria | 12982 |
| 796 | Ga0495604_0008709 | 3300047317 | Bacteria | 8021 |
| 797 | Ga0495604_0008817 | 3300047317 | Bacteria | 7970 |
| 798 | Ga0495604_0014512 | 3300047317 | Bacteria | 6283 |
| 799 | Ga0495604_0014525 | 3300047317 | Bacteria | 6281 |
| 800 | Ga0495604_0015646 | 3300047317 | Bacteria | 6055 |
| 801 | Ga0495604_0020766 | 3300047317 | Bacteria | 5243 |
| 802 | Ga0495636_0018033 | 3300047318 | Bacteria | 2831 |
| 803 | Ga0495674_0000118 | 3300047319 | Bacteria | 59873 |
| 804 | Ga0495674_0007553 | 3300047319 | Bacteria | 10384 |
| 805 | Ga0495674_0013001 | 3300047319 | Bacteria | 7836 |
| 806 | Ga0495674_0014177 | 3300047319 | Bacteria | 7466 |
| 807 | Ga0495674_0016848 | 3300047319 | Bacteria | 6815 |
| 808 | Ga0495674_0026900 | 3300047319 | Bacteria | 5261 |
| 809 | Ga0495674_0060448 | 3300047319 | Bacteria | 3306 |
| 810 | Ga0495674_0113882 | 3300047319 | Bacteria | 2290 |
| 811 | Ga0495676_0009516 | 3300047321 | Bacteria | 8848 |
| 812 | Ga0495676_0015877 | 3300047321 | Bacteria | 6692 |
| 813 | Ga0495676_0037225 | 3300047321 | Bacteria | 4052 |
| 814 | Ga0495680_0000260 | 3300047322 | Bacteria | 58455 |
| 815 | Ga0495680_0003970 | 3300047322 | Bacteria | 14295 |
| 816 | Ga0495680_0006638 | 3300047322 | Bacteria | 10713 |
| 817 | Ga0495680_0017210 | 3300047322 | Bacteria | 6182 |
| 818 | Ga0495680_0122816 | 3300047322 | Bacteria | 1916 |
| 819 | Ga0495680_0123953 | 3300047322 | Bacteria | 1905 |
| 820 | Ga0495675_0021339 | 3300047444 | Bacteria | 4123 |
| 821 | Ga0495675_0023234 | 3300047444 | Bacteria | 3951 |
| 822 | Ga0495675_0048525 | 3300047444 | Bacteria | 2700 |
| 823 | Ga0495677_0014286 | 3300047445 | Bacteria | 2892 |
| 824 | Ga0495685_004513 | 3300047447 | Bacteria | 4504 |
| 825 | Ga0495685_007259 | 3300047447 | Bacteria | 3655 |
| 826 | Ga0495685_011503 | 3300047447 | Bacteria | 2987 |
| 827 | Ga0495681_0055862 | 3300047470 | Bacteria | 1839 |
| 828 | Ga0495684_0018808 | 3300047471 | Bacteria | 5322 |
| 829 | Ga0495684_0021860 | 3300047471 | Bacteria | 4924 |
| 830 | Ga0495684_0026439 | 3300047471 | Bacteria | 4461 |
| 831 | Ga0495684_0032376 | 3300047471 | Bacteria | 4014 |
| 832 | Ga0495593_0003385 | 3300047673 | Bacteria | 9555 |
| 833 | Ga0495593_0048900 | 3300047673 | Bacteria | 2246 |
| 834 | Ga0495602_0000118 | 3300048088 | Bacteria | 74925 |
| 835 | Ga0495602_0008934 | 3300048088 | Bacteria | 10445 |
| 836 | Ga0495602_0030355 | 3300048088 | Bacteria | 5128 |
| 837 | Ga0495602_0032768 | 3300048088 | Bacteria | 4887 |
| 838 | Ga0495602_0083064 | 3300048088 | Bacteria | 2685 |
| 839 | Ga0495602_0092759 | 3300048088 | Bacteria | 2500 |
| 840 | Ga0495602_0133327 | 3300048088 | Bacteria | 1977 |
| 841 | Ga0495614_0001541 | 3300048089 | Bacteria | 9989 |
| 842 | Ga0495614_0016294 | 3300048089 | Bacteria | 3235 |
| 843 | Ga0495626_0010355 | 3300048091 | Bacteria | 4978 |
| 844 | Ga0496101_0037717 | 3300048904 | Bacteria | 3430 |
| 845 | Ga0496101_0044575 | 3300048904 | Bacteria | 3174 |
| 846 | Ga0496101_0092735 | 3300048904 | Bacteria | 2249 |
| 847 | Ga0496102_0000029 | 3300048905 | Bacteria | 222195 |
| 848 | Ga0496102_0001151 | 3300048905 | Bacteria | 24161 |
| 849 | Ga0496102_0150366 | 3300048905 | Bacteria | 2188 |
| 850 | Ga0496103_0000080 | 3300048906 | Bacteria | 110513 |
| 851 | Ga0496104_0001695 | 3300048907 | Bacteria | 19033 |
| 852 | Ga0496104_0003110 | 3300048907 | Bacteria | 14312 |
| 853 | Ga0496104_0012025 | 3300048907 | Bacteria | 7768 |
| 854 | Ga0496104_0057930 | 3300048907 | Bacteria | 3666 |
| 855 | Ga0496104_0101743 | 3300048907 | Bacteria | 2751 |
| 856 | Ga0496104_0202127 | 3300048907 | Bacteria | 1899 |
| 857 | Ga0496105_0001747 | 3300048908 | Bacteria | 15538 |
| 858 | Ga0496105_0007144 | 3300048908 | Bacteria | 8615 |
| 859 | Ga0496105_0016938 | 3300048908 | Bacteria | 5831 |
| 860 | Ga0496105_0029731 | 3300048908 | Bacteria | 4473 |
| 861 | Ga0496105_0121017 | 3300048908 | Bacteria | 2158 |
| 862 | Ga0496108_0008890 | 3300048911 | Bacteria | 8143 |
| 863 | Ga0496108_0010231 | 3300048911 | Bacteria | 7617 |
| 864 | Ga0496108_0016901 | 3300048911 | Bacteria | 5963 |
| 865 | Ga0496108_0018292 | 3300048911 | Bacteria | 5738 |
| 866 | Ga0496108_0093242 | 3300048911 | Bacteria | 2561 |
| 867 | Ga0496109_0008227 | 3300048912 | Bacteria | 8854 |
| 868 | Ga0496109_0017888 | 3300048912 | Bacteria | 6220 |
| 869 | Ga0496109_0077027 | 3300048912 | Bacteria | 3068 |
| 870 | Ga0496109_0086925 | 3300048912 | Bacteria | 2887 |
| 871 | Ga0496109_0139691 | 3300048912 | Bacteria | 2265 |
| 872 | Ga0496110_0001540 | 3300048913 | Bacteria | 16770 |
| 873 | Ga0496110_0007485 | 3300048913 | Bacteria | 8725 |
| 874 | Ga0496110_0013729 | 3300048913 | Bacteria | 6710 |
| 875 | Ga0496110_0019823 | 3300048913 | Bacteria | 5668 |
| 876 | Ga0496110_0031164 | 3300048913 | Bacteria | 4599 |
| 877 | Ga0496110_0034661 | 3300048913 | Bacteria | 4374 |
| 878 | Ga0496110_0162062 | 3300048913 | Bacteria | 2028 |
| 879 | Ga0496111_0000498 | 3300048914 | Bacteria | 20282 |
| 880 | Ga0496111_0006115 | 3300048914 | Bacteria | 7788 |
| 881 | Ga0496111_0051538 | 3300048914 | Bacteria | 2971 |
| 882 | Ga0496112_0001029 | 3300048915 | Bacteria | 20517 |
| 883 | Ga0496112_0009946 | 3300048915 | Bacteria | 8604 |
| 884 | Ga0496112_0020526 | 3300048915 | Bacteria | 6264 |
| 885 | Ga0496113_0006984 | 3300048916 | Bacteria | 7220 |
| 886 | Ga0496113_0009779 | 3300048916 | Bacteria | 6306 |
| 887 | Ga0496113_0013661 | 3300048916 | Bacteria | 5512 |
| 888 | Ga0496113_0045157 | 3300048916 | Bacteria | 3266 |
| 889 | Ga0496113_0135890 | 3300048916 | Bacteria | 1932 |
| 890 | Ga0496114_0003065 | 3300048917 | Bacteria | 12805 |
| 891 | Ga0496114_0018546 | 3300048917 | Bacteria | 5627 |
| 892 | Ga0496114_0026122 | 3300048917 | Bacteria | 4778 |
| 893 | Ga0496114_0030440 | 3300048917 | Bacteria | 4441 |
| 894 | Ga0496114_0053481 | 3300048917 | Bacteria | 3366 |
| 895 | Ga0496114_0070741 | 3300048917 | Bacteria | 2931 |
| 896 | Ga0496114_0103896 | 3300048917 | Bacteria | 2429 |
| 897 | Ga0496114_0106753 | 3300048917 | Bacteria | 2396 |
| 898 | Ga0496115_0018681 | 3300048918 | Bacteria | 5329 |
| 899 | Ga0496115_0023449 | 3300048918 | Bacteria | 4790 |
| 900 | Ga0496115_0030780 | 3300048918 | Bacteria | 4224 |
| 901 | Ga0496115_0035253 | 3300048918 | Bacteria | 3958 |
| 902 | Ga0496115_0056782 | 3300048918 | Bacteria | 3147 |
| 903 | Ga0496118_0012027 | 3300048921 | Bacteria | 8359 |
| 904 | Ga0496126_0014421 | 3300048929 | Bacteria | 7990 |
| 905 | Ga0496126_0017653 | 3300048929 | Bacteria | 7108 |
| 906 | Ga0496126_0084264 | 3300048929 | Bacteria | 2804 |
| 907 | Ga0496126_0100473 | 3300048929 | Bacteria | 2532 |
| 908 | Ga0501031_0000082 | 3300049568 | Bacteria | 50347 |
| 909 | Ga0501031_0000983 | 3300049568 | Bacteria | 17336 |
| 910 | Ga0501031_0022710 | 3300049568 | Bacteria | 4089 |
| 911 | Ga0501032_0000035 | 3300049569 | Bacteria | 117554 |
| 912 | Ga0501032_0002765 | 3300049569 | Bacteria | 13665 |
| 913 | Ga0501032_0008427 | 3300049569 | Bacteria | 7521 |
| 914 | Ga0501032_0024746 | 3300049569 | Bacteria | 4142 |
| 915 | Ga0501032_0047483 | 3300049569 | Bacteria | 2898 |
| 916 | Ga0501033_0001072 | 3300049570 | Bacteria | 24844 |
| 917 | Ga0501033_0001772 | 3300049570 | Bacteria | 18850 |
| 918 | Ga0501033_0004384 | 3300049570 | Bacteria | 11309 |
| 919 | Ga0501033_0013102 | 3300049570 | Bacteria | 6318 |
| 920 | Ga0501033_0023587 | 3300049570 | Bacteria | 4640 |
| 921 | Ga0501033_0042742 | 3300049570 | Bacteria | 3378 |
| 922 | Ga0501034_0000925 | 3300049571 | Bacteria | 42868 |
| 923 | Ga0501034_0003651 | 3300049571 | Bacteria | 17412 |
| 924 | Ga0501034_0010048 | 3300049571 | Bacteria | 9881 |
| 925 | Ga0501034_0010110 | 3300049571 | Bacteria | 9844 |
| 926 | Ga0501034_0022645 | 3300049571 | Bacteria | 6400 |
| 927 | Ga0501034_0041014 | 3300049571 | Bacteria | 4683 |
| 928 | Ga0501036_0002018 | 3300049572 | Bacteria | 15794 |
| 929 | Ga0501036_0002028 | 3300049572 | Bacteria | 15762 |
| 930 | Ga0501036_0005941 | 3300049572 | Bacteria | 9889 |
| 931 | Ga0501036_0010750 | 3300049572 | Bacteria | 7567 |
| 932 | Ga0501036_0013936 | 3300049572 | Bacteria | 6685 |
| 933 | Ga0501036_0017324 | 3300049572 | Bacteria | 6021 |
| 934 | Ga0501036_0034007 | 3300049572 | Bacteria | 4311 |
| 935 | Ga0501036_0048380 | 3300049572 | Bacteria | 3600 |
| 936 | Ga0501037_0000370 | 3300049573 | Bacteria | 37472 |
| 937 | Ga0501037_0000975 | 3300049573 | Bacteria | 21258 |
| 938 | Ga0501037_0004313 | 3300049573 | Bacteria | 10316 |
| 939 | Ga0501037_0010903 | 3300049573 | Bacteria | 6679 |
