F492027

General Info

Members Datasets Scaffolds Average Seq Length
1234 541 2468 529

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2728369276|2729906767
Length 624
Sequence TNSPVTAPVLVEPVLEAVEAPVDTPVSTPVDLLVQAPAETPAGALVDAPAEVSDLSEVLDAKKSEVPAQSRAKKAAGRSGSKAARSSEKTLKGDKTDKDLGHVSFVGAGPGDPGLLTVRAVDLLGAADVVVLDQGSREDLVARFARPGVEVLDAAFGDDGQPLARAARAKLVVRAAKAGGRVVRLMDGDPSTFTGLVDEVAACRKAGVTFDVVPGVSAVNAVPTYAGIPMTTPGTSSVNVVHPAGRSLDWSRHADADATVVVLGSGDDIAAAAAGLLGAGRGAATPVALTSHGTTTGQTTTTTTLGKLAAAVAGLDSSPTTAVVGDVVALREQNSWYETKPLFGWRVLVPRTKEQAGGITARLSGHGATAEVVPTISVEPPRTPQQMEKAVKGLVTGRYEWIGFTSVNAVKAVREKFTEYGLDARAFSGLKVAAVGGVTAEALREWGIEPDLLPETEQSAAGLLEAWPPYDDVLDPINRVFLPRADIATDTLVAGLVENGWEVDDVTAYRTVRAAPPAAPVRDAIKTGAFDAVVFTSSSTVRNLVGIAGKPHPSTVVACIGPATAKTAEEHGLRVDVLAAEPSAESLVEALASYGNVLRAAAVEAGEPVLRPSQKKSSARRRAR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
161 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
171 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
183 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
184 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
201 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
202 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
204 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
235 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
236 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
240 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
241 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
242 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
243 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
244 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
245 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
248 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
249 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
250 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
251 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
252 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
253 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
254 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
255 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
256 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
257 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
258 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
274 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
275 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
276 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
291 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
297 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
303 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
304 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
308 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
309 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
310 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
311 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
312 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
313 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
314 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
317 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
318 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
319 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
320 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
326 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
327 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
330 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
331 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
332 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
338 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
339 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
342 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
343 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
344 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
376 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
377 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
378 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
379 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
380 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
381 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
382 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
383 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
384 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
385 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
386 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
387 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
388 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
389 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
392 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
393 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
394 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
402 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
403 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
404 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
405 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
406 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
407 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
408 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
409 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
410 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
413 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
414 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
415 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
416 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
417 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
418 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
419 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
420 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
421 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
422 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
423 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
424 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
425 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
426 2643221647 Streptomyces sp. Root369 Isolate Unclassified
427 2643221679 Angustibacter sp. Root456 Isolate Unclassified
428 2643221711 Terrabacter sp. Root85 Isolate Unclassified
429 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
430 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
431 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
432 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
433 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
434 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
435 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
436 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
437 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
438 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
439 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
440 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
441 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
442 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
443 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
444 2808606448 Streptomyces sp. 193411 Isolate Unclassified
445 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
446 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
447 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
448 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
449 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
450 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
451 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
452 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
453 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
454 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
455 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
456 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
457 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
458 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
459 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
460 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
461 2862574272 Streptomyces sp. AcE210 Isolate Nodule
462 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
463 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
464 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
465 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
466 2867369537 Streptomyces sp. Z26 Isolate Unclassified
467 2867428634 Streptomyces sp. RP5T Isolate Unclassified
468 2867475112 Streptomyces sp. TM32 Isolate Unclassified
469 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
470 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
471 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
472 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
473 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
474 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
475 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
476 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
477 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
478 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
479 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
480 2891562705 Microbispora tritici MT50 Isolate Unclassified
481 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
482 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
483 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
484 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
485 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
486 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
487 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
488 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
489 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
490 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
491 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
492 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
493 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
494 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
495 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
496 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
497 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
498 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
499 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
500 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
501 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
502 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
503 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
504 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
505 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
506 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
507 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
508 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
509 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
510 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
511 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
512 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
513 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
514 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
515 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
516 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
517 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
518 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
519 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
520 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
521 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
522 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
523 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
524 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
525 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
526 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
527 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
528 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
529 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
530 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
531 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
532 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
533 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
534 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
535 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
536 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
537 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
538 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
539 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
540 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
541 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.93
Metatranscriptomes 1.78
Isolates 10.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0.24
Rhizoplane 5.11
Rhizosphere 85.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10000341 3300005327 Bacteria 40344
2 Ga0070658_10005154 3300005327 Bacteria 10635
3 Ga0070658_10019961 3300005327 Bacteria 5368
4 Ga0070658_10036087 3300005327 Bacteria 3984
5 Ga0070658_10120314 3300005327 Bacteria 2181
6 Ga0070683_100004700 3300005329 Bacteria 11288
7 Ga0070683_100018153 3300005329 Bacteria 6226
8 Ga0070683_100053662 3300005329 Bacteria 3735
9 Ga0070690_100060284 3300005330 Bacteria 2442
10 Ga0068869_100028900 3300005334 Bacteria 3878
11 Ga0070666_10076702 3300005335 Bacteria 2281
12 Ga0070680_100000142 3300005336 Bacteria 43698
13 Ga0070680_100028494 3300005336 Bacteria 4480
14 Ga0070680_100032455 3300005336 Bacteria 4204
15 Ga0070682_100007342 3300005337 Bacteria 6214
16 Ga0070682_100009822 3300005337 Bacteria 5418
17 Ga0068868_100019689 3300005338 Bacteria 5060
18 Ga0070660_100005421 3300005339 Bacteria 8833
19 Ga0070660_100046731 3300005339 Bacteria 3319
20 Ga0070691_10017887 3300005341 Bacteria 3262
21 Ga0070691_10024103 3300005341 Bacteria 2827
22 Ga0070675_100070224 3300005354 Bacteria 2902
23 Ga0070671_100077253 3300005355 Bacteria 2782
