F492007

General Info

Members Datasets Scaffolds Average Seq Length
1232 352 2464 191

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0562617|Ga0496113_0562617_14_730
Length 238
Sequence LTPRLFDRRLQALELFERGLFVERTALGVVGSVEHDAEDNTIEDDMAALIEAIEIKRKMFFEFEDAPYHCLDVDISKPTARGGQTLVRLKMRNLLTRAVFDRTFKAGEKFKEPDLSVVSASYLYGDGDGYHFMDQESYETLTLRGDVLGDDRQLLVDNVIVQVQKYNGNPIGLQFPPHVELTVVSTEPGVRGDTASGGVTKLATLESGLEIRVPLFIKEGEKVKVHTETREFAGRAQN

Samples

Sample ID Description Type Environment
1 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
209 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
210 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
213 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
214 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
215 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
216 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
217 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
218 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
219 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
222 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
223 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
268 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
269 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
270 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
276 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
279 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
280 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
287 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
313 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
317 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
318 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
322 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
323 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
327 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
341 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
342 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
343 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
344 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
345 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
346 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
348 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
349 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.44
Nodule 0
Rhizoplane 3.33
Rhizosphere 94.16
Stem 0
Stem Tuber 0
Unclassified 14.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496113_0562617 3300048916 Unclassified 914
2 SwRhRL2b_contig_2920398 2162886007 Bacteria 3886
3 Ga0065704_10259387 3300005289 Unclassified 968
4 Ga0065712_10015494 3300005290 Bacteria 3057
5 Ga0065712_10071965 3300005290 Unclassified 4966
6 Ga0065712_10080622 3300005290 Unclassified 3086
7 Ga0065712_10132722 3300005290 Unclassified 1529
8 Ga0065712_10153009 3300005290 Bacteria 1355
9 Ga0065712_10163511 3300005290 Bacteria 1287
10 Ga0065712_10204592 3300005290 Bacteria 1095
11 Ga0065715_10001388 3300005293 Bacteria 9316
12 Ga0065715_10005133 3300005293 Bacteria 3823
13 Ga0065715_10030344 3300005293 Bacteria 1334
14 Ga0065715_10034951 3300005293 Bacteria 1479
15 Ga0065715_10089748 3300005293 Bacteria 8623
16 Ga0065715_10113358 3300005293 Bacteria 2493
17 Ga0065715_10459578 3300005293 Bacteria 817
18 Ga0065707_10039266 3300005295 Bacteria 1140
19 Ga0065707_10102337 3300005295 Bacteria 2812
20 Ga0065707_10106835 3300005295 Bacteria 2580
21 Ga0065707_10339715 3300005295 Unclassified 935
22 Ga0070676_10002041 3300005328 Bacteria 10261
23 Ga0070676_10175860 3300005328 Unclassified 1388
24 Ga0070683_100048354 3300005329 Bacteria 3932
25 Ga0070683_100489394 3300005329 Unclassified 1175
26 Ga0070690_100014974 3300005330 Bacteria 4613
27 Ga0070690_100081386 3300005330 Bacteria 2119
28 Ga0070690_100097334 3300005330 Bacteria 1946
29 Ga0070670_100000862 3300005331 Bacteria 23811
30 Ga0070670_100032185 3300005331 Bacteria 4517
31 Ga0070670_100041538 3300005331 Bacteria 3952
32 Ga0070670_100094479 3300005331 Unclassified 2572
33 Ga0070677_10010250 3300005333 Bacteria 3201
34 Ga0070677_10265157 3300005333 Unclassified 859
35 Ga0068869_100010634 3300005334 Bacteria 6007
36 Ga0068869_100120728 3300005334 Unclassified 2004
37 Ga0068869_100152032 3300005334 Unclassified 1796
38 Ga0068869_100252576 3300005334 Unclassified 1409
39 Ga0068869_100557791 3300005334 Bacteria 963
40 Ga0070666_10051008 3300005335 Bacteria 2785
41 Ga0070666_10078007 3300005335 Bacteria 2261
42 Ga0070680_100053123 3300005336 Unclassified 3307
43 Ga0070682_100150153 3300005337 Bacteria 1598
44 Ga0068868_100076959 3300005338 Bacteria 2668
45 Ga0068868_100314952 3300005338 Bacteria 1332
46 Ga0068868_100940264 3300005338 Bacteria 788
47 Ga0070660_100010573 3300005339 Bacteria 6522
48 Ga0070660_100116238 3300005339 Bacteria 2133
49 Ga0070660_100917300 3300005339 Bacteria 739
50 Ga0070689_100143459 3300005340 Bacteria 1922
51 Ga0070689_100305821 3300005340 Bacteria 1324
52 Ga0070687_100019168 3300005343 Bacteria 3179
53 Ga0070661_100025411 3300005344 Bacteria 4255
54 Ga0070661_100040731 3300005344 Bacteria 3390
55 Ga0070692_10148734 3300005345 Unclassified 1332
56 Ga0070692_10344806 3300005345 Unclassified 923
57 Ga0070668_100375066 3300005347 Bacteria 1209
58 Ga0070668_100724052 3300005347 Bacteria 879
59 Ga0070668_101114271 3300005347 Unclassified 713
60 Ga0070669_100012604 3300005353 Bacteria 5999
61 Ga0070669_100020610 3300005353 Bacteria 4708
62 Ga0070669_100100041 3300005353 Bacteria 2186
63 Ga0070669_100321200 3300005353 Bacteria 1250
64 Ga0070669_100354311 3300005353 Bacteria 1192
65 Ga0070669_101034197 3300005353 Bacteria 706
66 Ga0070675_100003923 3300005354 Bacteria 11268
67 Ga0070675_100004526 3300005354 Bacteria 10616
68 Ga0070675_100016505 3300005354 Bacteria 5863
69 Ga0070675_100023144 3300005354 Unclassified 4964
70 Ga0070675_100023209 3300005354 Bacteria 4958
71 Ga0070675_100023283 3300005354 Unclassified 4951
72 Ga0070675_100107419 3300005354 Bacteria 2357
73 Ga0070675_100168953 3300005354 Bacteria 1885
74 Ga0070675_100175070 3300005354 Bacteria 1853
75 Ga0070675_100219738 3300005354 Bacteria 1654
76 Ga0070675_100292120 3300005354 Bacteria 1435
77 Ga0070675_100339578 3300005354 Bacteria 1330
78 Ga0070675_100350696 3300005354 Unclassified 1309
79 Ga0070675_100485328 3300005354 Bacteria 1112
80 Ga0070671_100008412 3300005355 Bacteria 8270
81 Ga0070671_100319463 3300005355 Bacteria 1323
82 Ga0070671_100654104 3300005355 Unclassified 910
83 Ga0070674_100012704 3300005356 Bacteria 5178
84 Ga0070674_100154850 3300005356 Bacteria 1733
85 Ga0070674_100196031 3300005356 Bacteria 1556
86 Ga0070673_100000594 3300005364 Bacteria 19718
87 Ga0070673_100002861 3300005364 Bacteria 10625
88 Ga0070673_100020126 3300005364 Bacteria 4807
89 Ga0070673_100020405 3300005364 Bacteria 4780
90 Ga0070673_100045243 3300005364 Bacteria 3412
91 Ga0070673_100279228 3300005364 Bacteria 1465
92 Ga0070673_100287676 3300005364 Bacteria 1443
93 Ga0070673_100358365 3300005364 Bacteria 1296
94 Ga0070673_100379015 3300005364 Unclassified 1261
95 Ga0070673_100420605 3300005364 Bacteria 1198
96 Ga0070673_100534939 3300005364 Bacteria 1063
97 Ga0070688_100001149 3300005365 Bacteria 13222
98 Ga0070688_100033507 3300005365 Bacteria 3106
99 Ga0070688_100075060 3300005365 Bacteria 2172
100 Ga0070688_100162976 3300005365 Unclassified 1533
101 Ga0070688_100467497 3300005365 Bacteria 946
102 Ga0070688_100824840 3300005365 Bacteria 727
103 Ga0070659_100086523 3300005366 Bacteria 2508
104 Ga0070659_100191601 3300005366 Bacteria 1680
105 Ga0070667_100307153 3300005367 Unclassified 1429
106 Ga0070709_11061093 3300005434 Unclassified 647
107 Ga0070701_10005840 3300005438 Bacteria 5128
108 Ga0070701_10199131 3300005438 Bacteria 1183
109 Ga0070701_10565938 3300005438 Bacteria 748
110 Ga0070711_100355964 3300005439 Bacteria 1178
111 Ga0070705_100004514 3300005440 Bacteria 6780
112 Ga0070705_100015721 3300005440 Bacteria 3918
113 Ga0070705_100689893 3300005440 Bacteria 801
114 Ga0070700_100044346 3300005441 Bacteria 2739
115 Ga0070700_100197488 3300005441 Unclassified 1411
116 Ga0070700_100353289 3300005441 Bacteria 1090
117 Ga0070700_100410379 3300005441 Bacteria 1021
118 Ga0070694_100010407 3300005444 Bacteria 5739
119 Ga0070694_100016670 3300005444 Bacteria 4627
120 Ga0070694_100030044 3300005444 Bacteria 3551
121 Ga0070678_100018590 3300005456 Bacteria 4506
122 Ga0070678_100034957 3300005456 Bacteria 3504
123 Ga0070678_100066544 3300005456 Bacteria 2679
124 Ga0070662_100159778 3300005457 Bacteria 1762
125 Ga0070662_101017605 3300005457 Bacteria 710
126 Ga0070681_10006132 3300005458 Bacteria 11671
127 Ga0070681_11168517 3300005458 Unclassified 691
128 Ga0068867_100002836 3300005459 Bacteria 12189
129 Ga0068867_100015507 3300005459 Bacteria 5407
130 Ga0068867_100038035 3300005459 Unclassified 3502
131 Ga0068867_100203244 3300005459 Bacteria 1587
132 Ga0068867_100645811 3300005459 Bacteria 928
133 Ga0068867_100707552 3300005459 Bacteria 890
134 Ga0068867_100782903 3300005459 Unclassified 849
135 Ga0070685_10066109 3300005466 Unclassified 2130
136 Ga0070685_10616277 3300005466 Bacteria 783
137 Ga0070706_100158336 3300005467 Bacteria 2114
138 Ga0070707_100013144 3300005468 Bacteria 7738
139 Ga0070707_100113616 3300005468 Bacteria 2627
140 Ga0070707_100215782 3300005468 Unclassified 1870
141 Ga0070707_100659392 3300005468 Bacteria 1009
142 Ga0070698_100004179 3300005471 Bacteria 15861
143 Ga0070698_100025407 3300005471 Bacteria 6174
144 Ga0070698_100048906 3300005471 Bacteria 4319
145 Ga0070698_100050993 3300005471 Bacteria 4216
146 Ga0070698_100153168 3300005471 Bacteria 2252
147 Ga0070698_100283181 3300005471 Bacteria 1589
148 Ga0070698_100284111 3300005471 Bacteria 1586
149 Ga0070698_100363070 3300005471 Bacteria 1380
150 Ga0070698_100653300 3300005471 Bacteria 993
151 Ga0070698_101074649 3300005471 Bacteria 753
152 Ga0070699_100000371 3300005518 Bacteria 43874
153 Ga0070699_100003501 3300005518 Bacteria 13880
154 Ga0070699_100004001 3300005518 Bacteria 13023
155 Ga0070699_100011447 3300005518 Bacteria 7660
156 Ga0070699_100824509 3300005518 Bacteria 849
157 Ga0070684_100188822 3300005535 Bacteria 1875
158 Ga0070684_100498779 3300005535 Bacteria 1127
159 Ga0070684_100830926 3300005535 Unclassified 864
160 Ga0070697_100108495 3300005536 Bacteria 2311
161 Ga0070697_100816995 3300005536 Unclassified 825
162 Ga0070672_100005295 3300005543 Bacteria 8539
163 Ga0070672_100005744 3300005543 Bacteria 8270
164 Ga0070672_100027238 3300005543 Bacteria 4262
165 Ga0070672_100039392 3300005543 Bacteria 3620
166 Ga0070672_100138169 3300005543 Bacteria 2008
167 Ga0070672_100196074 3300005543 Bacteria 1687
168 Ga0070686_100027043 3300005544 Bacteria 3469
169 Ga0070686_100075953 3300005544 Bacteria 2211
170 Ga0070686_100238708 3300005544 Bacteria 1322
171 Ga0070695_100038815 3300005545 Unclassified 3008
172 Ga0070695_100145393 3300005545 Bacteria 1649
173 Ga0070695_100423155 3300005545 Bacteria 1014
174 Ga0070696_100003185 3300005546 Bacteria 10932
175 Ga0070696_100023851 3300005546 Bacteria 4157
176 Ga0070696_100716222 3300005546 Unclassified 817
177 Ga0070693_100048550 3300005547 Bacteria 2418
178 Ga0070693_100629074 3300005547 Unclassified 778
179 Ga0070665_100005947 3300005548 Bacteria 12494
180 Ga0070665_100011134 3300005548 Bacteria 9090
181 Ga0070665_100368650 3300005548 Bacteria 1443
182 Ga0070665_101416440 3300005548 Bacteria 704
183 Ga0070704_100000346 3300005549 Bacteria 21124
184 Ga0070704_100040811 3300005549 Unclassified 3198
185 Ga0070704_100249066 3300005549 Bacteria 1458
186 Ga0070704_100762903 3300005549 Bacteria 862
187 Ga0070704_100845888 3300005549 Bacteria 820
188 Ga0068855_100341281 3300005563 Bacteria 1651
189 Ga0070664_100017628 3300005564 Bacteria 5864
190 Ga0070664_100025460 3300005564 Unclassified 4904
191 Ga0070664_100084982 3300005564 Bacteria 2732
192 Ga0070664_100128953 3300005564 Bacteria 2221
193 Ga0070664_100659202 3300005564 Unclassified 973
194 Ga0068857_100012311 3300005577 Bacteria 7443
195 Ga0068857_100043939 3300005577 Unclassified 3963
196 Ga0068857_100272746 3300005577 Unclassified 1555
197 Ga0068857_100592997 3300005577 Bacteria 1047
198 Ga0068857_100606599 3300005577 Bacteria 1035
199 Ga0068857_101033330 3300005577 Bacteria 792
200 Ga0068854_100462175 3300005578 Bacteria 1062
201 Ga0070702_100008414 3300005615 Bacteria 4996
202 Ga0070702_100026205 3300005615 Bacteria 3130
203 Ga0068852_100134299 3300005616 Bacteria 2283
204 Ga0068852_100396879 3300005616 Bacteria 1356
205 Ga0068859_100001816 3300005617 Bacteria 21743
206 Ga0068859_100004547 3300005617 Bacteria 14146
207 Ga0068859_100005799 3300005617 Bacteria 12544
208 Ga0068859_100159457 3300005617 Unclassified 2335
209 Ga0068859_100167031 3300005617 Bacteria 2280
210 Ga0068859_100217392 3300005617 Bacteria 1998
211 Ga0068859_100223804 3300005617 Bacteria 1970
212 Ga0068859_100247775 3300005617 Bacteria 1871
213 Ga0068859_100503982 3300005617 Bacteria 1306
214 Ga0068864_100015665 3300005618 Bacteria 6307
215 Ga0068864_100019802 3300005618 Bacteria 5626
216 Ga0068864_100061487 3300005618 Bacteria 3253
217 Ga0068864_100179005 3300005618 Bacteria 1937
218 Ga0068864_100641768 3300005618 Bacteria 1033
219 Ga0068864_100925609 3300005618 Bacteria 862
