F491919
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1225 | 862 | 667 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0231473|Ga0496121_0231473_338_1114 |
| Length | 258 |
| Sequence | VGLLSQSDGESCGALAFWSKTDHKASHQFRHSKDRPMKAAVIVFPGLNRDRDMIAALTKIGGVAPAVVWHQEADIPDVDLIVIPGGFSYGDYLRCGAIAARSPMMDKVRERAAKGVKVLGVCNGFQILIEAGLLPGALMRNTSLKFVCREVKLEVTNTDNAFTSGYAKGQIIRCPVAHHDGNYFADAETLAALEGDGRVAFRYAEGTNPNGSMNNIAGILNAEKNVLGLMPHPENLIESAHGGVDGRALFAALLDKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 11 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 16 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 20 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 21 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 22 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 23 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 24 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 25 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 26 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 27 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 28 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 29 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 30 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 31 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 32 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 33 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 34 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 35 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 36 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 37 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 38 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 39 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 40 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 41 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 42 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 43 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 44 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 45 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 46 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 47 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 48 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 49 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 50 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 51 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 52 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 53 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 54 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 55 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 56 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 57 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 58 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 59 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 60 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 61 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 62 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 63 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 64 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 65 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 66 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 67 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 68 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 69 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 70 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 71 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 72 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 73 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 74 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 75 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 76 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 77 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 78 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 79 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 80 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 81 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 82 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 83 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 84 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 85 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 86 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 87 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 88 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 89 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 90 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 91 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 92 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 93 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 94 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 95 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 96 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 97 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 98 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 99 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 100 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 101 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 102 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 103 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 104 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 105 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 106 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 107 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 108 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 109 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 110 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 111 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 112 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 113 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 114 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 115 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 116 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 117 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 118 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 119 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 120 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 121 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 122 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 123 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 124 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 125 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 126 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 127 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 128 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 129 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 130 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 131 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 132 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 133 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 134 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 135 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 136 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 137 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 138 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 139 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 140 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 141 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 142 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 143 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 144 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 145 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 146 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 147 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 148 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 149 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 150 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 151 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 152 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 153 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 154 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 155 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 156 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 157 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 158 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 159 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 160 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 161 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 162 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 163 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 164 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 165 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 166 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 167 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 168 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 169 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 170 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 171 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 172 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 173 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 174 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 175 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 176 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 177 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 178 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 179 