| 940 | Ga0501037_0033493 | 3300049573 | Bacteria | 3793 |
| 941 | Ga0501037_0074113 | 3300049573 | Bacteria | 2474 |
| 942 | Ga0501037_0086909 | 3300049573 | Bacteria | 2263 |
| 943 | Ga0501037_0092173 | 3300049573 | Bacteria | 2191 |
| 944 | Ga0501038_0000172 | 3300049574 | Bacteria | 55198 |
| 945 | Ga0501038_0000830 | 3300049574 | Bacteria | 27511 |
| 946 | Ga0501038_0001402 | 3300049574 | Bacteria | 22056 |
| 947 | Ga0501038_0002380 | 3300049574 | Bacteria | 17520 |
| 948 | Ga0501038_0007236 | 3300049574 | Bacteria | 10253 |
| 949 | Ga0501038_0009084 | 3300049574 | Bacteria | 9124 |
| 950 | Ga0501038_0016324 | 3300049574 | Bacteria | 6732 |
| 951 | Ga0501038_0018802 | 3300049574 | Bacteria | 6236 |
| 952 | Ga0501038_0022038 | 3300049574 | Bacteria | 5713 |
| 953 | Ga0501039_0000269 | 3300049575 | Bacteria | 37904 |
| 954 | Ga0501039_0003905 | 3300049575 | Bacteria | 11196 |
| 955 | Ga0501039_0008292 | 3300049575 | Bacteria | 7918 |
| 956 | Ga0501039_0027285 | 3300049575 | Bacteria | 4391 |
| 957 | Ga0501039_0037691 | 3300049575 | Bacteria | 3733 |
| 958 | Ga0501039_0080261 | 3300049575 | Bacteria | 2539 |
| 959 | Ga0501040_0009614 | 3300049576 | Bacteria | 6310 |
| 960 | Ga0501040_0122671 | 3300049576 | Bacteria | 1824 |
| 961 | Ga0501041_0006904 | 3300049577 | Bacteria | 6657 |
| 962 | Ga0501042_0003075 | 3300049578 | Bacteria | 10388 |
| 963 | Ga0501042_0004043 | 3300049578 | Bacteria | 9295 |
| 964 | Ga0501042_0009129 | 3300049578 | Bacteria | 6593 |
| 965 | Ga0501042_0010127 | 3300049578 | Bacteria | 6306 |
| 966 | Ga0501043_0000231 | 3300049579 | Bacteria | 50898 |
| 967 | Ga0501043_0000964 | 3300049579 | Bacteria | 25420 |
| 968 | Ga0501043_0001222 | 3300049579 | Bacteria | 22653 |
| 969 | Ga0501043_0009186 | 3300049579 | Bacteria | 7769 |
| 970 | Ga0501043_0010396 | 3300049579 | Bacteria | 7293 |
| 971 | Ga0501043_0024633 | 3300049579 | Bacteria | 4721 |
| 972 | Ga0501043_0041543 | 3300049579 | Bacteria | 3613 |
| 973 | Ga0501043_0128599 | 3300049579 | Bacteria | 1986 |
| 974 | Ga0501046_0000279 | 3300049580 | Bacteria | 51800 |
| 975 | Ga0501046_0005074 | 3300049580 | Bacteria | 11805 |
| 976 | Ga0501046_0017656 | 3300049580 | Bacteria | 5951 |
| 977 | Ga0501046_0057856 | 3300049580 | Bacteria | 3040 |
| 978 | Ga0501046_0111531 | 3300049580 | Bacteria | 2089 |
| 979 | Ga0501047_0000213 | 3300049581 | Bacteria | 69459 |
| 980 | Ga0501047_0000458 | 3300049581 | Bacteria | 45091 |
| 981 | Ga0501047_0000837 | 3300049581 | Bacteria | 31760 |
| 982 | Ga0501047_0007441 | 3300049581 | Bacteria | 10304 |
| 983 | Ga0501047_0012451 | 3300049581 | Bacteria | 8054 |
| 984 | Ga0501047_0015908 | 3300049581 | Bacteria | 7170 |
| 985 | Ga0501047_0023191 | 3300049581 | Bacteria | 5959 |
| 986 | Ga0501047_0042338 | 3300049581 | Bacteria | 4401 |
| 987 | Ga0501047_0052841 | 3300049581 | Bacteria | 3928 |
| 988 | Ga0501047_0060579 | 3300049581 | Bacteria | 3652 |
| 989 | Ga0501047_0080844 | 3300049581 | Bacteria | 3124 |
| 990 | Ga0501047_0087834 | 3300049581 | Bacteria | 2986 |
| 991 | Ga0501047_0094784 | 3300049581 | Bacteria | 2864 |
| 992 | Ga0501047_0179352 | 3300049581 | Bacteria | 1984 |
| 993 | Ga0501047_0183831 | 3300049581 | Bacteria | 1956 |
| 994 | Ga0501048_0000048 | 3300049582 | Bacteria | 59433 |
| 995 | Ga0501048_0001326 | 3300049582 | Bacteria | 18749 |
| 996 | Ga0501048_0005292 | 3300049582 | Bacteria | 9829 |
| 997 | Ga0501048_0012400 | 3300049582 | Bacteria | 6340 |
| 998 | Ga0501048_0014519 | 3300049582 | Bacteria | 5829 |
| 999 | Ga0501048_0017993 | 3300049582 | Bacteria | 5199 |
| 1000 | Ga0501048_0084571 | 3300049582 | Bacteria | 2238 |
| 1001 | Ga0501048_0129160 | 3300049582 | Bacteria | 1787 |
| 1002 | Ga0501067_0005264 | 3300049583 | Bacteria | 7188 |
| 1003 | Ga0501068_0002571 | 3300049584 | Bacteria | 9627 |
| 1004 | Ga0501069_0000330 | 3300049585 | Bacteria | 21345 |
| 1005 | Ga0501069_0027446 | 3300049585 | Bacteria | 3120 |
| 1006 | Ga0501070_0000504 | 3300049586 | Bacteria | 35626 |
| 1007 | Ga0501070_0002289 | 3300049586 | Bacteria | 16830 |
| 1008 | Ga0501070_0016182 | 3300049586 | Bacteria | 6267 |
| 1009 | Ga0501070_0031949 | 3300049586 | Bacteria | 4409 |
| 1010 | Ga0501070_0077446 | 3300049586 | Bacteria | 2752 |
| 1011 | Ga0501070_0100770 | 3300049586 | Bacteria | 2389 |
| 1012 | Ga0501070_0130103 | 3300049586 | Bacteria | 2080 |
| 1013 | Ga0501071_0010005 | 3300049587 | Bacteria | 6338 |
| 1014 | Ga0501071_0018673 | 3300049587 | Bacteria | 4806 |
| 1015 | Ga0501072_0027599 | 3300049588 | Bacteria | 4428 |
| 1016 | Ga0501072_0030727 | 3300049588 | Bacteria | 4202 |
| 1017 | Ga0501073_0001049 | 3300049589 | Bacteria | 19926 |
| 1018 | Ga0501073_0020491 | 3300049589 | Bacteria | 4768 |
| 1019 | Ga0501073_0097508 | 3300049589 | Bacteria | 2042 |
| 1020 | Ga0501074_0000061 | 3300049590 | Bacteria | 53799 |
| 1021 | Ga0501074_0000823 | 3300049590 | Bacteria | 19671 |
| 1022 | Ga0501074_0008685 | 3300049590 | Bacteria | 7361 |
| 1023 | Ga0501074_0022408 | 3300049590 | Bacteria | 4588 |
| 1024 | Ga0501074_0035507 | 3300049590 | Bacteria | 3612 |
| 1025 | Ga0501075_0027223 | 3300049591 | Bacteria | 4212 |
| 1026 | Ga0501076_0016692 | 3300049592 | Bacteria | 5569 |
| 1027 | Ga0501077_0003455 | 3300049593 | Bacteria | 9485 |
| 1028 | Ga0501079_0000093 | 3300049741 | Bacteria | 43802 |
| 1029 | Ga0501079_0003706 | 3300049741 | Bacteria | 11267 |
| 1030 | Ga0501080_0000160 | 3300049742 | Bacteria | 48505 |
| 1031 | Ga0501080_0000266 | 3300049742 | Bacteria | 39496 |
| 1032 | Ga0501080_0027168 | 3300049742 | Bacteria | 5322 |
| 1033 | Ga0501083_0006977 | 3300049744 | Bacteria | 8014 |
| 1034 | Ga0501035_0000404 | 3300049822 | Bacteria | 49157 |
| 1035 | Ga0501035_0001134 | 3300049822 | Bacteria | 27845 |
| 1036 | Ga0501035_0001925 | 3300049822 | Bacteria | 20813 |
| 1037 | Ga0501035_0004136 | 3300049822 | Bacteria | 13782 |
| 1038 | Ga0501035_0005043 | 3300049822 | Bacteria | 12505 |
| 1039 | Ga0501035_0019883 | 3300049822 | Bacteria | 6168 |
| 1040 | Ga0501035_0105615 | 3300049822 | Bacteria | 2469 |
| 1041 | Ga0501044_0000439 | 3300049823 | Bacteria | 50915 |
| 1042 | Ga0501044_0001745 | 3300049823 | Bacteria | 25377 |
| 1043 | Ga0501044_0002390 | 3300049823 | Bacteria | 21401 |
| 1044 | Ga0501044_0004503 | 3300049823 | Bacteria | 15582 |
| 1045 | Ga0501044_0019305 | 3300049823 | Bacteria | 7294 |
| 1046 | Ga0501044_0028298 | 3300049823 | Bacteria | 5915 |
| 1047 | Ga0501044_0041631 | 3300049823 | Bacteria | 4782 |
| 1048 | Ga0501044_0059509 | 3300049823 | Bacteria | 3913 |
| 1049 | Ga0501044_0086996 | 3300049823 | Bacteria | 3156 |
| 1050 | Ga0501044_0106576 | 3300049823 | Bacteria | 2815 |
| 1051 | Ga0501044_0120306 | 3300049823 | Bacteria | 2627 |
| 1052 | Ga0501044_0195302 | 3300049823 | Bacteria | 1984 |
| 1053 | Ga0501045_0007688 | 3300049824 | Bacteria | 7496 |
| 1054 | Ga0501045_0051300 | 3300049824 | Bacteria | 3011 |
| 1055 | nmdc:mga03n38_22580_c1 | 3300050490 | Bacteria | 2549 |
| 1056 | nmdc:mga06z11_5955_c1 | 3300050494 | Bacteria | 4926 |
| 1057 | nmdc:mga05p37_124403_c1 | 3300050507 | Bacteria | 3167 |
| 1058 | nmdc:mga05p37_1684_c1 | 3300050507 | Bacteria | 25717 |
| 1059 | nmdc:mga05p37_47176_c1 | 3300050507 | Bacteria | 5298 |
| 1060 | nmdc:mga05p37_8100_c1 | 3300050507 | Bacteria | 12421 |
| 1061 | nmdc:mga06r32_23130_c1 | 3300050510 | Bacteria | 5750 |
| 1062 | nmdc:mga08y16_12403_c1 | 3300050511 | Bacteria | 8965 |
| 1063 | nmdc:mga08y16_26780_c1 | 3300050511 | Bacteria | 6076 |
| 1064 | nmdc:mga0n895_17011_c1 | 3300050512 | Bacteria | 6691 |
| 1065 | nmdc:mga0n895_4823_c1 | 3300050512 | Bacteria | 11166 |
| 1066 | nmdc:mga0n895_7424_c1 | 3300050512 | Bacteria | 9406 |
| 1067 | nmdc:mga0rr50_13386_c1 | 3300050513 | Bacteria | 5340 |
| 1068 | nmdc:mga0rr50_26819_c1 | 3300050513 | Bacteria | 4028 |
| 1069 | nmdc:mga0rr50_34881_c1 | 3300050513 | Bacteria | 3607 |
| 1070 | nmdc:mga08x19_23875_c1 | 3300050514 | Bacteria | 3795 |
| 1071 | nmdc:mga08x19_7350_c1 | 3300050514 | Bacteria | 6545 |
| 1072 | nmdc:mga08x19_8225_c1 | 3300050514 | Bacteria | 6200 |
| 1073 | nmdc:mga0a205_23435_c1 | 3300050515 | Bacteria | 5856 |
| 1074 | nmdc:mga0a205_25017_c1 | 3300050515 | Bacteria | 5684 |
| 1075 | nmdc:mga0a205_7906_c1 | 3300050515 | Bacteria | 9658 |
| 1076 | Ga0495601_0009353 | 3300053077 | Bacteria | 5794 |
| 1077 | Ga0495601_0029193 | 3300053077 | Bacteria | 3419 |
| 1078 | Ga0495601_0031990 | 3300053077 | Bacteria | 3272 |
| 1079 | Ga0495601_0056929 | 3300053077 | Bacteria | 2476 |
| 1080 | Ga0495612_0002725 | 3300053078 | Bacteria | 7310 |