24 Ga0070659_100000340 3300005366 Bacteria 36008
25 Ga0070659_100002562 3300005366 Bacteria 12923
26 Ga0070659_100085970 3300005366 Bacteria 2516
27 Ga0070667_100011293 3300005367 Bacteria 7388
28 Ga0070709_10000148 3300005434 Bacteria 46542
29 Ga0070709_10011079 3300005434 Bacteria 5013
30 Ga0070709_10014133 3300005434 Bacteria 4509
31 Ga0070714_100000241 3300005435 Bacteria 42677
32 Ga0070714_100001408 3300005435 Bacteria 17443
33 Ga0070714_100020693 3300005435 Bacteria 5377
34 Ga0070714_100037623 3300005435 Bacteria 4067
35 Ga0070714_100044891 3300005435 Bacteria 3743
36 Ga0070714_100108150 3300005435 Bacteria 2458
37 Ga0070714_100188960 3300005435 Bacteria 1878
38 Ga0070713_100031003 3300005436 Bacteria 4253
39 Ga0070713_100045812 3300005436 Bacteria 3586
40 Ga0070713_100098361 3300005436 Bacteria 2530
41 Ga0070710_10000288 3300005437 Bacteria 23860
42 Ga0070710_10000754 3300005437 Bacteria 15430
43 Ga0070701_10098354 3300005438 Bacteria 1616
44 Ga0070711_100001415 3300005439 Bacteria 13168
45 Ga0070711_100036987 3300005439 Bacteria 3273
46 Ga0070711_100103016 3300005439 Bacteria 2079
47 Ga0070700_100000064 3300005441 Bacteria 78318
48 Ga0070694_100040214 3300005444 Bacteria 3117
49 Ga0070708_100006850 3300005445 Bacteria 9088
50 Ga0070708_100012378 3300005445 Bacteria 6961
51 Ga0070708_100052431 3300005445 Bacteria 3618
52 Ga0070708_100090504 3300005445 Bacteria 2785
53 Ga0070708_100171158 3300005445 Bacteria 2028
54 Ga0070663_100033990 3300005455 Bacteria 3527
55 Ga0070663_100130357 3300005455 Bacteria 1909
56 Ga0070678_100042234 3300005456 Bacteria 3240
57 Ga0070678_100083879 3300005456 Bacteria 2424
58 Ga0070678_100105459 3300005456 Bacteria 2194
59 Ga0070678_100130995 3300005456 Bacteria 1992
60 Ga0070681_10025573 3300005458 Bacteria 5938
61 Ga0070681_10028817 3300005458 Bacteria 5580
62 Ga0070681_10047180 3300005458 Bacteria 4306
63 Ga0070706_100002380 3300005467 Bacteria 18992
64 Ga0070706_100003532 3300005467 Bacteria 15370
65 Ga0070706_100005976 3300005467 Bacteria 11513
66 Ga0070706_100010066 3300005467 Bacteria 8784
67 Ga0070706_100010721 3300005467 Bacteria 8506
68 Ga0070706_100023725 3300005467 Bacteria 5647
69 Ga0070706_100039669 3300005467 Bacteria 4346
70 Ga0070706_100083189 3300005467 Bacteria 2965
71 Ga0070707_100000213 3300005468 Bacteria 58009
72 Ga0070707_100003232 3300005468 Bacteria 15432
73 Ga0070707_100003789 3300005468 Bacteria 14265
74 Ga0070707_100012139 3300005468 Bacteria 8042
75 Ga0070707_100030838 3300005468 Bacteria 5107
76 Ga0070707_100039951 3300005468 Bacteria 4487
77 Ga0070698_100000205 3300005471 Bacteria 56962
78 Ga0070698_100000527 3300005471 Bacteria 40863
79 Ga0070698_100000706 3300005471 Bacteria 35678
80 Ga0070698_100000992 3300005471 Bacteria 31252
81 Ga0070698_100001093 3300005471 Bacteria 29814
82 Ga0070698_100001437 3300005471 Bacteria 26406
83 Ga0070698_100004321 3300005471 Bacteria 15616
84 Ga0070698_100006891 3300005471 Bacteria 12313
85 Ga0070698_100031580 3300005471 Bacteria 5489
86 Ga0070698_100032056 3300005471 Bacteria 5446
87 Ga0070698_100059041 3300005471 Bacteria 3876
88 Ga0070699_100038999 3300005518 Bacteria 4112
89 Ga0070699_100062759 3300005518 Bacteria 3221
90 Ga0070679_100000016 3300005530 Bacteria 139454
91 Ga0070679_100002098 3300005530 Bacteria 17957
92 Ga0070679_100039772 3300005530 Bacteria 4675
93 Ga0070679_100124948 3300005530 Bacteria 2556
94 Ga0070679_100131620 3300005530 Bacteria 2482
95 Ga0070684_100205297 3300005535 Bacteria 1795
96 Ga0070697_100024392 3300005536 Bacteria 4815
97 Ga0068853_100034386 3300005539 Bacteria 4302
98 Ga0068853_100035256 3300005539 Bacteria 4248
99 Ga0070672_100087525 3300005543 Bacteria 2507
100 Ga0070686_100017464 3300005544 Bacteria 4193
101 Ga0070695_100055470 3300005545 Bacteria 2554
102 Ga0070696_100000953 3300005546 Bacteria 18773
103 Ga0070696_100096537 3300005546 Bacteria 2112
104 Ga0070693_100014101 3300005547 Bacteria 4086
105 Ga0070665_100012640 3300005548 Bacteria 8501
106 Ga0068855_100004743 3300005563 Bacteria 16597
107 Ga0068857_100055007 3300005577 Bacteria 3532
108 Ga0068857_100109438 3300005577 Bacteria 2483
109 Ga0068854_100002563 3300005578 Bacteria 11246
110 Ga0068854_100081603 3300005578 Bacteria 2389
111 Ga0068856_100012896 3300005614 Bacteria 8090
112 Ga0068856_100032085 3300005614 Bacteria 5141
113 Ga0068856_100080477 3300005614 Bacteria 3231
114 Ga0068856_100084252 3300005614 Bacteria 3158
115 Ga0070702_100000181 3300005615 Bacteria 20246
116 Ga0068852_100007081 3300005616 Bacteria 8170
117 Ga0068852_100035620 3300005616 Bacteria 4154
118 Ga0068859_100021021 3300005617 Bacteria 6551
119 Ga0068859_100079889 3300005617 Bacteria 3311
120 Ga0068859_100155550 3300005617 Bacteria 2363
121 Ga0068864_100003646 3300005618 Bacteria 12733
122 Ga0068864_100137313 3300005618 Bacteria 2203
123 Ga0068861_100017783 3300005719 Bacteria 5051
124 Ga0068861_100028258 3300005719 Bacteria 4092
125 Ga0068870_10007494 3300005840 Bacteria 4869
126 Ga0068858_100050056 3300005842 Bacteria 3867
127 Ga0068860_100108652 3300005843 Bacteria 2651
128 Ga0081455_10001759 3300005937 Bacteria 26177
129 Ga0081455_10011389 3300005937 Bacteria 8940
130 Ga0081455_10027242 3300005937 Bacteria 5238
131 Ga0081455_10071494 3300005937 Bacteria 2876
132 Ga0081538_10001441 3300005981 Bacteria 24455
133 Ga0081540_1000097 3300005983 Bacteria 92047
134 Ga0081540_1009149 3300005983 Bacteria 6836
135 Ga0081540_1031284 3300005983 Bacteria 2929
136 Ga0081539_10000015 3300005985 Bacteria 395781
137 Ga0081539_10000717 3300005985 Bacteria 66511
138 Ga0081539_10014229 3300005985 Bacteria 5906
139 Ga0081539_10023013 3300005985 Bacteria 4096
140 Ga0070717_10019268 3300006028 Bacteria 5349
141 Ga0070717_10022123 3300006028 Bacteria 5020
142 Ga0075363_100048012 3300006048 Bacteria 2269
143 Ga0075432_10000184 3300006058 Bacteria 15938
144 Ga0075432_10003361 3300006058 Bacteria 5407
145 Ga0070715_10009603 3300006163 Bacteria 3416
146 Ga0070715_10010578 3300006163 Bacteria 3293
147 Ga0070716_100000186 3300006173 Bacteria 24421
148 Ga0070716_100001102 3300006173 Bacteria 11878
149 Ga0070716_100037136 3300006173 Bacteria 2690
150 Ga0070712_100005948 3300006175 Bacteria 7542
151 Ga0070712_100036038 3300006175 Bacteria 3363
152 Ga0075367_10009815 3300006178 Bacteria 5016
153 Ga0075427_10002845 3300006194 Bacteria 2351
154 Ga0097621_100052980 3300006237 Bacteria 3306
155 Ga0068871_100037584 3300006358 Bacteria 3862
156 Ga0075428_100000285 3300006844 Bacteria 49638
157 Ga0075428_100008245 3300006844 Bacteria 11552
158 Ga0075428_100023028 3300006844 Bacteria 6894
159 Ga0075428_100029819 3300006844 Bacteria 6035
160 Ga0075430_100004937 3300006846 Bacteria 11219
161 Ga0075431_100006189 3300006847 Bacteria 11879
162 Ga0075433_10002351 3300006852 Bacteria 14387
163 Ga0075433_10002630 3300006852 Bacteria 13710
164 Ga0075433_10158999 3300006852 Bacteria 2011
165 Ga0075434_100003332 3300006871 Bacteria 14373
166 Ga0075434_100057478 3300006871 Bacteria 3866
167 Ga0075434_100105815 3300006871 Bacteria 2823
168 Ga0075429_100000714 3300006880 Bacteria 26009
169 Ga0075429_100033608 3300006880 Bacteria 4457
170 Ga0075436_100008179 3300006914 Bacteria 7159
171 Ga0075436_100084447 3300006914 Bacteria 2204
172 Ga0097620_100021021 3300006931 Bacteria 6551
173 Ga0097620_100079891 3300006931 Bacteria 3311
174 Ga0097620_100155544 3300006931 Bacteria 2363
175 Ga0075435_100001797 3300007076 Bacteria 13948
176 Ga0075435_100014600 3300007076 Bacteria 5878
177 Ga0075435_100028736 3300007076 Bacteria 4362
178 Ga0075435_100053244 3300007076 Bacteria 3263
179 Ga0105240_10026684 3300009093 Bacteria 7578
180 Ga0105240_10159410 3300009093 Bacteria 2682
181 Ga0111539_10009361 3300009094 Bacteria 12367
182 Ga0111539_10015527 3300009094 Bacteria 9468
183 Ga0105245_10061047 3300009098 Bacteria 3397
184 Ga0105245_10131086 3300009098 Bacteria 2351
185 Ga0114129_10000278 3300009147 Bacteria 58533
186 Ga0114129_10001404 3300009147 Bacteria 32492
187 Ga0114129_10002476 3300009147 Bacteria 25644
188 Ga0114129_10004135 3300009147 Bacteria 20508
189 Ga0114129_10070705 3300009147 Bacteria 4866
190 Ga0105243_10000176 3300009148 Bacteria 73715
191 Ga0105243_10003944 3300009148 Bacteria 11845
192 Ga0105243_10005949 3300009148 Bacteria 9449
193 Ga0105241_10005275 3300009174 Bacteria 9545
194 Ga0105248_10069469 3300009177 Bacteria 3955
195 Ga0105238_10022283 3300009551 Bacteria 6456
196 Ga0105238_10183891 3300009551 Bacteria 2067
197 Ga0105249_10062449 3300009553 Bacteria 3421
198 Ga0105249_10226043 3300009553 Bacteria 1844
199 Ga0105239_10047982 3300010375 Bacteria 4681
200 Ga0105246_10000307 3300011119 Bacteria 25935
201 Ga0157371_10021854 3300013102 Bacteria 4694
202 Ga0157370_10035408 3300013104 Bacteria 4852
203 Ga0157369_10000890 3300013105 Bacteria 38122
204 Ga0157369_10001482 3300013105 Bacteria 28790
205 Ga0157369_10022930 3300013105 Bacteria 6961
206 Ga0157369_10044670 3300013105 Bacteria 4821
207 Ga0157374_10123096 3300013296 Bacteria 2505
208 Ga0157375_10047169 3300013308 Bacteria 4205
209 Ga0157375_10217292 3300013308 Bacteria 2070
210 Ga0163163_10077534 3300014325 Bacteria 3318
211 Ga0163163_10183773 3300014325 Bacteria 2138
212 Ga0157380_10062562 3300014326 Bacteria 2981
213 Ga0157380_10193111 3300014326 Bacteria 1799
214 Ga0182008_10000943 3300014497 Bacteria 20240
215 Ga0157377_10020979 3300014745 Bacteria 3430
216 Ga0157379_10015119 3300014968 Bacteria 6769
217 Ga0182006_1009402 3300015261 Bacteria 4382
218 Ga0182007_10002092 3300015262 Bacteria 10249
219 Ga0183367_1002 3300015688 Bacteria 1101531
220 Ga0163161_10060911 3300017792 Bacteria 2748
221 Ga0197907_10936403 3300020069 Bacteria 3304
222 Ga0206356_10751802 3300020070 Bacteria 2543
223 Ga0206356_11783545 3300020070 Bacteria 2133
224 Ga0206351_10212682 3300020077 Bacteria 3673
225 Ga0206352_10890638 3300020078 Bacteria 2388
226 Ga0206350_10197218 3300020080 Bacteria 3025
227 Ga0206350_10690641 3300020080 Bacteria 2654
228 Ga0206350_11609180 3300020080 Bacteria 2386
229 Ga0206354_10851720 3300020081 Bacteria 2709
230 Ga0206353_10420202 3300020082 Bacteria 2286
231 Ga0206353_10790204 3300020082 Bacteria 2738
232 Ga0206353_10942493 3300020082 Bacteria 2911
233 Ga0206353_11803527 3300020082 Bacteria 3309
234 Ga0213876_10003347 3300021384 Bacteria 9178
235 Ga0213875_10000547 3300021388 Bacteria 30798
236 Ga0213875_10000781 3300021388 Bacteria 23756
237 Ga0213875_10012233 3300021388 Bacteria 4244
238 Ga0213875_10038392 3300021388 Bacteria 2256
239 Ga0224712_10001180 3300022467 Bacteria 5857
240 Ga0224712_10001750 3300022467 Bacteria 5168
241 Ga0224712_10001854 3300022467 Bacteria 5068
242 Ga0224712_10005293 3300022467 Bacteria 3578
243 Ga0224712_10010884 3300022467 Bacteria 2799
244 Ga0224712_10022844 3300022467 Bacteria 2162
245 Ga0224572_1008564 3300024225 Bacteria 1894
246 Ga0209758_1004169 3300025297 Bacteria 12292
247 Ga0207692_10000819 3300025898 Bacteria 11132
248 Ga0207692_10001032 3300025898 Bacteria 10175
249 Ga0207688_10007902 3300025901 Bacteria 5790
250 Ga0207688_10016234 3300025901 Bacteria 4037
251 Ga0207647_10004731 3300025904 Bacteria 10081
252 Ga0207647_10011050 3300025904 Bacteria 6348
253 Ga0207647_10039342 3300025904 Bacteria 2984
254 Ga0207685_10000849 3300025905 Bacteria 5730
255 Ga0207685_10007109 3300025905 Bacteria 3098
256 Ga0207699_10000338 3300025906 Bacteria 24924
257 Ga0207699_10000737 3300025906 Bacteria 15603
258 Ga0207699_10002992 3300025906 Bacteria 8036
259 Ga0207699_10004669 3300025906 Bacteria 6549
260 Ga0207705_10000550 3300025909 Bacteria 31517
261 Ga0207705_10005392 3300025909 Bacteria 9566
262 Ga0207705_10021321 3300025909 Bacteria 4623
263 Ga0207684_10015231 3300025910 Bacteria 6623
264 Ga0207684_10019463 3300025910 Bacteria 5808
265 Ga0207684_10032533 3300025910 Bacteria 4434
266 Ga0207654_10001414 3300025911 Bacteria 12729
267 Ga0207707_10075370 3300025912 Bacteria 2943
268 Ga0207707_10099957 3300025912 Bacteria 2535
269 Ga0207695_10000957 3300025913 Bacteria 51431
270 Ga0207671_10000405 3300025914 Bacteria 60326
271 Ga0207693_10012722 3300025915 Bacteria 6795
272 Ga0207693_10023030 3300025915 Bacteria 4946
273 Ga0207693_10053010 3300025915 Bacteria 3182
274 Ga0207663_10002971 3300025916 Bacteria 8202
275 Ga0207663_10010608 3300025916 Bacteria 4911
276 Ga0207660_10008750 3300025917 Bacteria 6544
277 Ga0207660_10014961 3300025917 Bacteria 5113
278 Ga0207662_10020710 3300025918 Bacteria 3753
279 Ga0207657_10006528 3300025919 Bacteria 12082
280 Ga0207657_10028947 3300025919 Bacteria 5047
281 Ga0207657_10042748 3300025919 Bacteria 3996
282 Ga0207652_10000015 3300025921 Bacteria 193042
283 Ga0207652_10003427 3300025921 Bacteria 13087
284 Ga0207652_10016038 3300025921 Bacteria 6110
285 Ga0207652_10055066 3300025921 Bacteria 3420
286 Ga0207646_10000105 3300025922 Bacteria 114126
287 Ga0207646_10001355 3300025922 Bacteria 30398
288 Ga0207646_10007603 3300025922 Bacteria 10978
289 Ga0207646_10018738 3300025922 Bacteria 6451
290 Ga0207646_10025959 3300025922 Bacteria 5355
291 Ga0207646_10086177 3300025922 Bacteria 2810
292 Ga0207694_10002983 3300025924 Bacteria 13570
293 Ga0207694_10077156 3300025924 Bacteria 2610
294 Ga0207687_10100117 3300025927 Bacteria 2131
295 Ga0207687_10125859 3300025927 Bacteria 1924
296 Ga0207700_10000737 3300025928 Bacteria 18884
297 Ga0207700_10002110 3300025928 Bacteria 11354
298 Ga0207700_10003804 3300025928 Bacteria 8816
299 Ga0207700_10014056 3300025928 Bacteria 5233
300 Ga0207700_10022870 3300025928 Bacteria 4296
301 Ga0207700_10048216 3300025928 Bacteria 3162
302 Ga0207700_10054712 3300025928 Bacteria 2997
303 Ga0207664_10000171 3300025929 Bacteria 51218
304 Ga0207664_10000683 3300025929 Bacteria 23312
305 Ga0207664_10000992 3300025929 Bacteria 19046
306 Ga0207664_10003484 3300025929 Bacteria 10499
307 Ga0207664_10006127 3300025929 Bacteria 8242
308 Ga0207664_10009752 3300025929 Bacteria 6753
309 Ga0207664_10016628 3300025929 Bacteria 5372
310 Ga0207664_10028888 3300025929 Bacteria 4219
311 Ga0207664_10044380 3300025929 Bacteria 3481
312 Ga0207664_10105998 3300025929 Bacteria 2330
313 Ga0207664_10124222 3300025929 Bacteria 2165
314 Ga0207690_10001323 3300025932 Bacteria 15573
315 Ga0207690_10118954 3300025932 Bacteria 1916
316 Ga0207706_10001492 3300025933 Bacteria 23254
317 Ga0207686_10044246 3300025934 Bacteria 2733
318 Ga0207709_10027016 3300025935 Bacteria 3302