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 180 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 181 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 182 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 183 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 184 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 185 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 186 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 187 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 188 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 189 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 190 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 191 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 192 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 193 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 194 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 195 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 196 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 197 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 198 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 199 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 200 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 201 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 202 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 203 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 204 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 205 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 206 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 207 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 208 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 209 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 210 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 211 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 212 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 213 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 214 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 215 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 216 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 217 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 218 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 219 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 220 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 221 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 222 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 223 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 224 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 225 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 226 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 227 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 228 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 229 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 230 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 231 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 232 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 233 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 234 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 235 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 236 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 237 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 238 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 239 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 240 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 241 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 242 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 243 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 244 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 245 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 246 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 247 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 248 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 249 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 250 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 251 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 252 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 253 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 254 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 255 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 256 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 257 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 258 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 259 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 260 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 261 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 262 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 263 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 264 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 265 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 266 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 267 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 268 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 269 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 270 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 271 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 272 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 273 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 274 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 275 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 276 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 277 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 278 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 279 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 280 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 281 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 282 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 283 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 284 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 285 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 286 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 287 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 288 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 289 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 290 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 291 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 292 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 293 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 294 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 295 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 296 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 297 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 298 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 299 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 300 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 301 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 302 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 303 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 304 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 305 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 306 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 307 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 308 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 309 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 310 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 311 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 312 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 313 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 314 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 315 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 316 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 317 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 318 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 319 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 320 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 321 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 322 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 323 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 324 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 325 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 326 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 327 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 328 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 329 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 330 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 331 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 332 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 333 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 334 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 335 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 336 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 337 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 338 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 339 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 340 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 341 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 342 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 343 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 344 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 345 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 346 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 347 