| 1081 | Ga0495612_0008768 | 3300053078 | Bacteria | 4101 |
| 1082 | Ga0495612_0013756 | 3300053078 | Bacteria | 3259 |
| 1083 | Ga0495612_0021976 | 3300053078 | Bacteria | 2558 |
| 1084 | Ga0495595_0002004 | 3300053084 | Bacteria | 7918 |
| 1085 | Ga0495595_0025779 | 3300053084 | Bacteria | 2608 |
| 1086 | Ga0495595_0026080 | 3300053084 | Bacteria | 2594 |
| 1087 | Ga0495619_0006913 | 3300053085 | Bacteria | 7175 |
| 1088 | Ga0495619_0026382 | 3300053085 | Bacteria | 3737 |
| 1089 | Ga0495619_0037853 | 3300053085 | Bacteria | 3146 |
| 1090 | Ga0495619_0064868 | 3300053085 | Bacteria | 2436 |
| 1091 | Ga0500578_0057421 | 3300053086 | Bacteria | 2488 |
| 1092 | Ga0500643_000483 | 3300053087 | Bacteria | 29043 |
| 1093 | Ga0500646_0000140 | 3300053090 | Bacteria | 21197 |
| 1094 | Ga0500658_0056132 | 3300053134 | Bacteria | 1623 |
| 1095 | Ga0500568_0001955 | 3300053139 | Bacteria | 12622 |
| 1096 | Ga0500616_0001335 | 3300053153 | Bacteria | 24220 |
| 1097 | Ga0500616_0003035 | 3300053153 | Bacteria | 13226 |
| 1098 | Ga0501084_0012932 | 3300054114 | Bacteria | 6910 |
| 1099 | Ga0501084_0024382 | 3300054114 | Bacteria | 5045 |
| 1100 | Ga0501084_0098569 | 3300054114 | Bacteria | 2454 |
| 1101 | Ga0501082_0003549 | 3300060353 | Bacteria | 13621 |
| 1102 | Ga0501082_0009216 | 3300060353 | Bacteria | 8508 |
| 1103 | Ga0466962_0001009 | 3300061719 | Bacteria | 12857 |
| 1104 | Ga0466962_0008427 | 3300061719 | Bacteria | 4939 |
| 1105 | Ga0466962_0021351 | 3300061719 | Bacteria | 3109 |
| 1106 | Ga0466962_0060333 | 3300061719 | Bacteria | 1810 |
| 1107 | Ga0530510_0001337 | 3300061734 | Bacteria | 16500 |
| 1108 | 2729906767 | 2728369276 | Bacteria | 5610032 |
| 1109 | 2547410194 | 2547132111 | Bacteria | 8013147 |
| 1110 | 2554256964 | 2554235005 | Bacteria | 6457341 |
| 1111 | 2558912557 | 2558860112 | Bacteria | 9931328 |
| 1112 | 2585308323 | 2582581313 | Bacteria | 10042643 |
| 1113 | 2616703166 | 2616644814 | Bacteria | 11555299 |
| 1114 | 2616904716 | 2616644941 | Bacteria | 8510691 |
| 1115 | 2643851358 | 2643221567 | Bacteria | 4163945 |
| 1116 | 2644014628 | 2643221601 | Bacteria | 7493239 |
| 1117 | 2644138052 | 2643221624 | Bacteria | 4384879 |
| 1118 | 2644176063 | 2643221631 | Bacteria | 8168043 |
| 1119 | 2644261842 | 2643221647 | Bacteria | 10741251 |
| 1120 | 2644445712 | 2643221679 | Bacteria | 3839507 |
| 1121 | 2644610354 | 2643221711 | Bacteria | 4865335 |
| 1122 | 2676495035 | 2675903060 | Bacteria | 10051191 |
| 1123 | 2731907163 | 2731639228 | Bacteria | 4187555 |
| 1124 | 2768644285 | 2767802112 | Bacteria | 6465194 |
| 1125 | 2774395025 | 2773857762 | Bacteria | 5971770 |
| 1126 | 2784473191 | 2784132109 | Bacteria | 3141763 |
| 1127 | 2784589490 | 2784132148 | Bacteria | 8627943 |
| 1128 | 2785342098 | 2784746763 | Bacteria | 9783172 |
| 1129 | 2785370563 | 2784746768 | Bacteria | 10036182 |
| 1130 | 2786671720 | 2786546132 | Bacteria | 10419719 |
| 1131 | 2793982627 | 2791355406 | Bacteria | 11364898 |
| 1132 | 2799186736 | 2799112218 | Bacteria | 4315149 |
| 1133 | 2808843120 | 2808606359 | Bacteria | 9866990 |
| 1134 | 2808872830 | 2808606365 | Bacteria | 4301966 |
| 1135 | 2808921468 | 2808606375 | Bacteria | 9466072 |
| 1136 | 2809194143 | 2808606439 | Bacteria | 5952208 |
| 1137 | 2809233154 | 2808606448 | Bacteria | 8656184 |
| 1138 | 2811845279 | 2808606982 | Bacteria | 7791042 |
| 1139 | 2812348873 | 2811994878 | Bacteria | 5992952 |
| 1140 | 2812357001 | 2811994879 | Bacteria | 9313447 |
| 1141 | 2812371744 | 2811994882 | Bacteria | 4688362 |
| 1142 | 2812479663 | 2811994917 | Bacteria | 7761064 |
| 1143 | 2819667320 | 2818991458 | Bacteria | 4794049 |
| 1144 | 2819690640 | 2818991462 | Bacteria | 4320267 |
| 1145 | 2819728051 | 2818991469 | Bacteria | 4644110 |
| 1146 | 2819742135 | 2818991472 | Bacteria | 10089953 |
| 1147 | 2842890615 | 2842888712 | Bacteria | 4279094 |
| 1148 | 2852640597 | 2852635781 | Bacteria | 8251373 |
| 1149 | 2856746214 | 2856741275 | Bacteria | 8096094 |
| 1150 | 2857712090 | 2857710386 | Bacteria | 3186771 |
| 1151 | 2862286870 | 2862281513 | Bacteria | 9621493 |
| 1152 | 2862291296 | 2862290372 | Bacteria | 7471434 |
| 1153 | 2862390040 | 2862382967 | Bacteria | 10317375 |
| 1154 | 2862578357 | 2862574272 | Bacteria | 10567477 |
| 1155 | 2862706107 | 2862705112 | Bacteria | 6563286 |
| 1156 | 2863411781 | 2863404153 | Bacteria | 9672205 |
| 1157 | 2866555721 | 2866552031 | Bacteria | 5824618 |
| 1158 | 2867349021 | 2867346516 | Bacteria | 7608576 |
| 1159 | 2867373056 | 2867369537 | Bacteria | 6501581 |
| 1160 | 2867433057 | 2867428634 | Bacteria | 9590268 |
| 1161 | 2867481281 | 2867475112 | Bacteria | 6909112 |
| 1162 | 2868090651 | 2868088558 | Bacteria | 7609351 |
| 1163 | 2870788408 | 2870782633 | Bacteria | 9624083 |
| 1164 | 2873154885 | 2873151551 | Bacteria | 8625867 |
| 1165 | 2873314896 | 2873314349 | Bacteria | 8512634 |
| 1166 | 2875394604 | 2875391855 | Bacteria | 7600475 |
| 1167 | 2877680059 | 2877676314 | Bacteria | 9512378 |
| 1168 | 2883826433 | 2883821847 | Bacteria | 5121194 |
| 1169 | 2884694321 | 2884693830 | Bacteria | 11273186 |
| 1170 | 2887486913 | 2887478801 | Bacteria | 8972725 |
| 1171 | 2891402613 | 2891395885 | Bacteria | 9251614 |
| 1172 | 2891554941 | 2891554331 | Bacteria | 8812224 |
| 1173 | 2891562760 | 2891562705 | Bacteria | 8039471 |
| 1174 | 2891973362 | 2891968417 | Bacteria | 5821697 |
| 1175 | 2895435610 | 2895427314 | Bacteria | 13147766 |
| 1176 | 2895444761 | 2895442618 | Bacteria | 11027144 |
| 1177 | 2912718653 | 2912715099 | Bacteria | 9460473 |
| 1178 | 2912730978 | 2912723979 | Bacteria | 8557534 |
| 1179 | 2912761943 | 2912757875 | Bacteria | 7940295 |
| 1180 | 2919449150 | 2919446982 | Bacteria | 3994487 |
| 1181 | 2919476067 | 2919468124 | Bacteria | 9133025 |
| 1182 | 2932400731 | 2932398195 | Bacteria | 3847976 |
| 1183 | 2935392392 | 2935390628 | Bacteria | 7043367 |
| 1184 | 2946068879 | 2946064051 | Bacteria | 8957905 |
| 1185 | 2947228033 | 2947224130 | Bacteria | 9938529 |
| 1186 | 2954002851 | 2954002825 | Bacteria | 9173742 |
| 1187 | 2954384990 | 2954380949 | Bacteria | 10050426 |
| 1188 | 2954678005 | 2954673503 | Bacteria | 9685905 |
| 1189 | 2954686153 | 2954682443 | Bacteria | 9862841 |
| 1190 | 2954695807 | 2954691527 | Bacteria | 10720516 |
| 1191 | 2954710998 | 2954701450 | Bacteria | 10834262 |
| 1192 | 2954715216 | 2954711539 | Bacteria | 10867210 |
| 1193 | 2954725157 | 2954721474 | Bacteria | 10456478 |
| 1194 | 2954736661 | 2954731030 | Bacteria | 10243860 |
| 1195 | 2954744090 | 2954740390 | Bacteria | 10229294 |
| 1196 | 2954755508 | 2954749733 | Bacteria | 10366972 |
| 1197 | 2954763032 | 2954759201 | Bacteria | 9358192 |
| 1198 | 2956942148 | 2956939328 | Bacteria | 3474458 |
| 1199 | 2990045192 | 2990044586 | Bacteria | 6603797 |
| 1200 | 2990059968 | 2990059506 | Bacteria | 9321252 |
| 1201 | 2990090277 | 2990088156 | Bacteria | 6657676 |
| 1202 | 2995467957 | 2995463766 | Bacteria | 8577691 |
| 1203 | 2997458085 | 2997451912 | Bacteria | 8492419 |
| 1204 | 2997606274 | 2997600082 | Bacteria | 9896405 |
| 1205 | 3001119500 | 3001119090 | Bacteria | 3449530 |
| 1206 | 3001892231 | 3001889506 | Bacteria | 2975194 |
| 1207 | 3003000841 | 3002998708 | Bacteria | 11715108 |
| 1208 | 3006327095 | 3006321560 | Bacteria | 8247479 |
| 1209 | 3006396376 | 3006393351 | Bacteria | 6615579 |
| 1210 | 3006428935 | 3006425503 | Bacteria | 6491253 |
| 1211 | 3006489268 | 3006486233 | Bacteria | 8157040 |
| 1212 | 3006494384 | 3006493962 | Bacteria | 8825450 |
| 1213 | 8001785276 | 8001781756 | Bacteria | 9586736 |
| 1214 | 8008488708 | 8008485437 | Bacteria | 7198341 |
| 1215 | 8008566307 | 8008558824 | Bacteria | 10610750 |
| 1216 | 8008577990 | 8008574985 | Bacteria | 7815457 |
| 1217 | 8023629995 | 8023623736 | Bacteria | 8593882 |
| 1218 | 8025483244 | 8025478263 | Bacteria | 8209203 |
| 1219 | 8025529467 | 8025524527 | Bacteria | 7197316 |
| 1220 | 8025536440 | 8025530807 | Bacteria | 8495698 |
| 1221 | 8047897127 | 8047893842 | Bacteria | 11723082 |
| 1222 | 8048134747 | 8048127548 | Bacteria | 11053136 |
| 1223 | 8048361825 | 8048356638 | Bacteria | 11044339 |
| 1224 | 8048374111 | 8048369669 | Bacteria | 11666822 |
| 1225 | 8048384115 | 8048379754 | Bacteria | 11877923 |
| 1226 | 8048413521 | 8048406513 | Bacteria | 8936924 |
| 1227 | 8053948496 | 8053945823 | Bacteria | 8962862 |
| 1228 | 8054160671 | 8054160619 | Bacteria | 7783213 |
| 1229 | 8055074172 | 8055066027 | Bacteria | 9479577 |
| 1230 | 8055175695 | 8055172936 | Bacteria | 9305943 |