319 Ga0207709_10035623 3300025935 Bacteria 2944
320 Ga0207670_10011841 3300025936 Bacteria 5078
321 Ga0207704_10087528 3300025938 Bacteria 2035
322 Ga0207665_10000278 3300025939 Bacteria 35536
323 Ga0207665_10000650 3300025939 Bacteria 23346
324 Ga0207665_10002702 3300025939 Bacteria 11894
325 Ga0207665_10104683 3300025939 Bacteria 1981
326 Ga0207691_10033704 3300025940 Bacteria 4768
327 Ga0207689_10018433 3300025942 Bacteria 5890
328 Ga0207661_10057216 3300025944 Bacteria 3134
329 Ga0207667_10060147 3300025949 Bacteria 3977
330 Ga0207668_10047607 3300025972 Bacteria 2937
331 Ga0207640_10005196 3300025981 Bacteria 7083
332 Ga0207640_10100034 3300025981 Bacteria 2031
333 Ga0207658_10024425 3300025986 Bacteria 4229
334 Ga0207677_10004838 3300026023 Bacteria 7268
335 Ga0207678_10050248 3300026067 Bacteria 3603
336 Ga0207708_10000076 3300026075 Bacteria 78340
337 Ga0207708_10017836 3300026075 Bacteria 5342
338 Ga0207702_10018909 3300026078 Bacteria 5700
339 Ga0207702_10030308 3300026078 Bacteria 4508
340 Ga0207702_10051423 3300026078 Bacteria 3482
341 Ga0207702_10111984 3300026078 Bacteria 2428
342 Ga0207648_10148255 3300026089 Bacteria 2070
343 Ga0207676_10009004 3300026095 Bacteria 7104
344 Ga0207674_10004920 3300026116 Bacteria 15972
345 Ga0207674_10005169 3300026116 Bacteria 15556
346 Ga0207674_10043356 3300026116 Bacteria 4639
347 Ga0207675_100018820 3300026118 Bacteria 6444
348 Ga0207683_10029753 3300026121 Bacteria 4729
349 Ga0207683_10030781 3300026121 Bacteria 4653
350 Ga0207683_10051377 3300026121 Bacteria 3611
351 Ga0207683_10137904 3300026121 Bacteria 2196
352 Ga0207683_10148086 3300026121 Bacteria 2118
353 Ga0207698_10007766 3300026142 Bacteria 6738
354 Ga0207698_10140480 3300026142 Bacteria 2080
355 Ga0207428_10003495 3300027907 Bacteria 15231
356 Ga0207428_10019672 3300027907 Bacteria 5754
357 Ga0265337_1000014 3300028556 Bacteria 81870
358 Ga0265326_10000789 3300028558 Bacteria 11730
359 Ga0265319_1004236 3300028563 Bacteria 7162
360 Ga0265334_10000160 3300028573 Bacteria 41820
361 Ga0265334_10001483 3300028573 Bacteria 11317
362 Ga0265323_10004706 3300028653 Bacteria 5853
363 Ga0265336_10003919 3300028666 Bacteria 5703
364 Ga0307515_10058339 3300028794 Bacteria 5561
365 Ga0307515_10131999 3300028794 Bacteria 2743
366 Ga0265338_10000148 3300028800 Bacteria 128839
367 Ga0265338_10000577 3300028800 Bacteria 64591
368 Ga0265338_10004722 3300028800 Bacteria 18243
369 Ga0265338_10014617 3300028800 Bacteria 8711
370 Ga0265324_10002464 3300029957 Bacteria 9412
371 Ga0268256_1011284 3300030500 Bacteria 2840
372 Ga0307511_10067650 3300030521 Bacteria 2648
373 Ga0316181_1252189 3300030744 Bacteria 2834
374 Ga0265332_10000443 3300031238 Bacteria 29217
375 Ga0265320_10001651 3300031240 Bacteria 15876
376 Ga0265325_10002380 3300031241 Bacteria 12708
377 Ga0265340_10001774 3300031247 Bacteria 12312
378 Ga0265339_10027146 3300031249 Bacteria 3273
379 Ga0265316_10009251 3300031344 Bacteria 9071
380 Ga0265316_10082874 3300031344 Bacteria 2457
381 Ga0307513_10023311 3300031456 Bacteria 7235
382 Ga0307513_10026989 3300031456 Bacteria 6605
383 Ga0307408_100014447 3300031548 Bacteria 5246
384 Ga0265313_10009246 3300031595 Bacteria 6420
385 Ga0307508_10016684 3300031616 Bacteria 6682
386 Ga0307508_10018583 3300031616 Bacteria 6317
387 Ga0307508_10020494 3300031616 Bacteria 6004
388 Ga0307508_10025970 3300031616 Bacteria 5311
389 Ga0307514_10005681 3300031649 Bacteria 11048
390 Ga0307514_10033883 3300031649 Bacteria 4071
391 Ga0307514_10083453 3300031649 Bacteria 2355
392 Ga0316575_10001367 3300031665 Bacteria 7834
393 Ga0316575_10040892 3300031665 Bacteria 1833
394 Ga0316579_10000001 3300031691 Bacteria 77478
395 Ga0316579_10013526 3300031691 Bacteria 3511
396 Ga0316579_10019729 3300031691 Bacteria 2982
397 Ga0265314_10005926 3300031711 Bacteria 10933
398 Ga0265314_10007762 3300031711 Bacteria 9277
399 Ga0316576_10002620 3300031727 Bacteria 10287
400 Ga0316576_10006560 3300031727 Bacteria 7258
401 Ga0316576_10020489 3300031727 Bacteria 4554
402 Ga0316578_10003178 3300031728 Bacteria 7439
403 Ga0316578_10006131 3300031728 Bacteria 5905
404 Ga0316578_10012533 3300031728 Bacteria 4473
405 Ga0316578_10023272 3300031728 Bacteria 3466
406 Ga0307516_10014655 3300031730 Bacteria 8283
407 Ga0307516_10085636 3300031730 Bacteria 2989
408 Ga0307405_10015926 3300031731 Bacteria 4086
409 Ga0307405_10020321 3300031731 Bacteria 3708
410 Ga0307405_10052481 3300031731 Bacteria 2535
411 Ga0316577_10044242 3300031733 Bacteria 2490
412 Ga0307413_10003683 3300031824 Bacteria 6511
413 Ga0307410_10000043 3300031852 Bacteria 43864
414 Ga0307410_10006019 3300031852 Bacteria 6501
415 Ga0307410_10038838 3300031852 Bacteria 3121
416 Ga0307410_10057397 3300031852 Bacteria 2651
417 Ga0307410_10111175 3300031852 Bacteria 1982
418 Ga0307406_10000008 3300031901 Bacteria 120233
419 Ga0307406_10006451 3300031901 Bacteria 6476
420 Ga0307407_10000710 3300031903 Bacteria 10840
421 Ga0307407_10019224 3300031903 Bacteria 3474
422 Ga0307409_100000014 3300031995 Bacteria 62867
423 Ga0307409_100000561 3300031995 Bacteria 16158
424 Ga0307409_100011137 3300031995 Bacteria 5647
425 Ga0307409_100097597 3300031995 Bacteria 2427
426 Ga0307409_100120252 3300031995 Bacteria 2223
427 Ga0307416_100000088 3300032002 Bacteria 62911
428 Ga0307416_100002704 3300032002 Bacteria 10272
429 Ga0307416_100009589 3300032002 Bacteria 6346
430 Ga0307416_100017669 3300032002 Bacteria 4999
431 Ga0307416_100022381 3300032002 Bacteria 4561
432 Ga0307416_100069765 3300032002 Bacteria 2910
433 Ga0307414_10005251 3300032004 Bacteria 7120
434 Ga0307411_10000384 3300032005 Bacteria 15110
435 Ga0307411_10125395 3300032005 Bacteria 1866
436 Ga0307415_100000019 3300032126 Bacteria 70406
437 Ga0307415_100005409 3300032126 Bacteria 6779
438 Ga0307415_100020493 3300032126 Bacteria 4038
439 Ga0307415_100027411 3300032126 Bacteria 3609
440 Ga0307507_10000009 3300033179 Bacteria 265992
441 Ga0307510_10017401 3300033180 Bacteria 8477
442 Ga0316596_1003704 3300033541 Bacteria 3375
443 Ga0316596_1010369 3300033541 Bacteria 2253
444 Ga0316212_1003286 3300033547 Bacteria 2327
445 Ga0373930_0008290 3300034816 Bacteria 1816
446 Ga0373926_0000105 3300035083 Bacteria 16863
447 Ga0373926_0000466 3300035083 Bacteria 10642
448 Ga0373926_0005218 3300035083 Bacteria 4277
449 Ga0373934_0000054 3300035086 Bacteria 38975
450 Ga0373934_0002514 3300035086 Bacteria 6739
451 Ga0373934_0007077 3300035086 Bacteria 4163
452 Ga0373944_0023275 3300035089 Bacteria 1806
453 Ga0373923_0007771 3300035111 Bacteria 3788
454 Ga0373923_0009106 3300035111 Bacteria 3571
455 Ga0373936_0001451 3300035113 Bacteria 8603
456 Ga0373936_0002308 3300035113 Bacteria 7137
457 Ga0373936_0004305 3300035113 Bacteria 5378
458 Ga0373945_0000026 3300035116 Bacteria 29970
459 Ga0373953_0000343 3300035117 Bacteria 12556
460 Ga0373953_0013819 3300035117 Bacteria 2891
461 Ga0373953_0034317 3300035117 Bacteria 1988
462 Ga0373954_0001747 3300035118 Bacteria 8921
463 Ga0373954_0031614 3300035118 Bacteria 2444
464 Ga0373956_0000083 3300035119 Bacteria 31785
465 Ga0373956_0011130 3300035119 Bacteria 3704
466 Ga0373957_0000013 3300035120 Bacteria 44715
467 Ga0373943_0000073 3300035170 Bacteria 35361
468 Ga0373943_0004602 3300035170 Bacteria 6235
469 Ga0373943_0013902 3300035170 Bacteria 3639
470 Ga0373943_0059990 3300035170 Bacteria 1898
471 Ga0373946_0000103 3300035171 Bacteria 23988
472 Ga0373955_0000009 3300035172 Bacteria 81129
473 Ga0373955_0030449 3300035172 Bacteria 2817
474 Ga0373955_0052417 3300035172 Bacteria 2225
475 Ga0316574_0016554 3300035398 Bacteria 4299
476 Ga0316574_0018770 3300035398 Bacteria 4069
477 Ga0373924_0002152 3300035410 Bacteria 6595
478 Ga0373924_0015170 3300035410 Bacteria 2924
479 Ga0373935_0001433 3300035692 Bacteria 13214
480 Ga0373935_0045885 3300035692 Bacteria 2758
481 Ga0373935_0056507 3300035692 Bacteria 2502
482 Ga0373927_0027780 3300035695 Bacteria 3694
483 Ga0373927_0086844 3300035695 Bacteria 2030
484 Ga0373933_0000006 3300035724 Bacteria 125141
485 Ga0373933_0007416 3300035724 Bacteria 5982
486 Ga0373933_0030297 3300035724 Bacteria 3132
487 Ga0373933_0033312 3300035724 Bacteria 2996
488 Ga0373947_0001176 3300035725 Bacteria 16097
489 Ga0373947_0003755 3300035725 Bacteria 8962
490 Ga0373947_0013107 3300035725 Bacteria 4752
491 Ga0373937_0000148 3300036401 Bacteria 67378
492 Ga0373937_0008996 3300036401 Bacteria 8671
493 Ga0373937_0018307 3300036401 Bacteria 6253
494 Ga0373937_0094415 3300036401 Bacteria 2773
495 Ga0372808_000487 3300036459 Bacteria 3160
496 Ga0316582_0009314 3300036647 Bacteria 5324
497 Ga0316582_0036417 3300036647 Bacteria 3046
498 Ga0316582_0073043 3300036647 Bacteria 2225
499 Ga0316584_0003561 3300036712 Bacteria 10167
500 Ga0316584_0052020 3300036712 Bacteria 3063
501 Ga0316584_0056574 3300036712 Bacteria 2936
502 Ga0316584_0066535 3300036712 Bacteria 2700
503 Ga0373925_0000004 3300037068 Bacteria 361597
504 Ga0373925_0002932 3300037068 Bacteria 13456
505 Ga0373925_0006283 3300037068 Bacteria 8756
506 Ga0373925_0010217 3300037068 Bacteria 6813
507 Ga0373925_0057438 3300037068 Bacteria 2916
508 Ga0373925_0095847 3300037068 Bacteria 2273
509 Ga0373925_0128967 3300037068 Bacteria 1970
510 Ga0395899_0003357 3300037312 Bacteria 12697
511 Ga0395899_0037552 3300037312 Bacteria 3631
512 Ga0395900_0033916 3300037418 Bacteria 5254
513 Ga0395900_0062817 3300037418 Bacteria 3818
514 Ga0395898_0003223 3300037466 Bacteria 18359
515 Ga0395898_0012248 3300037466 Bacteria 8867
516 Ga0395898_0013671 3300037466 Bacteria 8351
517 Ga0395898_0019426 3300037466 Bacteria 6915
518 Ga0395898_0046997 3300037466 Bacteria 4238
519 Ga0395898_0099821 3300037466 Bacteria 2788
520 Ga0395898_0169238 3300037466 Bacteria 2089
521 Ga0436364_0112641 3300037853 Bacteria 82637
522 Ga0436364_0195638 3300037853 Bacteria 19495
523 Ga0436364_0531653 3300037853 Bacteria 5078
524 Ga0436364_1133930 3300037853 Bacteria 44830
525 Ga0436364_1202907 3300037853 Bacteria 10551
526 Ga0395901_0014343 3300038443 Bacteria 8069
527 Ga0395901_0045839 3300038443 Bacteria 4539
528 Ga0395901_0060892 3300038443 Bacteria 3928
529 Ga0400485_08073 3300038735 Bacteria 15156
530 Ga0400488_53579 3300038741 Bacteria 13182
531 Ga0400486_26016 3300038742 Bacteria 85615
532 Ga0436365_0567091 3300039437 Bacteria 46375
533 Ga0436363_0661712 3300039450 Bacteria 1536
534 Ga0439436_0000557 3300041404 Bacteria 9817
535 Ga0439439_0000765 3300041406 Bacteria 5795
536 Ga0451789_0138174 3300041443 Bacteria 2208
537 Ga0451791_0734773 3300041451 Bacteria 4078
538 Ga0451795_0548267 3300041456 Bacteria 1952
539 Ga0451849_0159173 3300041505 Bacteria 1939
540 Ga0451843_1177035 3300041509 Bacteria 3599
541 Ga0451853_2494527 3300041512 Bacteria 8272
542 Ga0439433_0013858 3300041999 Bacteria 1773
543 Ga0439442_014674 3300042002 Bacteria 1613
544 Ga0439448_0007405 3300042005 Bacteria 3182
545 Ga0439455_0002672 3300042012 Bacteria 3284
546 Ga0439457_000323 3300042014 Bacteria 13227
547 Ga0439457_001128 3300042014 Bacteria 8031
548 Ga0439463_000980 3300042016 Bacteria 7776
549 Ga0450894_000618 3300042131 Bacteria 5988
550 Ga0450898_002268 3300042134 Bacteria 2674
551 Ga0450899_000145 3300042135 Bacteria 6779
552 Ga0450903_000727 3300042138 Bacteria 6505
553 Ga0450906_004155 3300042145 Bacteria 3059
554 Ga0450908_005005 3300042184 Bacteria 2544
555 Ga0466969_0001092 3300044656 Bacteria 14655
556 Ga0466969_0001548 3300044656 Bacteria 12356
557 Ga0466969_0003332 3300044656 Bacteria 8553
558 Ga0466969_0003795 3300044656 Bacteria 8028
559 Ga0466969_0009388 3300044656 Bacteria 5184
560 Ga0466969_0021457 3300044656 Bacteria 3339
561 Ga0466969_0030450 3300044656 Bacteria 2750
562 Ga0466972_0003101 3300044658 Bacteria 8245
563 Ga0466965_0000974 3300044683 Bacteria 11085
564 Ga0466966_0002114 3300044684 Bacteria 12908
565 Ga0466966_0002908 3300044684 Bacteria 11285
566 Ga0466966_0016563 3300044684 Bacteria 4867
567 Ga0466966_0026217 3300044684 Bacteria 3806
568 Ga0466966_0082745 3300044684 Bacteria 1997
569 Ga0466961_0001308 3300044693 Bacteria 15365
570 Ga0466961_0001396 3300044693 Bacteria 14959
571 Ga0466961_0002697 3300044693 Bacteria 11019
572 Ga0466961_0004026 3300044693 Bacteria 9205
573 Ga0466961_0005970 3300044693 Bacteria 7717
574 Ga0466961_0008148 3300044693 Bacteria 6676
575 Ga0466961_0008920 3300044693 Bacteria 6398
576 Ga0466961_0022167 3300044693 Bacteria 4086
577 Ga0466961_0025205 3300044693 Bacteria 3825
578 Ga0466961_0052646 3300044693 Bacteria 2598
579 Ga0466963_0004535 3300044694 Bacteria 8084
580 Ga0466963_0005648 3300044694 Bacteria 7345
581 Ga0466963_0047849 3300044694 Bacteria 2824
582 Ga0466964_0001929 3300044706 Bacteria 7260
583 Ga0466971_0000220 3300044719 Bacteria 21963
584 Ga0466971_0005159 3300044719 Bacteria 5654
585 Ga0466970_0001370 3300044765 Bacteria 11744
586 Ga0466957_0000798 3300044842 Bacteria 16086
587 Ga0466957_0014746 3300044842 Bacteria 4552
588 Ga0466957_0023644 3300044842 Bacteria 3633
589 Ga0466957_0131321 3300044842 Bacteria 1605
590 Ga0466960_0002037 3300044901 Bacteria 7504
591 Ga0466960_0013305 3300044901 Bacteria 3493
592 Ga0466959_0004898 3300045049 Bacteria 9065
593 Ga0466959_0010580 3300045049 Bacteria 6603
594 Ga0466959_0011045 3300045049 Bacteria 6481
595 Ga0466959_0020304 3300045049 Bacteria 4893
596 Ga0466959_0031253 3300045049 Bacteria 3940
597 Ga0466959_0036140 3300045049 Bacteria 3649
598 Ga0466959_0103213 3300045049 Bacteria 2040
599 Ga0466958_0012778 3300045836 Bacteria 4763
600 Ga0466958_0014558 3300045836 Bacteria 4489
601 Ga0466958_0018195 3300045836 Bacteria 4074
602 Ga0466958_0024515 3300045836 Bacteria 3550
603 Ga0466958_0035590 3300045836 Bacteria 2975
604 Ga0466967_0002536 3300045976 Bacteria 11434
605 Ga0466967_0005065 3300045976 Bacteria 9040
606 Ga0466967_0007108 3300045976 Bacteria 8033
607 Ga0466967_0014770 3300045976 Bacteria 6101
608 Ga0466967_0048027 3300045976 Bacteria 3725
609 Ga0466967_0051928 3300045976 Bacteria 3596
610 Ga0466967_0054843 3300045976 Bacteria 3510
611 Ga0466967_0138981 3300045976 Bacteria 2261
612 Ga0466967_0200255 3300045976 Bacteria 1891
613 Ga0495617_012501 3300046452 Bacteria 2893
614 Ga0495627_008465 3300046453 Bacteria 3855
615 Ga0495592_0000189 3300046454 Bacteria 54324
616 Ga0495592_0006449 3300046454 Bacteria 8735
617 Ga0495592_0008293 3300046454 Bacteria 7798
618 Ga0495592_0019414 3300046454 Bacteria 5169