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 348 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 349 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 350 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 351 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 352 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 353 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 354 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 355 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 356 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 357 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 358 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 359 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 360 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 361 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 362 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 363 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 364 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 365 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 366 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 367 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 368 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 369 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 370 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 371 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 372 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 373 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 374 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 375 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 376 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 377 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 378 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 379 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 380 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 381 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 382 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 383 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 384 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 385 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 386 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 387 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 388 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 389 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 390 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 391 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 392 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 393 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 394 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 395 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 396 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 397 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 398 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 399 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 400 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 401 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 402 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 403 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 404 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 405 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 406 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 407 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 408 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 409 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 410 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 411 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 412 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 413 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 414 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 415 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 416 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 417 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 418 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 419 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 420 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 421 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 422 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 423 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 424 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 425 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 426 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 427 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 428 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 429 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 430 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 431 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 432 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 433 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 434 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 435 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 436 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 437 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 438 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 439 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 440 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 441 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 442 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 443 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 444 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 445 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 446 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 447 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 448 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 449 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 450 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 451 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 452 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 453 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 454 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 455 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 456 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 457 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 458 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 459 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 460 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 461 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 462 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 463 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 464 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 465 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 466 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 467 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 468 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 469 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 470 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 471 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 472 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 473 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 474 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 475 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 476 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 477 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 478 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 479 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 480 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 481 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 482 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 483 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 484 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 485 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 486 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 487 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 488 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 489 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 490 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 491 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 492 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 493 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 494 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 495 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 496 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 497 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 498 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 499 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 500 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 501 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 502 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 503 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 504 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 505 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 506 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 507 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 508 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 509 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 510 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 511 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 512 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 513 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 514 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 515 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 