| 1231 | 8056062046 | 8056060235 | Bacteria | 7259403 |
| 1232 | 8056454400 | 8056447290 | Bacteria | 7680491 |
| 1233 | 8056672760 | 8056667051 | Bacteria | 6953971 |
| 1234 | 8056833766 | 8056829672 | Bacteria | 9045328 |
| 1235 | Ga0070658_10000341 | |||
| 1236 | Ga0070658_10005154 | |||
| 1237 | Ga0070658_10019961 | |||
| 1238 | Ga0070658_10036087 | |||
| 1239 | Ga0070658_10120314 | |||
| 1240 | Ga0070683_100004700 | |||
| 1241 | Ga0070683_100018153 | |||
| 1242 | Ga0070683_100053662 | |||
| 1243 | Ga0070690_100060284 | |||
| 1244 | Ga0068869_100028900 | |||
| 1245 | Ga0070666_10076702 | |||
| 1246 | Ga0070680_100000142 | |||
| 1247 | Ga0070680_100028494 | |||
| 1248 | Ga0070680_100032455 | |||
| 1249 | Ga0070682_100007342 | |||
| 1250 | Ga0070682_100009822 | |||
| 1251 | Ga0068868_100019689 | |||
| 1252 | Ga0070660_100005421 | |||
| 1253 | Ga0070660_100046731 | |||
| 1254 | Ga0070691_10017887 | |||
| 1255 | Ga0070691_10024103 | |||
| 1256 | Ga0070675_100070224 | |||
| 1257 | Ga0070671_100077253 | |||
| 1258 | Ga0070659_100000340 | |||
| 1259 | Ga0070659_100002562 | |||
| 1260 | Ga0070659_100085970 | |||
| 1261 | Ga0070667_100011293 | |||
| 1262 | Ga0070709_10000148 | |||
| 1263 | Ga0070709_10011079 | |||
| 1264 | Ga0070709_10014133 | |||
| 1265 | Ga0070714_100000241 | |||
| 1266 | Ga0070714_100001408 | |||
| 1267 | Ga0070714_100020693 | |||
| 1268 | Ga0070714_100037623 | |||
| 1269 | Ga0070714_100044891 | |||
| 1270 | Ga0070714_100108150 | |||
| 1271 | Ga0070714_100188960 | |||
| 1272 | Ga0070713_100031003 | |||
| 1273 | Ga0070713_100045812 | |||
| 1274 | Ga0070713_100098361 | |||
| 1275 | Ga0070710_10000288 | |||
| 1276 | Ga0070710_10000754 | |||
| 1277 | Ga0070701_10098354 | |||
| 1278 | Ga0070711_100001415 | |||
| 1279 | Ga0070711_100036987 | |||
| 1280 | Ga0070711_100103016 | |||
| 1281 | Ga0070700_100000064 | |||
| 1282 | Ga0070694_100040214 | |||
| 1283 | Ga0070708_100006850 | |||
| 1284 | Ga0070708_100012378 | |||
| 1285 | Ga0070708_100052431 | |||
| 1286 | Ga0070708_100090504 | |||
| 1287 | Ga0070708_100171158 | |||
| 1288 | Ga0070663_100033990 | |||
| 1289 | Ga0070663_100130357 | |||
| 1290 | Ga0070678_100042234 | |||
| 1291 | Ga0070678_100083879 | |||
| 1292 | Ga0070678_100105459 | |||
| 1293 | Ga0070678_100130995 | |||
| 1294 | Ga0070681_10025573 | |||
| 1295 | Ga0070681_10028817 | |||
| 1296 | Ga0070681_10047180 | |||
| 1297 | Ga0070706_100002380 | |||
| 1298 | Ga0070706_100003532 | |||
| 1299 | Ga0070706_100005976 | |||
| 1300 | Ga0070706_100010066 | |||
| 1301 | Ga0070706_100010721 | |||
| 1302 | Ga0070706_100023725 | |||
| 1303 | Ga0070706_100039669 | |||
| 1304 | Ga0070706_100083189 | |||
| 1305 | Ga0070707_100000213 | |||
| 1306 | Ga0070707_100003232 | |||
| 1307 | Ga0070707_100003789 | |||
| 1308 | Ga0070707_100012139 | |||
| 1309 | Ga0070707_100030838 | |||
| 1310 | Ga0070707_100039951 | |||
| 1311 | Ga0070698_100000205 | |||
| 1312 | Ga0070698_100000527 | |||
| 1313 | Ga0070698_100000706 | |||
| 1314 | Ga0070698_100000992 | |||
| 1315 | Ga0070698_100001093 | |||
| 1316 | Ga0070698_100001437 | |||
| 1317 | Ga0070698_100004321 | |||
| 1318 | Ga0070698_100006891 | |||
| 1319 | Ga0070698_100031580 | |||
| 1320 | Ga0070698_100032056 | |||
| 1321 | Ga0070698_100059041 | |||
| 1322 | Ga0070699_100038999 | |||
| 1323 | Ga0070699_100062759 | |||
| 1324 | Ga0070679_100000016 | |||
| 1325 | Ga0070679_100002098 | |||
| 1326 | Ga0070679_100039772 | |||
| 1327 | Ga0070679_100124948 | |||
| 1328 | Ga0070679_100131620 | |||
| 1329 | Ga0070684_100205297 | |||
| 1330 | Ga0070697_100024392 | |||
| 1331 | Ga0068853_100034386 | |||
| 1332 | Ga0068853_100035256 | |||
| 1333 | Ga0070672_100087525 | |||
| 1334 | Ga0070686_100017464 | |||
| 1335 | Ga0070695_100055470 | |||
| 1336 | Ga0070696_100000953 | |||
| 1337 | Ga0070696_100096537 | |||
| 1338 | Ga0070693_100014101 | |||
| 1339 | Ga0070665_100012640 | |||
| 1340 | Ga0068855_100004743 | |||
| 1341 | Ga0068857_100055007 | |||
| 1342 | Ga0068857_100109438 | |||
| 1343 | Ga0068854_100002563 | |||
| 1344 | Ga0068854_100081603 | |||
| 1345 | Ga0068856_100012896 | |||
| 1346 | Ga0068856_100032085 | |||
| 1347 | Ga0068856_100080477 | |||
| 1348 | Ga0068856_100084252 | |||
| 1349 | Ga0070702_100000181 | |||
| 1350 | Ga0068852_100007081 | |||
| 1351 | Ga0068852_100035620 | |||
| 1352 | Ga0068859_100021021 | |||
| 1353 | Ga0068859_100079889 | |||
| 1354 | Ga0068859_100155550 | |||
| 1355 | Ga0068864_100003646 | |||
| 1356 | Ga0068864_100137313 | |||
| 1357 | Ga0068861_100017783 | |||
| 1358 | Ga0068861_100028258 | |||
| 1359 | Ga0068870_10007494 | |||
| 1360 | Ga0068858_100050056 | |||
| 1361 | Ga0068860_100108652 | |||
| 1362 | Ga0081455_10001759 | |||
| 1363 | Ga0081455_10011389 | |||
| 1364 | Ga0081455_10027242 | |||
| 1365 | Ga0081455_10071494 | |||
| 1366 | Ga0081538_10001441 | |||
| 1367 | Ga0081540_1000097 | |||
| 1368 | Ga0081540_1009149 | |||
| 1369 | Ga0081540_1031284 | |||
| 1370 | Ga0081539_10000015 | |||
| 1371 | Ga0081539_10000717 | |||
| 1372 | Ga0081539_10014229 | |||
| 1373 | Ga0081539_10023013 | |||
| 1374 | Ga0070717_10019268 | |||
| 1375 | Ga0070717_10022123 | |||
| 1376 | Ga0075363_100048012 | |||
| 1377 | Ga0075432_10000184 | |||
| 1378 | Ga0075432_10003361 | |||
| 1379 | Ga0070715_10009603 | |||
| 1380 | Ga0070715_10010578 | |||
| 1381 | Ga0070716_100000186 | |||
| 1382 | Ga0070716_100001102 | |||
| 1383 | Ga0070716_100037136 | |||
| 1384 | Ga0070712_100005948 | |||
| 1385 | Ga0070712_100036038 | |||
| 1386 | Ga0075367_10009815 | |||
| 1387 | Ga0075427_10002845 | |||
| 1388 | Ga0097621_100052980 | |||
| 1389 | Ga0068871_100037584 | |||
| 1390 | Ga0075428_100000285 | |||
| 1391 | Ga0075428_100008245 | |||
| 1392 | Ga0075428_100023028 | |||
| 1393 | Ga0075428_100029819 | |||
| 1394 | Ga0075430_100004937 | |||
| 1395 | Ga0075431_100006189 | |||
| 1396 | Ga0075433_10002351 | |||
| 1397 | Ga0075433_10002630 | |||
| 1398 | Ga0075433_10158999 | |||
| 1399 | Ga0075434_100003332 | |||
| 1400 | Ga0075434_100057478 | |||
| 1401 | Ga0075434_100105815 | |||
| 1402 | Ga0075429_100000714 | |||
| 1403 | Ga0075429_100033608 | |||
| 1404 | Ga0075436_100008179 | |||
| 1405 | Ga0075436_100084447 | |||
| 1406 | Ga0097620_100021021 | |||
| 1407 | Ga0097620_100079891 | |||
| 1408 | Ga0097620_100155544 | |||
| 1409 | Ga0075435_100001797 | |||
| 1410 | Ga0075435_100014600 | |||
| 1411 | Ga0075435_100028736 | |||
| 1412 | Ga0075435_100053244 | |||
| 1413 | Ga0105240_10026684 | |||
| 1414 | Ga0105240_10159410 | |||
| 1415 | Ga0111539_10009361 | |||
| 1416 | Ga0111539_10015527 | |||
| 1417 | Ga0105245_10061047 | |||
| 1418 | Ga0105245_10131086 | |||
| 1419 | Ga0114129_10000278 | |||
| 1420 | Ga0114129_10001404 | |||
| 1421 | Ga0114129_10002476 | |||
| 1422 | Ga0114129_10004135 | |||
| 1423 | Ga0114129_10070705 | |||
| 1424 | Ga0105243_10000176 | |||
| 1425 | Ga0105243_10003944 | |||
| 1426 | Ga0105243_10005949 | |||
| 1427 | Ga0105241_10005275 | |||
| 1428 | Ga0105248_10069469 | |||
| 1429 | Ga0105238_10022283 | |||
| 1430 | Ga0105238_10183891 | |||
| 1431 | Ga0105249_10062449 | |||
| 1432 | Ga0105249_10226043 | |||
| 1433 | Ga0105239_10047982 | |||
| 1434 | Ga0105246_10000307 | |||
| 1435 | Ga0157371_10021854 | |||
| 1436 | Ga0157370_10035408 | |||
| 1437 | Ga0157369_10000890 | |||
| 1438 | Ga0157369_10001482 | |||
| 1439 | Ga0157369_10022930 | |||
| 1440 | Ga0157369_10044670 | |||
| 1441 | Ga0157374_10123096 | |||
| 1442 | Ga0157375_10047169 | |||
| 1443 | Ga0157375_10217292 | |||
| 1444 | Ga0163163_10077534 | |||
| 1445 | Ga0163163_10183773 | |||
| 1446 | Ga0157380_10062562 | |||
| 1447 | Ga0157380_10193111 | |||
| 1448 | Ga0182008_10000943 | |||
| 1449 | Ga0157377_10020979 | |||
| 1450 | Ga0157379_10015119 | |||
| 1451 | Ga0182006_1009402 | |||
| 1452 | Ga0182007_10002092 | |||
| 1453 | Ga0183367_1002 | |||
| 1454 | Ga0163161_10060911 | |||
| 1455 | Ga0197907_10936403 | |||
| 1456 | Ga0206356_10751802 | |||
| 1457 | Ga0206356_11783545 | |||
| 1458 | Ga0206351_10212682 | |||
| 1459 | Ga0206352_10890638 | |||
| 1460 | Ga0206350_10197218 | |||
| 1461 | Ga0206350_10690641 | |||
| 1462 | Ga0206350_11609180 | |||
| 1463 | Ga0206354_10851720 | |||
| 1464 | Ga0206353_10420202 | |||
| 1465 | Ga0206353_10790204 | |||
| 1466 | Ga0206353_10942493 | |||
| 1467 | Ga0206353_11803527 | |||
| 1468 | Ga0213876_10003347 | |||
| 1469 | Ga0213875_10000547 | |||
| 1470 | Ga0213875_10000781 | |||
| 1471 | Ga0213875_10012233 | |||
| 1472 | Ga0213875_10038392 | |||
| 1473 | Ga0224712_10001180 | |||
| 1474 | Ga0224712_10001750 | |||