619 Ga0495592_0031081 3300046454 Bacteria 4037
620 Ga0495592_0038942 3300046454 Bacteria 3573
621 Ga0495603_0000082 3300046455 Bacteria 42500
622 Ga0495603_0005180 3300046455 Bacteria 7784
623 Ga0495603_0007827 3300046455 Bacteria 6441
624 Ga0495603_0010487 3300046455 Bacteria 5615
625 Ga0495603_0012953 3300046455 Bacteria 5042
626 Ga0495629_0003195 3300046459 Bacteria 12402
627 Ga0495629_0008790 3300046459 Bacteria 7428
628 Ga0495629_0010724 3300046459 Bacteria 6665
629 Ga0495629_0053734 3300046459 Bacteria 2817
630 Ga0495629_0083662 3300046459 Bacteria 2227
631 Ga0495629_0085769 3300046459 Bacteria 2197
632 Ga0495638_0025505 3300046460 Bacteria 3841
633 Ga0495638_0044571 3300046460 Bacteria 2794
634 Ga0495651_0000071 3300046462 Bacteria 73914
635 Ga0495651_0000708 3300046462 Bacteria 25865
636 Ga0495651_0003342 3300046462 Bacteria 12315
637 Ga0495651_0004996 3300046462 Bacteria 10132
638 Ga0495651_0009515 3300046462 Bacteria 7463
639 Ga0495651_0009985 3300046462 Bacteria 7298
640 Ga0495651_0015296 3300046462 Bacteria 5931
641 Ga0495651_0019398 3300046462 Bacteria 5270
642 Ga0495651_0023269 3300046462 Bacteria 4818
643 Ga0495651_0026171 3300046462 Bacteria 4543
644 Ga0495653_0009372 3300046463 Bacteria 8009
645 Ga0495653_0010877 3300046463 Bacteria 7449
646 Ga0495653_0016368 3300046463 Bacteria 6040
647 Ga0495653_0032484 3300046463 Bacteria 4142
648 Ga0495653_0069571 3300046463 Bacteria 2636
649 Ga0495653_0073881 3300046463 Bacteria 2543
650 Ga0495653_0105727 3300046463 Bacteria 2031
651 Ga0495580_0053431 3300046472 Bacteria 2850
652 Ga0495582_0002562 3300046473 Bacteria 10116
653 Ga0495582_0008071 3300046473 Bacteria 5810
654 Ga0495582_0010553 3300046473 Bacteria 5081
655 Ga0495605_0009406 3300046474 Bacteria 5489
656 Ga0495639_0003116 3300046475 Bacteria 7206
657 Ga0495639_0062747 3300046475 Bacteria 1705
658 Ga0495662_0002994 3300046476 Bacteria 8525
659 Ga0495662_0007814 3300046476 Bacteria 5265
660 Ga0495662_0009305 3300046476 Bacteria 4819
661 Ga0495662_0057986 3300046476 Bacteria 1870
662 Ga0495664_0003163 3300046477 Bacteria 8938
663 Ga0495664_0004338 3300046477 Bacteria 7746
664 Ga0495664_0005713 3300046477 Bacteria 6848
665 Ga0495664_0024459 3300046477 Bacteria 3511
666 Ga0495664_0032644 3300046477 Bacteria 3056
667 Ga0495664_0040472 3300046477 Bacteria 2756
668 Ga0495585_0081628 3300046492 Bacteria 1751
669 Ga0495594_0012643 3300046499 Bacteria 4401
670 Ga0495607_0021059 3300046501 Bacteria 4107
671 Ga0495608_0000107 3300046511 Bacteria 59326
672 Ga0495608_0002791 3300046511 Bacteria 12531
673 Ga0495608_0004680 3300046511 Bacteria 9788
674 Ga0495608_0006891 3300046511 Bacteria 8049
675 Ga0495608_0040533 3300046511 Bacteria 3119
676 Ga0495608_0093597 3300046511 Bacteria 1941
677 Ga0495610_0025302 3300046512 Bacteria 3187
678 Ga0495616_0005670 3300046513 Bacteria 7647
679 Ga0495618_0003261 3300046514 Bacteria 10158
680 Ga0495618_0006446 3300046514 Bacteria 7125
681 Ga0495618_0006640 3300046514 Bacteria 7010
682 Ga0495618_0010914 3300046514 Bacteria 5501
683 Ga0495618_0023583 3300046514 Bacteria 3806
684 Ga0495618_0060827 3300046514 Bacteria 2395
685 Ga0495620_0016027 3300046515 Bacteria 3771
686 Ga0495628_0000136 3300046516 Bacteria 62431
687 Ga0495628_0003511 3300046516 Bacteria 14030
688 Ga0495628_0025864 3300046516 Bacteria 4792
689 Ga0495628_0062539 3300046516 Bacteria 2917
690 Ga0495628_0106628 3300046516 Bacteria 2157
691 Ga0495630_0005518 3300046517 Bacteria 8924
692 Ga0495630_0069945 3300046517 Bacteria 2640
693 Ga0495631_0018871 3300046518 Bacteria 3241
694 Ga0495637_0057332 3300046520 Bacteria 1609
695 Ga0495643_0010414 3300046522 Bacteria 5725
696 Ga0495666_0003956 3300046526 Bacteria 7494
697 Ga0495666_0015376 3300046526 Bacteria 3810
698 Ga0495666_0057347 3300046526 Bacteria 1864
699 Ga0495652_0000732 3300046529 Bacteria 37991
700 Ga0495652_0001718 3300046529 Bacteria 23592
701 Ga0495652_0012349 3300046529 Bacteria 7708
702 Ga0495652_0020541 3300046529 Bacteria 5870
703 Ga0495652_0043078 3300046529 Bacteria 3890
704 Ga0495652_0055605 3300046529 Bacteria 3364
705 Ga0495652_0077057 3300046529 Bacteria 2764
706 Ga0495654_0016160 3300046530 Bacteria 3951
707 Ga0495665_0009647 3300046531 Bacteria 5229
708 Ga0495665_0009885 3300046531 Bacteria 5164
709 Ga0495665_0037121 3300046531 Bacteria 2600
710 Ga0495640_0006120 3300046533 Bacteria 9537
711 Ga0495640_0007093 3300046533 Bacteria 8816
712 Ga0495640_0010766 3300046533 Bacteria 7055
713 Ga0495640_0025636 3300046533 Bacteria 4272
714 Ga0495640_0035637 3300046533 Bacteria 3520
715 Ga0495640_0072223 3300046533 Bacteria 2312
716 Ga0495586_0009559 3300046535 Bacteria 5166
717 Ga0495587_0000070 3300046536 Bacteria 85402
718 Ga0495587_0003232 3300046536 Bacteria 10899
719 Ga0495587_0003909 3300046536 Bacteria 9885
720 Ga0495587_0020513 3300046536 Bacteria 4079
721 Ga0495587_0031829 3300046536 Bacteria 3191
722 Ga0495597_0026695 3300046542 Bacteria 2652
723 Ga0495645_0003283 3300046543 Bacteria 10963
724 Ga0495645_0009696 3300046543 Bacteria 6734
725 Ga0495645_0019011 3300046543 Bacteria 4944
726 Ga0495645_0020301 3300046543 Bacteria 4791
727 Ga0495645_0021409 3300046543 Bacteria 4673
728 Ga0495645_0037195 3300046543 Bacteria 3547
729 Ga0495645_0063535 3300046543 Bacteria 2672
730 Ga0495622_0011931 3300046557 Bacteria 4019
731 Ga0495667_0000048 3300046559 Bacteria 117509
732 Ga0495667_0015266 3300046559 Bacteria 5186
733 Ga0495667_0033993 3300046559 Bacteria 3409
734 Ga0495667_0041363 3300046559 Bacteria 3057
735 Ga0495667_0135700 3300046559 Bacteria 1586
736 Ga0495656_0045734 3300046615 Bacteria 1849
737 Ga0495668_0005137 3300046616 Bacteria 8996
738 Ga0495634_0002233 3300046642 Bacteria 16223
739 Ga0495634_0010992 3300046642 Bacteria 6606
740 Ga0495634_0013252 3300046642 Bacteria 5961
741 Ga0495634_0072588 3300046642 Bacteria 2263
742 Ga0495634_0079036 3300046642 Bacteria 2154
743 Ga0495634_0083437 3300046642 Bacteria 2085
744 Ga0495625_0118444 3300046660 Bacteria 1804
745 Ga0495635_0001155 3300046663 Bacteria 17613
746 Ga0495635_0008954 3300046663 Bacteria 6986
747 Ga0495635_0034387 3300046663 Bacteria 3514
748 Ga0495635_0057588 3300046663 Bacteria 2673
749 Ga0495635_0066146 3300046663 Bacteria 2479
750 Ga0495661_0023753 3300046665 Bacteria 3974
751 Ga0495588_0000889 3300046674 Bacteria 13194
752 Ga0495657_0000046 3300046675 Bacteria 106064
753 Ga0495657_0004680 3300046675 Bacteria 10911
754 Ga0495657_0008676 3300046675 Bacteria 7759
755 Ga0495657_0009724 3300046675 Bacteria 7266
756 Ga0495657_0012224 3300046675 Bacteria 6383
757 Ga0495657_0018394 3300046675 Bacteria 5059
758 Ga0495657_0026036 3300046675 Bacteria 4147
759 Ga0495657_0031609 3300046675 Bacteria 3698
760 Ga0495599_0000023 3300046678 Bacteria 125139
761 Ga0495599_0002361 3300046678 Bacteria 10962
762 Ga0495599_0033068 3300046678 Bacteria 3248
763 Ga0495599_0072170 3300046678 Bacteria 2154
764 Ga0495623_0000157 3300046679 Bacteria 42271
765 Ga0495623_0009340 3300046679 Bacteria 6369
766 Ga0495623_0011858 3300046679 Bacteria 5647
767 Ga0495623_0016802 3300046679 Bacteria 4728
768 Ga0495623_0020578 3300046679 Bacteria 4264
769 Ga0495623_0081380 3300046679 Bacteria 2002
770 Ga0495646_0012336 3300046680 Bacteria 5435
771 Ga0495658_0003148 3300046683 Bacteria 8224
772 Ga0495658_0007177 3300046683 Bacteria 5504
773 Ga0495658_0043113 3300046683 Bacteria 2522
774 Ga0495658_0055501 3300046683 Bacteria 2257
775 Ga0495669_0002176 3300046684 Bacteria 8042
776 Ga0495613_0004199 3300046689 Bacteria 10782
777 Ga0495613_0008146 3300046689 Bacteria 7796
778 Ga0495613_0009441 3300046689 Bacteria 7235
779 Ga0495613_0011261 3300046689 Bacteria 6643
780 Ga0495613_0011520 3300046689 Bacteria 6577
781 Ga0495613_0144616 3300046689 Bacteria 1697
782 Ga0495624_0003948 3300046690 Bacteria 10918
783 Ga0495624_0013782 3300046690 Bacteria 5506
784 Ga0495649_0046669 3300046694 Bacteria 2358
785 Ga0495589_0020249 3300046794 Bacteria 3403
786 Ga0495600_0014154 3300046809 Bacteria 5025
787 Ga0495600_0045073 3300046809 Bacteria 2877
788 Ga0495660_0048292 3300046810 Bacteria 2328
789 Ga0495660_0072239 3300046810 Bacteria 1827
790 Ga0495581_0007738 3300047315 Bacteria 6218
791 Ga0495581_0009120 3300047315 Bacteria 5740
792 Ga0495581_0011441 3300047315 Bacteria 5136
793 Ga0495581_0044450 3300047315 Bacteria 2568
794 Ga0495604_0000037 3300047317 Bacteria 125140
795 Ga0495604_0003252 3300047317 Bacteria 12982
796 Ga0495604_0008709 3300047317 Bacteria 8021
797 Ga0495604_0008817 3300047317 Bacteria 7970
798 Ga0495604_0014512 3300047317 Bacteria 6283
799 Ga0495604_0014525 3300047317 Bacteria 6281
800 Ga0495604_0015646 3300047317 Bacteria 6055
801 Ga0495604_0020766 3300047317 Bacteria 5243
802 Ga0495636_0018033 3300047318 Bacteria 2831
803 Ga0495674_0000118 3300047319 Bacteria 59873
804 Ga0495674_0007553 3300047319 Bacteria 10384
805 Ga0495674_0013001 3300047319 Bacteria 7836
806 Ga0495674_0014177 3300047319 Bacteria 7466
807 Ga0495674_0016848 3300047319 Bacteria 6815
808 Ga0495674_0026900 3300047319 Bacteria 5261
809 Ga0495674_0060448 3300047319 Bacteria 3306
810 Ga0495674_0113882 3300047319 Bacteria 2290
811 Ga0495676_0009516 3300047321 Bacteria 8848
812 Ga0495676_0015877 3300047321 Bacteria 6692
813 Ga0495676_0037225 3300047321 Bacteria 4052
814 Ga0495680_0000260 3300047322 Bacteria 58455
815 Ga0495680_0003970 3300047322 Bacteria 14295
816 Ga0495680_0006638 3300047322 Bacteria 10713
817 Ga0495680_0017210 3300047322 Bacteria 6182
818 Ga0495680_0122816 3300047322 Bacteria 1916
819 Ga0495680_0123953 3300047322 Bacteria 1905
820 Ga0495675_0021339 3300047444 Bacteria 4123
821 Ga0495675_0023234 3300047444 Bacteria 3951
822 Ga0495675_0048525 3300047444 Bacteria 2700
823 Ga0495677_0014286 3300047445 Bacteria 2892
824 Ga0495685_004513 3300047447 Bacteria 4504
825 Ga0495685_007259 3300047447 Bacteria 3655
826 Ga0495685_011503 3300047447 Bacteria 2987
827 Ga0495681_0055862 3300047470 Bacteria 1839
828 Ga0495684_0018808 3300047471 Bacteria 5322
829 Ga0495684_0021860 3300047471 Bacteria 4924
830 Ga0495684_0026439 3300047471 Bacteria 4461
831 Ga0495684_0032376 3300047471 Bacteria 4014
832 Ga0495593_0003385 3300047673 Bacteria 9555
833 Ga0495593_0048900 3300047673 Bacteria 2246
834 Ga0495602_0000118 3300048088 Bacteria 74925
835 Ga0495602_0008934 3300048088 Bacteria 10445
836 Ga0495602_0030355 3300048088 Bacteria 5128
837 Ga0495602_0032768 3300048088 Bacteria 4887
838 Ga0495602_0083064 3300048088 Bacteria 2685
839 Ga0495602_0092759 3300048088 Bacteria 2500
840 Ga0495602_0133327 3300048088 Bacteria 1977
841 Ga0495614_0001541 3300048089 Bacteria 9989
842 Ga0495614_0016294 3300048089 Bacteria 3235
843 Ga0495626_0010355 3300048091 Bacteria 4978
844 Ga0496101_0037717 3300048904 Bacteria 3430
845 Ga0496101_0044575 3300048904 Bacteria 3174
846 Ga0496101_0092735 3300048904 Bacteria 2249
847 Ga0496102_0000029 3300048905 Bacteria 222195
848 Ga0496102_0001151 3300048905 Bacteria 24161
849 Ga0496102_0150366 3300048905 Bacteria 2188
850 Ga0496103_0000080 3300048906 Bacteria 110513
851 Ga0496104_0001695 3300048907 Bacteria 19033
852 Ga0496104_0003110 3300048907 Bacteria 14312
853 Ga0496104_0012025 3300048907 Bacteria 7768
854 Ga0496104_0057930 3300048907 Bacteria 3666
855 Ga0496104_0101743 3300048907 Bacteria 2751
856 Ga0496104_0202127 3300048907 Bacteria 1899
857 Ga0496105_0001747 3300048908 Bacteria 15538
858 Ga0496105_0007144 3300048908 Bacteria 8615
859 Ga0496105_0016938 3300048908 Bacteria 5831
860 Ga0496105_0029731 3300048908 Bacteria 4473
861 Ga0496105_0121017 3300048908 Bacteria 2158
862 Ga0496108_0008890 3300048911 Bacteria 8143
863 Ga0496108_0010231 3300048911 Bacteria 7617
864 Ga0496108_0016901 3300048911 Bacteria 5963
865 Ga0496108_0018292 3300048911 Bacteria 5738
866 Ga0496108_0093242 3300048911 Bacteria 2561
867 Ga0496109_0008227 3300048912 Bacteria 8854
868 Ga0496109_0017888 3300048912 Bacteria 6220
869 Ga0496109_0077027 3300048912 Bacteria 3068
870 Ga0496109_0086925 3300048912 Bacteria 2887
871 Ga0496109_0139691 3300048912 Bacteria 2265
872 Ga0496110_0001540 3300048913 Bacteria 16770
873 Ga0496110_0007485 3300048913 Bacteria 8725
874 Ga0496110_0013729 3300048913 Bacteria 6710
875 Ga0496110_0019823 3300048913 Bacteria 5668
876 Ga0496110_0031164 3300048913 Bacteria 4599
877 Ga0496110_0034661 3300048913 Bacteria 4374
878 Ga0496110_0162062 3300048913 Bacteria 2028
879 Ga0496111_0000498 3300048914 Bacteria 20282
880 Ga0496111_0006115 3300048914 Bacteria 7788
881 Ga0496111_0051538 3300048914 Bacteria 2971
882 Ga0496112_0001029 3300048915 Bacteria 20517
883 Ga0496112_0009946 3300048915 Bacteria 8604
884 Ga0496112_0020526 3300048915 Bacteria 6264
885 Ga0496113_0006984 3300048916 Bacteria 7220
886 Ga0496113_0009779 3300048916 Bacteria 6306
887 Ga0496113_0013661 3300048916 Bacteria 5512
888 Ga0496113_0045157 3300048916 Bacteria 3266
889 Ga0496113_0135890 3300048916 Bacteria 1932
890 Ga0496114_0003065 3300048917 Bacteria 12805
891 Ga0496114_0018546 3300048917 Bacteria 5627
892 Ga0496114_0026122 3300048917 Bacteria 4778
893 Ga0496114_0030440 3300048917 Bacteria 4441
894 Ga0496114_0053481 3300048917 Bacteria 3366
895 Ga0496114_0070741 3300048917 Bacteria 2931
896 Ga0496114_0103896 3300048917 Bacteria 2429
897 Ga0496114_0106753 3300048917 Bacteria 2396
898 Ga0496115_0018681 3300048918 Bacteria 5329
899 Ga0496115_0023449 3300048918 Bacteria 4790
900 Ga0496115_0030780 3300048918 Bacteria 4224
901 Ga0496115_0035253 3300048918 Bacteria 3958
902 Ga0496115_0056782 3300048918 Bacteria 3147
903 Ga0496118_0012027 3300048921 Bacteria 8359
904 Ga0496126_0014421 3300048929 Bacteria 7990
905 Ga0496126_0017653 3300048929 Bacteria 7108
906 Ga0496126_0084264 3300048929 Bacteria 2804
907 Ga0496126_0100473 3300048929 Bacteria 2532
908 Ga0501031_0000082 3300049568 Bacteria 50347
909 Ga0501031_0000983 3300049568 Bacteria 17336
910 Ga0501031_0022710 3300049568 Bacteria 4089
911 Ga0501032_0000035 3300049569 Bacteria 117554
912 Ga0501032_0002765 3300049569 Bacteria 13665
913 Ga0501032_0008427 3300049569 Bacteria 7521
914 Ga0501032_0024746 3300049569 Bacteria 4142
915 Ga0501032_0047483 3300049569 Bacteria 2898
916 Ga0501033_0001072 3300049570 Bacteria 24844
917 Ga0501033_0001772 3300049570 Bacteria 18850
918 Ga0501033_0004384 3300049570 Bacteria 11309
919 Ga0501033_0013102 3300049570 Bacteria 6318
920 Ga0501033_0023587 3300049570 Bacteria 4640