516 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 517 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 518 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 519 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 520 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 521 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 522 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 523 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 524 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 525 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 526 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 527 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 528 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 529 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 530 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 531 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 532 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 533 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 534 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 535 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 536 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 537 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 538 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 539 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 540 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 541 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 542 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 543 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 544 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 545 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 546 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 547 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 548 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 549 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 550 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 551 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 552 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 553 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 554 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 555 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 556 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 557 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 558 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 559 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 560 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 561 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 562 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 563 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 564 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 565 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 566 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 567 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 568 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 569 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 570 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 571 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 572 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 573 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 574 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 575 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 576 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 577 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 578 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 579 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 580 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 581 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 582 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 583 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 584 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 585 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 586 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 587 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 588 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 589 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 590 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 591 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 592 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 593 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 594 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 595 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 596 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 597 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 598 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 599 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 600 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 601 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 602 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 603 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 604 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 605 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 606 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 607 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 608 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 609 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 610 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 611 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 612 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 613 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 614 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 615 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 616 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 617 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 618 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 619 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 620 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 621 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 622 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 623 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 624 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 625 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 626 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 627 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 628 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 629 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 630 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 631 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 632 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 633 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 634 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 635 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 636 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 637 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 638 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 639 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 640 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 641 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 642 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 643 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 644 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 645 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 646 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 647 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 648 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 649 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 650 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 651 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 652 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 653 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 654 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 655 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 656 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 657 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 658 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 659 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 660 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 661 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 662 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 663 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 664 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 665 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 666 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 667 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 668 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 669 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 670 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 671 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 672 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 673 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 674 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 675 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 676 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 677 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 678 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 679 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 680 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 681 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 682 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 683 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 684 