| 1475 | Ga0224712_10001854 | |||
| 1476 | Ga0224712_10005293 | |||
| 1477 | Ga0224712_10010884 | |||
| 1478 | Ga0224712_10022844 | |||
| 1479 | Ga0224572_1008564 | |||
| 1480 | Ga0209758_1004169 | |||
| 1481 | Ga0207692_10000819 | |||
| 1482 | Ga0207692_10001032 | |||
| 1483 | Ga0207688_10007902 | |||
| 1484 | Ga0207688_10016234 | |||
| 1485 | Ga0207647_10004731 | |||
| 1486 | Ga0207647_10011050 | |||
| 1487 | Ga0207647_10039342 | |||
| 1488 | Ga0207685_10000849 | |||
| 1489 | Ga0207685_10007109 | |||
| 1490 | Ga0207699_10000338 | |||
| 1491 | Ga0207699_10000737 | |||
| 1492 | Ga0207699_10002992 | |||
| 1493 | Ga0207699_10004669 | |||
| 1494 | Ga0207705_10000550 | |||
| 1495 | Ga0207705_10005392 | |||
| 1496 | Ga0207705_10021321 | |||
| 1497 | Ga0207684_10015231 | |||
| 1498 | Ga0207684_10019463 | |||
| 1499 | Ga0207684_10032533 | |||
| 1500 | Ga0207654_10001414 | |||
| 1501 | Ga0207707_10075370 | |||
| 1502 | Ga0207707_10099957 | |||
| 1503 | Ga0207695_10000957 | |||
| 1504 | Ga0207671_10000405 | |||
| 1505 | Ga0207693_10012722 | |||
| 1506 | Ga0207693_10023030 | |||
| 1507 | Ga0207693_10053010 | |||
| 1508 | Ga0207663_10002971 | |||
| 1509 | Ga0207663_10010608 | |||
| 1510 | Ga0207660_10008750 | |||
| 1511 | Ga0207660_10014961 | |||
| 1512 | Ga0207662_10020710 | |||
| 1513 | Ga0207657_10006528 | |||
| 1514 | Ga0207657_10028947 | |||
| 1515 | Ga0207657_10042748 | |||
| 1516 | Ga0207652_10000015 | |||
| 1517 | Ga0207652_10003427 | |||
| 1518 | Ga0207652_10016038 | |||
| 1519 | Ga0207652_10055066 | |||
| 1520 | Ga0207646_10000105 | |||
| 1521 | Ga0207646_10001355 | |||
| 1522 | Ga0207646_10007603 | |||
| 1523 | Ga0207646_10018738 | |||
| 1524 | Ga0207646_10025959 | |||
| 1525 | Ga0207646_10086177 | |||
| 1526 | Ga0207694_10002983 | |||
| 1527 | Ga0207694_10077156 | |||
| 1528 | Ga0207687_10100117 | |||
| 1529 | Ga0207687_10125859 | |||
| 1530 | Ga0207700_10000737 | |||
| 1531 | Ga0207700_10002110 | |||
| 1532 | Ga0207700_10003804 | |||
| 1533 | Ga0207700_10014056 | |||
| 1534 | Ga0207700_10022870 | |||
| 1535 | Ga0207700_10048216 | |||
| 1536 | Ga0207700_10054712 | |||
| 1537 | Ga0207664_10000171 | |||
| 1538 | Ga0207664_10000683 | |||
| 1539 | Ga0207664_10000992 | |||
| 1540 | Ga0207664_10003484 | |||
| 1541 | Ga0207664_10006127 | |||
| 1542 | Ga0207664_10009752 | |||
| 1543 | Ga0207664_10016628 | |||
| 1544 | Ga0207664_10028888 | |||
| 1545 | Ga0207664_10044380 | |||
| 1546 | Ga0207664_10105998 | |||
| 1547 | Ga0207664_10124222 | |||
| 1548 | Ga0207690_10001323 | |||
| 1549 | Ga0207690_10118954 | |||
| 1550 | Ga0207706_10001492 | |||
| 1551 | Ga0207686_10044246 | |||
| 1552 | Ga0207709_10027016 | |||
| 1553 | Ga0207709_10035623 | |||
| 1554 | Ga0207670_10011841 | |||
| 1555 | Ga0207704_10087528 | |||
| 1556 | Ga0207665_10000278 | |||
| 1557 | Ga0207665_10000650 | |||
| 1558 | Ga0207665_10002702 | |||
| 1559 | Ga0207665_10104683 | |||
| 1560 | Ga0207691_10033704 | |||
| 1561 | Ga0207689_10018433 | |||
| 1562 | Ga0207661_10057216 | |||
| 1563 | Ga0207667_10060147 | |||
| 1564 | Ga0207668_10047607 | |||
| 1565 | Ga0207640_10005196 | |||
| 1566 | Ga0207640_10100034 | |||
| 1567 | Ga0207658_10024425 | |||
| 1568 | Ga0207677_10004838 | |||
| 1569 | Ga0207678_10050248 | |||
| 1570 | Ga0207708_10000076 | |||
| 1571 | Ga0207708_10017836 | |||
| 1572 | Ga0207702_10018909 | |||
| 1573 | Ga0207702_10030308 | |||
| 1574 | Ga0207702_10051423 | |||
| 1575 | Ga0207702_10111984 | |||
| 1576 | Ga0207648_10148255 | |||
| 1577 | Ga0207676_10009004 | |||
| 1578 | Ga0207674_10004920 | |||
| 1579 | Ga0207674_10005169 | |||
| 1580 | Ga0207674_10043356 | |||
| 1581 | Ga0207675_100018820 | |||
| 1582 | Ga0207683_10029753 | |||
| 1583 | Ga0207683_10030781 | |||
| 1584 | Ga0207683_10051377 | |||
| 1585 | Ga0207683_10137904 | |||
| 1586 | Ga0207683_10148086 | |||
| 1587 | Ga0207698_10007766 | |||
| 1588 | Ga0207698_10140480 | |||
| 1589 | Ga0207428_10003495 | |||
| 1590 | Ga0207428_10019672 | |||
| 1591 | Ga0265337_1000014 | |||
| 1592 | Ga0265326_10000789 | |||
| 1593 | Ga0265319_1004236 | |||
| 1594 | Ga0265334_10000160 | |||
| 1595 | Ga0265334_10001483 | |||
| 1596 | Ga0265323_10004706 | |||
| 1597 | Ga0265336_10003919 | |||
| 1598 | Ga0307515_10058339 | |||
| 1599 | Ga0307515_10131999 | |||
| 1600 | Ga0265338_10000148 | |||
| 1601 | Ga0265338_10000577 | |||
| 1602 | Ga0265338_10004722 | |||
| 1603 | Ga0265338_10014617 | |||
| 1604 | Ga0265324_10002464 | |||
| 1605 | Ga0268256_1011284 | |||
| 1606 | Ga0307511_10067650 | |||
| 1607 | Ga0316181_1252189 | |||
| 1608 | Ga0265332_10000443 | |||
| 1609 | Ga0265320_10001651 | |||
| 1610 | Ga0265325_10002380 | |||
| 1611 | Ga0265340_10001774 | |||
| 1612 | Ga0265339_10027146 | |||
| 1613 | Ga0265316_10009251 | |||
| 1614 | Ga0265316_10082874 | |||
| 1615 | Ga0307513_10023311 | |||
| 1616 | Ga0307513_10026989 | |||
| 1617 | Ga0307408_100014447 | |||
| 1618 | Ga0265313_10009246 | |||
| 1619 | Ga0307508_10016684 | |||
| 1620 | Ga0307508_10018583 | |||
| 1621 | Ga0307508_10020494 | |||
| 1622 | Ga0307508_10025970 | |||
| 1623 | Ga0307514_10005681 | |||
| 1624 | Ga0307514_10033883 | |||
| 1625 | Ga0307514_10083453 | |||
| 1626 | Ga0316575_10001367 | |||
| 1627 | Ga0316575_10040892 | |||
| 1628 | Ga0316579_10000001 | |||
| 1629 | Ga0316579_10013526 | |||
| 1630 | Ga0316579_10019729 | |||
| 1631 | Ga0265314_10005926 | |||
| 1632 | Ga0265314_10007762 | |||
| 1633 | Ga0316576_10002620 | |||
| 1634 | Ga0316576_10006560 | |||
| 1635 | Ga0316576_10020489 | |||
| 1636 | Ga0316578_10003178 | |||
| 1637 | Ga0316578_10006131 | |||
| 1638 | Ga0316578_10012533 | |||
| 1639 | Ga0316578_10023272 | |||
| 1640 | Ga0307516_10014655 | |||
| 1641 | Ga0307516_10085636 | |||
| 1642 | Ga0307405_10015926 | |||
| 1643 | Ga0307405_10020321 | |||
| 1644 | Ga0307405_10052481 | |||
| 1645 | Ga0316577_10044242 | |||
| 1646 | Ga0307413_10003683 | |||
| 1647 | Ga0307410_10000043 | |||
| 1648 | Ga0307410_10006019 | |||
| 1649 | Ga0307410_10038838 | |||
| 1650 | Ga0307410_10057397 | |||
| 1651 | Ga0307410_10111175 | |||
| 1652 | Ga0307406_10000008 | |||
| 1653 | Ga0307406_10006451 | |||
| 1654 | Ga0307407_10000710 | |||
| 1655 | Ga0307407_10019224 | |||
| 1656 | Ga0307409_100000014 | |||
| 1657 | Ga0307409_100000561 | |||
| 1658 | Ga0307409_100011137 | |||
| 1659 | Ga0307409_100097597 | |||
| 1660 | Ga0307409_100120252 | |||
| 1661 | Ga0307416_100000088 | |||
| 1662 | Ga0307416_100002704 | |||
| 1663 | Ga0307416_100009589 | |||
| 1664 | Ga0307416_100017669 | |||
| 1665 | Ga0307416_100022381 | |||
| 1666 | Ga0307416_100069765 | |||
| 1667 | Ga0307414_10005251 | |||
| 1668 | Ga0307411_10000384 | |||
| 1669 | Ga0307411_10125395 | |||
| 1670 | Ga0307415_100000019 | |||
| 1671 | Ga0307415_100005409 | |||
| 1672 | Ga0307415_100020493 | |||
| 1673 | Ga0307415_100027411 | |||
| 1674 | Ga0307507_10000009 | |||
| 1675 | Ga0307510_10017401 | |||
| 1676 | Ga0316596_1003704 | |||
| 1677 | Ga0316596_1010369 | |||
| 1678 | Ga0316212_1003286 | |||
| 1679 | Ga0373930_0008290 | |||
| 1680 | Ga0373926_0000105 | |||
| 1681 | Ga0373926_0000466 | |||
| 1682 | Ga0373926_0005218 | |||
| 1683 | Ga0373934_0000054 | |||
| 1684 | Ga0373934_0002514 | |||
| 1685 | Ga0373934_0007077 | |||
| 1686 | Ga0373944_0023275 | |||
| 1687 | Ga0373923_0007771 | |||
| 1688 | Ga0373923_0009106 | |||
| 1689 | Ga0373936_0001451 | |||
| 1690 | Ga0373936_0002308 | |||
| 1691 | Ga0373936_0004305 | |||
| 1692 | Ga0373945_0000026 | |||
| 1693 | Ga0373953_0000343 | |||
| 1694 | Ga0373953_0013819 | |||
| 1695 | Ga0373953_0034317 | |||
| 1696 | Ga0373954_0001747 | |||
| 1697 | Ga0373954_0031614 | |||
| 1698 | Ga0373956_0000083 | |||
| 1699 | Ga0373956_0011130 | |||
| 1700 | Ga0373957_0000013 | |||
| 1701 | Ga0373943_0000073 | |||
| 1702 | Ga0373943_0004602 | |||
| 1703 | Ga0373943_0013902 | |||
| 1704 | Ga0373943_0059990 | |||
| 1705 | Ga0373946_0000103 | |||
| 1706 | Ga0373955_0000009 | |||
| 1707 | Ga0373955_0030449 | |||
| 1708 | Ga0373955_0052417 | |||
| 1709 | Ga0316574_0016554 | |||
| 1710 | Ga0316574_0018770 | |||
| 1711 | Ga0373924_0002152 | |||
| 1712 | Ga0373924_0015170 | |||
| 1713 | Ga0373935_0001433 | |||
| 1714 | Ga0373935_0045885 | |||
| 1715 | Ga0373935_0056507 | |||
| 1716 | Ga0373927_0027780 | |||
| 1717 | Ga0373927_0086844 | |||
| 1718 | Ga0373933_0000006 | |||
| 1719 | Ga0373933_0007416 | |||
| 1720 | Ga0373933_0030297 | |||
| 1721 | Ga0373933_0033312 | |||
| 1722 | Ga0373947_0001176 | |||
| 1723 | Ga0373947_0003755 | |||
| 1724 | Ga0373947_0013107 | |||
| 1725 | Ga0373937_0000148 | |||
| 1726 | Ga0373937_0008996 | |||