921 Ga0501033_0042742 3300049570 Bacteria 3378
922 Ga0501034_0000925 3300049571 Bacteria 42868
923 Ga0501034_0003651 3300049571 Bacteria 17412
924 Ga0501034_0010048 3300049571 Bacteria 9881
925 Ga0501034_0010110 3300049571 Bacteria 9844
926 Ga0501034_0022645 3300049571 Bacteria 6400
927 Ga0501034_0041014 3300049571 Bacteria 4683
928 Ga0501036_0002018 3300049572 Bacteria 15794
929 Ga0501036_0002028 3300049572 Bacteria 15762
930 Ga0501036_0005941 3300049572 Bacteria 9889
931 Ga0501036_0010750 3300049572 Bacteria 7567
932 Ga0501036_0013936 3300049572 Bacteria 6685
933 Ga0501036_0017324 3300049572 Bacteria 6021
934 Ga0501036_0034007 3300049572 Bacteria 4311
935 Ga0501036_0048380 3300049572 Bacteria 3600
936 Ga0501037_0000370 3300049573 Bacteria 37472
937 Ga0501037_0000975 3300049573 Bacteria 21258
938 Ga0501037_0004313 3300049573 Bacteria 10316
939 Ga0501037_0010903 3300049573 Bacteria 6679
940 Ga0501037_0033493 3300049573 Bacteria 3793
941 Ga0501037_0074113 3300049573 Bacteria 2474
942 Ga0501037_0086909 3300049573 Bacteria 2263
943 Ga0501037_0092173 3300049573 Bacteria 2191
944 Ga0501038_0000172 3300049574 Bacteria 55198
945 Ga0501038_0000830 3300049574 Bacteria 27511
946 Ga0501038_0001402 3300049574 Bacteria 22056
947 Ga0501038_0002380 3300049574 Bacteria 17520
948 Ga0501038_0007236 3300049574 Bacteria 10253
949 Ga0501038_0009084 3300049574 Bacteria 9124
950 Ga0501038_0016324 3300049574 Bacteria 6732
951 Ga0501038_0018802 3300049574 Bacteria 6236
952 Ga0501038_0022038 3300049574 Bacteria 5713
953 Ga0501039_0000269 3300049575 Bacteria 37904
954 Ga0501039_0003905 3300049575 Bacteria 11196
955 Ga0501039_0008292 3300049575 Bacteria 7918
956 Ga0501039_0027285 3300049575 Bacteria 4391
957 Ga0501039_0037691 3300049575 Bacteria 3733
958 Ga0501039_0080261 3300049575 Bacteria 2539
959 Ga0501040_0009614 3300049576 Bacteria 6310
960 Ga0501040_0122671 3300049576 Bacteria 1824
961 Ga0501041_0006904 3300049577 Bacteria 6657
962 Ga0501042_0003075 3300049578 Bacteria 10388
963 Ga0501042_0004043 3300049578 Bacteria 9295
964 Ga0501042_0009129 3300049578 Bacteria 6593
965 Ga0501042_0010127 3300049578 Bacteria 6306
966 Ga0501043_0000231 3300049579 Bacteria 50898
967 Ga0501043_0000964 3300049579 Bacteria 25420
968 Ga0501043_0001222 3300049579 Bacteria 22653
969 Ga0501043_0009186 3300049579 Bacteria 7769
970 Ga0501043_0010396 3300049579 Bacteria 7293
971 Ga0501043_0024633 3300049579 Bacteria 4721
972 Ga0501043_0041543 3300049579 Bacteria 3613
973 Ga0501043_0128599 3300049579 Bacteria 1986
974 Ga0501046_0000279 3300049580 Bacteria 51800
975 Ga0501046_0005074 3300049580 Bacteria 11805
976 Ga0501046_0017656 3300049580 Bacteria 5951
977 Ga0501046_0057856 3300049580 Bacteria 3040
978 Ga0501046_0111531 3300049580 Bacteria 2089
979 Ga0501047_0000213 3300049581 Bacteria 69459
980 Ga0501047_0000458 3300049581 Bacteria 45091
981 Ga0501047_0000837 3300049581 Bacteria 31760
982 Ga0501047_0007441 3300049581 Bacteria 10304
983 Ga0501047_0012451 3300049581 Bacteria 8054
984 Ga0501047_0015908 3300049581 Bacteria 7170
985 Ga0501047_0023191 3300049581 Bacteria 5959
986 Ga0501047_0042338 3300049581 Bacteria 4401
987 Ga0501047_0052841 3300049581 Bacteria 3928
988 Ga0501047_0060579 3300049581 Bacteria 3652
989 Ga0501047_0080844 3300049581 Bacteria 3124
990 Ga0501047_0087834 3300049581 Bacteria 2986
991 Ga0501047_0094784 3300049581 Bacteria 2864
992 Ga0501047_0179352 3300049581 Bacteria 1984
993 Ga0501047_0183831 3300049581 Bacteria 1956
994 Ga0501048_0000048 3300049582 Bacteria 59433
995 Ga0501048_0001326 3300049582 Bacteria 18749
996 Ga0501048_0005292 3300049582 Bacteria 9829
997 Ga0501048_0012400 3300049582 Bacteria 6340
998 Ga0501048_0014519 3300049582 Bacteria 5829
999 Ga0501048_0017993 3300049582 Bacteria 5199
1000 Ga0501048_0084571 3300049582 Bacteria 2238
1001 Ga0501048_0129160 3300049582 Bacteria 1787
1002 Ga0501067_0005264 3300049583 Bacteria 7188
1003 Ga0501068_0002571 3300049584 Bacteria 9627
1004 Ga0501069_0000330 3300049585 Bacteria 21345
1005 Ga0501069_0027446 3300049585 Bacteria 3120
1006 Ga0501070_0000504 3300049586 Bacteria 35626
1007 Ga0501070_0002289 3300049586 Bacteria 16830
1008 Ga0501070_0016182 3300049586 Bacteria 6267
1009 Ga0501070_0031949 3300049586 Bacteria 4409
1010 Ga0501070_0077446 3300049586 Bacteria 2752
1011 Ga0501070_0100770 3300049586 Bacteria 2389
1012 Ga0501070_0130103 3300049586 Bacteria 2080
1013 Ga0501071_0010005 3300049587 Bacteria 6338
1014 Ga0501071_0018673 3300049587 Bacteria 4806
1015 Ga0501072_0027599 3300049588 Bacteria 4428
1016 Ga0501072_0030727 3300049588 Bacteria 4202
1017 Ga0501073_0001049 3300049589 Bacteria 19926
1018 Ga0501073_0020491 3300049589 Bacteria 4768
1019 Ga0501073_0097508 3300049589 Bacteria 2042
1020 Ga0501074_0000061 3300049590 Bacteria 53799
1021 Ga0501074_0000823 3300049590 Bacteria 19671
1022 Ga0501074_0008685 3300049590 Bacteria 7361
1023 Ga0501074_0022408 3300049590 Bacteria 4588
1024 Ga0501074_0035507 3300049590 Bacteria 3612
1025 Ga0501075_0027223 3300049591 Bacteria 4212
1026 Ga0501076_0016692 3300049592 Bacteria 5569
1027 Ga0501077_0003455 3300049593 Bacteria 9485
1028 Ga0501079_0000093 3300049741 Bacteria 43802
1029 Ga0501079_0003706 3300049741 Bacteria 11267
1030 Ga0501080_0000160 3300049742 Bacteria 48505
1031 Ga0501080_0000266 3300049742 Bacteria 39496
1032 Ga0501080_0027168 3300049742 Bacteria 5322
1033 Ga0501083_0006977 3300049744 Bacteria 8014
1034 Ga0501035_0000404 3300049822 Bacteria 49157
1035 Ga0501035_0001134 3300049822 Bacteria 27845
1036 Ga0501035_0001925 3300049822 Bacteria 20813
1037 Ga0501035_0004136 3300049822 Bacteria 13782
1038 Ga0501035_0005043 3300049822 Bacteria 12505
1039 Ga0501035_0019883 3300049822 Bacteria 6168
1040 Ga0501035_0105615 3300049822 Bacteria 2469
1041 Ga0501044_0000439 3300049823 Bacteria 50915
1042 Ga0501044_0001745 3300049823 Bacteria 25377
1043 Ga0501044_0002390 3300049823 Bacteria 21401
1044 Ga0501044_0004503 3300049823 Bacteria 15582
1045 Ga0501044_0019305 3300049823 Bacteria 7294
1046 Ga0501044_0028298 3300049823 Bacteria 5915
1047 Ga0501044_0041631 3300049823 Bacteria 4782
1048 Ga0501044_0059509 3300049823 Bacteria 3913
1049 Ga0501044_0086996 3300049823 Bacteria 3156
1050 Ga0501044_0106576 3300049823 Bacteria 2815
1051 Ga0501044_0120306 3300049823 Bacteria 2627
1052 Ga0501044_0195302 3300049823 Bacteria 1984
1053 Ga0501045_0007688 3300049824 Bacteria 7496
1054 Ga0501045_0051300 3300049824 Bacteria 3011
1055 nmdc:mga03n38_22580_c1 3300050490 Bacteria 2549
1056 nmdc:mga06z11_5955_c1 3300050494 Bacteria 4926
1057 nmdc:mga05p37_124403_c1 3300050507 Bacteria 3167
1058 nmdc:mga05p37_1684_c1 3300050507 Bacteria 25717
1059 nmdc:mga05p37_47176_c1 3300050507 Bacteria 5298
1060 nmdc:mga05p37_8100_c1 3300050507 Bacteria 12421
1061 nmdc:mga06r32_23130_c1 3300050510 Bacteria 5750
1062 nmdc:mga08y16_12403_c1 3300050511 Bacteria 8965
1063 nmdc:mga08y16_26780_c1 3300050511 Bacteria 6076
1064 nmdc:mga0n895_17011_c1 3300050512 Bacteria 6691
1065 nmdc:mga0n895_4823_c1 3300050512 Bacteria 11166
1066 nmdc:mga0n895_7424_c1 3300050512 Bacteria 9406
1067 nmdc:mga0rr50_13386_c1 3300050513 Bacteria 5340
1068 nmdc:mga0rr50_26819_c1 3300050513 Bacteria 4028
1069 nmdc:mga0rr50_34881_c1 3300050513 Bacteria 3607
1070 nmdc:mga08x19_23875_c1 3300050514 Bacteria 3795
1071 nmdc:mga08x19_7350_c1 3300050514 Bacteria 6545
1072 nmdc:mga08x19_8225_c1 3300050514 Bacteria 6200
1073 nmdc:mga0a205_23435_c1 3300050515 Bacteria 5856
1074 nmdc:mga0a205_25017_c1 3300050515 Bacteria 5684
1075 nmdc:mga0a205_7906_c1 3300050515 Bacteria 9658
1076 Ga0495601_0009353 3300053077 Bacteria 5794
1077 Ga0495601_0029193 3300053077 Bacteria 3419
1078 Ga0495601_0031990 3300053077 Bacteria 3272
1079 Ga0495601_0056929 3300053077 Bacteria 2476
1080 Ga0495612_0002725 3300053078 Bacteria 7310
1081 Ga0495612_0008768 3300053078 Bacteria 4101
1082 Ga0495612_0013756 3300053078 Bacteria 3259
1083 Ga0495612_0021976 3300053078 Bacteria 2558
1084 Ga0495595_0002004 3300053084 Bacteria 7918
1085 Ga0495595_0025779 3300053084 Bacteria 2608
1086 Ga0495595_0026080 3300053084 Bacteria 2594
1087 Ga0495619_0006913 3300053085 Bacteria 7175
1088 Ga0495619_0026382 3300053085 Bacteria 3737
1089 Ga0495619_0037853 3300053085 Bacteria 3146
1090 Ga0495619_0064868 3300053085 Bacteria 2436
1091 Ga0500578_0057421 3300053086 Bacteria 2488
1092 Ga0500643_000483 3300053087 Bacteria 29043
1093 Ga0500646_0000140 3300053090 Bacteria 21197
1094 Ga0500658_0056132 3300053134 Bacteria 1623
1095 Ga0500568_0001955 3300053139 Bacteria 12622
1096 Ga0500616_0001335 3300053153 Bacteria 24220
1097 Ga0500616_0003035 3300053153 Bacteria 13226
1098 Ga0501084_0012932 3300054114 Bacteria 6910
1099 Ga0501084_0024382 3300054114 Bacteria 5045
1100 Ga0501084_0098569 3300054114 Bacteria 2454
1101 Ga0501082_0003549 3300060353 Bacteria 13621
1102 Ga0501082_0009216 3300060353 Bacteria 8508
1103 Ga0466962_0001009 3300061719 Bacteria 12857
1104 Ga0466962_0008427 3300061719 Bacteria 4939
1105 Ga0466962_0021351 3300061719 Bacteria 3109
1106 Ga0466962_0060333 3300061719 Bacteria 1810
1107 Ga0530510_0001337 3300061734 Bacteria 16500
1108 2729906767 2728369276 Bacteria 5610032
1109 2547410194 2547132111 Bacteria 8013147
1110 2554256964 2554235005 Bacteria 6457341
1111 2558912557 2558860112 Bacteria 9931328
1112 2585308323 2582581313 Bacteria 10042643
1113 2616703166 2616644814 Bacteria 11555299
1114 2616904716 2616644941 Bacteria 8510691
1115 2643851358 2643221567 Bacteria 4163945
1116 2644014628 2643221601 Bacteria 7493239
1117 2644138052 2643221624 Bacteria 4384879
1118 2644176063 2643221631 Bacteria 8168043
1119 2644261842 2643221647 Bacteria 10741251
1120 2644445712 2643221679 Bacteria 3839507
1121 2644610354 2643221711 Bacteria 4865335
1122 2676495035 2675903060 Bacteria 10051191
1123 2731907163 2731639228 Bacteria 4187555
1124 2768644285 2767802112 Bacteria 6465194
1125 2774395025 2773857762 Bacteria 5971770
1126 2784473191 2784132109 Bacteria 3141763
1127 2784589490 2784132148 Bacteria 8627943
1128 2785342098 2784746763 Bacteria 9783172
1129 2785370563 2784746768 Bacteria 10036182
1130 2786671720 2786546132 Bacteria 10419719
1131 2793982627 2791355406 Bacteria 11364898
1132 2799186736 2799112218 Bacteria 4315149
1133 2808843120 2808606359 Bacteria 9866990
1134 2808872830 2808606365 Bacteria 4301966
1135 2808921468 2808606375 Bacteria 9466072
1136 2809194143 2808606439 Bacteria 5952208
1137 2809233154 2808606448 Bacteria 8656184
1138 2811845279 2808606982 Bacteria 7791042
1139 2812348873 2811994878 Bacteria 5992952
1140 2812357001 2811994879 Bacteria 9313447
1141 2812371744 2811994882 Bacteria 4688362
1142 2812479663 2811994917 Bacteria 7761064
1143 2819667320 2818991458 Bacteria 4794049
1144 2819690640 2818991462 Bacteria 4320267
1145 2819728051 2818991469 Bacteria 4644110
1146 2819742135 2818991472 Bacteria 10089953
1147 2842890615 2842888712 Bacteria 4279094
1148 2852640597 2852635781 Bacteria 8251373
1149 2856746214 2856741275 Bacteria 8096094
1150 2857712090 2857710386 Bacteria 3186771
1151 2862286870 2862281513 Bacteria 9621493
1152 2862291296 2862290372 Bacteria 7471434
1153 2862390040 2862382967 Bacteria 10317375
1154 2862578357 2862574272 Bacteria 10567477
1155 2862706107 2862705112 Bacteria 6563286
1156 2863411781 2863404153 Bacteria 9672205
1157 2866555721 2866552031 Bacteria 5824618
1158 2867349021 2867346516 Bacteria 7608576
1159 2867373056 2867369537 Bacteria 6501581
1160 2867433057 2867428634 Bacteria 9590268
1161 2867481281 2867475112 Bacteria 6909112
1162 2868090651 2868088558 Bacteria 7609351
1163 2870788408 2870782633 Bacteria 9624083
1164 2873154885 2873151551 Bacteria 8625867
1165 2873314896 2873314349 Bacteria 8512634
1166 2875394604 2875391855 Bacteria 7600475
1167 2877680059 2877676314 Bacteria 9512378
1168 2883826433 2883821847 Bacteria 5121194
1169 2884694321 2884693830 Bacteria 11273186
1170 2887486913 2887478801 Bacteria 8972725
1171 2891402613 2891395885 Bacteria 9251614
1172 2891554941 2891554331 Bacteria 8812224
1173 2891562760 2891562705 Bacteria 8039471
1174 2891973362 2891968417 Bacteria 5821697
1175 2895435610 2895427314 Bacteria 13147766
1176 2895444761 2895442618 Bacteria 11027144
1177 2912718653 2912715099 Bacteria 9460473
1178 2912730978 2912723979 Bacteria 8557534
1179 2912761943 2912757875 Bacteria 7940295
1180 2919449150 2919446982 Bacteria 3994487
1181 2919476067 2919468124 Bacteria 9133025
1182 2932400731 2932398195 Bacteria 3847976
1183 2935392392 2935390628 Bacteria 7043367
1184 2946068879 2946064051 Bacteria 8957905
1185 2947228033 2947224130 Bacteria 9938529
1186 2954002851 2954002825 Bacteria 9173742
1187 2954384990 2954380949 Bacteria 10050426
1188 2954678005 2954673503 Bacteria 9685905
1189 2954686153 2954682443 Bacteria 9862841
1190 2954695807 2954691527 Bacteria 10720516
1191 2954710998 2954701450 Bacteria 10834262
1192 2954715216 2954711539 Bacteria 10867210
1193 2954725157 2954721474 Bacteria 10456478
1194 2954736661 2954731030 Bacteria 10243860
1195 2954744090 2954740390 Bacteria 10229294
1196 2954755508 2954749733 Bacteria 10366972
1197 2954763032 2954759201 Bacteria 9358192
1198 2956942148 2956939328 Bacteria 3474458
1199 2990045192 2990044586 Bacteria 6603797
1200 2990059968 2990059506 Bacteria 9321252
1201 2990090277 2990088156 Bacteria 6657676
1202 2995467957 2995463766 Bacteria 8577691
1203 2997458085 2997451912 Bacteria 8492419
1204 2997606274 2997600082 Bacteria 9896405
1205 3001119500 3001119090 Bacteria 3449530
1206 3001892231 3001889506 Bacteria 2975194
1207 3003000841 3002998708 Bacteria 11715108
1208 3006327095 3006321560 Bacteria 8247479
1209 3006396376 3006393351 Bacteria 6615579
1210 3006428935 3006425503 Bacteria 6491253
1211 3006489268 3006486233 Bacteria 8157040
1212 3006494384 3006493962 Bacteria 8825450
1213 8001785276 8001781756 Bacteria 9586736
1214 8008488708 8008485437 Bacteria 7198341
1215 8008566307 8008558824 Bacteria 10610750
1216 8008577990 8008574985 Bacteria 7815457
1217 8023629995 8023623736 Bacteria 8593882
1218 8025483244 8025478263 Bacteria 8209203
1219 8025529467 8025524527 Bacteria 7197316
1220 8025536440 8025530807 Bacteria 8495698
1221 8047897127 8047893842 Bacteria 11723082
1222 8048134747 8048127548 Bacteria 11053136
1223 8048361825 8048356638 Bacteria 11044339
1224 8048374111 8048369669 Bacteria 11666822
1225 8048384115 8048379754 Bacteria 11877923