220 Ga0068866_10027180 3300005718 Bacteria 2710
221 Ga0068861_100009661 3300005719 Bacteria 6664
222 Ga0068861_100020099 3300005719 Bacteria 4777
223 Ga0068861_100031964 3300005719 Bacteria 3872
224 Ga0068861_100330194 3300005719 Bacteria 1331
225 Ga0068861_100451746 3300005719 Bacteria 1152
226 Ga0068861_100522592 3300005719 Bacteria 1077
227 Ga0068861_100592524 3300005719 Bacteria 1016
228 Ga0068851_10282906 3300005834 Bacteria 949
229 Ga0068870_10001188 3300005840 Bacteria 10443
230 Ga0068870_10042551 3300005840 Bacteria 2365
231 Ga0068870_10083473 3300005840 Unclassified 1771
232 Ga0068870_10203666 3300005840 Bacteria 1201
233 Ga0068870_10263692 3300005840 Unclassified 1073
234 Ga0068870_10372803 3300005840 Unclassified 922
235 Ga0068863_100096828 3300005841 Bacteria 2802
236 Ga0068863_100109132 3300005841 Bacteria 2634
237 Ga0068863_100878690 3300005841 Bacteria 896
238 Ga0068858_100010011 3300005842 Bacteria 9005
239 Ga0068858_100012037 3300005842 Bacteria 8154
240 Ga0068858_100023902 3300005842 Bacteria 5694
241 Ga0068858_100126632 3300005842 Bacteria 2392
242 Ga0068858_100186017 3300005842 Bacteria 1962
243 Ga0068858_100365157 3300005842 Bacteria 1384
244 Ga0068858_100528905 3300005842 Bacteria 1140
245 Ga0068860_100027562 3300005843 Bacteria 5470
246 Ga0068860_100053783 3300005843 Bacteria 3828
247 Ga0068860_100206571 3300005843 Unclassified 1905
248 Ga0068860_100393511 3300005843 Bacteria 1370
249 Ga0068860_101128325 3300005843 Bacteria 804
250 Ga0068860_101364770 3300005843 Unclassified 730
251 Ga0068862_100005365 3300005844 Bacteria 10735
252 Ga0068862_100129453 3300005844 Unclassified 2231
253 Ga0068862_100549147 3300005844 Bacteria 1103
254 Ga0081539_10000013 3300005985 Bacteria 432395
255 Ga0081539_10002253 3300005985 Bacteria 28047
256 Ga0081539_10010877 3300005985 Bacteria 7308
257 Ga0075368_10016977 3300006042 Bacteria 2719
258 Ga0075364_10124096 3300006051 Bacteria 1730
259 Ga0070715_10137877 3300006163 Bacteria 1181
260 Ga0075362_10002569 3300006177 Bacteria 6134
261 Ga0075367_10010145 3300006178 Bacteria 4940
262 Ga0075367_10157412 3300006178 Bacteria 1412
263 Ga0075367_10221341 3300006178 Bacteria 1185
264 Ga0075366_10024794 3300006195 Unclassified 3498
265 Ga0075366_10037208 3300006195 Bacteria 2872
266 Ga0075366_10393483 3300006195 Bacteria 853
267 Ga0097621_100016594 3300006237 Bacteria 5571
268 Ga0097621_100020723 3300006237 Bacteria 5071
269 Ga0097621_100036626 3300006237 Bacteria 3926
270 Ga0097621_100234710 3300006237 Bacteria 1602
271 Ga0097621_100327754 3300006237 Bacteria 1357
272 Ga0097621_100344110 3300006237 Bacteria 1325
273 Ga0097621_100477749 3300006237 Bacteria 1126
274 Ga0097621_100544787 3300006237 Bacteria 1055
275 Ga0097621_100920871 3300006237 Bacteria 815
276 Ga0075370_10071331 3300006353 Bacteria 1987
277 Ga0075370_10108632 3300006353 Bacteria 1610
278 Ga0068871_100001178 3300006358 Bacteria 17529
279 Ga0068871_100009610 3300006358 Bacteria 7022
280 Ga0068871_100028782 3300006358 Bacteria 4360
281 Ga0068871_100049815 3300006358 Bacteria 3387
282 Ga0068871_100126049 3300006358 Bacteria 2167
283 Ga0068871_100341998 3300006358 Unclassified 1321
284 Ga0068871_100460936 3300006358 Bacteria 1141
285 Ga0075428_100000037 3300006844 Bacteria 105391
286 Ga0075428_100011098 3300006844 Bacteria 10023
287 Ga0075428_100022955 3300006844 Bacteria 6905
288 Ga0075428_100068204 3300006844 Bacteria 3891
289 Ga0075428_100105121 3300006844 Bacteria 3079
290 Ga0075428_100126168 3300006844 Unclassified 2785
291 Ga0075428_100176023 3300006844 Bacteria 2317
292 Ga0075428_100282019 3300006844 Bacteria 1787
293 Ga0075428_100530720 3300006844 Bacteria 1259
294 Ga0075428_101133715 3300006844 Bacteria 825
295 Ga0075430_100009731 3300006846 Bacteria 8125
296 Ga0075430_100032869 3300006846 Bacteria 4403
297 Ga0075430_100128663 3300006846 Bacteria 2111
298 Ga0075430_100195476 3300006846 Bacteria 1680
299 Ga0075430_100327706 3300006846 Bacteria 1266
300 Ga0075430_100405708 3300006846 Bacteria 1125
301 Ga0075431_100041061 3300006847 Bacteria 4770
302 Ga0075431_100052788 3300006847 Bacteria 4191
303 Ga0075431_100092821 3300006847 Bacteria 3116
304 Ga0075431_100349051 3300006847 Bacteria 1488
305 Ga0075431_100537462 3300006847 Bacteria 1157
306 Ga0075433_10020088 3300006852 Bacteria 5578
307 Ga0075433_10053793 3300006852 Unclassified 3511
308 Ga0075433_10058259 3300006852 Bacteria 3378
309 Ga0075433_10084149 3300006852 Unclassified 2808
310 Ga0075433_10132071 3300006852 Bacteria 2218
311 Ga0075433_10152559 3300006852 Bacteria 2055
312 Ga0075433_10233761 3300006852 Bacteria 1632
313 Ga0075433_10349348 3300006852 Bacteria 1307
314 Ga0075433_10871347 3300006852 Bacteria 786
315 Ga0075433_10902533 3300006852 Bacteria 771
316 Ga0075434_100000870 3300006871 Bacteria 24140
317 Ga0075434_100001875 3300006871 Bacteria 18196
318 Ga0075434_100021212 3300006871 Bacteria 6313
319 Ga0075434_100025379 3300006871 Bacteria 5798
320 Ga0075434_100063349 3300006871 Unclassified 3680
321 Ga0075434_100099004 3300006871 Bacteria 2921
322 Ga0075434_100101395 3300006871 Bacteria 2885
323 Ga0075434_100148405 3300006871 Bacteria 2365
324 Ga0075434_100323563 3300006871 Bacteria 1562
325 Ga0075434_100541032 3300006871 Bacteria 1184
326 Ga0075429_100006566 3300006880 Bacteria 10072
327 Ga0075429_100053833 3300006880 Bacteria 3501
328 Ga0075429_100077033 3300006880 Bacteria 2905
329 Ga0075429_100111114 3300006880 Bacteria 2395
330 Ga0075429_100232919 3300006880 Bacteria 1613
331 Ga0075429_100345491 3300006880 Bacteria 1302
332 Ga0075429_100354269 3300006880 Bacteria 1285
333 Ga0075429_100368465 3300006880 Bacteria 1258
334 Ga0075429_100729670 3300006880 Bacteria 868
335 Ga0075429_100819425 3300006880 Bacteria 815
336 Ga0068865_100039363 3300006881 Bacteria 3206
337 Ga0068865_100053070 3300006881 Bacteria 2812
338 Ga0075436_100000567 3300006914 Bacteria 24122
339 Ga0075436_100022747 3300006914 Bacteria 4306
340 Ga0075436_100032025 3300006914 Bacteria 3623
341 Ga0075436_100061700 3300006914 Bacteria 2590
342 Ga0097620_100001816 3300006931 Bacteria 21743
343 Ga0097620_100004547 3300006931 Bacteria 14146
344 Ga0097620_100005799 3300006931 Bacteria 12544
345 Ga0097620_100159446 3300006931 Unclassified 2335
346 Ga0097620_100167028 3300006931 Bacteria 2280
347 Ga0097620_100217403 3300006931 Bacteria 1998
348 Ga0097620_100223785 3300006931 Bacteria 1970
349 Ga0097620_100247784 3300006931 Bacteria 1871
350 Ga0097620_100504009 3300006931 Bacteria 1306
351 Ga0097620_100554915 3300006931 Bacteria 1243
352 Ga0075435_100000423 3300007076 Bacteria 26136
353 Ga0075435_100015398 3300007076 Bacteria 5748
354 Ga0075435_100026864 3300007076 Bacteria 4496
355 Ga0075435_100137908 3300007076 Bacteria 2045
356 Ga0075435_100247736 3300007076 Unclassified 1516
357 Ga0075435_100296456 3300007076 Unclassified 1382
358 Ga0099795_10289617 3300007788 Bacteria 717
359 Ga0105240_10013601 3300009093 Bacteria 11164
360 Ga0105240_10036516 3300009093 Bacteria 6319
361 Ga0105240_10040222 3300009093 Bacteria 5982
362 Ga0105240_10197028 3300009093 Bacteria 2364
363 Ga0111539_10000009 3300009094 Bacteria 375223
364 Ga0111539_10000206 3300009094 Bacteria 69598
365 Ga0111539_10000596 3300009094 Bacteria 46666
366 Ga0111539_10008520 3300009094 Bacteria 13028
367 Ga0111539_10010289 3300009094 Bacteria 11777
368 Ga0111539_10018231 3300009094 Bacteria 8693
369 Ga0111539_10027758 3300009094 Bacteria 6914
370 Ga0111539_10031853 3300009094 Bacteria 6405
371 Ga0111539_10052880 3300009094 Bacteria 4834
372 Ga0111539_10074162 3300009094 Bacteria 4010
373 Ga0111539_10224969 3300009094 Bacteria 2185
374 Ga0111539_10242963 3300009094 Bacteria 2096
375 Ga0111539_10265822 3300009094 Bacteria 1997
376 Ga0111539_10368864 3300009094 Bacteria 1671
377 Ga0111539_10416819 3300009094 Unclassified 1564
378 Ga0111539_10869790 3300009094 Bacteria 1048
379 Ga0105245_10013339 3300009098 Bacteria 7160
380 Ga0105245_10048962 3300009098 Bacteria 3782
381 Ga0105245_11395985 3300009098 Unclassified 750
382 Ga0105245_11595587 3300009098 Bacteria 704
383 Ga0105245_11773646 3300009098 Bacteria 670
384 Ga0105247_10008841 3300009101 Bacteria 6140
385 Ga0105247_10112869 3300009101 Bacteria 1751
386 Ga0105247_10157459 3300009101 Bacteria 1501
387 Ga0114129_10001068 3300009147 Bacteria 36016
388 Ga0114129_10003364 3300009147 Bacteria 22462
389 Ga0114129_10005094 3300009147 Bacteria 18505
390 Ga0114129_10012277 3300009147 Bacteria 12189
391 Ga0114129_10013294 3300009147 Bacteria 11730
392 Ga0114129_10013964 3300009147 Bacteria 11444
393 Ga0114129_10039308 3300009147 Bacteria 6669
394 Ga0114129_10054619 3300009147 Bacteria 5600
395 Ga0114129_10056323 3300009147 Bacteria 5507
396 Ga0114129_10108401 3300009147 Bacteria 3834
397 Ga0114129_10151276 3300009147 Unclassified 3176
398 Ga0114129_10200932 3300009147 Bacteria 2699
399 Ga0114129_10231566 3300009147 Bacteria 2488
400 Ga0114129_11033318 3300009147 Bacteria 1033
401 Ga0114129_11257483 3300009147 Bacteria 919
402 Ga0114129_11278660 3300009147 Bacteria 910
403 Ga0114129_11627393 3300009147 Bacteria 790
404 Ga0105243_10013296 3300009148 Bacteria 6224
405 Ga0105243_10031914 3300009148 Unclassified 4064
406 Ga0105243_10149556 3300009148 Bacteria 2002
407 Ga0105243_10324235 3300009148 Unclassified 1405
408 Ga0105243_11192062 3300009148 Bacteria 774
409 Ga0105242_10004210 3300009176 Bacteria 11213
410 Ga0105242_10041300 3300009176 Bacteria 3720
411 Ga0105242_10044496 3300009176 Bacteria 3596
412 Ga0105242_10132588 3300009176 Bacteria 2153
413 Ga0105242_10278737 3300009176 Bacteria 1518
414 Ga0105242_11289860 3300009176 Bacteria 753
415 Ga0105248_10002819 3300009177 Bacteria 19286
416 Ga0105248_10073705 3300009177 Bacteria 3837
417 Ga0105248_10092667 3300009177 Bacteria 3403
418 Ga0105248_10203707 3300009177 Unclassified 2229
419 Ga0105248_10232229 3300009177 Bacteria 2076
420 Ga0105248_10393424 3300009177 Bacteria 1561
421 Ga0105248_10396704 3300009177 Unclassified 1553
422 Ga0105248_10470034 3300009177 Bacteria 1418
423 Ga0105248_10539601 3300009177 Bacteria 1316
424 Ga0105248_10654045 3300009177 Bacteria 1186
425 Ga0105237_10207013 3300009545 Bacteria 1962
426 Ga0105238_10190616 3300009551 Unclassified 2026
427 Ga0105238_10689874 3300009551 Bacteria 1033
428 Ga0105238_11293882 3300009551 Bacteria 755
429 Ga0105249_10019042 3300009553 Bacteria 6122
430 Ga0105249_10026947 3300009553 Bacteria 5183
431 Ga0105249_10047858 3300009553 Bacteria 3898
432 Ga0105249_10084615 3300009553 Unclassified 2954
433 Ga0105249_10132207 3300009553 Bacteria 2383
434 Ga0105249_10182942 3300009553 Bacteria 2040
435 Ga0105249_10229634 3300009553 Bacteria 1830
436 Ga0105249_10323105 3300009553 Bacteria 1555
437 Ga0105249_10389117 3300009553 Bacteria 1422
438 Ga0105249_10565143 3300009553 Bacteria 1189
439 Ga0105249_10848584 3300009553 Bacteria 979
440 Ga0099796_10133467 3300010159 Bacteria 965
441 Ga0105239_11157276 3300010375 Bacteria 891
442 Ga0105246_10243632 3300011119 Unclassified 1423
443 Ga0105246_10333940 3300011119 Bacteria 1236
444 Ga0157369_10438137 3300013105 Bacteria 1354
445 Ga0157369_10637160 3300013105 Bacteria 1100
446 Ga0157374_10073648 3300013296 Bacteria 3224
447 Ga0157374_10137280 3300013296 Bacteria 2372
448 Ga0157374_10724452 3300013296 Bacteria 1008
449 Ga0157374_10797350 3300013296 Unclassified 960
450 Ga0157374_11022272 3300013296 Bacteria 846
451 Ga0157378_10022752 3300013297 Bacteria 5515
452 Ga0157378_10176847 3300013297 Unclassified 2005
453 Ga0157378_10417251 3300013297 Bacteria 1326
454 Ga0157378_11036782 3300013297 Unclassified 856
455 Ga0163162_10016220 3300013306 Bacteria 7286
456 Ga0163162_10066713 3300013306 Unclassified 3647
457 Ga0163162_10116775 3300013306 Bacteria 2769
458 Ga0163162_10888544 3300013306 Bacteria 1005
459 Ga0157372_10049040 3300013307 Bacteria 4695
460 Ga0157375_10037023 3300013308 Bacteria 4671
461 Ga0157375_10039270 3300013308 Bacteria 4555
462 Ga0157375_10105801 3300013308 Unclassified 2905
463 Ga0157375_10114814 3300013308 Bacteria 2795
464 Ga0157375_10315667 3300013308 Unclassified 1727
465 Ga0157375_10415874 3300013308 Unclassified 1511
466 Ga0157375_10724571 3300013308 Bacteria 1147
467 Ga0163163_10008187 3300014325 Bacteria 9274
468 Ga0163163_10064081 3300014325 Bacteria 3647
469 Ga0163163_10141669 3300014325 Bacteria 2447
470 Ga0163163_10161868 3300014325 Bacteria 2283
471 Ga0163163_10172154 3300014325 Bacteria 2212
472 Ga0163163_10651455 3300014325 Unclassified 1117
473 Ga0163163_10803017 3300014325 Unclassified 1004
474 Ga0163163_11585234 3300014325 Bacteria 716
475 Ga0157380_10007043 3300014326 Bacteria 7959
476 Ga0157380_10007242 3300014326 Bacteria 7868
477 Ga0157380_10020009 3300014326 Bacteria 4996
478 Ga0157380_10029171 3300014326 Bacteria 4216
479 Ga0157380_10032813 3300014326 Bacteria 3996
480 Ga0157380_10033360 3300014326 Bacteria 3964
481 Ga0157380_10101597 3300014326 Unclassified 2396
482 Ga0157380_10181910 3300014326 Bacteria 1848
483 Ga0157380_10255958 3300014326 Bacteria 1587
484 Ga0157380_10333601 3300014326 Bacteria 1411
485 Ga0157380_10847914 3300014326 Bacteria 935
486 Ga0157380_11437255 3300014326 Bacteria 741
487 Ga0157380_11450478 3300014326 Unclassified 738
488 Ga0157377_10071987 3300014745 Bacteria 2000
489 Ga0157377_10079012 3300014745 Bacteria 1919
490 Ga0157377_10149093 3300014745 Bacteria 1445
491 Ga0157379_10061457 3300014968 Bacteria 3359