| 1727 | Ga0373937_0018307 | |||
| 1728 | Ga0373937_0094415 | |||
| 1729 | Ga0372808_000487 | |||
| 1730 | Ga0316582_0009314 | |||
| 1731 | Ga0316582_0036417 | |||
| 1732 | Ga0316582_0073043 | |||
| 1733 | Ga0316584_0003561 | |||
| 1734 | Ga0316584_0052020 | |||
| 1735 | Ga0316584_0056574 | |||
| 1736 | Ga0316584_0066535 | |||
| 1737 | Ga0373925_0000004 | |||
| 1738 | Ga0373925_0002932 | |||
| 1739 | Ga0373925_0006283 | |||
| 1740 | Ga0373925_0010217 | |||
| 1741 | Ga0373925_0057438 | |||
| 1742 | Ga0373925_0095847 | |||
| 1743 | Ga0373925_0128967 | |||
| 1744 | Ga0395899_0003357 | |||
| 1745 | Ga0395899_0037552 | |||
| 1746 | Ga0395900_0033916 | |||
| 1747 | Ga0395900_0062817 | |||
| 1748 | Ga0395898_0003223 | |||
| 1749 | Ga0395898_0012248 | |||
| 1750 | Ga0395898_0013671 | |||
| 1751 | Ga0395898_0019426 | |||
| 1752 | Ga0395898_0046997 | |||
| 1753 | Ga0395898_0099821 | |||
| 1754 | Ga0395898_0169238 | |||
| 1755 | Ga0436364_0112641 | |||
| 1756 | Ga0436364_0195638 | |||
| 1757 | Ga0436364_0531653 | |||
| 1758 | Ga0436364_1133930 | |||
| 1759 | Ga0436364_1202907 | |||
| 1760 | Ga0395901_0014343 | |||
| 1761 | Ga0395901_0045839 | |||
| 1762 | Ga0395901_0060892 | |||
| 1763 | Ga0400485_08073 | |||
| 1764 | Ga0400488_53579 | |||
| 1765 | Ga0400486_26016 | |||
| 1766 | Ga0436365_0567091 | |||
| 1767 | Ga0436363_0661712 | |||
| 1768 | Ga0439436_0000557 | |||
| 1769 | Ga0439439_0000765 | |||
| 1770 | Ga0451789_0138174 | |||
| 1771 | Ga0451791_0734773 | |||
| 1772 | Ga0451795_0548267 | |||
| 1773 | Ga0451849_0159173 | |||
| 1774 | Ga0451843_1177035 | |||
| 1775 | Ga0451853_2494527 | |||
| 1776 | Ga0439433_0013858 | |||
| 1777 | Ga0439442_014674 | |||
| 1778 | Ga0439448_0007405 | |||
| 1779 | Ga0439455_0002672 | |||
| 1780 | Ga0439457_000323 | |||
| 1781 | Ga0439457_001128 | |||
| 1782 | Ga0439463_000980 | |||
| 1783 | Ga0450894_000618 | |||
| 1784 | Ga0450898_002268 | |||
| 1785 | Ga0450899_000145 | |||
| 1786 | Ga0450903_000727 | |||
| 1787 | Ga0450906_004155 | |||
| 1788 | Ga0450908_005005 | |||
| 1789 | Ga0466969_0001092 | |||
| 1790 | Ga0466969_0001548 | |||
| 1791 | Ga0466969_0003332 | |||
| 1792 | Ga0466969_0003795 | |||
| 1793 | Ga0466969_0009388 | |||
| 1794 | Ga0466969_0021457 | |||
| 1795 | Ga0466969_0030450 | |||
| 1796 | Ga0466972_0003101 | |||
| 1797 | Ga0466965_0000974 | |||
| 1798 | Ga0466966_0002114 | |||
| 1799 | Ga0466966_0002908 | |||
| 1800 | Ga0466966_0016563 | |||
| 1801 | Ga0466966_0026217 | |||
| 1802 | Ga0466966_0082745 | |||
| 1803 | Ga0466961_0001308 | |||
| 1804 | Ga0466961_0001396 | |||
| 1805 | Ga0466961_0002697 | |||
| 1806 | Ga0466961_0004026 | |||
| 1807 | Ga0466961_0005970 | |||
| 1808 | Ga0466961_0008148 | |||
| 1809 | Ga0466961_0008920 | |||
| 1810 | Ga0466961_0022167 | |||
| 1811 | Ga0466961_0025205 | |||
| 1812 | Ga0466961_0052646 | |||
| 1813 | Ga0466963_0004535 | |||
| 1814 | Ga0466963_0005648 | |||
| 1815 | Ga0466963_0047849 | |||
| 1816 | Ga0466964_0001929 | |||
| 1817 | Ga0466971_0000220 | |||
| 1818 | Ga0466971_0005159 | |||
| 1819 | Ga0466970_0001370 | |||
| 1820 | Ga0466957_0000798 | |||
| 1821 | Ga0466957_0014746 | |||
| 1822 | Ga0466957_0023644 | |||
| 1823 | Ga0466957_0131321 | |||
| 1824 | Ga0466960_0002037 | |||
| 1825 | Ga0466960_0013305 | |||
| 1826 | Ga0466959_0004898 | |||
| 1827 | Ga0466959_0010580 | |||
| 1828 | Ga0466959_0011045 | |||
| 1829 | Ga0466959_0020304 | |||
| 1830 | Ga0466959_0031253 | |||
| 1831 | Ga0466959_0036140 | |||
| 1832 | Ga0466959_0103213 | |||
| 1833 | Ga0466958_0012778 | |||
| 1834 | Ga0466958_0014558 | |||
| 1835 | Ga0466958_0018195 | |||
| 1836 | Ga0466958_0024515 | |||
| 1837 | Ga0466958_0035590 | |||
| 1838 | Ga0466967_0002536 | |||
| 1839 | Ga0466967_0005065 | |||
| 1840 | Ga0466967_0007108 | |||
| 1841 | Ga0466967_0014770 | |||
| 1842 | Ga0466967_0048027 | |||
| 1843 | Ga0466967_0051928 | |||
| 1844 | Ga0466967_0054843 | |||
| 1845 | Ga0466967_0138981 | |||
| 1846 | Ga0466967_0200255 | |||
| 1847 | Ga0495617_012501 | |||
| 1848 | Ga0495627_008465 | |||
| 1849 | Ga0495592_0000189 | |||
| 1850 | Ga0495592_0006449 | |||
| 1851 | Ga0495592_0008293 | |||
| 1852 | Ga0495592_0019414 | |||
| 1853 | Ga0495592_0031081 | |||
| 1854 | Ga0495592_0038942 | |||
| 1855 | Ga0495603_0000082 | |||
| 1856 | Ga0495603_0005180 | |||
| 1857 | Ga0495603_0007827 | |||
| 1858 | Ga0495603_0010487 | |||
| 1859 | Ga0495603_0012953 | |||
| 1860 | Ga0495629_0003195 | |||
| 1861 | Ga0495629_0008790 | |||
| 1862 | Ga0495629_0010724 | |||
| 1863 | Ga0495629_0053734 | |||
| 1864 | Ga0495629_0083662 | |||
| 1865 | Ga0495629_0085769 | |||
| 1866 | Ga0495638_0025505 | |||
| 1867 | Ga0495638_0044571 | |||
| 1868 | Ga0495651_0000071 | |||
| 1869 | Ga0495651_0000708 | |||
| 1870 | Ga0495651_0003342 | |||
| 1871 | Ga0495651_0004996 | |||
| 1872 | Ga0495651_0009515 | |||
| 1873 | Ga0495651_0009985 | |||
| 1874 | Ga0495651_0015296 | |||
| 1875 | Ga0495651_0019398 | |||
| 1876 | Ga0495651_0023269 | |||
| 1877 | Ga0495651_0026171 | |||
| 1878 | Ga0495653_0009372 | |||
| 1879 | Ga0495653_0010877 | |||
| 1880 | Ga0495653_0016368 | |||
| 1881 | Ga0495653_0032484 | |||
| 1882 | Ga0495653_0069571 | |||
| 1883 | Ga0495653_0073881 | |||
| 1884 | Ga0495653_0105727 | |||
| 1885 | Ga0495580_0053431 | |||
| 1886 | Ga0495582_0002562 | |||
| 1887 | Ga0495582_0008071 | |||
| 1888 | Ga0495582_0010553 | |||
| 1889 | Ga0495605_0009406 | |||
| 1890 | Ga0495639_0003116 | |||
| 1891 | Ga0495639_0062747 | |||
| 1892 | Ga0495662_0002994 | |||
| 1893 | Ga0495662_0007814 | |||
| 1894 | Ga0495662_0009305 | |||
| 1895 | Ga0495662_0057986 | |||
| 1896 | Ga0495664_0003163 | |||
| 1897 | Ga0495664_0004338 | |||
| 1898 | Ga0495664_0005713 | |||
| 1899 | Ga0495664_0024459 | |||
| 1900 | Ga0495664_0032644 | |||
| 1901 | Ga0495664_0040472 | |||
| 1902 | Ga0495585_0081628 | |||
| 1903 | Ga0495594_0012643 | |||
| 1904 | Ga0495607_0021059 | |||
| 1905 | Ga0495608_0000107 | |||
| 1906 | Ga0495608_0002791 | |||
| 1907 | Ga0495608_0004680 | |||
| 1908 | Ga0495608_0006891 | |||
| 1909 | Ga0495608_0040533 | |||
| 1910 | Ga0495608_0093597 | |||
| 1911 | Ga0495610_0025302 | |||
| 1912 | Ga0495616_0005670 | |||
| 1913 | Ga0495618_0003261 | |||
| 1914 | Ga0495618_0006446 | |||
| 1915 | Ga0495618_0006640 | |||
| 1916 | Ga0495618_0010914 | |||
| 1917 | Ga0495618_0023583 | |||
| 1918 | Ga0495618_0060827 | |||
| 1919 | Ga0495620_0016027 | |||
| 1920 | Ga0495628_0000136 | |||
| 1921 | Ga0495628_0003511 | |||
| 1922 | Ga0495628_0025864 | |||
| 1923 | Ga0495628_0062539 | |||
| 1924 | Ga0495628_0106628 | |||
| 1925 | Ga0495630_0005518 | |||
| 1926 | Ga0495630_0069945 | |||
| 1927 | Ga0495631_0018871 | |||
| 1928 | Ga0495637_0057332 | |||
| 1929 | Ga0495643_0010414 | |||
| 1930 | Ga0495666_0003956 | |||
| 1931 | Ga0495666_0015376 | |||
| 1932 | Ga0495666_0057347 | |||
| 1933 | Ga0495652_0000732 | |||
| 1934 | Ga0495652_0001718 | |||
| 1935 | Ga0495652_0012349 | |||
| 1936 | Ga0495652_0020541 | |||
| 1937 | Ga0495652_0043078 | |||
| 1938 | Ga0495652_0055605 | |||
| 1939 | Ga0495652_0077057 | |||
| 1940 | Ga0495654_0016160 | |||
| 1941 | Ga0495665_0009647 | |||
| 1942 | Ga0495665_0009885 | |||
| 1943 | Ga0495665_0037121 | |||
| 1944 | Ga0495640_0006120 | |||
| 1945 | Ga0495640_0007093 | |||
| 1946 | Ga0495640_0010766 | |||
| 1947 | Ga0495640_0025636 | |||
| 1948 | Ga0495640_0035637 | |||
| 1949 | Ga0495640_0072223 | |||
| 1950 | Ga0495586_0009559 | |||
| 1951 | Ga0495587_0000070 | |||
| 1952 | Ga0495587_0003232 | |||
| 1953 | Ga0495587_0003909 | |||
| 1954 | Ga0495587_0020513 | |||
| 1955 | Ga0495587_0031829 | |||
| 1956 | Ga0495597_0026695 | |||
| 1957 | Ga0495645_0003283 | |||
| 1958 | Ga0495645_0009696 | |||
| 1959 | Ga0495645_0019011 | |||
| 1960 | Ga0495645_0020301 | |||
| 1961 | Ga0495645_0021409 | |||
| 1962 | Ga0495645_0037195 | |||
| 1963 | Ga0495645_0063535 | |||
| 1964 | Ga0495622_0011931 | |||
| 1965 | Ga0495667_0000048 | |||
| 1966 | Ga0495667_0015266 | |||
| 1967 | Ga0495667_0033993 | |||
| 1968 | Ga0495667_0041363 | |||
| 1969 | Ga0495667_0135700 | |||
| 1970 | Ga0495656_0045734 | |||
| 1971 | Ga0495668_0005137 | |||
| 1972 | Ga0495634_0002233 | |||
| 1973 | Ga0495634_0010992 | |||
| 1974 | Ga0495634_0013252 | |||
| 1975 | Ga0495634_0072588 | |||
| 1976 | Ga0495634_0079036 | |||
| 1977 | Ga0495634_0083437 | |||
| 1978 | Ga0495625_0118444 | |||
| 1979 | Ga0495635_0001155 | |||
| 1980 | Ga0495635_0008954 | |||
| 1981 | Ga0495635_0034387 | |||
| 1982 | Ga0495635_0057588 | |||
| 1983 | Ga0495635_0066146 | |||
| 1984 | Ga0495661_0023753 | |||
| 1985 | Ga0495588_0000889 | |||