1226 8048413521 8048406513 Bacteria 8936924
1227 8053948496 8053945823 Bacteria 8962862
1228 8054160671 8054160619 Bacteria 7783213
1229 8055074172 8055066027 Bacteria 9479577
1230 8055175695 8055172936 Bacteria 9305943
1231 8056062046 8056060235 Bacteria 7259403
1232 8056454400 8056447290 Bacteria 7680491
1233 8056672760 8056667051 Bacteria 6953971
1234 8056833766 8056829672 Bacteria 9045328
1235 Ga0070658_10000341
1236 Ga0070658_10005154
1237 Ga0070658_10019961
1238 Ga0070658_10036087
1239 Ga0070658_10120314
1240 Ga0070683_100004700
1241 Ga0070683_100018153
1242 Ga0070683_100053662
1243 Ga0070690_100060284
1244 Ga0068869_100028900
1245 Ga0070666_10076702
1246 Ga0070680_100000142
1247 Ga0070680_100028494
1248 Ga0070680_100032455
1249 Ga0070682_100007342
1250 Ga0070682_100009822
1251 Ga0068868_100019689
1252 Ga0070660_100005421
1253 Ga0070660_100046731
1254 Ga0070691_10017887
1255 Ga0070691_10024103
1256 Ga0070675_100070224
1257 Ga0070671_100077253
1258 Ga0070659_100000340
1259 Ga0070659_100002562
1260 Ga0070659_100085970
1261 Ga0070667_100011293
1262 Ga0070709_10000148
1263 Ga0070709_10011079
1264 Ga0070709_10014133
1265 Ga0070714_100000241
1266 Ga0070714_100001408
1267 Ga0070714_100020693
1268 Ga0070714_100037623
1269 Ga0070714_100044891
1270 Ga0070714_100108150
1271 Ga0070714_100188960
1272 Ga0070713_100031003
1273 Ga0070713_100045812
1274 Ga0070713_100098361
1275 Ga0070710_10000288
1276 Ga0070710_10000754
1277 Ga0070701_10098354
1278 Ga0070711_100001415
1279 Ga0070711_100036987
1280 Ga0070711_100103016
1281 Ga0070700_100000064
1282 Ga0070694_100040214
1283 Ga0070708_100006850
1284 Ga0070708_100012378
1285 Ga0070708_100052431
1286 Ga0070708_100090504
1287 Ga0070708_100171158
1288 Ga0070663_100033990
1289 Ga0070663_100130357
1290 Ga0070678_100042234
1291 Ga0070678_100083879
1292 Ga0070678_100105459
1293 Ga0070678_100130995
1294 Ga0070681_10025573
1295 Ga0070681_10028817
1296 Ga0070681_10047180
1297 Ga0070706_100002380
1298 Ga0070706_100003532
1299 Ga0070706_100005976
1300 Ga0070706_100010066
1301 Ga0070706_100010721
1302 Ga0070706_100023725
1303 Ga0070706_100039669
1304 Ga0070706_100083189
1305 Ga0070707_100000213
1306 Ga0070707_100003232
1307 Ga0070707_100003789
1308 Ga0070707_100012139
1309 Ga0070707_100030838
1310 Ga0070707_100039951
1311 Ga0070698_100000205
1312 Ga0070698_100000527
1313 Ga0070698_100000706
1314 Ga0070698_100000992
1315 Ga0070698_100001093
1316 Ga0070698_100001437
1317 Ga0070698_100004321
1318 Ga0070698_100006891
1319 Ga0070698_100031580
1320 Ga0070698_100032056
1321 Ga0070698_100059041
1322 Ga0070699_100038999
1323 Ga0070699_100062759
1324 Ga0070679_100000016
1325 Ga0070679_100002098
1326 Ga0070679_100039772
1327 Ga0070679_100124948
1328 Ga0070679_100131620
1329 Ga0070684_100205297
1330 Ga0070697_100024392
1331 Ga0068853_100034386
1332 Ga0068853_100035256
1333 Ga0070672_100087525
1334 Ga0070686_100017464
1335 Ga0070695_100055470
1336 Ga0070696_100000953
1337 Ga0070696_100096537
1338 Ga0070693_100014101
1339 Ga0070665_100012640
1340 Ga0068855_100004743
1341 Ga0068857_100055007
1342 Ga0068857_100109438
1343 Ga0068854_100002563
1344 Ga0068854_100081603
1345 Ga0068856_100012896
1346 Ga0068856_100032085
1347 Ga0068856_100080477
1348 Ga0068856_100084252
1349 Ga0070702_100000181
1350 Ga0068852_100007081
1351 Ga0068852_100035620
1352 Ga0068859_100021021
1353 Ga0068859_100079889
1354 Ga0068859_100155550
1355 Ga0068864_100003646
1356 Ga0068864_100137313
1357 Ga0068861_100017783
1358 Ga0068861_100028258
1359 Ga0068870_10007494
1360 Ga0068858_100050056
1361 Ga0068860_100108652
1362 Ga0081455_10001759
1363 Ga0081455_10011389
1364 Ga0081455_10027242
1365 Ga0081455_10071494
1366 Ga0081538_10001441
1367 Ga0081540_1000097
1368 Ga0081540_1009149
1369 Ga0081540_1031284
1370 Ga0081539_10000015
1371 Ga0081539_10000717
1372 Ga0081539_10014229
1373 Ga0081539_10023013
1374 Ga0070717_10019268
1375 Ga0070717_10022123
1376 Ga0075363_100048012
1377 Ga0075432_10000184
1378 Ga0075432_10003361
1379 Ga0070715_10009603
1380 Ga0070715_10010578
1381 Ga0070716_100000186
1382 Ga0070716_100001102
1383 Ga0070716_100037136
1384 Ga0070712_100005948
1385 Ga0070712_100036038
1386 Ga0075367_10009815
1387 Ga0075427_10002845
1388 Ga0097621_100052980
1389 Ga0068871_100037584
1390 Ga0075428_100000285
1391 Ga0075428_100008245
1392 Ga0075428_100023028
1393 Ga0075428_100029819
1394 Ga0075430_100004937
1395 Ga0075431_100006189
1396 Ga0075433_10002351
1397 Ga0075433_10002630
1398 Ga0075433_10158999
1399 Ga0075434_100003332
1400 Ga0075434_100057478
1401 Ga0075434_100105815
1402 Ga0075429_100000714
1403 Ga0075429_100033608
1404 Ga0075436_100008179
1405 Ga0075436_100084447
1406 Ga0097620_100021021
1407 Ga0097620_100079891
1408 Ga0097620_100155544
1409 Ga0075435_100001797
1410 Ga0075435_100014600
1411 Ga0075435_100028736
1412 Ga0075435_100053244
1413 Ga0105240_10026684
1414 Ga0105240_10159410
1415 Ga0111539_10009361
1416 Ga0111539_10015527
1417 Ga0105245_10061047
1418 Ga0105245_10131086
1419 Ga0114129_10000278
1420 Ga0114129_10001404
1421 Ga0114129_10002476
1422 Ga0114129_10004135
1423 Ga0114129_10070705
1424 Ga0105243_10000176
1425 Ga0105243_10003944
1426 Ga0105243_10005949
1427 Ga0105241_10005275
1428 Ga0105248_10069469
1429 Ga0105238_10022283
1430 Ga0105238_10183891
1431 Ga0105249_10062449
1432 Ga0105249_10226043
1433 Ga0105239_10047982
1434 Ga0105246_10000307
1435 Ga0157371_10021854
1436 Ga0157370_10035408
1437 Ga0157369_10000890
1438 Ga0157369_10001482
1439 Ga0157369_10022930
1440 Ga0157369_10044670
1441 Ga0157374_10123096
1442 Ga0157375_10047169
1443 Ga0157375_10217292
1444 Ga0163163_10077534
1445 Ga0163163_10183773
1446 Ga0157380_10062562
1447 Ga0157380_10193111
1448 Ga0182008_10000943
1449 Ga0157377_10020979
1450 Ga0157379_10015119
1451 Ga0182006_1009402
1452 Ga0182007_10002092
1453 Ga0183367_1002
1454 Ga0163161_10060911
1455 Ga0197907_10936403
1456 Ga0206356_10751802
1457 Ga0206356_11783545
1458 Ga0206351_10212682
1459 Ga0206352_10890638
1460 Ga0206350_10197218
1461 Ga0206350_10690641
1462 Ga0206350_11609180
1463 Ga0206354_10851720
1464 Ga0206353_10420202
1465 Ga0206353_10790204
1466 Ga0206353_10942493
1467 Ga0206353_11803527
1468 Ga0213876_10003347
1469 Ga0213875_10000547
1470 Ga0213875_10000781
1471 Ga0213875_10012233
1472 Ga0213875_10038392
1473 Ga0224712_10001180
1474 Ga0224712_10001750
1475 Ga0224712_10001854
1476 Ga0224712_10005293
1477 Ga0224712_10010884
1478 Ga0224712_10022844
1479 Ga0224572_1008564
1480 Ga0209758_1004169
1481 Ga0207692_10000819
1482 Ga0207692_10001032
1483 Ga0207688_10007902
1484 Ga0207688_10016234
1485 Ga0207647_10004731
1486 Ga0207647_10011050
1487 Ga0207647_10039342
1488 Ga0207685_10000849
1489 Ga0207685_10007109
1490 Ga0207699_10000338
1491 Ga0207699_10000737
1492 Ga0207699_10002992
1493 Ga0207699_10004669
1494 Ga0207705_10000550
1495 Ga0207705_10005392
1496 Ga0207705_10021321
1497 Ga0207684_10015231
1498 Ga0207684_10019463
1499 Ga0207684_10032533
1500 Ga0207654_10001414
1501 Ga0207707_10075370
1502 Ga0207707_10099957
1503 Ga0207695_10000957
1504 Ga0207671_10000405
1505 Ga0207693_10012722
1506 Ga0207693_10023030
1507 Ga0207693_10053010
1508 Ga0207663_10002971
1509 Ga0207663_10010608
1510 Ga0207660_10008750
1511 Ga0207660_10014961
1512 Ga0207662_10020710
1513 Ga0207657_10006528
1514 Ga0207657_10028947
1515 Ga0207657_10042748
1516 Ga0207652_10000015
1517 Ga0207652_10003427
1518 Ga0207652_10016038
1519 Ga0207652_10055066
1520 Ga0207646_10000105
1521 Ga0207646_10001355
1522 Ga0207646_10007603
1523 Ga0207646_10018738
1524 Ga0207646_10025959
1525 Ga0207646_10086177
1526 Ga0207694_10002983
1527 Ga0207694_10077156
1528 Ga0207687_10100117
1529 Ga0207687_10125859
1530 Ga0207700_10000737
1531 Ga0207700_10002110
1532 Ga0207700_10003804
1533 Ga0207700_10014056
1534 Ga0207700_10022870
1535 Ga0207700_10048216
1536 Ga0207700_10054712
1537 Ga0207664_10000171
1538 Ga0207664_10000683
1539 Ga0207664_10000992
1540 Ga0207664_10003484
1541 Ga0207664_10006127
1542 Ga0207664_10009752
1543 Ga0207664_10016628
1544 Ga0207664_10028888
1545 Ga0207664_10044380
1546 Ga0207664_10105998
1547 Ga0207664_10124222
1548 Ga0207690_10001323
1549 Ga0207690_10118954
1550 Ga0207706_10001492
1551 Ga0207686_10044246
1552 Ga0207709_10027016
1553 Ga0207709_10035623
1554 Ga0207670_10011841
1555 Ga0207704_10087528
1556 Ga0207665_10000278
1557 Ga0207665_10000650
1558 Ga0207665_10002702
1559 Ga0207665_10104683
1560 Ga0207691_10033704
1561 Ga0207689_10018433
1562 Ga0207661_10057216
1563 Ga0207667_10060147
1564 Ga0207668_10047607
1565 Ga0207640_10005196
1566 Ga0207640_10100034
1567 Ga0207658_10024425
1568 Ga0207677_10004838
1569 Ga0207678_10050248
1570 Ga0207708_10000076
1571 Ga0207708_10017836
1572 Ga0207702_10018909
1573 Ga0207702_10030308
1574 Ga0207702_10051423
1575 Ga0207702_10111984
1576 Ga0207648_10148255
1577 Ga0207676_10009004
1578 Ga0207674_10004920
1579 Ga0207674_10005169
1580 Ga0207674_10043356
1581 Ga0207675_100018820
1582 Ga0207683_10029753
1583 Ga0207683_10030781
1584 Ga0207683_10051377
1585 Ga0207683_10137904
1586 Ga0207683_10148086
1587 Ga0207698_10007766
1588 Ga0207698_10140480
1589 Ga0207428_10003495
1590 Ga0207428_10019672
1591 Ga0265337_1000014
1592 Ga0265326_10000789
1593 Ga0265319_1004236
1594 Ga0265334_10000160
1595 Ga0265334_10001483
1596 Ga0265323_10004706
1597 Ga0265336_10003919
1598 Ga0307515_10058339
1599 Ga0307515_10131999
1600 Ga0265338_10000148
1601 Ga0265338_10000577
1602 Ga0265338_10004722
1603 Ga0265338_10014617
1604 Ga0265324_10002464
1605 Ga0268256_1011284
1606 Ga0307511_10067650
1607 Ga0316181_1252189
1608 Ga0265332_10000443
1609 Ga0265320_10001651
1610 Ga0265325_10002380
1611 Ga0265340_10001774
1612 Ga0265339_10027146
1613 Ga0265316_10009251
1614 Ga0265316_10082874
1615 Ga0307513_10023311
1616 Ga0307513_10026989
1617 Ga0307408_100014447
1618 Ga0265313_10009246
1619 Ga0307508_10016684
1620 Ga0307508_10018583
1621 Ga0307508_10020494
1622 Ga0307508_10025970
1623 Ga0307514_10005681
1624 Ga0307514_10033883
1625 Ga0307514_10083453
1626 Ga0316575_10001367
1627 Ga0316575_10040892
1628 Ga0316579_10000001
1629 Ga0316579_10013526
1630 Ga0316579_10019729
1631 Ga0265314_10005926
1632 Ga0265314_10007762
1633 Ga0316576_10002620
1634 Ga0316576_10006560
1635 Ga0316576_10020489
1636 Ga0316578_10003178
1637 Ga0316578_10006131
1638 Ga0316578_10012533
1639 Ga0316578_10023272
1640 Ga0307516_10014655
1641 Ga0307516_10085636
1642 Ga0307405_10015926
1643 Ga0307405_10020321
1644 Ga0307405_10052481
1645 Ga0316577_10044242
1646 Ga0307413_10003683
1647 Ga0307410_10000043
1648 Ga0307410_10006019
1649 Ga0307410_10038838
1650 Ga0307410_10057397
1651 Ga0307410_10111175
1652 Ga0307406_10000008
1653 Ga0307406_10006451
1654 Ga0307407_10000710
1655 Ga0307407_10019224
1656 Ga0307409_100000014
1657 Ga0307409_100000561
1658 Ga0307409_100011137
1659 Ga0307409_100097597
1660 Ga0307409_100120252
1661 Ga0307416_100000088
1662 Ga0307416_100002704
1663 Ga0307416_100009589
1664 Ga0307416_100017669
1665 Ga0307416_100022381
1666 Ga0307416_100069765
1667 Ga0307414_10005251
1668 Ga0307411_10000384
1669 Ga0307411_10125395
1670 Ga0307415_100000019
1671 Ga0307415_100005409
1672 Ga0307415_100020493
1673 Ga0307415_100027411
1674 Ga0307507_10000009
1675 Ga0307510_10017401
1676 Ga0316596_1003704
1677 Ga0316596_1010369
1678 Ga0316212_1003286
1679 Ga0373930_0008290
1680 Ga0373926_0000105
1681 Ga0373926_0000466
1682 Ga0373926_0005218
1683 Ga0373934_0000054
1684 Ga0373934_0002514
1685 Ga0373934_0007077
1686 Ga0373944_0023275
1687 Ga0373923_0007771
1688 Ga0373923_0009106
1689 Ga0373936_0001451
1690 Ga0373936_0002308
1691 Ga0373936_0004305
1692 Ga0373945_0000026
1693 Ga0373953_0000343
1694 Ga0373953_0013819
1695 Ga0373953_0034317
1696 Ga0373954_0001747
1697 Ga0373954_0031614
1698 Ga0373956_0000083
1699 Ga0373956_0011130
1700 Ga0373957_0000013
1701 Ga0373943_0000073
1702 Ga0373943_0004602
1703 Ga0373943_0013902
1704 Ga0373943_0059990
1705 Ga0373946_0000103
1706 Ga0373955_0000009
1707 Ga0373955_0030449
1708 Ga0373955_0052417
1709 Ga0316574_0016554
1710 Ga0316574_0018770
1711 Ga0373924_0002152
1712 Ga0373924_0015170
1713 Ga0373935_0001433
1714 Ga0373935_0045885
1715 Ga0373935_0056507
1716 Ga0373927_0027780
1717 Ga0373927_0086844
1718 Ga0373933_0000006
1719 Ga0373933_0007416
1720 Ga0373933_0030297
1721 Ga0373933_0033312
1722 Ga0373947_0001176
1723 Ga0373947_0003755
1724 Ga0373947_0013107
1725 Ga0373937_0000148
1726 Ga0373937_0008996
1727 Ga0373937_0018307
1728 Ga0373937_0094415
1729 Ga0372808_000487
1730 Ga0316582_0009314
1731 Ga0316582_0036417
1732 Ga0316582_0073043
1733 Ga0316584_0003561
1734 Ga0316584_0052020
1735 Ga0316584_0056574
1736 Ga0316584_0066535
1737 Ga0373925_0000004
1738 Ga0373925_0002932
1739 Ga0373925_0006283
1740 Ga0373925_0010217
1741 Ga0373925_0057438
1742 Ga0373925_0095847
1743 Ga0373925_0128967
1744 Ga0395899_0003357
1745 Ga0395899_0037552
1746 Ga0395900_0033916
1747 Ga0395900_0062817
1748 Ga0395898_0003223
1749 Ga0395898_0012248
1750 Ga0395898_0013671
1751 Ga0395898_0019426
1752 Ga0395898_0046997
1753 Ga0395898_0099821
1754 Ga0395898_0169238
1755 Ga0436364_0112641
1756 Ga0436364_0195638
1757 Ga0436364_0531653
1758 Ga0436364_1133930
1759 Ga0436364_1202907
1760 Ga0395901_0014343
1761 Ga0395901_0045839
1762 Ga0395901_0060892
1763 Ga0400485_08073
1764 Ga0400488_53579
1765 Ga0400486_26016
1766 Ga0436365_0567091
1767 Ga0436363_0661712
1768 Ga0439436_0000557
1769 Ga0439439_0000765
1770 Ga0451789_0138174
1771 Ga0451791_0734773
1772 Ga0451795_0548267
1773 Ga0451849_0159173
1774 Ga0451843_1177035
1775 Ga0451853_2494527
1776 Ga0439433_0013858
1777 Ga0439442_014674
1778 Ga0439448_0007405
1779 Ga0439455_0002672
1780 Ga0439457_000323
1781 Ga0439457_001128
1782 Ga0439463_000980
1783 Ga0450894_000618
1784 Ga0450898_002268
1785 Ga0450899_000145
1786 Ga0450903_000727
1787 Ga0450906_004155
1788 Ga0450908_005005
1789 Ga0466969_0001092
1790 Ga0466969_0001548
1791 Ga0466969_0003332
1792 Ga0466969_0003795
1793 Ga0466969_0009388
1794 Ga0466969_0021457
1795 Ga0466969_0030450
1796 Ga0466972_0003101
1797 Ga0466965_0000974
1798 Ga0466966_0002114
1799 Ga0466966_0002908
1800 Ga0466966_0016563
1801 Ga0466966_0026217
1802 Ga0466966_0082745
1803 Ga0466961_0001308
1804 Ga0466961_0001396
1805 Ga0466961_0002697
1806 Ga0466961_0004026
1807 Ga0466961_0005970
1808 Ga0466961_0008148
1809 Ga0466961_0008920
1810 Ga0466961_0022167
1811 Ga0466961_0025205
1812 Ga0466961_0052646
1813 Ga0466963_0004535