492 Ga0157379_10132190 3300014968 Unclassified 2247
493 Ga0157379_10191798 3300014968 Unclassified 1847
494 Ga0157376_10030937 3300014969 Bacteria 4280
495 Ga0157376_10135831 3300014969 Bacteria 2201
496 Ga0157376_10211191 3300014969 Bacteria 1792
497 Ga0157376_10764825 3300014969 Bacteria 976
498 Ga0163161_10228014 3300017792 Bacteria 1445
499 Ga0163161_10275678 3300017792 Bacteria 1318
500 Ga0207697_10207741 3300025315 Bacteria 862
501 Ga0207697_10218338 3300025315 Bacteria 841
502 Ga0207697_10294494 3300025315 Unclassified 720
503 Ga0207682_10020244 3300025893 Bacteria 2610
504 Ga0207682_10024986 3300025893 Bacteria 2368
505 Ga0207682_10033667 3300025893 Bacteria 2064
506 Ga0207682_10044246 3300025893 Unclassified 1825
507 Ga0207682_10050727 3300025893 Bacteria 1716
508 Ga0207682_10093653 3300025893 Unclassified 1306
509 Ga0207642_10199493 3300025899 Unclassified 1104
510 Ga0207710_10014741 3300025900 Bacteria 3300
511 Ga0207710_10129473 3300025900 Bacteria 1211
512 Ga0207688_10206070 3300025901 Bacteria 1180
513 Ga0207680_10028210 3300025903 Bacteria 3137
514 Ga0207685_10082999 3300025905 Bacteria 1331
515 Ga0207685_10373292 3300025905 Bacteria 725
516 Ga0207699_10630156 3300025906 Unclassified 782
517 Ga0207645_10007668 3300025907 Bacteria 7605
518 Ga0207645_10011896 3300025907 Bacteria 5923
519 Ga0207645_10040123 3300025907 Bacteria 2998
520 Ga0207643_10001728 3300025908 Bacteria 12251
521 Ga0207643_10044587 3300025908 Bacteria 2504
522 Ga0207643_10082892 3300025908 Unclassified 1860
523 Ga0207643_10096537 3300025908 Bacteria 1729
524 Ga0207643_10553618 3300025908 Bacteria 738
525 Ga0207705_10275185 3300025909 Bacteria 1288
526 Ga0207654_10559184 3300025911 Unclassified 813
527 Ga0207654_10692403 3300025911 Unclassified 732
528 Ga0207707_10020033 3300025912 Bacteria 5836
529 Ga0207695_10241621 3300025913 Bacteria 1707
530 Ga0207695_10264471 3300025913 Bacteria 1617
531 Ga0207695_10349698 3300025913 Bacteria 1365
532 Ga0207671_10458016 3300025914 Bacteria 1016
533 Ga0207663_10292152 3300025916 Bacteria 1214
534 Ga0207660_10044291 3300025917 Unclassified 3130
535 Ga0207660_10224251 3300025917 Bacteria 1476
536 Ga0207662_10155695 3300025918 Bacteria 1457
537 Ga0207662_10163062 3300025918 Unclassified 1425
538 Ga0207657_10010775 3300025919 Bacteria 9101
539 Ga0207657_10078645 3300025919 Bacteria 2776
540 Ga0207649_10075035 3300025920 Bacteria 2172
541 Ga0207649_10290143 3300025920 Unclassified 1193
542 Ga0207649_10302567 3300025920 Bacteria 1170
543 Ga0207649_10558649 3300025920 Bacteria 876
544 Ga0207649_10663449 3300025920 Bacteria 807
545 Ga0207649_10748153 3300025920 Bacteria 760
546 Ga0207652_10526796 3300025921 Bacteria 1063
547 Ga0207652_10854695 3300025921 Bacteria 806
548 Ga0207646_10040520 3300025922 Bacteria 4188
549 Ga0207646_10173549 3300025922 Bacteria 1947
550 Ga0207646_10294867 3300025922 Bacteria 1465
551 Ga0207681_10000756 3300025923 Bacteria 21263
552 Ga0207681_10021826 3300025923 Bacteria 4075
553 Ga0207681_10029186 3300025923 Bacteria 3579
554 Ga0207681_10101063 3300025923 Bacteria 2080
555 Ga0207681_10156482 3300025923 Bacteria 1713
556 Ga0207681_10786602 3300025923 Bacteria 794
557 Ga0207650_10005471 3300025925 Bacteria 8666
558 Ga0207650_10012377 3300025925 Bacteria 5889
559 Ga0207650_10015994 3300025925 Bacteria 5235
560 Ga0207650_10049450 3300025925 Bacteria 3105
561 Ga0207650_10067240 3300025925 Unclassified 2689
562 Ga0207650_10097987 3300025925 Bacteria 2252
563 Ga0207650_10281237 3300025925 Bacteria 1355
564 Ga0207659_10000409 3300025926 Bacteria 25882
565 Ga0207659_10000513 3300025926 Bacteria 23245
566 Ga0207659_10003283 3300025926 Bacteria 9683
567 Ga0207659_10005650 3300025926 Bacteria 7606
568 Ga0207659_10010073 3300025926 Bacteria 5922
569 Ga0207659_10013773 3300025926 Bacteria 5194
570 Ga0207659_10016409 3300025926 Bacteria 4819
571 Ga0207659_10017472 3300025926 Bacteria 4687
572 Ga0207659_10103874 3300025926 Bacteria 2148
573 Ga0207659_10129884 3300025926 Bacteria 1943
574 Ga0207659_10182717 3300025926 Bacteria 1663
575 Ga0207659_10185450 3300025926 Unclassified 1652
576 Ga0207659_10211459 3300025926 Bacteria 1555
577 Ga0207659_10515849 3300025926 Bacteria 1013
578 Ga0207659_10557365 3300025926 Bacteria 975
579 Ga0207659_10668632 3300025926 Bacteria 888
580 Ga0207659_10943730 3300025926 Bacteria 742
581 Ga0207687_10013584 3300025927 Bacteria 5315
582 Ga0207644_10003875 3300025931 Bacteria 9697
583 Ga0207644_10424761 3300025931 Unclassified 1089
584 Ga0207690_10050487 3300025932 Bacteria 2777
585 Ga0207690_10063477 3300025932 Bacteria 2519
586 Ga0207690_10126066 3300025932 Bacteria 1867
587 Ga0207690_10141498 3300025932 Bacteria 1773
588 Ga0207706_10045496 3300025933 Bacteria 3888
589 Ga0207706_10124840 3300025933 Bacteria 2264
590 Ga0207706_10188941 3300025933 Bacteria 1808
591 Ga0207706_10255640 3300025933 Bacteria 1530
592 Ga0207686_10009864 3300025934 Bacteria 5190
593 Ga0207686_10015014 3300025934 Bacteria 4323
594 Ga0207686_10032771 3300025934 Bacteria 3095
595 Ga0207686_10104459 3300025934 Bacteria 1898
596 Ga0207709_10017151 3300025935 Bacteria 4037
597 Ga0207709_10038298 3300025935 Bacteria 2854
598 Ga0207670_10130278 3300025936 Bacteria 1842
599 Ga0207670_10348867 3300025936 Bacteria 1171
600 Ga0207670_10451937 3300025936 Bacteria 1036
601 Ga0207670_10614532 3300025936 Bacteria 893
602 Ga0207669_10004345 3300025937 Bacteria 6227
603 Ga0207669_10013720 3300025937 Bacteria 4037
604 Ga0207669_10071499 3300025937 Bacteria 2180
605 Ga0207669_10178532 3300025937 Bacteria 1520
606 Ga0207669_10362125 3300025937 Bacteria 1124
607 Ga0207669_10617516 3300025937 Unclassified 883
608 Ga0207704_10006931 3300025938 Bacteria 5317
609 Ga0207704_10051090 3300025938 Unclassified 2498
610 Ga0207704_10077766 3300025938 Bacteria 2131
611 Ga0207704_10195356 3300025938 Bacteria 1475
612 Ga0207691_10018056 3300025940 Bacteria 6679
613 Ga0207691_10036031 3300025940 Bacteria 4586
614 Ga0207691_10054571 3300025940 Bacteria 3645
615 Ga0207691_10063043 3300025940 Bacteria 3363
616 Ga0207691_10096418 3300025940 Bacteria 2644
617 Ga0207691_10594637 3300025940 Bacteria 937
618 Ga0207711_10099495 3300025941 Bacteria 2571
619 Ga0207711_10123167 3300025941 Bacteria 2317
620 Ga0207711_10175333 3300025941 Bacteria 1947
621 Ga0207711_10365570 3300025941 Bacteria 1337
622 Ga0207711_10401115 3300025941 Bacteria 1274
623 Ga0207711_10426351 3300025941 Bacteria 1234
624 Ga0207711_10500928 3300025941 Bacteria 1132
625 Ga0207689_10022155 3300025942 Bacteria 5342
626 Ga0207689_10032275 3300025942 Bacteria 4357
627 Ga0207689_10082870 3300025942 Bacteria 2637
628 Ga0207689_10144760 3300025942 Unclassified 1958
629 Ga0207689_10234375 3300025942 Bacteria 1517
630 Ga0207689_10306960 3300025942 Bacteria 1315
631 Ga0207689_10958059 3300025942 Bacteria 722
632 Ga0207661_10091475 3300025944 Bacteria 2535
633 Ga0207661_10107876 3300025944 Bacteria 2350
634 Ga0207679_10003570 3300025945 Bacteria 9643
635 Ga0207679_10041171 3300025945 Bacteria 3311
636 Ga0207679_10114887 3300025945 Bacteria 2132
637 Ga0207679_10160297 3300025945 Bacteria 1841
638 Ga0207679_10225006 3300025945 Bacteria 1580
639 Ga0207679_10230612 3300025945 Unclassified 1563
640 Ga0207679_10353814 3300025945 Bacteria 1281
641 Ga0207679_10424532 3300025945 Bacteria 1174
642 Ga0207679_10455577 3300025945 Bacteria 1135
643 Ga0207679_11061698 3300025945 Unclassified 743
644 Ga0207651_10016878 3300025960 Bacteria 4294
645 Ga0207651_10034198 3300025960 Bacteria 3289
646 Ga0207651_10066934 3300025960 Bacteria 2526
647 Ga0207651_10084225 3300025960 Bacteria 2302
648 Ga0207651_10278688 3300025960 Unclassified 1381
649 Ga0207651_10424844 3300025960 Bacteria 1135
650 Ga0207651_10506869 3300025960 Bacteria 1044
651 Ga0207651_10791366 3300025960 Bacteria 840
652 Ga0207651_10937349 3300025960 Bacteria 772
653 Ga0207712_10569187 3300025961 Bacteria 976
654 Ga0207712_10731421 3300025961 Bacteria 866
655 Ga0207712_11056030 3300025961 Unclassified 722
656 Ga0207668_10012282 3300025972 Bacteria 5237
657 Ga0207668_10153201 3300025972 Bacteria 1787
658 Ga0207668_10610821 3300025972 Bacteria 951
659 Ga0207668_11091494 3300025972 Bacteria 715
660 Ga0207640_10026716 3300025981 Bacteria 3509
661 Ga0207640_10364833 3300025981 Bacteria 1165
662 Ga0207640_10881046 3300025981 Bacteria 781
663 Ga0207658_10726242 3300025986 Unclassified 899
664 Ga0207658_10823932 3300025986 Unclassified 843
665 Ga0207677_10002861 3300026023 Bacteria 9105
666 Ga0207677_10215068 3300026023 Bacteria 1538
667 Ga0207677_10460093 3300026023 Unclassified 1092
668 Ga0207677_10478165 3300026023 Bacteria 1073
669 Ga0207677_10679688 3300026023 Unclassified 911
670 Ga0207703_10040018 3300026035 Unclassified 3750
671 Ga0207703_10176325 3300026035 Bacteria 1883
672 Ga0207703_10214382 3300026035 Bacteria 1718
673 Ga0207703_10242614 3300026035 Bacteria 1620
674 Ga0207703_10288209 3300026035 Bacteria 1493
675 Ga0207703_11137731 3300026035 Bacteria 750
676 Ga0207678_10038731 3300026067 Bacteria 4140
677 Ga0207678_10040906 3300026067 Bacteria 4019
678 Ga0207708_10008298 3300026075 Bacteria 7695
679 Ga0207708_10012992 3300026075 Bacteria 6210
680 Ga0207708_10013529 3300026075 Bacteria 6099
681 Ga0207708_10027990 3300026075 Bacteria 4268
682 Ga0207708_10191527 3300026075 Bacteria 1628
683 Ga0207708_10213204 3300026075 Bacteria 1544
684 Ga0207708_10361974 3300026075 Bacteria 1192
685 Ga0207708_10363980 3300026075 Bacteria 1189
686 Ga0207708_10721570 3300026075 Bacteria 853
687 Ga0207641_10063869 3300026088 Bacteria 3146
688 Ga0207641_10103465 3300026088 Bacteria 2512
689 Ga0207641_10329105 3300026088 Bacteria 1451
690 Ga0207641_10701837 3300026088 Bacteria 996
691 Ga0207641_10749245 3300026088 Bacteria 964
692 Ga0207641_10776106 3300026088 Bacteria 947
693 Ga0207641_10906720 3300026088 Unclassified 875
694 Ga0207641_10932211 3300026088 Bacteria 863
695 Ga0207648_10005358 3300026089 Bacteria 12934
696 Ga0207648_10021394 3300026089 Bacteria 5814
697 Ga0207648_10051709 3300026089 Unclassified 3591
698 Ga0207648_10224636 3300026089 Bacteria 1670
699 Ga0207648_10559310 3300026089 Bacteria 1051
700 Ga0207648_10629350 3300026089 Bacteria 991
701 Ga0207648_10862934 3300026089 Bacteria 844
702 Ga0207676_10044169 3300026095 Bacteria 3436
703 Ga0207676_10045314 3300026095 Unclassified 3398
704 Ga0207676_10066774 3300026095 Bacteria 2870
705 Ga0207676_10298155 3300026095 Bacteria 1471
706 Ga0207676_10377934 3300026095 Bacteria 1318
707 Ga0207674_10018254 3300026116 Bacteria 7628
708 Ga0207674_10098679 3300026116 Bacteria 2904
709 Ga0207674_10315662 3300026116 Bacteria 1512
710 Ga0207674_10335576 3300026116 Unclassified 1462
711 Ga0207674_10375557 3300026116 Bacteria 1374
712 Ga0207674_10717865 3300026116 Bacteria 965
713 Ga0207674_10731381 3300026116 Unclassified 955
714 Ga0207674_10739189 3300026116 Bacteria 950
715 Ga0207674_11098619 3300026116 Bacteria 765
716 Ga0207675_100009281 3300026118 Bacteria 9224
717 Ga0207675_100013181 3300026118 Bacteria 7716
718 Ga0207675_100024319 3300026118 Bacteria 5633
719 Ga0207675_100030374 3300026118 Bacteria 5032
720 Ga0207675_100063144 3300026118 Bacteria 3461
721 Ga0207675_100225545 3300026118 Bacteria 1806
722 Ga0207675_100325586 3300026118 Bacteria 1501
723 Ga0207675_100485168 3300026118 Bacteria 1229
724 Ga0207675_100644376 3300026118 Bacteria 1065
725 Ga0207675_100769506 3300026118 Bacteria 975
726 Ga0207683_10009303 3300026121 Bacteria 8372
727 Ga0207683_10031707 3300026121 Bacteria 4588
728 Ga0207683_10086956 3300026121 Bacteria 2779
729 Ga0207683_10097070 3300026121 Bacteria 2628
730 Ga0207683_10107468 3300026121 Bacteria 2496
731 Ga0207683_10458977 3300026121 Bacteria 1175
732 Ga0207683_10827755 3300026121 Bacteria 859
733 Ga0207698_10104729 3300026142 Bacteria 2355
734 Ga0207698_10137347 3300026142 Bacteria 2100
735 Ga0209968_1046996 3300027526 Bacteria 744
736 Ga0209983_1010826 3300027665 Bacteria 1863
737 Ga0209813_10028291 3300027866 Bacteria 1634
738 Ga0209813_10048532 3300027866 Unclassified 1319
739 Ga0209974_10098327 3300027876 Bacteria 1021
740 Ga0207428_10000005 3300027907 Bacteria 520045
741 Ga0207428_10001750 3300027907 Bacteria 22233
742 Ga0207428_10003228 3300027907 Bacteria 15921
743 Ga0207428_10017368 3300027907 Bacteria 6176
744 Ga0207428_10052854 3300027907 Bacteria 3242
745 Ga0207428_10054851 3300027907 Bacteria 3172
746 Ga0207428_10114987 3300027907 Unclassified 2067
747 Ga0207428_10158267 3300027907 Unclassified 1721
748 Ga0207428_10401111 3300027907 Bacteria 1004
749 Ga0207428_10526336 3300027907 Bacteria 857
750 Ga0207428_10690013 3300027907 Unclassified 731
751 Ga0207428_10875067 3300027907 Unclassified 635
752 Ga0268266_10104974 3300028379 Bacteria 2495
753 Ga0268266_10424427 3300028379 Bacteria 1260
754 Ga0268266_10614165 3300028379 Bacteria 1045
755 Ga0268266_10993686 3300028379 Bacteria 812
756 Ga0268265_10003302 3300028380 Bacteria 11687
757 Ga0268265_10190128 3300028380 Bacteria 1772
758 Ga0268265_10219725 3300028380 Bacteria 1662
759 Ga0268265_10537291 3300028380 Unclassified 1108
760 Ga0268265_10578297 3300028380 Bacteria 1070
761 Ga0268265_10743750 3300028380 Bacteria 951
762 Ga0268265_10995128 3300028380 Unclassified 828
763 Ga0268265_11165222 3300028380 Bacteria 767
764 Ga0268265_11185428 3300028380 Bacteria 761
765 Ga0268264_10037653 3300028381 Unclassified 3988