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 685 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 686 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 687 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 688 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 689 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 690 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 691 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 692 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 693 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 694 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 695 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 696 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 697 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 698 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 699 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 700 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 701 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 702 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 703 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 704 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 705 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 706 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 707 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 708 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 709 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 710 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 711 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 712 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 713 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 714 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 715 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 716 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 717 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 718 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 721 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 724 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 725 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 726 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 727 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 728 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 729 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 730 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 731 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 732 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 733 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 734 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 735 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 736 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 737 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 738 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 739 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 740 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 741 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 742 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 743 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 744 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 745 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 746 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 747 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 748 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 749 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 750 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 751 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 752 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 753 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 754 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 755 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 756 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 757 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 758 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 759 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 760 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 761 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 762 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 763 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 764 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 765 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 766 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 767 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 768 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 769 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 770 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 771 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 772 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 773 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 774 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 775 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 776 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 777 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 778 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 779 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 780 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 781 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 782 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 783 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 784 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 786 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 787 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 788 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 789 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 790 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 791 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 792 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 793 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 794 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 795 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 796 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 797 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 798 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 799 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 800 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 801 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 802 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 803 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 804 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 805 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 806 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 807 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 808 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 809 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 810 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 811 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 812 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 813 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 814 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 815 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 816 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 817 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 818 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 819 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 820 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 821 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 822 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 823 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 824 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 825 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 826 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 827 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 828 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 829 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 830 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 831 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 832 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 833 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 834 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 835 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 836 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 837 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 838 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 839 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 840 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 841 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 842 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 843 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 844 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 845 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 846 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 847 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 848 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 849 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 850 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 851 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 852 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 853 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 854 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 855 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 856 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 857 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 858 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 859 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 860 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 861 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 862 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 53.39 |