1814 Ga0466963_0005648
1815 Ga0466963_0047849
1816 Ga0466964_0001929
1817 Ga0466971_0000220
1818 Ga0466971_0005159
1819 Ga0466970_0001370
1820 Ga0466957_0000798
1821 Ga0466957_0014746
1822 Ga0466957_0023644
1823 Ga0466957_0131321
1824 Ga0466960_0002037
1825 Ga0466960_0013305
1826 Ga0466959_0004898
1827 Ga0466959_0010580
1828 Ga0466959_0011045
1829 Ga0466959_0020304
1830 Ga0466959_0031253
1831 Ga0466959_0036140
1832 Ga0466959_0103213
1833 Ga0466958_0012778
1834 Ga0466958_0014558
1835 Ga0466958_0018195
1836 Ga0466958_0024515
1837 Ga0466958_0035590
1838 Ga0466967_0002536
1839 Ga0466967_0005065
1840 Ga0466967_0007108
1841 Ga0466967_0014770
1842 Ga0466967_0048027
1843 Ga0466967_0051928
1844 Ga0466967_0054843
1845 Ga0466967_0138981
1846 Ga0466967_0200255
1847 Ga0495617_012501
1848 Ga0495627_008465
1849 Ga0495592_0000189
1850 Ga0495592_0006449
1851 Ga0495592_0008293
1852 Ga0495592_0019414
1853 Ga0495592_0031081
1854 Ga0495592_0038942
1855 Ga0495603_0000082
1856 Ga0495603_0005180
1857 Ga0495603_0007827
1858 Ga0495603_0010487
1859 Ga0495603_0012953
1860 Ga0495629_0003195
1861 Ga0495629_0008790
1862 Ga0495629_0010724
1863 Ga0495629_0053734
1864 Ga0495629_0083662
1865 Ga0495629_0085769
1866 Ga0495638_0025505
1867 Ga0495638_0044571
1868 Ga0495651_0000071
1869 Ga0495651_0000708
1870 Ga0495651_0003342
1871 Ga0495651_0004996
1872 Ga0495651_0009515
1873 Ga0495651_0009985
1874 Ga0495651_0015296
1875 Ga0495651_0019398
1876 Ga0495651_0023269
1877 Ga0495651_0026171
1878 Ga0495653_0009372
1879 Ga0495653_0010877
1880 Ga0495653_0016368
1881 Ga0495653_0032484
1882 Ga0495653_0069571
1883 Ga0495653_0073881
1884 Ga0495653_0105727
1885 Ga0495580_0053431
1886 Ga0495582_0002562
1887 Ga0495582_0008071
1888 Ga0495582_0010553
1889 Ga0495605_0009406
1890 Ga0495639_0003116
1891 Ga0495639_0062747
1892 Ga0495662_0002994
1893 Ga0495662_0007814
1894 Ga0495662_0009305
1895 Ga0495662_0057986
1896 Ga0495664_0003163
1897 Ga0495664_0004338
1898 Ga0495664_0005713
1899 Ga0495664_0024459
1900 Ga0495664_0032644
1901 Ga0495664_0040472
1902 Ga0495585_0081628
1903 Ga0495594_0012643
1904 Ga0495607_0021059
1905 Ga0495608_0000107
1906 Ga0495608_0002791
1907 Ga0495608_0004680
1908 Ga0495608_0006891
1909 Ga0495608_0040533
1910 Ga0495608_0093597
1911 Ga0495610_0025302
1912 Ga0495616_0005670
1913 Ga0495618_0003261
1914 Ga0495618_0006446
1915 Ga0495618_0006640
1916 Ga0495618_0010914
1917 Ga0495618_0023583
1918 Ga0495618_0060827
1919 Ga0495620_0016027
1920 Ga0495628_0000136
1921 Ga0495628_0003511
1922 Ga0495628_0025864
1923 Ga0495628_0062539
1924 Ga0495628_0106628
1925 Ga0495630_0005518
1926 Ga0495630_0069945
1927 Ga0495631_0018871
1928 Ga0495637_0057332
1929 Ga0495643_0010414
1930 Ga0495666_0003956
1931 Ga0495666_0015376
1932 Ga0495666_0057347
1933 Ga0495652_0000732
1934 Ga0495652_0001718
1935 Ga0495652_0012349
1936 Ga0495652_0020541
1937 Ga0495652_0043078
1938 Ga0495652_0055605
1939 Ga0495652_0077057
1940 Ga0495654_0016160
1941 Ga0495665_0009647
1942 Ga0495665_0009885
1943 Ga0495665_0037121
1944 Ga0495640_0006120
1945 Ga0495640_0007093
1946 Ga0495640_0010766
1947 Ga0495640_0025636
1948 Ga0495640_0035637
1949 Ga0495640_0072223
1950 Ga0495586_0009559
1951 Ga0495587_0000070
1952 Ga0495587_0003232
1953 Ga0495587_0003909
1954 Ga0495587_0020513
1955 Ga0495587_0031829
1956 Ga0495597_0026695
1957 Ga0495645_0003283
1958 Ga0495645_0009696
1959 Ga0495645_0019011
1960 Ga0495645_0020301
1961 Ga0495645_0021409
1962 Ga0495645_0037195
1963 Ga0495645_0063535
1964 Ga0495622_0011931
1965 Ga0495667_0000048
1966 Ga0495667_0015266
1967 Ga0495667_0033993
1968 Ga0495667_0041363
1969 Ga0495667_0135700
1970 Ga0495656_0045734
1971 Ga0495668_0005137
1972 Ga0495634_0002233
1973 Ga0495634_0010992
1974 Ga0495634_0013252
1975 Ga0495634_0072588
1976 Ga0495634_0079036
1977 Ga0495634_0083437
1978 Ga0495625_0118444
1979 Ga0495635_0001155
1980 Ga0495635_0008954
1981 Ga0495635_0034387
1982 Ga0495635_0057588
1983 Ga0495635_0066146
1984 Ga0495661_0023753
1985 Ga0495588_0000889
1986 Ga0495657_0000046
1987 Ga0495657_0004680
1988 Ga0495657_0008676
1989 Ga0495657_0009724
1990 Ga0495657_0012224
1991 Ga0495657_0018394
1992 Ga0495657_0026036
1993 Ga0495657_0031609
1994 Ga0495599_0000023
1995 Ga0495599_0002361
1996 Ga0495599_0033068
1997 Ga0495599_0072170
1998 Ga0495623_0000157
1999 Ga0495623_0009340
2000 Ga0495623_0011858
2001 Ga0495623_0016802
2002 Ga0495623_0020578
2003 Ga0495623_0081380
2004 Ga0495646_0012336
2005 Ga0495658_0003148
2006 Ga0495658_0007177
2007 Ga0495658_0043113
2008 Ga0495658_0055501
2009 Ga0495669_0002176
2010 Ga0495613_0004199
2011 Ga0495613_0008146
2012 Ga0495613_0009441
2013 Ga0495613_0011261
2014 Ga0495613_0011520
2015 Ga0495613_0144616
2016 Ga0495624_0003948
2017 Ga0495624_0013782
2018 Ga0495649_0046669
2019 Ga0495589_0020249
2020 Ga0495600_0014154
2021 Ga0495600_0045073
2022 Ga0495660_0048292
2023 Ga0495660_0072239
2024 Ga0495581_0007738
2025 Ga0495581_0009120
2026 Ga0495581_0011441
2027 Ga0495581_0044450
2028 Ga0495604_0000037
2029 Ga0495604_0003252
2030 Ga0495604_0008709
2031 Ga0495604_0008817
2032 Ga0495604_0014512
2033 Ga0495604_0014525
2034 Ga0495604_0015646
2035 Ga0495604_0020766
2036 Ga0495636_0018033
2037 Ga0495674_0000118
2038 Ga0495674_0007553
2039 Ga0495674_0013001
2040 Ga0495674_0014177
2041 Ga0495674_0016848
2042 Ga0495674_0026900
2043 Ga0495674_0060448
2044 Ga0495674_0113882
2045 Ga0495676_0009516
2046 Ga0495676_0015877
2047 Ga0495676_0037225
2048 Ga0495680_0000260
2049 Ga0495680_0003970
2050 Ga0495680_0006638
2051 Ga0495680_0017210
2052 Ga0495680_0122816
2053 Ga0495680_0123953
2054 Ga0495675_0021339
2055 Ga0495675_0023234
2056 Ga0495675_0048525
2057 Ga0495677_0014286
2058 Ga0495685_004513
2059 Ga0495685_007259
2060 Ga0495685_011503
2061 Ga0495681_0055862
2062 Ga0495684_0018808
2063 Ga0495684_0021860
2064 Ga0495684_0026439
2065 Ga0495684_0032376
2066 Ga0495593_0003385
2067 Ga0495593_0048900
2068 Ga0495602_0000118
2069 Ga0495602_0008934
2070 Ga0495602_0030355
2071 Ga0495602_0032768
2072 Ga0495602_0083064
2073 Ga0495602_0092759
2074 Ga0495602_0133327
2075 Ga0495614_0001541
2076 Ga0495614_0016294
2077 Ga0495626_0010355
2078 Ga0496101_0037717
2079 Ga0496101_0044575
2080 Ga0496101_0092735
2081 Ga0496102_0000029
2082 Ga0496102_0001151
2083 Ga0496102_0150366
2084 Ga0496103_0000080
2085 Ga0496104_0001695
2086 Ga0496104_0003110
2087 Ga0496104_0012025
2088 Ga0496104_0057930
2089 Ga0496104_0101743
2090 Ga0496104_0202127
2091 Ga0496105_0001747
2092 Ga0496105_0007144
2093 Ga0496105_0016938
2094 Ga0496105_0029731
2095 Ga0496105_0121017
2096 Ga0496108_0008890
2097 Ga0496108_0010231
2098 Ga0496108_0016901
2099 Ga0496108_0018292
2100 Ga0496108_0093242
2101 Ga0496109_0008227
2102 Ga0496109_0017888
2103 Ga0496109_0077027
2104 Ga0496109_0086925
2105 Ga0496109_0139691
2106 Ga0496110_0001540
2107 Ga0496110_0007485
2108 Ga0496110_0013729
2109 Ga0496110_0019823
2110 Ga0496110_0031164
2111 Ga0496110_0034661
2112 Ga0496110_0162062
2113 Ga0496111_0000498
2114 Ga0496111_0006115
2115 Ga0496111_0051538
2116 Ga0496112_0001029
2117 Ga0496112_0009946
2118 Ga0496112_0020526
2119 Ga0496113_0006984
2120 Ga0496113_0009779
2121 Ga0496113_0013661
2122 Ga0496113_0045157
2123 Ga0496113_0135890
2124 Ga0496114_0003065
2125 Ga0496114_0018546
2126 Ga0496114_0026122
2127 Ga0496114_0030440
2128 Ga0496114_0053481
2129 Ga0496114_0070741
2130 Ga0496114_0103896
2131 Ga0496114_0106753
2132 Ga0496115_0018681
2133 Ga0496115_0023449
2134 Ga0496115_0030780
2135 Ga0496115_0035253
2136 Ga0496115_0056782
2137 Ga0496118_0012027
2138 Ga0496126_0014421
2139 Ga0496126_0017653
2140 Ga0496126_0084264
2141 Ga0496126_0100473
2142 Ga0501031_0000082
2143 Ga0501031_0000983
2144 Ga0501031_0022710
2145 Ga0501032_0000035
2146 Ga0501032_0002765
2147 Ga0501032_0008427
2148 Ga0501032_0024746
2149 Ga0501032_0047483
2150 Ga0501033_0001072
2151 Ga0501033_0001772
2152 Ga0501033_0004384
2153 Ga0501033_0013102
2154 Ga0501033_0023587
2155 Ga0501033_0042742
2156 Ga0501034_0000925
2157 Ga0501034_0003651
2158 Ga0501034_0010048
2159 Ga0501034_0010110
2160 Ga0501034_0022645
2161 Ga0501034_0041014
2162 Ga0501036_0002018
2163 Ga0501036_0002028
2164 Ga0501036_0005941
2165 Ga0501036_0010750
2166 Ga0501036_0013936
2167 Ga0501036_0017324
2168 Ga0501036_0034007
2169 Ga0501036_0048380
2170 Ga0501037_0000370
2171 Ga0501037_0000975
2172 Ga0501037_0004313
2173 Ga0501037_0010903
2174 Ga0501037_0033493
2175 Ga0501037_0074113
2176 Ga0501037_0086909
2177 Ga0501037_0092173
2178 Ga0501038_0000172
2179 Ga0501038_0000830
2180 Ga0501038_0001402
2181 Ga0501038_0002380
2182 Ga0501038_0007236
2183 Ga0501038_0009084
2184 Ga0501038_0016324
2185 Ga0501038_0018802
2186 Ga0501038_0022038
2187 Ga0501039_0000269
2188 Ga0501039_0003905
2189 Ga0501039_0008292
2190 Ga0501039_0027285
2191 Ga0501039_0037691
2192 Ga0501039_0080261
2193 Ga0501040_0009614
2194 Ga0501040_0122671
2195 Ga0501041_0006904
2196 Ga0501042_0003075
2197 Ga0501042_0004043
2198 Ga0501042_0009129
2199 Ga0501042_0010127
2200 Ga0501043_0000231
2201 Ga0501043_0000964
2202 Ga0501043_0001222
2203 Ga0501043_0009186
2204 Ga0501043_0010396
2205 Ga0501043_0024633
2206 Ga0501043_0041543
2207 Ga0501043_0128599
2208 Ga0501046_0000279
2209 Ga0501046_0005074
2210 Ga0501046_0017656
2211 Ga0501046_0057856
2212 Ga0501046_0111531
2213 Ga0501047_0000213
2214 Ga0501047_0000458
2215 Ga0501047_0000837
2216 Ga0501047_0007441
2217 Ga0501047_0012451
2218 Ga0501047_0015908
2219 Ga0501047_0023191
2220 Ga0501047_0042338
2221 Ga0501047_0052841
2222 Ga0501047_0060579
2223 Ga0501047_0080844
2224 Ga0501047_0087834
2225 Ga0501047_0094784
2226 Ga0501047_0179352
2227 Ga0501047_0183831
2228 Ga0501048_0000048
2229 Ga0501048_0001326
2230 Ga0501048_0005292
2231 Ga0501048_0012400
2232 Ga0501048_0014519
2233 Ga0501048_0017993
2234 Ga0501048_0084571
2235 Ga0501048_0129160
2236 Ga0501067_0005264
2237 Ga0501068_0002571
2238 Ga0501069_0000330
2239 Ga0501069_0027446
2240 Ga0501070_0000504
2241 Ga0501070_0002289
2242 Ga0501070_0016182
2243 Ga0501070_0031949
2244 Ga0501070_0077446
2245 Ga0501070_0100770
2246 Ga0501070_0130103
2247 Ga0501071_0010005
2248 Ga0501071_0018673
2249 Ga0501072_0027599
2250 Ga0501072_0030727
2251 Ga0501073_0001049
2252 Ga0501073_0020491
2253 Ga0501073_0097508
2254 Ga0501074_0000061
2255 Ga0501074_0000823
2256 Ga0501074_0008685
2257 Ga0501074_0022408
2258 Ga0501074_0035507
2259 Ga0501075_0027223
2260 Ga0501076_0016692
2261 Ga0501077_0003455
2262 Ga0501079_0000093
2263 Ga0501079_0003706
2264 Ga0501080_0000160
2265 Ga0501080_0000266
2266 Ga0501080_0027168
2267 Ga0501083_0006977
2268 Ga0501035_0000404
2269 Ga0501035_0001134
2270 Ga0501035_0001925
2271 Ga0501035_0004136
2272 Ga0501035_0005043
2273 Ga0501035_0019883
2274 Ga0501035_0105615
2275 Ga0501044_0000439
2276 Ga0501044_0001745
2277 Ga0501044_0002390
2278 Ga0501044_0004503
2279 Ga0501044_0019305
2280 Ga0501044_0028298
2281 Ga0501044_0041631
2282 Ga0501044_0059509
2283 Ga0501044_0086996
2284 Ga0501044_0106576
2285 Ga0501044_0120306
2286 Ga0501044_0195302
2287 Ga0501045_0007688
2288 Ga0501045_0051300
2289 nmdc:mga03n38_22580_c1
2290 nmdc:mga06z11_5955_c1
2291 nmdc:mga05p37_124403_c1
2292 nmdc:mga05p37_1684_c1
2293 nmdc:mga05p37_47176_c1
2294 nmdc:mga05p37_8100_c1
2295 nmdc:mga06r32_23130_c1
2296 nmdc:mga08y16_12403_c1
2297 nmdc:mga08y16_26780_c1
2298 nmdc:mga0n895_17011_c1
2299 nmdc:mga0n895_4823_c1
2300 nmdc:mga0n895_7424_c1
2301 nmdc:mga0rr50_13386_c1
2302 nmdc:mga0rr50_26819_c1
2303 nmdc:mga0rr50_34881_c1
2304 nmdc:mga08x19_23875_c1
2305 nmdc:mga08x19_7350_c1
2306 nmdc:mga08x19_8225_c1
2307 nmdc:mga0a205_23435_c1
2308 nmdc:mga0a205_25017_c1
2309 nmdc:mga0a205_7906_c1
2310 Ga0495601_0009353
2311 Ga0495601_0029193
2312 Ga0495601_0031990
2313 Ga0495601_0056929
2314 Ga0495612_0002725
2315 Ga0495612_0008768
2316 Ga0495612_0013756
2317 Ga0495612_0021976
2318 Ga0495595_0002004
2319 Ga0495595_0025779
2320 Ga0495595_0026080
2321 Ga0495619_0006913
2322 Ga0495619_0026382
2323 Ga0495619_0037853
2324 Ga0495619_0064868
2325 Ga0500578_0057421
2326 Ga0500643_000483
2327 Ga0500646_0000140
2328 Ga0500658_0056132
2329 Ga0500568_0001955
2330 Ga0500616_0001335
2331 Ga0500616_0003035
2332 Ga0501084_0012932
2333 Ga0501084_0024382
2334 Ga0501084_0098569
2335 Ga0501082_0003549
2336 Ga0501082_0009216
2337 Ga0466962_0001009
2338 Ga0466962_0008427
2339 Ga0466962_0021351
2340 Ga0466962_0060333
2341 Ga0530510_0001337
2342 2729906767
2343 2547410194
2344 2554256964
2345 2558912557
2346 2585308323
2347 2616703166
2348 2616904716
2349 2643851358
2350 2644014628
2351 2644138052
2352 2644176063
2353 2644261842
2354 2644445712
2355 2644610354
2356 2676495035
2357 2731907163
2358 2768644285
2359 2774395025
2360 2784473191
2361 2784589490
2362 2785342098
2363 2785370563
2364 2786671720
2365 2793982627
2366 2799186736
2367 2808843120
2368 2808872830
2369 2808921468
2370 2809194143
2371 2809233154
2372 2811845279
2373 2812348873
2374 2812357001
2375 2812371744
2376 2812479663
2377 2819667320
2378 2819690640
2379 2819728051
2380 2819742135
2381 2842890615
2382 2852640597
2383 2856746214
2384 2857712090
2385 2862286870
2386 2862291296
2387 2862390040
2388 2862578357
2389 2862706107
2390 2863411781
2391 2866555721
2392 2867349021
2393 2867373056
2394 2867433057
2395 2867481281
2396 2868090651
2397 2870788408
2398 2873154885
2399 2873314896
2400 2875394604
2401 2877680059
2402 2883826433
2403 2884694321
2404 2887486913
2405 2891402613
2406 2891554941
2407 2891562760
2408 2891973362
2409 2895435610
2410 2895444761
2411 2912718653
2412 2912730978
2413 2912761943
2414 2919449150
2415 2919476067
2416 2932400731
2417 2935392392
2418 2946068879
2419 2947228033
2420 2954002851
2421 2954384990
2422 2954678005
2423 2954686153
2424 2954695807
2425 2954710998
2426 2954715216
2427 2954725157
2428 2954736661
2429 2954744090
2430 2954755508
2431 2954763032
2432 2956942148
2433 2990045192
2434 2990059968
2435 2990090277
2436 2995467957
2437 2997458085
2438 2997606274
2439 3001119500
2440 3001892231
2441 3003000841
2442 3006327095
2443 3006396376
2444 3006428935
2445 3006489268
2446 3006494384
2447 8001785276
2448 8008488708
2449 8008566307
2450 8008577990
2451 8023629995
2452 8025483244
2453 8025529467
2454 8025536440
2455 8047897127
2456 8048134747
2457 8048361825
2458 8048374111
2459 8048384115
2460 8048413521
2461 8053948496
2462 8054160671
2463 8055074172
2464 8055175695
2465 8056062046
2466 8056454400
2467 8056672760
2468 8056833766