| 1986 | Ga0495657_0000046 | |||
| 1987 | Ga0495657_0004680 | |||
| 1988 | Ga0495657_0008676 | |||
| 1989 | Ga0495657_0009724 | |||
| 1990 | Ga0495657_0012224 | |||
| 1991 | Ga0495657_0018394 | |||
| 1992 | Ga0495657_0026036 | |||
| 1993 | Ga0495657_0031609 | |||
| 1994 | Ga0495599_0000023 | |||
| 1995 | Ga0495599_0002361 | |||
| 1996 | Ga0495599_0033068 | |||
| 1997 | Ga0495599_0072170 | |||
| 1998 | Ga0495623_0000157 | |||
| 1999 | Ga0495623_0009340 | |||
| 2000 | Ga0495623_0011858 | |||
| 2001 | Ga0495623_0016802 | |||
| 2002 | Ga0495623_0020578 | |||
| 2003 | Ga0495623_0081380 | |||
| 2004 | Ga0495646_0012336 | |||
| 2005 | Ga0495658_0003148 | |||
| 2006 | Ga0495658_0007177 | |||
| 2007 | Ga0495658_0043113 | |||
| 2008 | Ga0495658_0055501 | |||
| 2009 | Ga0495669_0002176 | |||
| 2010 | Ga0495613_0004199 | |||
| 2011 | Ga0495613_0008146 | |||
| 2012 | Ga0495613_0009441 | |||
| 2013 | Ga0495613_0011261 | |||
| 2014 | Ga0495613_0011520 | |||
| 2015 | Ga0495613_0144616 | |||
| 2016 | Ga0495624_0003948 | |||
| 2017 | Ga0495624_0013782 | |||
| 2018 | Ga0495649_0046669 | |||
| 2019 | Ga0495589_0020249 | |||
| 2020 | Ga0495600_0014154 | |||
| 2021 | Ga0495600_0045073 | |||
| 2022 | Ga0495660_0048292 | |||
| 2023 | Ga0495660_0072239 | |||
| 2024 | Ga0495581_0007738 | |||
| 2025 | Ga0495581_0009120 | |||
| 2026 | Ga0495581_0011441 | |||
| 2027 | Ga0495581_0044450 | |||
| 2028 | Ga0495604_0000037 | |||
| 2029 | Ga0495604_0003252 | |||
| 2030 | Ga0495604_0008709 | |||
| 2031 | Ga0495604_0008817 | |||
| 2032 | Ga0495604_0014512 | |||
| 2033 | Ga0495604_0014525 | |||
| 2034 | Ga0495604_0015646 | |||
| 2035 | Ga0495604_0020766 | |||
| 2036 | Ga0495636_0018033 | |||
| 2037 | Ga0495674_0000118 | |||
| 2038 | Ga0495674_0007553 | |||
| 2039 | Ga0495674_0013001 | |||
| 2040 | Ga0495674_0014177 | |||
| 2041 | Ga0495674_0016848 | |||
| 2042 | Ga0495674_0026900 | |||
| 2043 | Ga0495674_0060448 | |||
| 2044 | Ga0495674_0113882 | |||
| 2045 | Ga0495676_0009516 | |||
| 2046 | Ga0495676_0015877 | |||
| 2047 | Ga0495676_0037225 | |||
| 2048 | Ga0495680_0000260 | |||
| 2049 | Ga0495680_0003970 | |||
| 2050 | Ga0495680_0006638 | |||
| 2051 | Ga0495680_0017210 | |||
| 2052 | Ga0495680_0122816 | |||
| 2053 | Ga0495680_0123953 | |||
| 2054 | Ga0495675_0021339 | |||
| 2055 | Ga0495675_0023234 | |||
| 2056 | Ga0495675_0048525 | |||
| 2057 | Ga0495677_0014286 | |||
| 2058 | Ga0495685_004513 | |||
| 2059 | Ga0495685_007259 | |||
| 2060 | Ga0495685_011503 | |||
| 2061 | Ga0495681_0055862 | |||
| 2062 | Ga0495684_0018808 | |||
| 2063 | Ga0495684_0021860 | |||
| 2064 | Ga0495684_0026439 | |||
| 2065 | Ga0495684_0032376 | |||
| 2066 | Ga0495593_0003385 | |||
| 2067 | Ga0495593_0048900 | |||
| 2068 | Ga0495602_0000118 | |||
| 2069 | Ga0495602_0008934 | |||
| 2070 | Ga0495602_0030355 | |||
| 2071 | Ga0495602_0032768 | |||
| 2072 | Ga0495602_0083064 | |||
| 2073 | Ga0495602_0092759 | |||
| 2074 | Ga0495602_0133327 | |||
| 2075 | Ga0495614_0001541 | |||
| 2076 | Ga0495614_0016294 | |||
| 2077 | Ga0495626_0010355 | |||
| 2078 | Ga0496101_0037717 | |||
| 2079 | Ga0496101_0044575 | |||
| 2080 | Ga0496101_0092735 | |||
| 2081 | Ga0496102_0000029 | |||
| 2082 | Ga0496102_0001151 | |||
| 2083 | Ga0496102_0150366 | |||
| 2084 | Ga0496103_0000080 | |||
| 2085 | Ga0496104_0001695 | |||
| 2086 | Ga0496104_0003110 | |||
| 2087 | Ga0496104_0012025 | |||
| 2088 | Ga0496104_0057930 | |||
| 2089 | Ga0496104_0101743 | |||
| 2090 | Ga0496104_0202127 | |||
| 2091 | Ga0496105_0001747 | |||
| 2092 | Ga0496105_0007144 | |||
| 2093 | Ga0496105_0016938 | |||
| 2094 | Ga0496105_0029731 | |||
| 2095 | Ga0496105_0121017 | |||
| 2096 | Ga0496108_0008890 | |||
| 2097 | Ga0496108_0010231 | |||
| 2098 | Ga0496108_0016901 | |||
| 2099 | Ga0496108_0018292 | |||
| 2100 | Ga0496108_0093242 | |||
| 2101 | Ga0496109_0008227 | |||
| 2102 | Ga0496109_0017888 | |||
| 2103 | Ga0496109_0077027 | |||
| 2104 | Ga0496109_0086925 | |||
| 2105 | Ga0496109_0139691 | |||
| 2106 | Ga0496110_0001540 | |||
| 2107 | Ga0496110_0007485 | |||
| 2108 | Ga0496110_0013729 | |||
| 2109 | Ga0496110_0019823 | |||
| 2110 | Ga0496110_0031164 | |||
| 2111 | Ga0496110_0034661 | |||
| 2112 | Ga0496110_0162062 | |||
| 2113 | Ga0496111_0000498 | |||
| 2114 | Ga0496111_0006115 | |||
| 2115 | Ga0496111_0051538 | |||
| 2116 | Ga0496112_0001029 | |||
| 2117 | Ga0496112_0009946 | |||
| 2118 | Ga0496112_0020526 | |||
| 2119 | Ga0496113_0006984 | |||
| 2120 | Ga0496113_0009779 | |||
| 2121 | Ga0496113_0013661 | |||
| 2122 | Ga0496113_0045157 | |||
| 2123 | Ga0496113_0135890 | |||
| 2124 | Ga0496114_0003065 | |||
| 2125 | Ga0496114_0018546 | |||
| 2126 | Ga0496114_0026122 | |||
| 2127 | Ga0496114_0030440 | |||
| 2128 | Ga0496114_0053481 | |||
| 2129 | Ga0496114_0070741 | |||
| 2130 | Ga0496114_0103896 | |||
| 2131 | Ga0496114_0106753 | |||
| 2132 | Ga0496115_0018681 | |||
| 2133 | Ga0496115_0023449 | |||
| 2134 | Ga0496115_0030780 | |||
| 2135 | Ga0496115_0035253 | |||
| 2136 | Ga0496115_0056782 | |||
| 2137 | Ga0496118_0012027 | |||
| 2138 | Ga0496126_0014421 | |||
| 2139 | Ga0496126_0017653 | |||
| 2140 | Ga0496126_0084264 | |||
| 2141 | Ga0496126_0100473 | |||
| 2142 | Ga0501031_0000082 | |||
| 2143 | Ga0501031_0000983 | |||
| 2144 | Ga0501031_0022710 | |||
| 2145 | Ga0501032_0000035 | |||
| 2146 | Ga0501032_0002765 | |||
| 2147 | Ga0501032_0008427 | |||
| 2148 | Ga0501032_0024746 | |||
| 2149 | Ga0501032_0047483 | |||
| 2150 | Ga0501033_0001072 | |||
| 2151 | Ga0501033_0001772 | |||
| 2152 | Ga0501033_0004384 | |||
| 2153 | Ga0501033_0013102 | |||
| 2154 | Ga0501033_0023587 | |||
| 2155 | Ga0501033_0042742 | |||
| 2156 | Ga0501034_0000925 | |||
| 2157 | Ga0501034_0003651 | |||
| 2158 | Ga0501034_0010048 | |||
| 2159 | Ga0501034_0010110 | |||
| 2160 | Ga0501034_0022645 | |||
| 2161 | Ga0501034_0041014 | |||
| 2162 | Ga0501036_0002018 | |||
| 2163 | Ga0501036_0002028 | |||
| 2164 | Ga0501036_0005941 | |||
| 2165 | Ga0501036_0010750 | |||
| 2166 | Ga0501036_0013936 | |||
| 2167 | Ga0501036_0017324 | |||
| 2168 | Ga0501036_0034007 | |||
| 2169 | Ga0501036_0048380 | |||
| 2170 | Ga0501037_0000370 | |||
| 2171 | Ga0501037_0000975 | |||
| 2172 | Ga0501037_0004313 | |||
| 2173 | Ga0501037_0010903 | |||
| 2174 | Ga0501037_0033493 | |||
| 2175 | Ga0501037_0074113 | |||
| 2176 | Ga0501037_0086909 | |||
| 2177 | Ga0501037_0092173 | |||
| 2178 | Ga0501038_0000172 | |||
| 2179 | Ga0501038_0000830 | |||
| 2180 | Ga0501038_0001402 | |||
| 2181 | Ga0501038_0002380 | |||
| 2182 | Ga0501038_0007236 | |||
| 2183 | Ga0501038_0009084 | |||
| 2184 | Ga0501038_0016324 | |||
| 2185 | Ga0501038_0018802 | |||
| 2186 | Ga0501038_0022038 | |||
| 2187 | Ga0501039_0000269 | |||
| 2188 | Ga0501039_0003905 | |||
| 2189 | Ga0501039_0008292 | |||
| 2190 | Ga0501039_0027285 | |||
| 2191 | Ga0501039_0037691 | |||
| 2192 | Ga0501039_0080261 | |||
| 2193 | Ga0501040_0009614 | |||
| 2194 | Ga0501040_0122671 | |||
| 2195 | Ga0501041_0006904 | |||
| 2196 | Ga0501042_0003075 | |||
| 2197 | Ga0501042_0004043 | |||
| 2198 | Ga0501042_0009129 | |||
| 2199 | Ga0501042_0010127 | |||
| 2200 | Ga0501043_0000231 | |||
| 2201 | Ga0501043_0000964 | |||
| 2202 | Ga0501043_0001222 | |||
| 2203 | Ga0501043_0009186 | |||
| 2204 | Ga0501043_0010396 | |||
| 2205 | Ga0501043_0024633 | |||
| 2206 | Ga0501043_0041543 | |||
| 2207 | Ga0501043_0128599 | |||
| 2208 | Ga0501046_0000279 | |||
| 2209 | Ga0501046_0005074 | |||
| 2210 | Ga0501046_0017656 | |||
| 2211 | Ga0501046_0057856 | |||
| 2212 | Ga0501046_0111531 | |||
| 2213 | Ga0501047_0000213 | |||
| 2214 | Ga0501047_0000458 | |||
| 2215 | Ga0501047_0000837 | |||
| 2216 | Ga0501047_0007441 | |||
| 2217 | Ga0501047_0012451 | |||
| 2218 | Ga0501047_0015908 | |||
| 2219 | Ga0501047_0023191 | |||
| 2220 | Ga0501047_0042338 | |||
| 2221 | Ga0501047_0052841 | |||
| 2222 | Ga0501047_0060579 | |||
| 2223 | Ga0501047_0080844 | |||
| 2224 | Ga0501047_0087834 | |||
| 2225 | Ga0501047_0094784 | |||
| 2226 | Ga0501047_0179352 | |||
| 2227 | Ga0501047_0183831 | |||
| 2228 | Ga0501048_0000048 | |||
| 2229 | Ga0501048_0001326 | |||
| 2230 | Ga0501048_0005292 | |||
| 2231 | Ga0501048_0012400 | |||
| 2232 | Ga0501048_0014519 | |||
| 2233 | Ga0501048_0017993 | |||
| 2234 | Ga0501048_0084571 | |||
| 2235 | Ga0501048_0129160 | |||
| 2236 | Ga0501067_0005264 | |||
| 2237 | Ga0501068_0002571 | |||
| 2238 | Ga0501069_0000330 | |||
| 2239 | Ga0501069_0027446 | |||
| 2240 | Ga0501070_0000504 | |||
| 2241 | Ga0501070_0002289 | |||
| 2242 | Ga0501070_0016182 | |||
| 2243 | Ga0501070_0031949 | |||
| 2244 | Ga0501070_0077446 | |||