766 Ga0268264_10051401 3300028381 Bacteria 3434
767 Ga0268264_10127903 3300028381 Bacteria 2248
768 Ga0268264_10130465 3300028381 Bacteria 2227
769 Ga0268264_10186960 3300028381 Bacteria 1885
770 Ga0268264_10618469 3300028381 Bacteria 1069
771 Ga0268264_11047701 3300028381 Bacteria 823
772 Ga0268264_11132106 3300028381 Bacteria 791
773 Ga0307408_100004250 3300031548 Bacteria 9748
774 Ga0307408_100006478 3300031548 Bacteria 7764
775 Ga0307408_100036579 3300031548 Unclassified 3452
776 Ga0307408_100265581 3300031548 Bacteria 1422
777 Ga0307408_100755701 3300031548 Bacteria 879
778 Ga0307408_101260422 3300031548 Unclassified 692
779 Ga0307405_10013016 3300031731 Bacteria 4426
780 Ga0307405_10015440 3300031731 Bacteria 4138
781 Ga0307405_10146861 3300031731 Bacteria 1653
782 Ga0307405_10227469 3300031731 Bacteria 1373
783 Ga0307405_10618894 3300031731 Bacteria 886
784 Ga0307413_10010520 3300031824 Bacteria 4493
785 Ga0307413_10037784 3300031824 Bacteria 2792
786 Ga0307413_10039615 3300031824 Unclassified 2742
787 Ga0307413_10064617 3300031824 Bacteria 2275
788 Ga0307410_10004623 3300031852 Bacteria 7147
789 Ga0307410_10009540 3300031852 Bacteria 5449
790 Ga0307410_10016025 3300031852 Bacteria 4458
791 Ga0307410_10134811 3300031852 Bacteria 1819
792 Ga0307410_10143576 3300031852 Bacteria 1769
793 Ga0307410_10162398 3300031852 Bacteria 1675
794 Ga0307410_10231154 3300031852 Bacteria 1428
795 Ga0307410_10462601 3300031852 Bacteria 1037
796 Ga0307406_10477061 3300031901 Bacteria 1006
797 Ga0307407_10004563 3300031903 Bacteria 5900
798 Ga0307407_10013909 3300031903 Bacteria 3922
799 Ga0307407_10128071 3300031903 Bacteria 1620
800 Ga0307407_10290328 3300031903 Bacteria 1136
801 Ga0307407_10389301 3300031903 Bacteria 997
802 Ga0307407_10456996 3300031903 Unclassified 928
803 Ga0307407_10664808 3300031903 Bacteria 782
804 Ga0307412_10018902 3300031911 Bacteria 4159
805 Ga0307412_10109155 3300031911 Bacteria 1972
806 Ga0307412_10201356 3300031911 Bacteria 1512
807 Ga0307412_10637560 3300031911 Unclassified 907
808 Ga0307412_10778925 3300031911 Bacteria 828
809 Ga0307409_100002144 3300031995 Bacteria 10172
810 Ga0307409_100002231 3300031995 Bacteria 10011
811 Ga0307409_100070415 3300031995 Unclassified 2776
812 Ga0307409_100081202 3300031995 Bacteria 2620
813 Ga0307409_100408480 3300031995 Bacteria 1299
814 Ga0307409_100786781 3300031995 Bacteria 958
815 Ga0307416_100005008 3300032002 Bacteria 8078
816 Ga0307416_100016375 3300032002 Bacteria 5152
817 Ga0307416_100103426 3300032002 Bacteria 2486
818 Ga0307416_100186601 3300032002 Bacteria 1950
819 Ga0307416_100219732 3300032002 Unclassified 1821
820 Ga0307416_100282991 3300032002 Bacteria 1636
821 Ga0307416_100329883 3300032002 Eukaryota 1533
822 Ga0307416_100470462 3300032002 Bacteria 1314
823 Ga0307416_100676921 3300032002 Bacteria 1119
824 Ga0307416_101145839 3300032002 Bacteria 883
825 Ga0307416_102341925 3300032002 Unclassified 634
826 Ga0307414_10072250 3300032004 Bacteria 2492
827 Ga0307414_10296987 3300032004 Bacteria 1365
828 Ga0307414_10431664 3300032004 Bacteria 1151
829 Ga0307414_10517168 3300032004 Bacteria 1059
830 Ga0307411_10005476 3300032005 Bacteria 6242
831 Ga0307411_10023444 3300032005 Bacteria 3657
832 Ga0307411_10052135 3300032005 Unclassified 2673
833 Ga0307411_10053933 3300032005 Bacteria 2637
834 Ga0307411_10230730 3300032005 Bacteria 1442
835 Ga0307411_10288866 3300032005 Bacteria 1309
836 Ga0307411_10567235 3300032005 Bacteria 971
837 Ga0307411_10616614 3300032005 Bacteria 935
838 Ga0307411_10729614 3300032005 Bacteria 866
839 Ga0307415_100007677 3300032126 Bacteria 5921
840 Ga0307415_100044824 3300032126 Bacteria 2960
841 Ga0373934_0000918 3300035086 Bacteria 10639
842 Ga0373949_0011364 3300035090 Unclassified 1960
843 Ga0373936_0030634 3300035113 Unclassified 2122
844 Ga0373953_0096192 3300035117 Bacteria 1243
845 Ga0373953_0133170 3300035117 Bacteria 1061
846 Ga0373954_0048663 3300035118 Bacteria 1987
847 Ga0373957_0060365 3300035120 Bacteria 1468
848 Ga0373960_0042849 3300035121 Unclassified 1316
849 Ga0373943_0038346 3300035170 Bacteria 2303
850 Ga0373943_0203025 3300035170 Bacteria 1098
851 Ga0373943_0386935 3300035170 Bacteria 806
852 Ga0373955_0058307 3300035172 Bacteria 2124
853 Ga0373955_0565682 3300035172 Bacteria 696
854 Ga0373924_0101386 3300035410 Bacteria 1239
855 Ga0373924_0124735 3300035410 Unclassified 1119
856 Ga0373935_0067249 3300035692 Bacteria 2304
857 Ga0373927_0041386 3300035695 Unclassified 2989
858 Ga0373933_0001130 3300035724 Bacteria 15852
859 Ga0373947_0397626 3300035725 Bacteria 929
860 Ga0373937_0000083 3300036401 Bacteria 87777
861 Ga0373937_0036079 3300036401 Bacteria 4504
862 Ga0373937_0161274 3300036401 Bacteria 2102
863 Ga0373937_1553487 3300036401 Bacteria 609
864 Ga0316584_0222358 3300036712 Bacteria 1386
865 Ga0373925_0067230 3300037068 Unclassified 2703
866 Ga0373925_0247155 3300037068 Bacteria 1430
867 Ga0439436_0141862 3300041404 Bacteria 676
868 Ga0451853_0010312 3300041512 Bacteria 2725
869 Ga0439433_0064301 3300041999 Bacteria 878
870 Ga0439450_000957 3300042008 Bacteria 4030
871 Ga0450920_038846 3300042122 Unclassified 947
872 Ga0450897_022744 3300042128 Bacteria 679
873 Ga0450895_002860 3300042132 Bacteria 1309
874 Ga0450896_000626 3300042133 Bacteria 3842
875 Ga0450896_011104 3300042133 Bacteria 1267
876 Ga0450906_035628 3300042145 Bacteria 878
877 Ga0450909_048208 3300042185 Bacteria 662
878 Ga0439434_0036285 3300042435 Bacteria 1508
879 Ga0439444_0043592 3300042437 Bacteria 890
880 Ga0439464_0006201 3300042439 Bacteria 3109
881 Ga0439460_0119724 3300042461 Bacteria 860
882 Ga0451577_0102030 3300042876 Bacteria 2563
883 Ga0439440_0012961 3300042993 Bacteria 1781
884 Ga0453684_0873337 3300044712 Bacteria 965
885 Ga0451576_0007148 3300045051 Bacteria 13467
886 Ga0451576_0033432 3300045051 Bacteria 5466
887 Ga0451576_0129746 3300045051 Bacteria 2627
888 Ga0451576_0140736 3300045051 Unclassified 2516
889 Ga0451576_0510137 3300045051 Bacteria 1263
890 Ga0466967_0108270 3300045976 Bacteria 2550
891 Ga0495592_0406979 3300046454 Bacteria 860
892 Ga0495603_0014052 3300046455 Bacteria 4840
893 Ga0495603_0346852 3300046455 Bacteria 852
894 Ga0495629_0028814 3300046459 Bacteria 3941
895 Ga0495629_0170023 3300046459 Bacteria 1513
896 Ga0495641_0384394 3300046461 Unclassified 636
897 Ga0495580_0199540 3300046472 Bacteria 1379
898 Ga0495580_0217726 3300046472 Bacteria 1313
899 Ga0495582_0343523 3300046473 Bacteria 859
900 Ga0495639_0013240 3300046475 Bacteria 3559
901 Ga0495639_0221697 3300046475 Bacteria 930
902 Ga0495662_0154867 3300046476 Bacteria 1129
903 Ga0495664_0236581 3300046477 Bacteria 1105
904 Ga0495584_0054738 3300046491 Bacteria 2008
905 Ga0495594_0051038 3300046499 Bacteria 2276
906 Ga0495628_0148886 3300046516 Bacteria 1784
907 Ga0495628_0518648 3300046516 Unclassified 859
908 Ga0495630_0400313 3300046517 Bacteria 1052
909 Ga0495643_0003179 3300046522 Bacteria 12210
910 Ga0495642_0033111 3300046528 Unclassified 2077
911 Ga0495642_0273973 3300046528 Bacteria 739
912 Ga0495652_0421097 3300046529 Bacteria 941
913 Ga0495665_0212170 3300046531 Bacteria 1002
914 Ga0495640_0033415 3300046533 Bacteria 3654
915 Ga0495640_0318794 3300046533 Bacteria 963
916 Ga0495586_0127184 3300046535 Bacteria 1426
917 Ga0495587_0155540 3300046536 Bacteria 1302
918 Ga0495598_0008333 3300046537 Bacteria 2411
919 Ga0495598_0017148 3300046537 Bacteria 1862
920 Ga0495598_0047868 3300046537 Bacteria 1277
921 Ga0495598_0089542 3300046537 Bacteria 1001
922 Ga0495598_0220314 3300046537 Bacteria 692
923 Ga0495609_0048989 3300046538 Bacteria 1887
924 Ga0495609_0297859 3300046538 Bacteria 657
925 Ga0495621_0001907 3300046539 Bacteria 5483
926 Ga0495621_0015600 3300046539 Bacteria 2425
927 Ga0495621_0040796 3300046539 Bacteria 1628
928 Ga0495621_0144124 3300046539 Bacteria 934
929 Ga0495621_0149387 3300046539 Bacteria 918
930 Ga0495645_0009657 3300046543 Bacteria 6748
931 Ga0495656_0140684 3300046615 Bacteria 1157
932 Ga0495656_0394304 3300046615 Unclassified 723
933 Ga0495656_0452390 3300046615 Bacteria 677
934 Ga0495668_0177019 3300046616 Bacteria 1169
935 Ga0495635_0072809 3300046663 Bacteria 2354
936 Ga0495635_0188921 3300046663 Bacteria 1399
937 Ga0495659_0004537 3300046664 Bacteria 4369
938 Ga0495659_0012739 3300046664 Bacteria 2730
939 Ga0495659_0078569 3300046664 Bacteria 1248
940 Ga0495588_0058591 3300046674 Bacteria 1991
941 Ga0495588_0158426 3300046674 Bacteria 1197
942 Ga0495623_0149303 3300046679 Bacteria 1383
943 Ga0495623_0251692 3300046679 Bacteria 993
944 Ga0495647_0009902 3300046681 Unclassified 3238
945 Ga0495647_0099079 3300046681 Bacteria 1205
946 Ga0495647_0193004 3300046681 Unclassified 890
947 Ga0495658_0278279 3300046683 Unclassified 1056
948 Ga0495658_0436660 3300046683 Bacteria 836
949 Ga0495669_0002286 3300046684 Bacteria 7861
950 Ga0495613_0246672 3300046689 Bacteria 1247
951 Ga0495670_0007169 3300046691 Bacteria 5490
952 Ga0495600_0265198 3300046809 Bacteria 1090
953 Ga0495581_0099289 3300047315 Bacteria 1691
954 Ga0495674_0308050 3300047319 Bacteria 1292
955 Ga0495676_0014331 3300047321 Bacteria 7095
956 Ga0495680_0097754 3300047322 Bacteria 2191
957 Ga0495677_0039201 3300047445 Bacteria 1732
958 Ga0495684_0015254 3300047471 Bacteria 5919
959 Ga0495684_0220345 3300047471 Bacteria 1391
960 Ga0495614_0150986 3300048089 Unclassified 1036
961 Ga0496100_0004889 3300048903 Bacteria 7162
962 Ga0496101_0000392 3300048904 Bacteria 28631
963 Ga0496101_0744132 3300048904 Unclassified 774
964 Ga0496102_0156910 3300048905 Unclassified 2139
965 Ga0496102_0484326 3300048905 Bacteria 1159
966 Ga0496104_0034339 3300048907 Bacteria 4729
967 Ga0496104_0228362 3300048907 Bacteria 1773
968 Ga0496104_0310778 3300048907 Bacteria 1489
969 Ga0496104_0550446 3300048907 Bacteria 1065
970 Ga0496105_0448886 3300048908 Bacteria 1018
971 Ga0496106_0017422 3300048909 Bacteria 5316
972 Ga0496106_0112062 3300048909 Unclassified 2125
973 Ga0496106_0256561 3300048909 Bacteria 1399
974 Ga0496106_0838972 3300048909 Bacteria 728
975 Ga0496106_0893303 3300048909 Bacteria 702
976 Ga0496107_0383262 3300048910 Bacteria 1046
977 Ga0496107_0446570 3300048910 Bacteria 961
978 Ga0496107_0814942 3300048910 Bacteria 683
979 Ga0496108_0007989 3300048911 Bacteria 8581
980 Ga0496108_0031918 3300048911 Bacteria 4372
981 Ga0496108_0216380 3300048911 Bacteria 1664
982 Ga0496108_0220325 3300048911 Bacteria 1649
983 Ga0496109_0003064 3300048912 Bacteria 13929
984 Ga0496109_0102894 3300048912 Unclassified 2650
985 Ga0496109_0253113 3300048912 Bacteria 1659
986 Ga0496109_0647473 3300048912 Bacteria 994
987 Ga0496110_0244276 3300048913 Bacteria 1634
988 Ga0496110_1173055 3300048913 Unclassified 677
989 Ga0496111_0003513 3300048914 Bacteria 9697
990 Ga0496111_0037609 3300048914 Bacteria 3464
991 Ga0496112_0003499 3300048915 Bacteria 13013
992 Ga0496112_0020608 3300048915 Bacteria 6251
993 Ga0496112_0080929 3300048915 Bacteria 3212
994 Ga0496112_0208490 3300048915 Bacteria 1912
995 Ga0496113_0103063 3300048916 Bacteria 2213
996 Ga0496114_0001759 3300048917 Bacteria 16446
997 Ga0496114_0125508 3300048917 Bacteria 2212
998 Ga0496114_0182003 3300048917 Unclassified 1835
999 Ga0496114_0286784 3300048917 Bacteria 1452
1000 Ga0496115_0146913 3300048918 Bacteria 1946
1001 Ga0501298_056485 3300049521 Bacteria 823
1002 Ga0501299_016147 3300049522 Bacteria 1319
1003 Ga0501032_0019408 3300049569 Bacteria 4756
1004 Ga0501032_0063552 3300049569 Unclassified 2471
1005 Ga0501033_0000480 3300049570 Bacteria 37720
1006 Ga0501033_0000783 3300049570 Bacteria 29163
1007 Ga0501034_0028254 3300049571 Bacteria 5706
1008 Ga0501034_0133595 3300049571 Bacteria 2463
1009 Ga0501034_0182104 3300049571 Bacteria 2065
1010 Ga0501036_0012626 3300049572 Bacteria 7006
1011 Ga0501036_0015332 3300049572 Bacteria 6401
1012 Ga0501036_0023278 3300049572 Bacteria 5217
1013 Ga0501036_0065726 3300049572 Bacteria 3069
1014 Ga0501037_0003977 3300049573 Bacteria 10720
1015 Ga0501037_0013596 3300049573 Bacteria 5996
1016 Ga0501037_0087597 3300049573 Bacteria 2254
1017 Ga0501037_0427652 3300049573 Bacteria 906
1018 Ga0501038_0049005 3300049574 Bacteria 3653
1019 Ga0501038_0524690 3300049574 Bacteria 903
1020 Ga0501038_0766764 3300049574 Unclassified 719
1021 Ga0501039_0008819 3300049575 Bacteria 7683
1022 Ga0501040_0027964 3300049576 Bacteria 3799
1023 Ga0501040_0063708 3300049576 Unclassified 2537
1024 Ga0501040_0074359 3300049576 Bacteria 2348
1025 Ga0501040_0387610 3300049576 Bacteria 1003
1026 Ga0501041_0015430 3300049577 Bacteria 4535
1027 Ga0501041_0030673 3300049577 Bacteria 3246
1028 Ga0501042_0457083 3300049578 Unclassified 926
1029 Ga0501043_0001669 3300049579 Bacteria 19289
1030 Ga0501043_0007233 3300049579 Bacteria 8815
1031 Ga0501043_0223163 3300049579 Bacteria 1457
1032 Ga0501043_0430174 3300049579 Bacteria 994
1033 Ga0501046_0089597 3300049580 Bacteria 2367
1034 Ga0501046_0101731 3300049580 Bacteria 2204
1035 Ga0501047_0001616 3300049581 Bacteria 21973
1036 Ga0501047_0196905 3300049581 Bacteria 1877
1037 Ga0501047_0284390 3300049581 Bacteria 1498
1038 Ga0501048_0015624 3300049582 Bacteria 5603
1039 Ga0501048_0287957 3300049582 Unclassified 1168
1040 Ga0501067_0013667 3300049583 Bacteria 4496
1041 Ga0501068_0041739 3300049584 Unclassified 2757
1042 Ga0501068_0115348 3300049584 Bacteria 1672