| Metatranscriptomes | 1.06 |
| Isolates | 45.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.41 |
| Bulb | 0 |
| Endosphere | 20 |
| Nodule | 33.47 |
| Rhizoplane | 2.29 |
| Rhizosphere | 26.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1012538 | 3300002074 | Bacteria | 1001 |
| 2 | JGI25156J39149_1000174 | 3300002705 | Bacteria | 47087 |
| 3 | JGI25162J39368_1000240 | 3300002737 | Bacteria | 54635 |
| 4 | JGI25162J39368_1000394 | 3300002737 | Bacteria | 36901 |
| 5 | JGI25154J39366_1000011 | 3300002738 | Bacteria | 296007 |
| 6 | JGI25158J39367_1000755 | 3300002739 | Bacteria | 6207 |
| 7 | JGI25157J39369_1000218 | 3300002741 | Bacteria | 47085 |
| 8 | JGI25152J39213_1001242 | 3300002773 | Bacteria | 11655 |
| 9 | JGI25152J39213_1003244 | 3300002773 | Bacteria | 5648 |
| 10 | JGI25152J39213_1006666 | 3300002773 | Bacteria | 3091 |
| 11 | JGI25152J39213_1007576 | 3300002773 | Bacteria | 2794 |
| 12 | JGI25150J39212_1000070 | 3300002774 | Bacteria | 61799 |
| 13 | JGI25159J45721_1000007 | 3300002987 | Bacteria | 176362 |
| 14 | JGI25159J45721_1000161 | 3300002987 | Bacteria | 31760 |
| 15 | JGI25151J46595_10000208 | 3300003187 | Bacteria | 71857 |
| 16 | JGI25151J46595_10005630 | 3300003187 | Bacteria | 6440 |
| 17 | JGI25165J46597_1000709 | 3300003214 | Bacteria | 26301 |
| 18 | JGI25165J46597_1000755 | 3300003214 | Bacteria | 24825 |
| 19 | JGI25165J46597_1005205 | 3300003214 | Bacteria | 2564 |
| 20 | JGI25153J46596_10002457 | 3300003215 | Bacteria | 10678 |
| 21 | JGI25153J46596_10005041 | 3300003215 | Bacteria | 6985 |
| 22 | JGI25153J46596_10013861 | 3300003215 | Bacteria | 3383 |
| 23 | JGI25153J46596_10015554 | 3300003215 | Bacteria | 3091 |
| 24 | JGI25153J46596_10017728 | 3300003215 | Bacteria | 2794 |
| 25 | JGI25153J46596_10021821 | 3300003215 | Bacteria | 2378 |
| 26 | JGI25160J50197_1000010 | 3300003354 | Bacteria | 279365 |
| 27 | JGI25160J50197_1000011 | 3300003354 | Bacteria | 275577 |
| 28 | JGI25160J50197_1000521 | 3300003354 | Bacteria | 22453 |
| 29 | JGI25160J50197_1004636 | 3300003354 | Bacteria | 5908 |
| 30 | JGI25161J50226_1000006 | 3300003374 | Bacteria | 279563 |
| 31 | JGI25161J50226_1000055 | 3300003374 | Bacteria | 104131 |
| 32 | JGI25161J50226_1000706 | 3300003374 | Bacteria | 13094 |
| 33 | JGI25161J50226_1001998 | 3300003374 | Bacteria | 5585 |
| 34 | Ga0006562J51391_1006992 | 3300003578 | Bacteria | 2060 |
| 35 | Ga0006562J51391_1014891 | 3300003578 | Bacteria | 2540 |
| 36 | Ga0055539_1009431 | 3300003752 | Bacteria | 1211 |
| 37 | Ga0055526_1002733 | 3300003771 | Bacteria | 11728 |
| 38 | Ga0055526_1013247 | 3300003771 | Bacteria | 3504 |
| 39 | Ga0055526_1017696 | 3300003771 | Bacteria | 2708 |
| 40 | Ga0055526_1021046 | 3300003771 | Bacteria | 2287 |
| 41 | Ga0055526_1022319 | 3300003771 | Bacteria | 2158 |
| 42 | Ga0055524_1000766 | 3300003775 | Bacteria | 21629 |
| 43 | Ga0055524_1001235 | 3300003775 | Bacteria | 15060 |
| 44 | Ga0055524_1007386 | 3300003775 | Bacteria | 4673 |
| 45 | Ga0055524_1014165 | 3300003775 | Bacteria | 2970 |
| 46 | Ga0055524_1018212 | 3300003775 | Bacteria | 2446 |
| 47 | Ga0055524_1021790 | 3300003775 | Bacteria | 2112 |
| 48 | Ga0055536_1006737 | 3300003781 | Bacteria | 5272 |
| 49 | Ga0055536_1012129 | 3300003781 | Bacteria | 3227 |
| 50 | Ga0055536_1015981 | 3300003781 | Bacteria | 2536 |
| 51 | Ga0055528_1000222 | 3300003790 | Bacteria | 47898 |
| 52 | Ga0055528_1002861 | 3300003790 | Bacteria | 8991 |
| 53 | Ga0055528_1016522 | 3300003790 | Bacteria | 2604 |
| 54 | Ga0055528_1020890 | 3300003790 | Bacteria | 2102 |
| 55 | Ga0055528_1026284 | 3300003790 | Bacteria | 1678 |
| 56 | Ga0055528_1036795 | 3300003790 | Bacteria | 1162 |
| 57 | Ga0055530_10007550 | 3300003791 | Bacteria | 4553 |
| 58 | Ga0055530_10012914 | 3300003791 | Bacteria | 2884 |
| 59 | Ga0055540_1001610 | 3300003792 | Bacteria | 13152 |
| 60 | Ga0055540_1003323 | 3300003792 | Bacteria | 7832 |
| 61 | Ga0055540_1008157 | 3300003792 | Bacteria | 3814 |
| 62 | Ga0055540_1012797 | 3300003792 | Bacteria | 2608 |
| 63 | Ga0055540_1025106 | 3300003792 | Bacteria | 1466 |
| 64 | Ga0055540_1026118 | 3300003792 | Bacteria | 1417 |
| 65 | Ga0055531_10003225 | 3300003794 | Bacteria | 10464 |
| 66 | Ga0055531_10005192 | 3300003794 | Bacteria | 7664 |
| 67 | Ga0055531_10034597 | 3300003794 | Bacteria | 1599 |
| 68 | Ga0058692_1002551 | 3300003856 | Bacteria | 6035 |
| 69 | Ga0058692_1003928 | 3300003856 | Bacteria | 4499 |
| 70 | Ga0055543_1000014 | 3300004625 | Bacteria | 177906 |
| 71 | Ga0055543_1000032 | 3300004625 | Bacteria | 130218 |
| 72 | Ga0055543_1000179 | 3300004625 | Bacteria | 52563 |
| 73 | Ga0055543_1000312 | 3300004625 | Bacteria | 33737 |
| 74 | Ga0065165_1000018 | 3300005262 | Bacteria | 275082 |
| 75 | Ga0065165_1000251 | 3300005262 | Bacteria | 93020 |
| 76 | Ga0065165_1011958 | 3300005262 | Bacteria | 3570 |
| 77 | Ga0065165_1015153 | 3300005262 | Bacteria | 2954 |
| 78 | Ga0065165_1016666 | 3300005262 | Bacteria | 2741 |
| 79 | Ga0070658_10129447 | 3300005327 | Bacteria | 2103 |
| 80 | Ga0070658_10164634 | 3300005327 | Bacteria | 1862 |
| 81 | Ga0070658_10246751 | 3300005327 | Bacteria | 1514 |
| 82 | Ga0070670_100013586 | 3300005331 | Bacteria | 6979 |
| 83 | Ga0070666_10307247 | 3300005335 | Bacteria | 1130 |
| 84 | Ga0068868_100175080 | 3300005338 | Bacteria | 1778 |
| 85 | Ga0070660_100029463 | 3300005339 | Bacteria | 4114 |
| 86 | Ga0070660_100112458 | 3300005339 | Bacteria | 2167 |
| 87 | Ga0070661_100037811 | 3300005344 | Bacteria | 3512 |
| 88 | Ga0070661_100270971 | 3300005344 | Bacteria | 1315 |
| 89 | Ga0070669_100071642 | 3300005353 | Bacteria | 2564 |
| 90 | Ga0070675_100331681 | 3300005354 | Bacteria | 1346 |
| 91 | Ga0070675_100600240 | 3300005354 | Bacteria | 998 |
| 92 | Ga0070671_100098647 | 3300005355 | Bacteria | 2451 |
| 93 | Ga0070674_100009304 | 3300005356 | Bacteria | 5881 |
| 94 | Ga0070673_100285879 | 3300005364 | Bacteria | 1448 |
| 95 | Ga0070673_100348882 | 3300005364 | Bacteria | 1313 |
| 96 | Ga0070659_100013307 | 3300005366 | Bacteria | 6120 |
| 97 | Ga0070659_100117275 | 3300005366 | Bacteria | 2153 |
| 98 | Ga0070667_100254802 | 3300005367 | Bacteria | 1570 |
| 99 | Ga0070708_100171611 | 3300005445 | Bacteria | 2025 |
| 100 | Ga0070663_100367814 | 3300005455 | Bacteria | 1168 |
| 101 | Ga0070663_100949656 | 3300005455 | Bacteria | 745 |
| 102 | Ga0070678_100046022 | 3300005456 | Bacteria | 3126 |
| 103 | Ga0070678_100179422 | 3300005456 | Bacteria | 1732 |
| 104 | Ga0068853_100152949 | 3300005539 | Bacteria | 2078 |
| 105 | Ga0068853_100157980 | 3300005539 | Bacteria | 2044 |
| 106 | Ga0070672_100278328 | 3300005543 | Bacteria | 1414 |
| 107 | Ga0070665_100114859 | 3300005548 | Bacteria | 2695 |
| 108 | Ga0070665_100178769 | 3300005548 | Bacteria | 2123 |
| 109 | Ga0070665_100223866 | 3300005548 | Bacteria | 1882 |
| 110 | Ga0068855_100122067 | 3300005563 | Bacteria | 2982 |
| 111 | Ga0068855_100423006 | 3300005563 | Bacteria | 1457 |
| 112 | Ga0068854_100028834 | 3300005578 | Bacteria | 3839 |
| 113 | Ga0068854_100412500 | 3300005578 | Bacteria | 1120 |
| 114 | Ga0068852_100006203 | 3300005616 | Bacteria | 8619 |
| 115 | Ga0068852_100007647 | 3300005616 | Bacteria | 7903 |
| 116 | Ga0068852_100114076 | 3300005616 | Bacteria | 2462 |
| 117 | Ga0068851_10221141 | 3300005834 | Bacteria | 1064 |
| 118 | Ga0081455_10017257 | 3300005937 | Bacteria | 6928 |
| 119 | Ga0075365_10086473 | 3300006038 | Bacteria | 2131 |
| 120 | Ga0075365_10167231 | 3300006038 | Bacteria | 1534 |
| 121 | Ga0075365_10287947 | 3300006038 | Bacteria | 1156 |
| 122 | Ga0075365_10404484 | 3300006038 | Bacteria | 963 |
| 123 | Ga0075368_10000104 | 3300006042 | Bacteria | 21606 |
| 124 | Ga0075368_10065762 | 3300006042 | Bacteria | 1457 |
| 125 | Ga0075363_100052670 | 3300006048 | Bacteria | 2173 |
| 126 | Ga0075363_100355182 | 3300006048 | Bacteria | 856 |
| 127 | Ga0075364_10012266 | 3300006051 | Bacteria | 5240 |
| 128 | Ga0075364_10023511 | 3300006051 | Bacteria | 3902 |
| 129 | Ga0075362_10001584 | 3300006177 | Bacteria | 7369 |
| 130 | Ga0075362_10014041 | 3300006177 | Bacteria | 3223 |
| 131 | Ga0075367_10006555 | 3300006178 | Bacteria | 5892 |
| 132 | Ga0075367_10033762 | 3300006178 | Bacteria | 2951 |
| 133 | Ga0075369_10001290 | 3300006186 | Bacteria | 8522 |
| 134 | Ga0075369_10002414 | 3300006186 | Bacteria | 6663 |
| 135 | Ga0075369_10159784 | 3300006186 | Bacteria | 1033 |
| 136 | Ga0075366_10003548 | 3300006195 | Bacteria | 8248 |
| 137 | Ga0075366_10031472 | 3300006195 | Bacteria | 3122 |
| 138 | Ga0075370_10023082 | 3300006353 | Bacteria | 3423 |
| 139 | Ga0075370_10033426 | 3300006353 | Bacteria | 2880 |
| 140 | Ga0075370_10034017 | 3300006353 | Bacteria | 2856 |
| 141 | Ga0075370_10062474 | 3300006353 | Bacteria | 2122 |
| 142 | Ga0075370_10160838 | 3300006353 | Bacteria | 1318 |
| 143 | Ga0075428_100442303 | 3300006844 | Bacteria | 1392 |
| 144 | Ga0075431_100266156 | 3300006847 | Bacteria | 1738 |
| 145 | Ga0079104_1000022 | 3300006946 | Bacteria | 223522 |
| 146 | Ga0079104_1003384 | 3300006946 | Bacteria | 7472 |
| 147 | Ga0099826_10000117 | 3300006948 | Bacteria | 36698 |
| 148 | Ga0099826_10163770 | 3300006948 | Bacteria | 1257 |
| 149 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 150 | Ga0105243_10440864 | 3300009148 | Bacteria | 1219 |
| 151 | Ga0105243_10982252 | 3300009148 | Bacteria | 846 |
| 152 | Ga0105241_10166290 | 3300009174 | Bacteria | 1818 |