| 2245 | Ga0501070_0100770 | |||
| 2246 | Ga0501070_0130103 | |||
| 2247 | Ga0501071_0010005 | |||
| 2248 | Ga0501071_0018673 | |||
| 2249 | Ga0501072_0027599 | |||
| 2250 | Ga0501072_0030727 | |||
| 2251 | Ga0501073_0001049 | |||
| 2252 | Ga0501073_0020491 | |||
| 2253 | Ga0501073_0097508 | |||
| 2254 | Ga0501074_0000061 | |||
| 2255 | Ga0501074_0000823 | |||
| 2256 | Ga0501074_0008685 | |||
| 2257 | Ga0501074_0022408 | |||
| 2258 | Ga0501074_0035507 | |||
| 2259 | Ga0501075_0027223 | |||
| 2260 | Ga0501076_0016692 | |||
| 2261 | Ga0501077_0003455 | |||
| 2262 | Ga0501079_0000093 | |||
| 2263 | Ga0501079_0003706 | |||
| 2264 | Ga0501080_0000160 | |||
| 2265 | Ga0501080_0000266 | |||
| 2266 | Ga0501080_0027168 | |||
| 2267 | Ga0501083_0006977 | |||
| 2268 | Ga0501035_0000404 | |||
| 2269 | Ga0501035_0001134 | |||
| 2270 | Ga0501035_0001925 | |||
| 2271 | Ga0501035_0004136 | |||
| 2272 | Ga0501035_0005043 | |||
| 2273 | Ga0501035_0019883 | |||
| 2274 | Ga0501035_0105615 | |||
| 2275 | Ga0501044_0000439 | |||
| 2276 | Ga0501044_0001745 | |||
| 2277 | Ga0501044_0002390 | |||
| 2278 | Ga0501044_0004503 | |||
| 2279 | Ga0501044_0019305 | |||
| 2280 | Ga0501044_0028298 | |||
| 2281 | Ga0501044_0041631 | |||
| 2282 | Ga0501044_0059509 | |||
| 2283 | Ga0501044_0086996 | |||
| 2284 | Ga0501044_0106576 | |||
| 2285 | Ga0501044_0120306 | |||
| 2286 | Ga0501044_0195302 | |||
| 2287 | Ga0501045_0007688 | |||
| 2288 | Ga0501045_0051300 | |||
| 2289 | nmdc:mga03n38_22580_c1 | |||
| 2290 | nmdc:mga06z11_5955_c1 | |||
| 2291 | nmdc:mga05p37_124403_c1 | |||
| 2292 | nmdc:mga05p37_1684_c1 | |||
| 2293 | nmdc:mga05p37_47176_c1 | |||
| 2294 | nmdc:mga05p37_8100_c1 | |||
| 2295 | nmdc:mga06r32_23130_c1 | |||
| 2296 | nmdc:mga08y16_12403_c1 | |||
| 2297 | nmdc:mga08y16_26780_c1 | |||
| 2298 | nmdc:mga0n895_17011_c1 | |||
| 2299 | nmdc:mga0n895_4823_c1 | |||
| 2300 | nmdc:mga0n895_7424_c1 | |||
| 2301 | nmdc:mga0rr50_13386_c1 | |||
| 2302 | nmdc:mga0rr50_26819_c1 | |||
| 2303 | nmdc:mga0rr50_34881_c1 | |||
| 2304 | nmdc:mga08x19_23875_c1 | |||
| 2305 | nmdc:mga08x19_7350_c1 | |||
| 2306 | nmdc:mga08x19_8225_c1 | |||
| 2307 | nmdc:mga0a205_23435_c1 | |||
| 2308 | nmdc:mga0a205_25017_c1 | |||
| 2309 | nmdc:mga0a205_7906_c1 | |||
| 2310 | Ga0495601_0009353 | |||
| 2311 | Ga0495601_0029193 | |||
| 2312 | Ga0495601_0031990 | |||
| 2313 | Ga0495601_0056929 | |||
| 2314 | Ga0495612_0002725 | |||
| 2315 | Ga0495612_0008768 | |||
| 2316 | Ga0495612_0013756 | |||
| 2317 | Ga0495612_0021976 | |||
| 2318 | Ga0495595_0002004 | |||
| 2319 | Ga0495595_0025779 | |||
| 2320 | Ga0495595_0026080 | |||
| 2321 | Ga0495619_0006913 | |||
| 2322 | Ga0495619_0026382 | |||
| 2323 | Ga0495619_0037853 | |||
| 2324 | Ga0495619_0064868 | |||
| 2325 | Ga0500578_0057421 | |||
| 2326 | Ga0500643_000483 | |||
| 2327 | Ga0500646_0000140 | |||
| 2328 | Ga0500658_0056132 | |||
| 2329 | Ga0500568_0001955 | |||
| 2330 | Ga0500616_0001335 | |||
| 2331 | Ga0500616_0003035 | |||
| 2332 | Ga0501084_0012932 | |||
| 2333 | Ga0501084_0024382 | |||
| 2334 | Ga0501084_0098569 | |||
| 2335 | Ga0501082_0003549 | |||
| 2336 | Ga0501082_0009216 | |||
| 2337 | Ga0466962_0001009 | |||
| 2338 | Ga0466962_0008427 | |||
| 2339 | Ga0466962_0021351 | |||
| 2340 | Ga0466962_0060333 | |||
| 2341 | Ga0530510_0001337 | |||
| 2342 | 2729906767 | |||
| 2343 | 2547410194 | |||
| 2344 | 2554256964 | |||
| 2345 | 2558912557 | |||
| 2346 | 2585308323 | |||
| 2347 | 2616703166 | |||
| 2348 | 2616904716 | |||
| 2349 | 2643851358 | |||
| 2350 | 2644014628 | |||
| 2351 | 2644138052 | |||
| 2352 | 2644176063 | |||
| 2353 | 2644261842 | |||
| 2354 | 2644445712 | |||
| 2355 | 2644610354 | |||
| 2356 | 2676495035 | |||
| 2357 | 2731907163 | |||
| 2358 | 2768644285 | |||
| 2359 | 2774395025 | |||
| 2360 | 2784473191 | |||
| 2361 | 2784589490 | |||
| 2362 | 2785342098 | |||
| 2363 | 2785370563 | |||
| 2364 | 2786671720 | |||
| 2365 | 2793982627 | |||
| 2366 | 2799186736 | |||
| 2367 | 2808843120 | |||
| 2368 | 2808872830 | |||
| 2369 | 2808921468 | |||
| 2370 | 2809194143 | |||
| 2371 | 2809233154 | |||
| 2372 | 2811845279 | |||
| 2373 | 2812348873 | |||
| 2374 | 2812357001 | |||
| 2375 | 2812371744 | |||
| 2376 | 2812479663 | |||
| 2377 | 2819667320 | |||
| 2378 | 2819690640 | |||
| 2379 | 2819728051 | |||
| 2380 | 2819742135 | |||
| 2381 | 2842890615 | |||
| 2382 | 2852640597 | |||
| 2383 | 2856746214 | |||
| 2384 | 2857712090 | |||
| 2385 | 2862286870 | |||
| 2386 | 2862291296 | |||
| 2387 | 2862390040 | |||
| 2388 | 2862578357 | |||
| 2389 | 2862706107 | |||
| 2390 | 2863411781 | |||
| 2391 | 2866555721 | |||
| 2392 | 2867349021 | |||
| 2393 | 2867373056 | |||
| 2394 | 2867433057 | |||
| 2395 | 2867481281 | |||
| 2396 | 2868090651 | |||
| 2397 | 2870788408 | |||
| 2398 | 2873154885 | |||
| 2399 | 2873314896 | |||
| 2400 | 2875394604 | |||
| 2401 | 2877680059 | |||
| 2402 | 2883826433 | |||
| 2403 | 2884694321 | |||
| 2404 | 2887486913 | |||
| 2405 | 2891402613 | |||
| 2406 | 2891554941 | |||
| 2407 | 2891562760 | |||
| 2408 | 2891973362 | |||
| 2409 | 2895435610 | |||
| 2410 | 2895444761 | |||
| 2411 | 2912718653 | |||
| 2412 | 2912730978 | |||
| 2413 | 2912761943 | |||
| 2414 | 2919449150 | |||
| 2415 | 2919476067 | |||
| 2416 | 2932400731 | |||
| 2417 | 2935392392 | |||
| 2418 | 2946068879 | |||
| 2419 | 2947228033 | |||
| 2420 | 2954002851 | |||
| 2421 | 2954384990 | |||
| 2422 | 2954678005 | |||
| 2423 | 2954686153 | |||
| 2424 | 2954695807 | |||
| 2425 | 2954710998 | |||
| 2426 | 2954715216 | |||
| 2427 | 2954725157 | |||
| 2428 | 2954736661 | |||
| 2429 | 2954744090 | |||
| 2430 | 2954755508 | |||
| 2431 | 2954763032 | |||
| 2432 | 2956942148 | |||
| 2433 | 2990045192 | |||
| 2434 | 2990059968 | |||
| 2435 | 2990090277 | |||
| 2436 | 2995467957 | |||
| 2437 | 2997458085 | |||
| 2438 | 2997606274 | |||
| 2439 | 3001119500 | |||
| 2440 | 3001892231 | |||
| 2441 | 3003000841 | |||
| 2442 | 3006327095 | |||
| 2443 | 3006396376 | |||
| 2444 | 3006428935 | |||
| 2445 | 3006489268 | |||
| 2446 | 3006494384 | |||
| 2447 | 8001785276 | |||
| 2448 | 8008488708 | |||
| 2449 | 8008566307 | |||
| 2450 | 8008577990 | |||
| 2451 | 8023629995 | |||
| 2452 | 8025483244 | |||
| 2453 | 8025529467 | |||
| 2454 | 8025536440 | |||
| 2455 | 8047897127 | |||
| 2456 | 8048134747 | |||
| 2457 | 8048361825 | |||
| 2458 | 8048374111 | |||
| 2459 | 8048384115 | |||
| 2460 | 8048413521 | |||
| 2461 | 8053948496 | |||
| 2462 | 8054160671 | |||
| 2463 | 8055074172 | |||
| 2464 | 8055175695 | |||
| 2465 | 8056062046 | |||
| 2466 | 8056454400 | |||
| 2467 | 8056672760 | |||
| 2468 | 8056833766 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1cbf-assembly1.cif.gz_A | the x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif | 0.9084 | 12 | 215 |
| 1pjt-assembly1.cif.gz_B | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.9022 | 4 | 230 |
| 2ybo-assembly1.cif.gz_A-2 | the x-ray structure of the sam-dependent uroporphyrinogen iii methyltransferase nire from pseudomonas aeruginosa in complex with sah | 0.8953 | 10 | 216 |
| 6p5z-assembly1.cif.gz_A | cobalt-sirohydrochlorin-bound s. typhimurium siroheme synthase | 0.8952 | 4 | 230 |
| 6pr1-assembly1.cif.gz_A | r260a/s128a s. typhimurium siroheme synthase | 0.8937 | 4 | 230 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1pjsA04 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9173 | 10 | 119 | 3.40.1010.10 |
| af_A0A1D8PGS2_266_389_3.40.1010.10 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9104 | 6 | 119 | 3.40.1010.10 |
| 3neiB01 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9081 | 12 | 118 | 3.40.1010.10 |
| af_Q2FVM0_1_122_3.40.1010.10 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9028 | 8 | 119 | 3.40.1010.10 |
| 1pjsA04 | Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain | 0.9015 | 10 | 119 | 3.40.1010.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A655AIJ8-F1-model_v4 | Uroporphyrin-III C-methyltransferase | 0.9483 | 406 | 503 |
GO:0004852
GO:0006780 GO:0008168 GO:0032259 |
| AF-A0A830G2K3-F1-model_v4 | deleted | 0.9424 | 10 | 211 |
|
| AF-A0A1Y3TDD2-F1-model_v4 | Precorrin-4 C(11)-methyltransferase | 0.9273 | 13 | 216 |
GO:0009236
GO:0032259 GO:0046026 |
| AF-A0A838SKW1-F1-model_v4 | uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) | 0.927 | 10 | 500 |
GO:0004851
GO:0004852 GO:0019354 GO:0032259 |
| AF-Q2RT12-F1-model_v4 | Uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) | 0.9262 | 4 | 214 |
GO:0004851
GO:0009236 GO:0019354 GO:0032259 GO:0043115 GO:0051266 GO:0051287 |