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02602

HEM4

Uroporphyrinogen-III synthase HemD

358

589

0.97

PF00590

TP_methylase

Tetrapyrrole (Corrin/Porphyrin) Methylases

102

309

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1cbf-assembly1.cif.gz_A the x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif 0.9084 12 215
1pjt-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9022 4 230
2ybo-assembly1.cif.gz_A-2 the x-ray structure of the sam-dependent uroporphyrinogen iii methyltransferase nire from pseudomonas aeruginosa in complex with sah 0.8953 10 216
6p5z-assembly1.cif.gz_A cobalt-sirohydrochlorin-bound s. typhimurium siroheme synthase 0.8952 4 230
6pr1-assembly1.cif.gz_A r260a/s128a s. typhimurium siroheme synthase 0.8937 4 230
ID Description Score Start End Superfamily
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9173 10 119 3.40.1010.10
af_A0A1D8PGS2_266_389_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9104 6 119 3.40.1010.10
3neiB01 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9081 12 118 3.40.1010.10
af_Q2FVM0_1_122_3.40.1010.10 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9028 8 119 3.40.1010.10
1pjsA04 Alpha Beta;3-Layer(aba) Sandwich;Cobalt-precorrin-4 Transmethylase; domain 1;Tetrapyrrole methylase, N-terminal domain 0.9015 10 119 3.40.1010.10
ID Description Score Start End GO Terms
AF-A0A655AIJ8-F1-model_v4 Uroporphyrin-III C-methyltransferase 0.9483 406 503 GO:0004852
GO:0006780
GO:0008168
GO:0032259
AF-A0A830G2K3-F1-model_v4 deleted 0.9424 10 211
AF-A0A1Y3TDD2-F1-model_v4 Precorrin-4 C(11)-methyltransferase 0.9273 13 216 GO:0009236
GO:0032259
GO:0046026
AF-A0A838SKW1-F1-model_v4 uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.927 10 500 GO:0004851
GO:0004852
GO:0019354
GO:0032259
AF-Q2RT12-F1-model_v4 Uroporphyrinogen-III C-methyltransferase (EC 2.1.1.107) 0.9262 4 214 GO:0004851
GO:0009236
GO:0019354
GO:0032259
GO:0043115
GO:0051266
GO:0051287

Map