| 153 | Ga0105248_10280754 | 3300009177 | Bacteria | 1875 |
| 154 | Ga0105237_10002572 | 3300009545 | Bacteria | 22387 |
| 155 | Ga0105238_10003838 | 3300009551 | Bacteria | 14926 |
| 156 | Ga0105238_10279354 | 3300009551 | Bacteria | 1651 |
| 157 | Ga0123341_1081385 | 3300009765 | Bacteria | 1263 |
| 158 | Ga0123342_1015299 | 3300009766 | Bacteria | 7020 |
| 159 | Ga0123342_1021619 | 3300009766 | Bacteria | 4491 |
| 160 | Ga0105239_10001022 | 3300010375 | Bacteria | 39112 |
| 161 | Ga0105239_10125354 | 3300010375 | Bacteria | 2854 |
| 162 | Ga0157373_10283309 | 3300013100 | Bacteria | 1175 |
| 163 | Ga0157371_10000240 | 3300013102 | Bacteria | 78391 |
| 164 | Ga0157371_10022856 | 3300013102 | Bacteria | 4574 |
| 165 | Ga0157371_10408298 | 3300013102 | Bacteria | 994 |
| 166 | Ga0157370_10000322 | 3300013104 | Bacteria | 59997 |
| 167 | Ga0157370_10017118 | 3300013104 | Bacteria | 7318 |
| 168 | Ga0157370_10018937 | 3300013104 | Bacteria | 6921 |
| 169 | Ga0157370_10114005 | 3300013104 | Bacteria | 2525 |
| 170 | Ga0157369_10073641 | 3300013105 | Bacteria | 3664 |
| 171 | Ga0157369_10082968 | 3300013105 | Bacteria | 3429 |
| 172 | Ga0157378_10379844 | 3300013297 | Bacteria | 1387 |
| 173 | Ga0157372_10037628 | 3300013307 | Bacteria | 5339 |
| 174 | Ga0157372_10109904 | 3300013307 | Bacteria | 3157 |
| 175 | Ga0157372_10754347 | 3300013307 | Bacteria | 1131 |
| 176 | Ga0163163_10197904 | 3300014325 | Bacteria | 2058 |
| 177 | Ga0183363_1246 | 3300015690 | Bacteria | 9239 |
| 178 | Ga0163161_10655175 | 3300017792 | Bacteria | 870 |
| 179 | Ga0214544_1016120 | 3300021320 | Bacteria | 7390 |
| 180 | Ga0214542_1000245 | 3300021321 | Bacteria | 90699 |
| 181 | Ga0214542_1018074 | 3300021321 | Bacteria | 6107 |
| 182 | Ga0214543_1000010 | 3300021327 | Bacteria | 364844 |
| 183 | Ga0214543_1000134 | 3300021327 | Bacteria | 102056 |
| 184 | Ga0228711_1000007 | 3300022739 | Bacteria | 202413 |
| 185 | Ga0228710_1000007 | 3300022740 | Bacteria | 189104 |
| 186 | Ga0209435_100012 | 3300025206 | Bacteria | 401621 |
| 187 | Ga0209436_100034 | 3300025208 | Bacteria | 80089 |
| 188 | Ga0209436_100878 | 3300025208 | Bacteria | 12002 |
| 189 | Ga0209437_100047 | 3300025233 | Bacteria | 405163 |
| 190 | Ga0209437_100308 | 3300025233 | Bacteria | 66019 |
| 191 | Ga0207425_1000024 | 3300025245 | Bacteria | 328978 |
| 192 | Ga0207425_1002077 | 3300025245 | Bacteria | 7441 |
| 193 | Ga0207425_1013645 | 3300025245 | Bacteria | 1870 |
| 194 | Ga0207425_1024341 | 3300025245 | Bacteria | 1259 |
| 195 | Ga0207425_1053174 | 3300025245 | Bacteria | 733 |
| 196 | Ga0209646_1000026 | 3300025246 | Bacteria | 401621 |
| 197 | Ga0209646_1017629 | 3300025246 | Bacteria | 1051 |
| 198 | Ga0209026_1000014 | 3300025250 | Bacteria | 401621 |
| 199 | Ga0209677_100371 | 3300025253 | Bacteria | 27456 |
| 200 | Ga0209759_1000012 | 3300025256 | Bacteria | 401621 |
| 201 | Ga0209759_1018976 | 3300025256 | Bacteria | 1647 |
| 202 | Ga0209129_1000069 | 3300025258 | Bacteria | 212790 |
| 203 | Ga0209129_1000133 | 3300025258 | Bacteria | 126018 |
| 204 | Ga0209129_1001650 | 3300025258 | Bacteria | 12079 |
| 205 | Ga0209129_1002620 | 3300025258 | Bacteria | 8565 |
| 206 | Ga0209129_1003038 | 3300025258 | Bacteria | 7611 |
| 207 | Ga0209129_1007594 | 3300025258 | Bacteria | 3193 |
| 208 | Ga0209129_1008509 | 3300025258 | Bacteria | 2846 |
| 209 | Ga0209233_1000048 | 3300025261 | Bacteria | 453669 |
| 210 | Ga0209233_1000069 | 3300025261 | Bacteria | 367639 |
| 211 | Ga0209233_1000221 | 3300025261 | Bacteria | 104090 |
| 212 | Ga0209673_1000013 | 3300025273 | Bacteria | 571633 |
| 213 | Ga0209673_1000048 | 3300025273 | Bacteria | 287976 |
| 214 | Ga0209673_1000448 | 3300025273 | Bacteria | 70096 |
| 215 | Ga0209673_1000505 | 3300025273 | Bacteria | 64374 |
| 216 | Ga0209673_1001588 | 3300025273 | Bacteria | 20087 |
| 217 | Ga0209673_1001697 | 3300025273 | Bacteria | 18711 |
| 218 | Ga0209673_1003716 | 3300025273 | Bacteria | 8740 |
| 219 | Ga0209673_1028005 | 3300025273 | Bacteria | 1823 |
| 220 | Ga0209130_1000004 | 3300025284 | Bacteria | 633436 |
| 221 | Ga0209130_1000021 | 3300025284 | Bacteria | 374278 |
| 222 | Ga0209130_1000029 | 3300025284 | Bacteria | 323399 |
| 223 | Ga0209676_1009491 | 3300025292 | Bacteria | 4190 |
| 224 | Ga0209676_1035696 | 3300025292 | Bacteria | 1455 |
| 225 | Ga0209025_1000033 | 3300025294 | Bacteria | 414511 |
| 226 | Ga0209025_1000050 | 3300025294 | Bacteria | 331531 |
| 227 | Ga0209025_1000445 | 3300025294 | Bacteria | 81092 |
| 228 | Ga0209025_1000572 | 3300025294 | Bacteria | 66863 |
| 229 | Ga0209025_1002013 | 3300025294 | Bacteria | 23196 |
| 230 | Ga0209025_1003067 | 3300025294 | Bacteria | 16404 |
| 231 | Ga0209025_1016746 | 3300025294 | Bacteria | 4292 |
| 232 | Ga0209025_1019400 | 3300025294 | Bacteria | 3783 |
| 233 | Ga0209025_1032542 | 3300025294 | Bacteria | 2434 |
| 234 | Ga0209025_1051708 | 3300025294 | Bacteria | 1629 |
| 235 | Ga0209025_1075212 | 3300025294 | Bacteria | 1175 |
| 236 | Ga0209025_1076235 | 3300025294 | Bacteria | 1162 |
| 237 | Ga0209564_1000288 | 3300025295 | Bacteria | 102088 |
| 238 | Ga0209564_1000375 | 3300025295 | Bacteria | 82204 |
| 239 | Ga0209564_1000570 | 3300025295 | Bacteria | 58555 |
| 240 | Ga0209564_1001678 | 3300025295 | Bacteria | 21104 |
| 241 | Ga0209564_1029031 | 3300025295 | Bacteria | 1751 |
| 242 | Ga0209564_1040273 | 3300025295 | Bacteria | 1271 |
| 243 | Ga0209564_1044251 | 3300025295 | Bacteria | 1157 |
| 244 | Ga0209758_1000342 | 3300025297 | Bacteria | 86095 |
| 245 | Ga0209758_1000421 | 3300025297 | Bacteria | 71884 |
| 246 | Ga0209758_1000468 | 3300025297 | Bacteria | 66625 |
| 247 | Ga0209758_1000629 | 3300025297 | Bacteria | 54026 |
| 248 | Ga0209758_1002428 | 3300025297 | Bacteria | 19044 |
| 249 | Ga0209758_1020357 | 3300025297 | Bacteria | 3143 |
| 250 | Ga0209758_1020362 | 3300025297 | Bacteria | 3143 |
| 251 | Ga0209758_1022889 | 3300025297 | Bacteria | 2846 |
| 252 | Ga0209758_1024832 | 3300025297 | Bacteria | 2655 |
| 253 | Ga0209758_1030767 | 3300025297 | Bacteria | 2216 |
| 254 | Ga0209758_1037914 | 3300025297 | Bacteria | 1856 |
| 255 | Ga0209050_1001717 | 3300025298 | Bacteria | 21872 |
| 256 | Ga0209050_1004324 | 3300025298 | Bacteria | 9694 |
| 257 | Ga0209256_1000354 | 3300025299 | Bacteria | 74714 |
| 258 | Ga0209256_1000809 | 3300025299 | Bacteria | 40091 |
| 259 | Ga0209256_1000852 | 3300025299 | Bacteria | 38024 |
| 260 | Ga0209256_1003719 | 3300025299 | Bacteria | 10336 |
| 261 | Ga0209256_1008152 | 3300025299 | Bacteria | 4928 |
| 262 | Ga0209256_1008744 | 3300025299 | Bacteria | 4614 |
| 263 | Ga0209256_1009059 | 3300025299 | Bacteria | 4446 |
| 264 | Ga0209256_1038436 | 3300025299 | Bacteria | 1240 |
| 265 | Ga0209256_1075280 | 3300025299 | Bacteria | 749 |
| 266 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 267 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 268 | Ga0207426_1000039 | 3300025302 | Bacteria | 439937 |
| 269 | Ga0207426_1000074 | 3300025302 | Bacteria | 323399 |
| 270 | Ga0207426_1001779 | 3300025302 | Bacteria | 16197 |
| 271 | Ga0209051_1000445 | 3300025303 | Bacteria | 55846 |
| 272 | Ga0209051_1002402 | 3300025303 | Bacteria | 13472 |
| 273 | Ga0209051_1004526 | 3300025303 | Bacteria | 8526 |
| 274 | Ga0209051_1005330 | 3300025303 | Bacteria | 7565 |
| 275 | Ga0209051_1028809 | 3300025303 | Bacteria | 2185 |
| 276 | Ga0209051_1045360 | 3300025303 | Bacteria | 1522 |
| 277 | Ga0209051_1056382 | 3300025303 | Bacteria | 1267 |
| 278 | Ga0209257_1002537 | 3300025304 | Bacteria | 17887 |
| 279 | Ga0209257_1005388 | 3300025304 | Bacteria | 9016 |
| 280 | Ga0209257_1013660 | 3300025304 | Bacteria | 3581 |
| 281 | Ga0209257_1020481 | 3300025304 | Bacteria | 2443 |
| 282 | Ga0209257_1030620 | 3300025304 | Bacteria | 1734 |
| 283 | Ga0209257_1057283 | 3300025304 | Bacteria | 1072 |
| 284 | Ga0207656_10244087 | 3300025321 | Bacteria | 878 |
| 285 | Ga0207680_10351042 | 3300025903 | Bacteria | 1036 |
| 286 | Ga0207705_10054317 | 3300025909 | Bacteria | 2887 |
| 287 | Ga0207654_10314967 | 3300025911 | Bacteria | 1068 |
| 288 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 289 | Ga0207671_10000215 | 3300025914 | Bacteria | 87204 |
| 290 | Ga0207671_10000674 | 3300025914 | Bacteria | 44575 |
| 291 | Ga0207657_10015111 | 3300025919 | Bacteria | 7498 |
| 292 | Ga0207657_10071717 | 3300025919 | Bacteria | 2932 |
| 293 | Ga0207649_10036319 | 3300025920 | Bacteria | 2967 |
| 294 | Ga0207649_10159130 | 3300025920 | Bacteria | 1563 |
| 295 | Ga0207652_10433192 | 3300025921 | Bacteria | 1186 |
| 296 | Ga0207650_10025328 | 3300025925 | Bacteria | 4226 |
| 297 | Ga0207659_10256501 | 3300025926 | Bacteria | 1421 |
| 298 | Ga0207644_10100880 | 3300025931 | Bacteria | 2168 |
| 299 | Ga0207690_10056613 | 3300025932 | Bacteria | 2646 |
| 300 | Ga0207706_10426761 | 3300025933 | Bacteria | 1148 |
| 301 | Ga0207691_10080054 | 3300025940 | Bacteria | 2939 |
| 302 | Ga0207711_10260335 | 3300025941 | Bacteria | 1594 |
| 303 | Ga0207667_10003395 | 3300025949 | Bacteria | 19649 |
| 304 | Ga0207667_10047558 | 3300025949 | Bacteria | 4540 |
| 305 | Ga0207667_10168264 | 3300025949 | Bacteria | 2253 |
| 306 | Ga0207667_11064612 | 3300025949 | Bacteria | 793 |
| 307 | Ga0207640_10388493 | 3300025981 | Bacteria | 1133 |
| 308 | Ga0207639_10312668 | 3300026041 | Bacteria | 1392 |
| 309 | Ga0207678_10164807 | 3300026067 | Bacteria | 1892 |
| 310 | Ga0207702_10051493 | 3300026078 | Bacteria | 3480 |
| 311 | Ga0207702_10108226 | 3300026078 | Bacteria | 2466 |
| 312 | Ga0207674_10017245 | 3300026116 | Bacteria | 7877 |
| 313 | Ga0207683_10017007 | 3300026121 | Bacteria | 6190 |
| 314 | Ga0207683_10214787 | 3300026121 | Bacteria | 1751 |
| 315 | Ga0207698_10082949 | 3300026142 | Bacteria | 2593 |
| 316 | Ga0207698_10274625 | 3300026142 | Bacteria | 1555 |