1043 Ga0501069_0001312 3300049585 Bacteria 12179
1044 Ga0501070_0007532 3300049586 Bacteria 9248
1045 Ga0501070_0040647 3300049586 Bacteria 3877
1046 Ga0501071_0014307 3300049587 Bacteria 5428
1047 Ga0501071_0054074 3300049587 Bacteria 2897
1048 Ga0501071_0150040 3300049587 Bacteria 1739
1049 Ga0501072_0002240 3300049588 Bacteria 14436
1050 Ga0501072_0028185 3300049588 Unclassified 4384
1051 Ga0501072_0034883 3300049588 Bacteria 3942
1052 Ga0501073_0003545 3300049589 Bacteria 11719
1053 Ga0501073_0023361 3300049589 Bacteria 4439
1054 Ga0501074_0019250 3300049590 Bacteria 4958
1055 Ga0501074_0110284 3300049590 Bacteria 1969
1056 Ga0501074_0157503 3300049590 Unclassified 1622
1057 Ga0501074_0278004 3300049590 Bacteria 1190
1058 Ga0501075_0010824 3300049591 Bacteria 6429
1059 Ga0501075_0014970 3300049591 Bacteria 5564
1060 Ga0501075_0143636 3300049591 Bacteria 1819
1061 Ga0501075_0309652 3300049591 Bacteria 1203
1062 Ga0501076_0124728 3300049592 Bacteria 2086
1063 Ga0501076_0127564 3300049592 Unclassified 2062
1064 Ga0501076_0131795 3300049592 Bacteria 2027
1065 Ga0501076_0144293 3300049592 Bacteria 1935
1066 Ga0501076_0298687 3300049592 Bacteria 1320
1067 Ga0501076_0748264 3300049592 Bacteria 807
1068 Ga0501076_0959580 3300049592 Bacteria 705
1069 Ga0501233_111584 3300049668 Bacteria 732
1070 Ga0501235_075539 3300049669 Bacteria 801
1071 Ga0501079_0000682 3300049741 Bacteria 22753
1072 Ga0501079_0010677 3300049741 Bacteria 6993
1073 Ga0501079_0051070 3300049741 Unclassified 3191
1074 Ga0501079_0147808 3300049741 Bacteria 1832
1075 Ga0501079_0674990 3300049741 Bacteria 813
1076 Ga0501080_0135097 3300049742 Bacteria 2283
1077 Ga0501080_0140087 3300049742 Bacteria 2236
1078 Ga0501081_0015787 3300049743 Unclassified 4986
1079 Ga0501081_0109670 3300049743 Bacteria 1958
1080 Ga0501081_0869483 3300049743 Bacteria 679
1081 Ga0501083_0056006 3300049744 Bacteria 2642
1082 Ga0501083_0344633 3300049744 Bacteria 969
1083 Ga0501283_023022 3300049779 Bacteria 1008
1084 Ga0501035_0001044 3300049822 Bacteria 28962
1085 Ga0501035_0013177 3300049822 Bacteria 7630
1086 Ga0501035_0153241 3300049822 Bacteria 1999
1087 Ga0501035_0244383 3300049822 Bacteria 1526
1088 Ga0501035_0914949 3300049822 Bacteria 694
1089 Ga0501044_0012248 3300049823 Bacteria 9285
1090 Ga0501044_0189574 3300049823 Bacteria 2019
1091 Ga0501045_0003220 3300049824 Bacteria 11163
1092 Ga0501045_0092833 3300049824 Unclassified 2232
1093 Ga0501045_0169143 3300049824 Bacteria 1628
1094 Ga0501045_0556692 3300049824 Bacteria 850
1095 Ga0501045_0653253 3300049824 Unclassified 777
1096 nmdc:mga03683_10895_c1 3300050489 Bacteria 3271
1097 nmdc:mga00v17_18472_c1 3300050491 Bacteria 3962
1098 nmdc:mga00v17_325879_c1 3300050491 Bacteria 998
1099 nmdc:mga00v17_410873_c1 3300050491 Bacteria 879
1100 nmdc:mga0yw44_361192_c1 3300050492 Bacteria 979
1101 nmdc:mga0k408_114209_c1 3300050493 Bacteria 1597
1102 nmdc:mga0k408_279797_c1 3300050493 Bacteria 996
1103 nmdc:mga06z11_4109_c1 3300050494 Bacteria 5687
1104 nmdc:mga06z11_7404_c1 3300050494 Bacteria 4513
1105 nmdc:mga04h51_3647_c1 3300050495 Bacteria 3763
1106 nmdc:mga04h51_39253_c1 3300050495 Unclassified 1537
1107 nmdc:mga04h51_9962_c1 3300050495 Bacteria 2595
1108 nmdc:mga07m45_76810_c1 3300050496 Bacteria 1904
1109 nmdc:mga05p37_1151644_c1 3300050507 Unclassified 807
1110 nmdc:mga05p37_178572_c1 3300050507 Bacteria 2585
1111 nmdc:mga05p37_218562_c1 3300050507 Unclassified 2301
1112 nmdc:mga05p37_2831_c1 3300050507 Bacteria 20178
1113 nmdc:mga05p37_306490_c1 3300050507 Bacteria 1884
1114 nmdc:mga05p37_36653_c1 3300050507 Bacteria 6015
1115 nmdc:mga05p37_37500_c1 3300050507 Bacteria 5943
1116 nmdc:mga05p37_379642_c1 3300050507 Unclassified 1656
1117 nmdc:mga05p37_4_c1 3300050507 Bacteria 162001
1118 nmdc:mga05p37_59828_c1 3300050507 Bacteria 4691
1119 nmdc:mga05p37_73609_c1 3300050507 Bacteria 4204
1120 nmdc:mga05p37_86132_c1 3300050507 Bacteria 3872
1121 nmdc:mga05p37_87984_c1 3300050507 Bacteria 3829
1122 nmdc:mga09592_135183_c1 3300050508 Bacteria 2123
1123 nmdc:mga09592_2487_c1 3300050508 Bacteria 14893
1124 nmdc:mga09592_2722_c1 3300050508 Bacteria 14293
1125 nmdc:mga09592_284745_c1 3300050508 Bacteria 1433
1126 nmdc:mga09592_286965_c1 3300050508 Bacteria 1427
1127 nmdc:mga09592_336473_c1 3300050508 Bacteria 1307
1128 nmdc:mga09592_37276_c1 3300050508 Bacteria 4078
1129 nmdc:mga09592_383237_c1 3300050508 Bacteria 1216
1130 nmdc:mga09592_4191_c1 3300050508 Bacteria 11647
1131 nmdc:mga09592_421997_c1 3300050508 Bacteria 1152
1132 nmdc:mga09592_868472_c1 3300050508 Bacteria 760
1133 nmdc:mga09592_919838_c1 3300050508 Bacteria 734
1134 nmdc:mga09592_935788_c1 3300050508 Bacteria 727
1135 nmdc:mga0qj67_118594_c1 3300050509 Bacteria 2139
1136 nmdc:mga0qj67_17578_c1 3300050509 Bacteria 5439
1137 nmdc:mga0qj67_235656_c1 3300050509 Bacteria 1485
1138 nmdc:mga0qj67_320330_c1 3300050509 Bacteria 1255
1139 nmdc:mga0qj67_383347_c1 3300050509 Bacteria 1135
1140 nmdc:mga0qj67_43459_c1 3300050509 Bacteria 3539
1141 nmdc:mga0qj67_503988_c1 3300050509 Bacteria 973
1142 nmdc:mga0qj67_879999_c1 3300050509 Bacteria 706
1143 nmdc:mga0qj67_9341_c1 3300050509 Bacteria 7293
1144 nmdc:mga06r32_24407_c1 3300050510 Bacteria 5612
1145 nmdc:mga06r32_277272_c1 3300050510 Bacteria 1664
1146 nmdc:mga06r32_313313_c1 3300050510 Unclassified 1555
1147 nmdc:mga06r32_476792_c1 3300050510 Bacteria 1226
1148 nmdc:mga06r32_68105_c1 3300050510 Bacteria 3438
1149 nmdc:mga06r32_822_c1 3300050510 Bacteria 27490
1150 nmdc:mga08y16_109861_c1 3300050511 Bacteria 2871
1151 nmdc:mga08y16_1173966_c1 3300050511 Unclassified 739
1152 nmdc:mga08y16_122956_c1 3300050511 Bacteria 2700
1153 nmdc:mga08y16_147569_c1 3300050511 Bacteria 2445
1154 nmdc:mga08y16_204494_c1 3300050511 Bacteria 2046
1155 nmdc:mga08y16_28840_c1 3300050511 Bacteria 5851
1156 nmdc:mga08y16_367669_c1 3300050511 Unclassified 1476
1157 nmdc:mga08y16_46672_c1 3300050511 Bacteria 4535
1158 nmdc:mga08y16_475334_c1 3300050511 Bacteria 1272
1159 nmdc:mga08y16_53374_c1 3300050511 Bacteria 4226
1160 nmdc:mga08y16_5558_c1 3300050511 Bacteria 13198
1161 nmdc:mga08y16_5598_c1 3300050511 Bacteria 13165
1162 nmdc:mga08y16_621_c1 3300050511 Bacteria 33126
1163 nmdc:mga08y16_665092_c1 3300050511 Bacteria 1044
1164 nmdc:mga08y16_887_c1 3300050511 Bacteria 28853
1165 nmdc:mga08y16_928407_c1 3300050511 Unclassified 855
1166 nmdc:mga08y16_9_c1 3300050511 Bacteria 566088
1167 nmdc:mga0n895_199626_c1 3300050512 Bacteria 2031
1168 nmdc:mga0n895_284867_c1 3300050512 Bacteria 1675
1169 nmdc:mga0n895_33_c1 3300050512 Bacteria 80749
1170 nmdc:mga0n895_351622_c1 3300050512 Bacteria 1493
1171 nmdc:mga0n895_41360_c1 3300050512 Bacteria 4480
1172 nmdc:mga0n895_469118_c1 3300050512 Bacteria 1270
1173 nmdc:mga0n895_54022_c1 3300050512 Unclassified 2968
1174 nmdc:mga0n895_608294_c1 3300050512 Bacteria 1095
1175 nmdc:mga0n895_913791_c1 3300050512 Bacteria 863
1176 nmdc:mga0n895_97357_c1 3300050512 Unclassified 2948
1177 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
1178 nmdc:mga0rr50_228602_c1 3300050513 Bacteria 1538
1179 nmdc:mga0rr50_253904_c1 3300050513 Bacteria 1461
1180 nmdc:mga0rr50_25583_c1 3300050513 Bacteria 4106
1181 nmdc:mga0rr50_313564_c1 3300050513 Bacteria 1314
1182 nmdc:mga0rr50_642210_c1 3300050513 Bacteria 905
1183 nmdc:mga0rr50_67491_c1 3300050513 Bacteria 2717
1184 nmdc:mga0rr50_927665_c1 3300050513 Unclassified 742
1185 nmdc:mga08x19_125637_c1 3300050514 Bacteria 1723
1186 nmdc:mga08x19_396_c1 3300050514 Bacteria 30660
1187 nmdc:mga08x19_577491_c1 3300050514 Bacteria 796
1188 nmdc:mga0a205_1025002_c1 3300050515 Unclassified 672
1189 nmdc:mga0a205_153991_c1 3300050515 Bacteria 2198
1190 nmdc:mga0a205_165805_c1 3300050515 Bacteria 2105
1191 nmdc:mga0a205_191575_c1 3300050515 Bacteria 1937
1192 nmdc:mga0a205_19714_c1 3300050515 Bacteria 6363
1193 nmdc:mga0a205_237271_c1 3300050515 Bacteria 1705
1194 nmdc:mga0a205_506387_c1 3300050515 Unclassified 1064
1195 nmdc:mga0a205_57403_c2 3300050515 Bacteria 3399
1196 nmdc:mga0a205_659595_c1 3300050515 Bacteria 897
1197 nmdc:mga0a205_99588_c1 3300050515 Unclassified 2805
1198 nmdc:mga0sz30_180233_c1 3300050516 Bacteria 937
1199 Ga0495601_0087356 3300053077 Unclassified 2005
1200 Ga0495601_0170496 3300053077 Bacteria 1423
1201 Ga0495601_0226544 3300053077 Bacteria 1221
1202 Ga0495595_0145016 3300053084 Bacteria 1166
1203 Ga0495619_0050155 3300053085 Unclassified 2754
1204 Ga0495619_0121897 3300053085 Bacteria 1788
1205 Ga0500555_000698 3300053103 Bacteria 12671
1206 Ga0500616_0000929 3300053153 Bacteria 32035
1207 Ga0500645_000218 3300053730 Bacteria 43808
1208 Ga0501084_0003674 3300054114 Bacteria 12448
1209 Ga0501084_0031103 3300054114 Bacteria 4464
1210 Ga0501084_0104714 3300054114 Bacteria 2376
1211 Ga0501084_0181793 3300054114 Bacteria 1775
1212 Ga0501084_0201155 3300054114 Bacteria 1681
1213 Ga0501084_0265009 3300054114 Bacteria 1451
1214 Ga0501084_1029105 3300054114 Bacteria 692
1215 Ga0590071_001796 3300059421 Bacteria 5539
1216 Ga0590071_003839 3300059421 Bacteria 3686
1217 Ga0590075_025742 3300059424 Bacteria 1479
1218 Ga0590077_001530 3300059426 Bacteria 5357
1219 Ga0590077_053087 3300059426 Bacteria 912
1220 Ga0587073_0018495 3300059492 Bacteria 1303
1221 Ga0587099_020165 3300059622 Bacteria 748
1222 Ga0501082_0001932 3300060353 Bacteria 18234
1223 Ga0501082_0061865 3300060353 Unclassified 3222
1224 Ga0501082_0399091 3300060353 Bacteria 1200
1225 Ga0501082_0595025 3300060353 Bacteria 968
1226 Ga0501082_1099091 3300060353 Bacteria 695
1227 Ga0501082_1393389 3300060353 Bacteria 612
1228 Ga0530510_0000783 3300061734 Bacteria 20662
1229 Ga0530510_0032632 3300061734 Bacteria 3747
1230 Ga0530510_0122040 3300061734 Bacteria 1913
1231 Ga0530510_0180136 3300061734 Unclassified 1567
1232 Ga0530510_0198484 3300061734 Bacteria 1490
1233 Ga0496113_0562617
1234 SwRhRL2b_contig_2920398
1235 Ga0065704_10259387
1236 Ga0065712_10015494
1237 Ga0065712_10071965
1238 Ga0065712_10080622
1239 Ga0065712_10132722
1240 Ga0065712_10153009
1241 Ga0065712_10163511
1242 Ga0065712_10204592
1243 Ga0065715_10001388
1244 Ga0065715_10005133
1245 Ga0065715_10030344
1246 Ga0065715_10034951
1247 Ga0065715_10089748
1248 Ga0065715_10113358
1249 Ga0065715_10459578
1250 Ga0065707_10039266
1251 Ga0065707_10102337
1252 Ga0065707_10106835
1253 Ga0065707_10339715
1254 Ga0070676_10002041
1255 Ga0070676_10175860
1256 Ga0070683_100048354
1257 Ga0070683_100489394
1258 Ga0070690_100014974
1259 Ga0070690_100081386
1260 Ga0070690_100097334
1261 Ga0070670_100000862
1262 Ga0070670_100032185
1263 Ga0070670_100041538
1264 Ga0070670_100094479
1265 Ga0070677_10010250
1266 Ga0070677_10265157
1267 Ga0068869_100010634
1268 Ga0068869_100120728
1269 Ga0068869_100152032
1270 Ga0068869_100252576
1271 Ga0068869_100557791
1272 Ga0070666_10051008
1273 Ga0070666_10078007
1274 Ga0070680_100053123
1275 Ga0070682_100150153
1276 Ga0068868_100076959
1277 Ga0068868_100314952
1278 Ga0068868_100940264
1279 Ga0070660_100010573
1280 Ga0070660_100116238
1281 Ga0070660_100917300
1282 Ga0070689_100143459
1283 Ga0070689_100305821
1284 Ga0070687_100019168
1285 Ga0070661_100025411
1286 Ga0070661_100040731
1287 Ga0070692_10148734
1288 Ga0070692_10344806
1289 Ga0070668_100375066
1290 Ga0070668_100724052
1291 Ga0070668_101114271
1292 Ga0070669_100012604
1293 Ga0070669_100020610
1294 Ga0070669_100100041
1295 Ga0070669_100321200
1296 Ga0070669_100354311
1297 Ga0070669_101034197
1298 Ga0070675_100003923
1299 Ga0070675_100004526
1300 Ga0070675_100016505
1301 Ga0070675_100023144
1302 Ga0070675_100023209
1303 Ga0070675_100023283
1304 Ga0070675_100107419
1305 Ga0070675_100168953
1306 Ga0070675_100175070
1307 Ga0070675_100219738
1308 Ga0070675_100292120
1309 Ga0070675_100339578
1310 Ga0070675_100350696
1311 Ga0070675_100485328
1312 Ga0070671_100008412
1313 Ga0070671_100319463
1314 Ga0070671_100654104
1315 Ga0070674_100012704
1316 Ga0070674_100154850
1317 Ga0070674_100196031
1318 Ga0070673_100000594
1319 Ga0070673_100002861
1320 Ga0070673_100020126
1321 Ga0070673_100020405
1322 Ga0070673_100045243
1323 Ga0070673_100279228
1324 Ga0070673_100287676
1325 Ga0070673_100358365
1326 Ga0070673_100379015
1327 Ga0070673_100420605
1328 Ga0070673_100534939
1329 Ga0070688_100001149
1330 Ga0070688_100033507
1331 Ga0070688_100075060
1332 Ga0070688_100162976
1333 Ga0070688_100467497
1334 Ga0070688_100824840
1335 Ga0070659_100086523
1336 Ga0070659_100191601
1337 Ga0070667_100307153
1338 Ga0070709_11061093
1339 Ga0070701_10005840
1340 Ga0070701_10199131
1341 Ga0070701_10565938
1342 Ga0070711_100355964
1343 Ga0070705_100004514
1344 Ga0070705_100015721
1345 Ga0070705_100689893
1346 Ga0070700_100044346
1347 Ga0070700_100197488
1348 Ga0070700_100353289
1349 Ga0070700_100410379
1350 Ga0070694_100010407
1351 Ga0070694_100016670
1352 Ga0070694_100030044
1353 Ga0070678_100018590
1354 Ga0070678_100034957
1355 Ga0070678_100066544
1356 Ga0070662_100159778
1357 Ga0070662_101017605
1358 Ga0070681_10006132
1359 Ga0070681_11168517
1360 Ga0068867_100002836
1361 Ga0068867_100015507
1362 Ga0068867_100038035
1363 Ga0068867_100203244
1364 Ga0068867_100645811
1365 Ga0068867_100707552
1366 Ga0068867_100782903
1367 Ga0070685_10066109
1368 Ga0070685_10616277
1369 Ga0070706_100158336
1370 Ga0070707_100013144
1371 Ga0070707_100113616
1372 Ga0070707_100215782
1373 Ga0070707_100659392
1374 Ga0070698_100004179
1375 Ga0070698_100025407
1376 Ga0070698_100048906
1377 Ga0070698_100050993
1378 Ga0070698_100153168
1379 Ga0070698_100283181
1380 Ga0070698_100284111
1381 Ga0070698_100363070
1382 Ga0070698_100653300
1383 Ga0070698_101074649
1384 Ga0070699_100000371
1385 Ga0070699_100003501
1386 Ga0070699_100004001
1387 Ga0070699_100011447
1388 Ga0070699_100824509
1389 Ga0070684_100188822
1390 Ga0070684_100498779
1391 Ga0070684_100830926
1392 Ga0070697_100108495
1393 Ga0070697_100816995
1394 Ga0070672_100005295
1395 Ga0070672_100005744
1396 Ga0070672_100027238
1397 Ga0070672_100039392
1398 Ga0070672_100138169
1399 Ga0070672_100196074
1400 Ga0070686_100027043
1401 Ga0070686_100075953
1402 Ga0070686_100238708
1403 Ga0070695_100038815
1404 Ga0070695_100145393
1405 Ga0070695_100423155
1406 Ga0070696_100003185
1407 Ga0070696_100023851
1408 Ga0070696_100716222
1409 Ga0070693_100048550
1410 Ga0070693_100629074
1411 Ga0070665_100005947
1412 Ga0070665_100011134
1413 Ga0070665_100368650
1414 Ga0070665_101416440
1415 Ga0070704_100000346
1416 Ga0070704_100040811
1417 Ga0070704_100249066
1418 Ga0070704_100762903
1419 Ga0070704_100845888
1420 Ga0068855_100341281
1421 Ga0070664_100017628
1422 Ga0070664_100025460
1423 Ga0070664_100084982
1424 Ga0070664_100128953
1425 Ga0070664_100659202
1426 Ga0068857_100012311
1427 Ga0068857_100043939
1428 Ga0068857_100272746
1429 Ga0068857_100592997
1430 Ga0068857_100606599
1431 Ga0068857_101033330
1432 Ga0068854_100462175
1433 Ga0070702_100008414
1434 Ga0070702_100026205
1435 Ga0068852_100134299
1436 Ga0068852_100396879
1437 Ga0068859_100001816
1438 Ga0068859_100004547
1439 Ga0068859_100005799
1440 Ga0068859_100159457
1441 Ga0068859_100167031
1442 Ga0068859_100217392
1443 Ga0068859_100223804
1444 Ga0068859_100247775
1445 Ga0068859_100503982
1446 Ga0068864_100015665
1447 Ga0068864_100019802
1448 Ga0068864_100061487
1449 Ga0068864_100179005
1450 Ga0068864_100641768
1451 Ga0068864_100925609
1452 Ga0068866_10027180
1453 Ga0068861_100009661
1454 Ga0068861_100020099
1455 Ga0068861_100031964
1456 Ga0068861_100330194
1457 Ga0068861_100451746
1458 Ga0068861_100522592
1459 Ga0068861_100592524
1460 Ga0068851_10282906
1461 Ga0068870_10001188
1462 Ga0068870_10042551
1463 Ga0068870_10083473
1464 Ga0068870_10203666
1465 Ga0068870_10263692
1466 Ga0068870_10372803
1467 Ga0068863_100096828
1468 Ga0068863_100109132
1469 Ga0068863_100878690
1470 Ga0068858_100010011
1471 Ga0068858_100012037
1472 Ga0068858_100023902
1473 Ga0068858_100126632
1474 Ga0068858_100186017
1475 Ga0068858_100365157
1476 Ga0068858_100528905
1477 Ga0068860_100027562
1478 Ga0068860_100053783
1479 Ga0068860_100206571
1480 Ga0068860_100393511
1481 Ga0068860_101128325
1482 Ga0068860_101364770
1483 Ga0068862_100005365
1484 Ga0068862_100129453
1485 Ga0068862_100549147
1486 Ga0081539_10000013
1487 Ga0081539_10002253
1488 Ga0081539_10010877
1489 Ga0075368_10016977
1490 Ga0075364_10124096
1491 Ga0070715_10137877
1492 Ga0075362_10002569
1493 Ga0075367_10010145
1494 Ga0075367_10157412
1495 Ga0075367_10221341
1496 Ga0075366_10024794
1497 Ga0075366_10037208
1498 Ga0075366_10393483
1499 Ga0097621_100016594
1500 Ga0097621_100020723
1501 Ga0097621_100036626
1502 Ga0097621_100234710
1503 Ga0097621_100327754
1504 Ga0097621_100344110
1505 Ga0097621_100477749
1506 Ga0097621_100544787
1507 Ga0097621_100920871
1508 Ga0075370_10071331
1509 Ga0075370_10108632
1510 Ga0068871_100001178
1511 Ga0068871_100009610
1512 Ga0068871_100028782
1513 Ga0068871_100049815
1514 Ga0068871_100126049
1515 Ga0068871_100341998
1516 Ga0068871_100460936
1517 Ga0075428_100000037
1518 Ga0075428_100011098
1519 Ga0075428_100022955
1520 Ga0075428_100068204
1521 Ga0075428_100105121
1522 Ga0075428_100126168
1523 Ga0075428_100176023
1524 Ga0075428_100282019
1525 Ga0075428_100530720
1526 Ga0075428_101133715
1527 Ga0075430_100009731
1528 Ga0075430_100032869
1529 Ga0075430_100128663
1530 Ga0075430_100195476
1531 Ga0075430_100327706
1532 Ga0075430_100405708
1533 Ga0075431_100041061
1534 Ga0075431_100052788
1535 Ga0075431_100092821
1536 Ga0075431_100349051
1537 Ga0075431_100537462
1538 Ga0075433_10020088
1539 Ga0075433_10053793
1540 Ga0075433_10058259
1541 Ga0075433_10084149
1542 Ga0075433_10132071
1543 Ga0075433_10152559
1544 Ga0075433_10233761
1545 Ga0075433_10349348
1546 Ga0075433_10871347
1547 Ga0075433_10902533
1548 Ga0075434_100000870
1549 Ga0075434_100001875
1550 Ga0075434_100021212
1551 Ga0075434_100025379
1552 Ga0075434_100063349
1553 Ga0075434_100099004
1554 Ga0075434_100101395
1555 Ga0075434_100148405
1556 Ga0075434_100323563
1557 Ga0075434_100541032
1558 Ga0075429_100006566
1559 Ga0075429_100053833
1560 Ga0075429_100077033
1561 Ga0075429_100111114
1562 Ga0075429_100232919
1563 Ga0075429_100345491
1564 Ga0075429_100354269
1565 Ga0075429_100368465
1566 Ga0075429_100729670
1567 Ga0075429_100819425
1568 Ga0068865_100039363
1569 Ga0068865_100053070
1570 Ga0075436_100000567
1571 Ga0075436_100022747
1572 Ga0075436_100032025
1573 Ga0075436_100061700
1574 Ga0097620_100001816
1575 Ga0097620_100004547
1576 Ga0097620_100005799
1577 Ga0097620_100159446
1578 Ga0097620_100167028
1579 Ga0097620_100217403
1580 Ga0097620_100223785
1581 Ga0097620_100247784
1582 Ga0097620_100504009
1583 Ga0097620_100554915
1584 Ga0075435_100000423
1585 Ga0075435_100015398
1586 Ga0075435_100026864
1587 Ga0075435_100137908
1588 Ga0075435_100247736
1589 Ga0075435_100296456
1590 Ga0099795_10289617
1591 Ga0105240_10013601
1592 Ga0105240_10036516
1593 Ga0105240_10040222
1594 Ga0105240_10197028
1595 Ga0111539_10000009
1596 Ga0111539_10000206
1597 Ga0111539_10000596
1598 Ga0111539_10008520
1599 Ga0111539_10010289
1600 Ga0111539_10018231
1601 Ga0111539_10027758
1602 Ga0111539_10031853
1603 Ga0111539_10052880
1604 Ga0111539_10074162
1605 Ga0111539_10224969
1606 Ga0111539_10242963
1607 Ga0111539_10265822
1608 Ga0111539_10368864
1609 Ga0111539_10416819
1610 Ga0111539_10869790
1611 Ga0105245_10013339
1612 Ga0105245_10048962
1613 Ga0105245_11395985
1614 Ga0105245_11595587
1615 Ga0105245_11773646
1616 Ga0105247_10008841
1617 Ga0105247_10112869
1618 Ga0105247_10157459
1619 Ga0114129_10001068
1620 Ga0114129_10003364
1621 Ga0114129_10005094
1622 Ga0114129_10012277
1623 Ga0114129_10013294
1624 Ga0114129_10013964
1625 Ga0114129_10039308
1626 Ga0114129_10054619
1627 Ga0114129_10056323
1628 Ga0114129_10108401
1629 Ga0114129_10151276
1630 Ga0114129_10200932
1631 Ga0114129_10231566
1632 Ga0114129_11033318
1633 Ga0114129_11257483
1634 Ga0114129_11278660
1635 Ga0114129_11627393
1636 Ga0105243_10013296
1637 Ga0105243_10031914
1638 Ga0105243_10149556
1639 Ga0105243_10324235
1640 Ga0105243_11192062
1641 Ga0105242_10004210
1642 Ga0105242_10041300
1643 Ga0105242_10044496
1644 Ga0105242_10132588
1645 Ga0105242_10278737
1646 Ga0105242_11289860
1647 Ga0105248_10002819
1648 Ga0105248_10073705
1649 Ga0105248_10092667
1650 Ga0105248_10203707
1651 Ga0105248_10232229
1652 Ga0105248_10393424
1653 Ga0105248_10396704
1654 Ga0105248_10470034
1655 Ga0105248_10539601
1656 Ga0105248_10654045
1657 Ga0105237_10207013
1658 Ga0105238_10190616
1659 Ga0105238_10689874
1660 Ga0105238_11293882
1661 Ga0105249_10019042
1662 Ga0105249_10026947
1663 Ga0105249_10047858
1664 Ga0105249_10084615
1665 Ga0105249_10132207
1666 Ga0105249_10182942
1667 Ga0105249_10229634
1668 Ga0105249_10323105
1669 Ga0105249_10389117
1670 Ga0105249_10565143
1671 Ga0105249_10848584
1672 Ga0099796_10133467
1673 Ga0105239_11157276
1674 Ga0105246_10243632
1675 Ga0105246_10333940
1676 Ga0157369_10438137
1677 Ga0157369_10637160
1678 Ga0157374_10073648
1679 Ga0157374_10137280
1680 Ga0157374_10724452
1681 Ga0157374_10797350
1682 Ga0157374_11022272
1683 Ga0157378_10022752
1684 Ga0157378_10176847
1685 Ga0157378_10417251
1686 Ga0157378_11036782
1687 Ga0163162_10016220
1688 Ga0163162_10066713
1689 Ga0163162_10116775
1690 Ga0163162_10888544
1691 Ga0157372_10049040
1692 Ga0157375_10037023
1693 Ga0157375_10039270
1694 Ga0157375_10105801
1695 Ga0157375_10114814
1696 Ga0157375_10315667
1697 Ga0157375_10415874
1698 Ga0157375_10724571
1699 Ga0163163_10008187
1700 Ga0163163_10064081
1701 Ga0163163_10141669
1702 Ga0163163_10161868
1703 Ga0163163_10172154
1704 Ga0163163_10651455
1705 Ga0163163_10803017
1706 Ga0163163_11585234
1707 Ga0157380_10007043
1708 Ga0157380_10007242
1709 Ga0157380_10020009
1710 Ga0157380_10029171
1711 Ga0157380_10032813
1712 Ga0157380_10033360
1713 Ga0157380_10101597
1714 Ga0157380_10181910
1715 Ga0157380_10255958
1716 Ga0157380_10333601
1717 Ga0157380_10847914
1718 Ga0157380_11437255
1719 Ga0157380_11450478
1720 Ga0157377_10071987
1721 Ga0157377_10079012
1722 Ga0157377_10149093
1723 Ga0157379_10061457
1724 Ga0157379_10132190
1725 Ga0157379_10191798
1726 Ga0157376_10030937
1727 Ga0157376_10135831
1728 Ga0157376_10211191
1729 Ga0157376_10764825
1730 Ga0163161_10228014
1731 Ga0163161_10275678
1732 Ga0207697_10207741
1733 Ga0207697_10218338
1734 Ga0207697_10294494
1735 Ga0207682_10020244
1736 Ga0207682_10024986
1737 Ga0207682_10033667
1738 Ga0207682_10044246
1739 Ga0207682_10050727
1740 Ga0207682_10093653
1741 Ga0207642_10199493
1742 Ga0207710_10014741
1743 Ga0207710_10129473
1744 Ga0207688_10206070
1745 Ga0207680_10028210
1746 Ga0207685_10082999
1747 Ga0207685_10373292
1748 Ga0207699_10630156
1749 Ga0207645_10007668
1750 Ga0207645_10011896
1751 Ga0207645_10040123
1752 Ga0207643_10001728
1753 Ga0207643_10044587
1754 Ga0207643_10082892
1755 Ga0207643_10096537
1756 Ga0207643_10553618
1757 Ga0207705_10275185
1758 Ga0207654_10559184
1759 Ga0207654_10692403
1760 Ga0207707_10020033
1761 Ga0207695_10241621
1762 Ga0207695_10264471
1763 Ga0207695_10349698
1764 Ga0207671_10458016
1765 Ga0207663_10292152
1766 Ga0207660_10044291
1767 Ga0207660_10224251
1768 Ga0207662_10155695
1769 Ga0207662_10163062
1770 Ga0207657_10010775
1771 Ga0207657_10078645
1772 Ga0207649_10075035
1773 Ga0207649_10290143
1774 Ga0207649_10302567
1775 Ga0207649_10558649
1776 Ga0207649_10663449
1777 Ga0207649_10748153
1778 Ga0207652_10526796
1779 Ga0207652_10854695
1780 Ga0207646_10040520
1781 Ga0207646_10173549
1782 Ga0207646_10294867
1783 Ga0207681_10000756
1784 Ga0207681_10021826
1785 Ga0207681_10029186
1786 Ga0207681_10101063
1787 Ga0207681_10156482
1788 Ga0207681_10786602
1789 Ga0207650_10005471
1790 Ga0207650_10012377
1791 Ga0207650_10015994
1792 Ga0207650_10049450
1793 Ga0207650_10067240
1794 Ga0207650_10097987
1795 Ga0207650_10281237
1796 Ga0207659_10000409
1797 Ga0207659_10000513
1798 Ga0207659_10003283
1799 Ga0207659_10005650
1800 Ga0207659_10010073
1801 Ga0207659_10013773
1802 Ga0207659_10016409
1803 Ga0207659_10017472
1804 Ga0207659_10103874
1805 Ga0207659_10129884
1806 Ga0207659_10182717
1807 Ga0207659_10185450
1808 Ga0207659_10211459
1809 Ga0207659_10515849
1810 Ga0207659_10557365
1811 Ga0207659_10668632
1812 Ga0207659_10943730
1813 Ga0207687_10013584
1814 Ga0207644_10003875
1815 Ga0207644_10424761
1816 Ga0207690_10050487
1817 Ga0207690_10063477
1818 Ga0207690_10126066
1819 Ga0207690_10141498
1820 Ga0207706_10045496
1821 Ga0207706_10124840
1822 Ga0207706_10188941
1823 Ga0207706_10255640
1824 Ga0207686_10009864
1825 Ga0207686_10015014
1826 Ga0207686_10032771
1827 Ga0207686_10104459
1828 Ga0207709_10017151
1829 Ga0207709_10038298
1830 Ga0207670_10130278
1831 Ga0207670_10348867
1832 Ga0207670_10451937
1833 Ga0207670_10614532
1834 Ga0207669_10004345
1835 Ga0207669_10013720
1836 Ga0207669_10071499
1837 Ga0207669_10178532
1838 Ga0207669_10362125
1839 Ga0207669_10617516
1840 Ga0207704_10006931
1841 Ga0207704_10051090
1842 Ga0207704_10077766
1843 Ga0207704_10195356
1844 Ga0207691_10018056
1845 Ga0207691_10036031
1846 Ga0207691_10054571
1847 Ga0207691_10063043
1848 Ga0207691_10096418
1849 Ga0207691_10594637
1850 Ga0207711_10099495
1851 Ga0207711_10123167
1852 Ga0207711_10175333
1853 Ga0207711_10365570
1854 Ga0207711_10401115
1855 Ga0207711_10426351
1856 Ga0207711_10500928
1857 Ga0207689_10022155
1858 Ga0207689_10032275
1859 Ga0207689_10082870
1860 Ga0207689_10144760
1861 Ga0207689_10234375
1862 Ga0207689_10306960
1863 Ga0207689_10958059
1864 Ga0207661_10091475
1865 Ga0207661_10107876
1866 Ga0207679_10003570
1867 Ga0207679_10041171
1868 Ga0207679_10114887
1869 Ga0207679_10160297
1870 Ga0207679_10225006
1871 Ga0207679_10230612
1872 Ga0207679_10353814
1873 Ga0207679_10424532
1874 Ga0207679_10455577
1875 Ga0207679_11061698
1876 Ga0207651_10016878
1877 Ga0207651_10034198
1878 Ga0207651_10066934
1879 Ga0207651_10084225
1880 Ga0207651_10278688
1881 Ga0207651_10424844
1882 Ga0207651_10506869
1883 Ga0207651_10791366
1884 Ga0207651_10937349
1885 Ga0207712_10569187
1886 Ga0207712_10731421
1887 Ga0207712_11056030
1888 Ga0207668_10012282
1889 Ga0207668_10153201
1890 Ga0207668_10610821
1891 Ga0207668_11091494
1892 Ga0207640_10026716
1893 Ga0207640_10364833
1894 Ga0207640_10881046
1895 Ga0207658_10726242
1896 Ga0207658_10823932
1897 Ga0207677_10002861
1898 Ga0207677_10215068
1899 Ga0207677_10460093
1900 Ga0207677_10478165
1901 Ga0207677_10679688
1902 Ga0207703_10040018
1903 Ga0207703_10176325
1904 Ga0207703_10214382
1905 Ga0207703_10242614
1906 Ga0207703_10288209
1907 Ga0207703_11137731
1908 Ga0207678_10038731
1909 Ga0207678_10040906
1910 Ga0207708_10008298
1911 Ga0207708_10012992
1912 Ga0207708_10013529
1913 Ga0207708_10027990
1914 Ga0207708_10191527
1915 Ga0207708_10213204
1916 Ga0207708_10361974
1917 Ga0207708_10363980
1918 Ga0207708_10721570
1919 Ga0207641_10063869
1920 Ga0207641_10103465
1921 Ga0207641_10329105
1922 Ga0207641_10701837
1923 Ga0207641_10749245
1924 Ga0207641_10776106
1925 Ga0207641_10906720
1926 Ga0207641_10932211
1927 Ga0207648_10005358
1928 Ga0207648_10021394
1929 Ga0207648_10051709
1930 Ga0207648_10224636
1931 Ga0207648_10559310
1932 Ga0207648_10629350
1933 Ga0207648_10862934
1934 Ga0207676_10044169
1935 Ga0207676_10045314
1936 Ga0207676_10066774
1937 Ga0207676_10298155
1938 Ga0207676_10377934
1939 Ga0207674_10018254
1940 Ga0207674_10098679
1941 Ga0207674_10315662
1942 Ga0207674_10335576
1943 Ga0207674_10375557
1944 Ga0207674_10717865
1945 Ga0207674_10731381
1946 Ga0207674_10739189
1947 Ga0207674_11098619
1948 Ga0207675_100009281
1949 Ga0207675_100013181
1950 Ga0207675_100024319
1951 Ga0207675_100030374
1952 Ga0207675_100063144
1953 Ga0207675_100225545
1954 Ga0207675_100325586
1955 Ga0207675_100485168
1956 Ga0207675_100644376
1957 Ga0207675_100769506
1958 Ga0207683_10009303
1959 Ga0207683_10031707
1960 Ga0207683_10086956
1961 Ga0207683_10097070
1962 Ga0207683_10107468
1963 Ga0207683_10458977
1964 Ga0207683_10827755
1965 Ga0207698_10104729
1966 Ga0207698_10137347
1967 Ga0209968_1046996
1968 Ga0209983_1010826
1969 Ga0209813_10028291
1970 Ga0209813_10048532
1971 Ga0209974_10098327
1972 Ga0207428_10000005
1973 Ga0207428_10001750
1974 Ga0207428_10003228
1975 Ga0207428_10017368
1976 Ga0207428_10052854
1977 Ga0207428_10054851
1978 Ga0207428_10114987
1979 Ga0207428_10158267
1980 Ga0207428_10401111
1981 Ga0207428_10526336
1982 Ga0207428_10690013
1983 Ga0207428_10875067
1984 Ga0268266_10104974
1985 Ga0268266_10424427
1986 Ga0268266_10614165
1987 Ga0268266_10993686
1988 Ga0268265_10003302
1989 Ga0268265_10190128
1990 Ga0268265_10219725
1991 Ga0268265_10537291
1992 Ga0268265_10578297
1993 Ga0268265_10743750
1994 Ga0268265_10995128
1995 Ga0268265_11165222
1996 Ga0268265_11185428
1997 Ga0268264_10037653
1998 Ga0268264_10051401
1999 Ga0268264_10127903
2000 Ga0268264_10130465
2001 Ga0268264_10186960
2002 Ga0268264_10618469
2003 Ga0268264_11047701
2004 Ga0268264_11132106
2005 Ga0307408_100004250
2006 Ga0307408_100006478
2007 Ga0307408_100036579
2008 Ga0307408_100265581
2009 Ga0307408_100755701
2010 Ga0307408_101260422
2011 Ga0307405_10013016
2012 Ga0307405_10015440
2013 Ga0307405_10146861
2014 Ga0307405_10227469
2015 Ga0307405_10618894
2016 Ga0307413_10010520
2017 Ga0307413_10037784
2018 Ga0307413_10039615
2019 Ga0307413_10064617
2020 Ga0307410_10004623
2021 Ga0307410_10009540
2022 Ga0307410_10016025
2023 Ga0307410_10134811
2024 Ga0307410_10143576
2025 Ga0307410_10162398
2026 Ga0307410_10231154
2027 Ga0307410_10462601
2028 Ga0307406_10477061
2029 Ga0307407_10004563
2030 Ga0307407_10013909
2031 Ga0307407_10128071
2032 Ga0307407_10290328
2033 Ga0307407_10389301
2034 Ga0307407_10456996
2035 Ga0307407_10664808
2036 Ga0307412_10018902
2037 Ga0307412_10109155
2038 Ga0307412_10201356
2039 Ga0307412_10637560
2040 Ga0307412_10778925
2041 Ga0307409_100002144
2042 Ga0307409_100002231
2043 Ga0307409_100070415
2044 Ga0307409_100081202
2045 Ga0307409_100408480
2046 Ga0307409_100786781
2047 Ga0307416_100005008
2048 Ga0307416_100016375
2049 Ga0307416_100103426
2050 Ga0307416_100186601
2051 Ga0307416_100219732
2052 Ga0307416_100282991
2053 Ga0307416_100329883
2054 Ga0307416_100470462
2055 Ga0307416_100676921
2056 Ga0307416_101145839
2057 Ga0307416_102341925
2058 Ga0307414_10072250
2059 Ga0307414_10296987
2060 Ga0307414_10431664
2061 Ga0307414_10517168
2062 Ga0307411_10005476
2063 Ga0307411_10023444
2064 Ga0307411_10052135
2065 Ga0307411_10053933
2066 Ga0307411_10230730
2067 Ga0307411_10288866
2068 Ga0307411_10567235
2069 Ga0307411_10616614
2070 Ga0307411_10729614
2071 Ga0307415_100007677
2072 Ga0307415_100044824
2073 Ga0373934_0000918
2074 Ga0373949_0011364
2075 Ga0373936_0030634
2076 Ga0373953_0096192
2077 Ga0373953_0133170
2078 Ga0373954_0048663
2079 Ga0373957_0060365
2080 Ga0373960_0042849
2081 Ga0373943_0038346
2082 Ga0373943_0203025
2083 Ga0373943_0386935
2084 Ga0373955_0058307
2085 Ga0373955_0565682
2086 Ga0373924_0101386
2087 Ga0373924_0124735
2088 Ga0373935_0067249
2089 Ga0373927_0041386
2090 Ga0373933_0001130
2091 Ga0373947_0397626
2092 Ga0373937_0000083
2093 Ga0373937_0036079
2094 Ga0373937_0161274
2095 Ga0373937_1553487
2096 Ga0316584_0222358
2097 Ga0373925_0067230
2098 Ga0373925_0247155
2099 Ga0439436_0141862
2100 Ga0451853_0010312
2101 Ga0439433_0064301
2102 Ga0439450_000957
2103 Ga0450920_038846
2104 Ga0450897_022744
2105 Ga0450895_002860
2106 Ga0450896_000626
2107 Ga0450896_011104
2108 Ga0450906_035628
2109 Ga0450909_048208
2110 Ga0439434_0036285
2111 Ga0439444_0043592
2112 Ga0439464_0006201
2113 Ga0439460_0119724
2114 Ga0451577_0102030
2115 Ga0439440_0012961
2116 Ga0453684_0873337
2117 Ga0451576_0007148
2118 Ga0451576_0033432
2119 Ga0451576_0129746
2120 Ga0451576_0140736
2121 Ga0451576_0510137
2122 Ga0466967_0108270
2123 Ga0495592_0406979
2124 Ga0495603_0014052
2125 Ga0495603_0346852
2126 Ga0495629_0028814
2127 Ga0495629_0170023
2128 Ga0495641_0384394
2129 Ga0495580_0199540
2130 Ga0495580_0217726
2131 Ga0495582_0343523
2132 Ga0495639_0013240
2133 Ga0495639_0221697
2134 Ga0495662_0154867
2135 Ga0495664_0236581
2136 Ga0495584_0054738
2137 Ga0495594_0051038
2138 Ga0495628_0148886
2139 Ga0495628_0518648
2140 Ga0495630_0400313
2141 Ga0495643_0003179
2142 Ga0495642_0033111
2143 Ga0495642_0273973
2144 Ga0495652_0421097
2145 Ga0495665_0212170
2146 Ga0495640_0033415
2147 Ga0495640_0318794
2148 Ga0495586_0127184
2149 Ga0495587_0155540
2150 Ga0495598_0008333
2151 Ga0495598_0017148
2152 Ga0495598_0047868
2153 Ga0495598_0089542
2154 Ga0495598_0220314
2155 Ga0495609_0048989
2156 Ga0495609_0297859
2157 Ga0495621_0001907
2158 Ga0495621_0015600
2159 Ga0495621_0040796
2160 Ga0495621_0144124
2161 Ga0495621_0149387
2162 Ga0495645_0009657
2163 Ga0495656_0140684
2164 Ga0495656_0394304
2165 Ga0495656_0452390
2166 Ga0495668_0177019
2167 Ga0495635_0072809
2168 Ga0495635_0188921
2169 Ga0495659_0004537
2170 Ga0495659_0012739
2171 Ga0495659_0078569
2172 Ga0495588_0058591
2173 Ga0495588_0158426
2174 Ga0495623_0149303
2175 Ga0495623_0251692
2176 Ga0495647_0009902
2177 Ga0495647_0099079
2178 Ga0495647_0193004
2179 Ga0495658_0278279
2180 Ga0495658_0436660
2181 Ga0495669_0002286
2182 Ga0495613_0246672
2183 Ga0495670_0007169
2184 Ga0495600_0265198
2185 Ga0495581_0099289
2186 Ga0495674_0308050
2187 Ga0495676_0014331
2188 Ga0495680_0097754
2189 Ga0495677_0039201
2190 Ga0495684_0015254
2191 Ga0495684_0220345
2192 Ga0495614_0150986
2193 Ga0496100_0004889
2194 Ga0496101_0000392
2195 Ga0496101_0744132
2196 Ga0496102_0156910
2197 Ga0496102_0484326
2198 Ga0496104_0034339
2199 Ga0496104_0228362
2200 Ga0496104_0310778
2201 Ga0496104_0550446
2202 Ga0496105_0448886
2203 Ga0496106_0017422
2204 Ga0496106_0112062
2205 Ga0496106_0256561
2206 Ga0496106_0838972
2207 Ga0496106_0893303
2208 Ga0496107_0383262
2209 Ga0496107_0446570
2210 Ga0496107_0814942
2211 Ga0496108_0007989
2212 Ga0496108_0031918
2213 Ga0496108_0216380
2214 Ga0496108_0220325
2215 Ga0496109_0003064
2216 Ga0496109_0102894
2217 Ga0496109_0253113
2218 Ga0496109_0647473
2219 Ga0496110_0244276
2220 Ga0496110_1173055
2221 Ga0496111_0003513
2222 Ga0496111_0037609
2223 Ga0496112_0003499
2224 Ga0496112_0020608
2225 Ga0496112_0080929
2226 Ga0496112_0208490
2227 Ga0496113_0103063
2228 Ga0496114_0001759
2229 Ga0496114_0125508
2230 Ga0496114_0182003
2231 Ga0496114_0286784
2232 Ga0496115_0146913
2233 Ga0501298_056485
2234 Ga0501299_016147
2235 Ga0501032_0019408
2236 Ga0501032_0063552
2237 Ga0501033_0000480
2238 Ga0501033_0000783
2239 Ga0501034_0028254
2240 Ga0501034_0133595
2241 Ga0501034_0182104
2242 Ga0501036_0012626
2243 Ga0501036_0015332
2244 Ga0501036_0023278
2245 Ga0501036_0065726
2246 Ga0501037_0003977
2247 Ga0501037_0013596
2248 Ga0501037_0087597
2249 Ga0501037_0427652
2250 Ga0501038_0049005
2251 Ga0501038_0524690
2252 Ga0501038_0766764
2253 Ga0501039_0008819
2254 Ga0501040_0027964
2255 Ga0501040_0063708
2256 Ga0501040_0074359
2257 Ga0501040_0387610
2258 Ga0501041_0015430
2259 Ga0501041_0030673
2260 Ga0501042_0457083
2261 Ga0501043_0001669
2262 Ga0501043_0007233
2263 Ga0501043_0223163
2264 Ga0501043_0430174
2265 Ga0501046_0089597
2266 Ga0501046_0101731
2267 Ga0501047_0001616
2268 Ga0501047_0196905
2269 Ga0501047_0284390
2270 Ga0501048_0015624
2271 Ga0501048_0287957
2272 Ga0501067_0013667
2273 Ga0501068_0041739
2274 Ga0501068_0115348
2275 Ga0501069_0001312
2276 Ga0501070_0007532
2277 Ga0501070_0040647
2278 Ga0501071_0014307
2279 Ga0501071_0054074
2280 Ga0501071_0150040
2281 Ga0501072_0002240
2282 Ga0501072_0028185
2283 Ga0501072_0034883
2284 Ga0501073_0003545
2285 Ga0501073_0023361
2286 Ga0501074_0019250
2287 Ga0501074_0110284
2288 Ga0501074_0157503
2289 Ga0501074_0278004
2290 Ga0501075_0010824
2291 Ga0501075_0014970
2292 Ga0501075_0143636
2293 Ga0501075_0309652
2294 Ga0501076_0124728
2295 Ga0501076_0127564
2296 Ga0501076_0131795
2297 Ga0501076_0144293
2298 Ga0501076_0298687
2299 Ga0501076_0748264
2300 Ga0501076_0959580
2301 Ga0501233_111584
2302 Ga0501235_075539
2303 Ga0501079_0000682
2304 Ga0501079_0010677
2305 Ga0501079_0051070
2306 Ga0501079_0147808
2307 Ga0501079_0674990
2308 Ga0501080_0135097
2309 Ga0501080_0140087
2310 Ga0501081_0015787
2311 Ga0501081_0109670
2312 Ga0501081_0869483
2313 Ga0501083_0056006
2314 Ga0501083_0344633
2315 Ga0501283_023022
2316 Ga0501035_0001044
2317 Ga0501035_0013177
2318 Ga0501035_0153241
2319 Ga0501035_0244383
2320 Ga0501035_0914949
2321 Ga0501044_0012248
2322 Ga0501044_0189574
2323 Ga0501045_0003220
2324 Ga0501045_0092833
2325 Ga0501045_0169143
2326 Ga0501045_0556692
2327 Ga0501045_0653253
2328 nmdc:mga03683_10895_c1
2329 nmdc:mga00v17_18472_c1
2330 nmdc:mga00v17_325879_c1
2331 nmdc:mga00v17_410873_c1
2332 nmdc:mga0yw44_361192_c1
2333 nmdc:mga0k408_114209_c1
2334 nmdc:mga0k408_279797_c1
2335 nmdc:mga06z11_4109_c1
2336 nmdc:mga06z11_7404_c1
2337 nmdc:mga04h51_3647_c1
2338 nmdc:mga04h51_39253_c1
2339 nmdc:mga04h51_9962_c1
2340 nmdc:mga07m45_76810_c1
2341 nmdc:mga05p37_1151644_c1
2342 nmdc:mga05p37_178572_c1
2343 nmdc:mga05p37_218562_c1
2344 nmdc:mga05p37_2831_c1
2345 nmdc:mga05p37_306490_c1
2346 nmdc:mga05p37_36653_c1
2347 nmdc:mga05p37_37500_c1
2348 nmdc:mga05p37_379642_c1
2349 nmdc:mga05p37_4_c1
2350 nmdc:mga05p37_59828_c1
2351 nmdc:mga05p37_73609_c1
2352 nmdc:mga05p37_86132_c1
2353 nmdc:mga05p37_87984_c1
2354 nmdc:mga09592_135183_c1
2355 nmdc:mga09592_2487_c1
2356 nmdc:mga09592_2722_c1
2357 nmdc:mga09592_284745_c1
2358 nmdc:mga09592_286965_c1
2359 nmdc:mga09592_336473_c1
2360 nmdc:mga09592_37276_c1
2361 nmdc:mga09592_383237_c1
2362 nmdc:mga09592_4191_c1
2363 nmdc:mga09592_421997_c1
2364 nmdc:mga09592_868472_c1
2365 nmdc:mga09592_919838_c1
2366 nmdc:mga09592_935788_c1
2367 nmdc:mga0qj67_118594_c1
2368 nmdc:mga0qj67_17578_c1
2369 nmdc:mga0qj67_235656_c1
2370 nmdc:mga0qj67_320330_c1
2371 nmdc:mga0qj67_383347_c1
2372 nmdc:mga0qj67_43459_c1
2373 nmdc:mga0qj67_503988_c1
2374 nmdc:mga0qj67_879999_c1
2375 nmdc:mga0qj67_9341_c1
2376 nmdc:mga06r32_24407_c1
2377 nmdc:mga06r32_277272_c1
2378 nmdc:mga06r32_313313_c1
2379 nmdc:mga06r32_476792_c1
2380 nmdc:mga06r32_68105_c1
2381 nmdc:mga06r32_822_c1
2382 nmdc:mga08y16_109861_c1
2383 nmdc:mga08y16_1173966_c1
2384 nmdc:mga08y16_122956_c1
2385 nmdc:mga08y16_147569_c1
2386 nmdc:mga08y16_204494_c1
2387 nmdc:mga08y16_28840_c1
2388 nmdc:mga08y16_367669_c1
2389 nmdc:mga08y16_46672_c1
2390 nmdc:mga08y16_475334_c1
2391 nmdc:mga08y16_53374_c1
2392 nmdc:mga08y16_5558_c1
2393 nmdc:mga08y16_5598_c1
2394 nmdc:mga08y16_621_c1
2395 nmdc:mga08y16_665092_c1
2396 nmdc:mga08y16_887_c1
2397 nmdc:mga08y16_928407_c1
2398 nmdc:mga08y16_9_c1
2399 nmdc:mga0n895_199626_c1
2400 nmdc:mga0n895_284867_c1
2401 nmdc:mga0n895_33_c1
2402 nmdc:mga0n895_351622_c1
2403 nmdc:mga0n895_41360_c1
2404 nmdc:mga0n895_469118_c1
2405 nmdc:mga0n895_54022_c1
2406 nmdc:mga0n895_608294_c1
2407 nmdc:mga0n895_913791_c1
2408 nmdc:mga0n895_97357_c1
2409 nmdc:mga0rr50_1_c1
2410 nmdc:mga0rr50_228602_c1
2411 nmdc:mga0rr50_253904_c1
2412 nmdc:mga0rr50_25583_c1
2413 nmdc:mga0rr50_313564_c1
2414 nmdc:mga0rr50_642210_c1
2415 nmdc:mga0rr50_67491_c1
2416 nmdc:mga0rr50_927665_c1
2417 nmdc:mga08x19_125637_c1
2418 nmdc:mga08x19_396_c1
2419 nmdc:mga08x19_577491_c1
2420 nmdc:mga0a205_1025002_c1
2421 nmdc:mga0a205_153991_c1
2422 nmdc:mga0a205_165805_c1
2423 nmdc:mga0a205_191575_c1
2424 nmdc:mga0a205_19714_c1
2425 nmdc:mga0a205_237271_c1
2426 nmdc:mga0a205_506387_c1
2427 nmdc:mga0a205_57403_c2
2428 nmdc:mga0a205_659595_c1
2429 nmdc:mga0a205_99588_c1
2430 nmdc:mga0sz30_180233_c1
2431 Ga0495601_0087356
2432 Ga0495601_0170496
2433 Ga0495601_0226544
2434 Ga0495595_0145016
2435 Ga0495619_0050155
2436 Ga0495619_0121897
2437 Ga0500555_000698
2438 Ga0500616_0000929
2439 Ga0500645_000218
2440 Ga0501084_0003674
2441 Ga0501084_0031103
2442 Ga0501084_0104714
2443 Ga0501084_0181793
2444 Ga0501084_0201155
2445 Ga0501084_0265009
2446 Ga0501084_1029105
2447 Ga0590071_001796
2448 Ga0590071_003839
2449 Ga0590075_025742
2450 Ga0590077_001530
2451 Ga0590077_053087
2452 Ga0587073_0018495
2453 Ga0587099_020165
2454 Ga0501082_0001932
2455 Ga0501082_0061865
2456 Ga0501082_0399091
2457 Ga0501082_0595025
2458 Ga0501082_1099091
2459 Ga0501082_1393389
2460 Ga0530510_0000783
2461 Ga0530510_0032632
2462 Ga0530510_0122040
2463 Ga0530510_0180136
2464 Ga0530510_0198484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

179

235

0.99

PF01132

EFP

Elongation factor P (EF-P) OB domain

118

171

0.97

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

51

110

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wxk-assembly1.cif.gz_B earp bound with domain i of ef-p 0.8703 15 67
3tre-assembly1.cif.gz_A structure of a translation elongation factor p (efp) from coxiella burnetii 0.8621 14 131
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.8553 7 64
3a5z-assembly1.cif.gz_B crystal structure of escherichia coli genx in complex with elongation factor p 0.854 7 139
2eif-assembly1.cif.gz_A eukaryotic translation initiation factor 5a from methanococcus jannaschii 0.8364 14 130
ID Description Score Start End Superfamily
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9678 70 131 2.40.50.140
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9553 134 191 2.40.50.140
af_I1L709_116_178_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9541 69 131 2.40.50.140
3huyV03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9399 134 191 2.40.50.140
af_I1L709_116_178_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9399 69 131 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7C6EIA7-F1-model_v4 Elongation factor P 0.9491 6 132 GO:0003746
GO:0005737
AF-A0A2V9NYJ0-F1-model_v4 Elongation factor P 0.9042 7 142 GO:0003746
GO:0005737
AF-A0A7C6EIA7-F1-model_v4 Elongation factor P 0.9002 6 132 GO:0003746
GO:0005737
AF-A0A7X8J8V0-F1-model_v4 Elongation factor P 0.874 7 144 GO:0003746
GO:0005737
AF-A0A496Z6B1-F1-model_v4 Elongation factor P 0.8625 14 147 GO:0003746
GO:0005737

Map