| 317 | Ga0207698_10866981 | 3300026142 | Bacteria | 909 |
| 318 | Ga0209281_1000128 | 3300027111 | Bacteria | 199265 |
| 319 | Ga0209281_1000374 | 3300027111 | Bacteria | 71684 |
| 320 | Ga0209371_1000058 | 3300027312 | Bacteria | 237920 |
| 321 | Ga0209371_1024045 | 3300027312 | Bacteria | 1423 |
| 322 | Ga0209282_1000034 | 3300027666 | Bacteria | 140100 |
| 323 | Ga0209282_1037976 | 3300027666 | Bacteria | 2891 |
| 324 | Ga0209813_10001551 | 3300027866 | Bacteria | 5151 |
| 325 | Ga0268266_10000255 | 3300028379 | Bacteria | 89930 |
| 326 | Ga0268266_10054398 | 3300028379 | Bacteria | 3439 |
| 327 | Ga0268266_10174887 | 3300028379 | Bacteria | 1951 |
| 328 | Ga0268266_10387595 | 3300028379 | Bacteria | 1319 |
| 329 | Ga0307515_10000198 | 3300028794 | Bacteria | 147738 |
| 330 | Ga0307515_10033455 | 3300028794 | Bacteria | 8462 |
| 331 | Ga0307515_10039992 | 3300028794 | Bacteria | 7430 |
| 332 | Ga0307515_10172811 | 3300028794 | Bacteria | 2145 |
| 333 | Ga0268256_1000056 | 3300030500 | Bacteria | 231684 |
| 334 | Ga0268256_1029812 | 3300030500 | Bacteria | 1330 |
| 335 | Ga0265331_10087739 | 3300031250 | Bacteria | 1440 |
| 336 | Ga0307513_10017351 | 3300031456 | Bacteria | 8633 |
| 337 | Ga0307513_10106482 | 3300031456 | Bacteria | 2810 |
| 338 | Ga0307405_10003205 | 3300031731 | Bacteria | 7456 |
| 339 | Ga0307413_10084466 | 3300031824 | Bacteria | 2046 |
| 340 | Ga0307410_10647580 | 3300031852 | Bacteria | 886 |
| 341 | Ga0307406_10013129 | 3300031901 | Bacteria | 4738 |
| 342 | Ga0307412_10002280 | 3300031911 | Bacteria | 10620 |
| 343 | Ga0307412_10142993 | 3300031911 | Bacteria | 1755 |
| 344 | Ga0307412_10492931 | 3300031911 | Bacteria | 1018 |
| 345 | Ga0315914_1000010 | 3300031967 | Bacteria | 171642 |
| 346 | Ga0307416_100331898 | 3300032002 | Bacteria | 1529 |
| 347 | Ga0307414_10168684 | 3300032004 | Bacteria | 1747 |
| 348 | Ga0307414_10911093 | 3300032004 | Bacteria | 806 |
| 349 | Ga0307414_10923025 | 3300032004 | Bacteria | 801 |
| 350 | Ga0315913_1000005 | 3300033430 | Bacteria | 171651 |
| 351 | Ga0315915_1000012 | 3300033464 | Bacteria | 199284 |
| 352 | Ga0373943_0428234 | 3300035170 | Bacteria | 766 |
| 353 | Ga0316574_0388862 | 3300035398 | Bacteria | 879 |
| 354 | Ga0373935_0129091 | 3300035692 | Bacteria | 1697 |
| 355 | Ga0373927_0003766 | 3300035695 | Bacteria | 10769 |
| 356 | Ga0395899_0172848 | 3300037312 | Bacteria | 1520 |
| 357 | Ga0395900_0491873 | 3300037418 | Bacteria | 1178 |
| 358 | Ga0395898_0047273 | 3300037466 | Bacteria | 4224 |
| 359 | Ga0395898_0709546 | 3300037466 | Bacteria | 947 |
| 360 | Ga0395905_0000913 | 3300037471 | Bacteria | 38168 |
| 361 | Ga0395901_0198967 | 3300038443 | Bacteria | 2100 |
| 362 | Ga0395901_0331385 | 3300038443 | Bacteria | 1573 |
| 363 | Ga0237819_00289 | 3300038705 | Bacteria | 18507 |
| 364 | Ga0439465_0002585 | 3300041413 | Bacteria | 5897 |
| 365 | Ga0439465_0028154 | 3300041413 | Bacteria | 1781 |
| 366 | Ga0451797_0628677 | 3300041453 | Bacteria | 1119 |
| 367 | Ga0451798_0746823 | 3300041458 | Bacteria | 921 |
| 368 | Ga0451833_0980777 | 3300041491 | Bacteria | 864 |
| 369 | Ga0451833_1242594 | 3300041491 | Bacteria | 1686 |
| 370 | Ga0451835_0538804 | 3300041492 | Bacteria | 1857 |
| 371 | Ga0451837_0158764 | 3300041494 | Bacteria | 1482 |
| 372 | Ga0451837_1611223 | 3300041494 | Bacteria | 1064 |
| 373 | Ga0451839_0680386 | 3300041496 | Bacteria | 3577 |
| 374 | Ga0451841_0496995 | 3300041498 | Bacteria | 1075 |
| 375 | Ga0451845_0096118 | 3300041501 | Bacteria | 2347 |
| 376 | Ga0451845_0189620 | 3300041501 | Bacteria | 1816 |
| 377 | Ga0451846_27131 | 3300041502 | Bacteria | 1859 |
| 378 | Ga0451847_0053929 | 3300041503 | Bacteria | 1691 |
| 379 | Ga0451847_0256758 | 3300041503 | Bacteria | 811 |
| 380 | Ga0451849_0151792 | 3300041505 | Bacteria | 3244 |
| 381 | Ga0451851_0028592 | 3300041507 | Bacteria | 1065 |
| 382 | Ga0451854_09483 | 3300041510 | Bacteria | 851 |
| 383 | Ga0451855_0129778 | 3300041511 | Bacteria | 1396 |
| 384 | Ga0451853_0540011 | 3300041512 | Bacteria | 1628 |
| 385 | Ga0439445_0046947 | 3300042004 | Bacteria | 1159 |
| 386 | Ga0439449_0027239 | 3300042007 | Bacteria | 2133 |
| 387 | Ga0439449_0047804 | 3300042007 | Bacteria | 1584 |
| 388 | Ga0439449_0067289 | 3300042007 | Bacteria | 1321 |
| 389 | Ga0450906_018546 | 3300042145 | Bacteria | 1248 |
| 390 | Ga0450918_012406 | 3300042531 | Bacteria | 1486 |
| 391 | Ga0466965_0036166 | 3300044683 | Bacteria | 2422 |
| 392 | Ga0466963_0018287 | 3300044694 | Bacteria | 4379 |
| 393 | Ga0466968_0017268 | 3300044735 | Bacteria | 2883 |
| 394 | Ga0466970_0105796 | 3300044765 | Bacteria | 1535 |
| 395 | Ga0466957_0049509 | 3300044842 | Bacteria | 2555 |
| 396 | Ga0466957_0524924 | 3300044842 | Bacteria | 823 |
| 397 | Ga0466960_0437234 | 3300044901 | Bacteria | 758 |
| 398 | Ga0495617_024465 | 3300046452 | Bacteria | 2038 |
| 399 | Ga0495627_100028 | 3300046453 | Bacteria | 828 |
| 400 | Ga0495629_0062875 | 3300046459 | Bacteria | 2592 |
| 401 | Ga0495638_0000912 | 3300046460 | Bacteria | 30176 |
| 402 | Ga0495638_0020127 | 3300046460 | Bacteria | 4409 |
| 403 | Ga0495638_0237622 | 3300046460 | Bacteria | 1010 |
| 404 | Ga0495650_0056153 | 3300046471 | Bacteria | 1599 |
| 405 | Ga0495605_0008173 | 3300046474 | Bacteria | 5916 |
| 406 | Ga0495605_0011529 | 3300046474 | Bacteria | 4923 |
| 407 | Ga0495662_0010788 | 3300046476 | Bacteria | 4468 |
| 408 | Ga0495585_0035896 | 3300046492 | Bacteria | 2799 |
| 409 | Ga0495585_0095426 | 3300046492 | Bacteria | 1597 |
| 410 | Ga0495585_0101850 | 3300046492 | Bacteria | 1535 |
| 411 | Ga0495607_0024523 | 3300046501 | Bacteria | 3759 |
| 412 | Ga0495607_0053485 | 3300046501 | Bacteria | 2333 |
| 413 | Ga0495607_0184654 | 3300046501 | Bacteria | 1043 |
| 414 | Ga0495583_0054448 | 3300046506 | Bacteria | 1811 |
| 415 | Ga0495606_0002051 | 3300046507 | Bacteria | 24670 |
| 416 | Ga0495606_0008842 | 3300046507 | Bacteria | 8632 |
| 417 | Ga0495606_0090738 | 3300046507 | Bacteria | 1880 |
| 418 | Ga0495606_0104484 | 3300046507 | Bacteria | 1719 |
| 419 | Ga0495610_0002292 | 3300046512 | Bacteria | 16169 |
| 420 | Ga0495610_0004005 | 3300046512 | Bacteria | 11119 |
| 421 | Ga0495616_0035535 | 3300046513 | Bacteria | 2578 |
| 422 | Ga0495620_0016413 | 3300046515 | Bacteria | 3716 |
| 423 | Ga0495620_0030897 | 3300046515 | Bacteria | 2460 |
| 424 | Ga0495620_0072935 | 3300046515 | Bacteria | 1401 |
| 425 | Ga0495631_0005366 | 3300046518 | Bacteria | 6721 |
| 426 | Ga0495631_0020864 | 3300046518 | Bacteria | 3056 |
| 427 | Ga0495632_0021734 | 3300046519 | Bacteria | 3452 |
| 428 | Ga0495643_0013503 | 3300046522 | Bacteria | 4884 |
| 429 | Ga0495643_0025310 | 3300046522 | Bacteria | 3359 |
| 430 | Ga0495643_0036628 | 3300046522 | Bacteria | 2694 |
| 431 | Ga0495643_0088720 | 3300046522 | Bacteria | 1598 |
| 432 | Ga0495643_0128687 | 3300046522 | Bacteria | 1273 |
| 433 | Ga0495648_0024563 | 3300046524 | Bacteria | 4101 |
| 434 | Ga0495663_0016020 | 3300046525 | Bacteria | 2117 |
| 435 | Ga0495654_0006310 | 3300046530 | Bacteria | 6747 |
| 436 | Ga0495654_0015845 | 3300046530 | Bacteria | 3996 |
| 437 | Ga0495654_0136809 | 3300046530 | Bacteria | 1095 |
| 438 | Ga0495587_0183369 | 3300046536 | Bacteria | 1186 |
| 439 | Ga0495609_0017745 | 3300046538 | Bacteria | 3302 |
| 440 | Ga0495609_0172511 | 3300046538 | Bacteria | 913 |
| 441 | Ga0495633_0051268 | 3300046558 | Bacteria | 1945 |
| 442 | Ga0495633_0116426 | 3300046558 | Bacteria | 1238 |
| 443 | Ga0495656_0092219 | 3300046615 | Bacteria | 1387 |
| 444 | Ga0495668_0007395 | 3300046616 | Bacteria | 7030 |
| 445 | Ga0495668_0015062 | 3300046616 | Bacteria | 4523 |
| 446 | Ga0495625_0025182 | 3300046660 | Bacteria | 4515 |
| 447 | Ga0495625_0025662 | 3300046660 | Bacteria | 4466 |
| 448 | Ga0495625_0298014 | 3300046660 | Bacteria | 1032 |
| 449 | Ga0495625_0416977 | 3300046660 | Bacteria | 836 |
| 450 | Ga0495635_0130621 | 3300046663 | Bacteria | 1712 |
| 451 | Ga0495588_0024719 | 3300046674 | Bacteria | 2986 |
| 452 | Ga0495588_0056886 | 3300046674 | Bacteria | 2020 |
| 453 | Ga0495657_0104414 | 3300046675 | Bacteria | 1802 |
| 454 | Ga0495670_0073173 | 3300046691 | Bacteria | 1737 |
| 455 | Ga0495670_0108191 | 3300046691 | Bacteria | 1437 |
| 456 | Ga0495649_0053179 | 3300046694 | Bacteria | 2193 |
| 457 | Ga0495589_0106330 | 3300046794 | Bacteria | 1356 |
| 458 | Ga0495600_0116323 | 3300046809 | Bacteria | 1740 |
| 459 | Ga0495660_0023265 | 3300046810 | Bacteria | 3534 |
| 460 | Ga0495660_0029530 | 3300046810 | Bacteria | 3092 |
| 461 | Ga0495636_0016804 | 3300047318 | Bacteria | 2926 |
| 462 | Ga0495672_0025375 | 3300047320 | Bacteria | 3795 |
| 463 | Ga0495687_020080 | 3300047443 | Bacteria | 3264 |
| 464 | Ga0495677_0158449 | 3300047445 | Bacteria | 873 |
| 465 | Ga0495685_097265 | 3300047447 | Bacteria | 973 |
| 466 | Ga0495673_0034766 | 3300047469 | Bacteria | 2328 |
| 467 | Ga0495681_0014636 | 3300047470 | Bacteria | 4483 |
| 468 | Ga0495681_0155790 | 3300047470 | Bacteria | 955 |
| 469 | Ga0495686_0000647 | 3300047472 | Bacteria | 47618 |
| 470 | Ga0495686_0015408 | 3300047472 | Bacteria | 5221 |
| 471 | Ga0495686_0015712 | 3300047472 | Bacteria | 5158 |
| 472 | Ga0495686_0020495 | 3300047472 | Bacteria | 4407 |
| 473 | Ga0495686_0063374 | 3300047472 | Bacteria | 2291 |
| 474 | Ga0495686_0156870 | 3300047472 | Bacteria | 1332 |
| 475 | Ga0495686_0300845 | 3300047472 | Bacteria | 885 |
| 476 | Ga0495626_0059980 | 3300048091 | Bacteria | 1735 |
| 477 | Ga0496100_0192193 | 3300048903 | Bacteria | 1482 |
| 478 | Ga0496101_0153477 | 3300048904 | Bacteria | 1762 |
| 479 | Ga0496101_0670582 | 3300048904 | Bacteria | 819 |
| 480 | Ga0496102_0062055 | 3300048905 | Bacteria | 3422 |
| 481 | Ga0496103_0039140 | 3300048906 | Bacteria | 2913 |
| 482 | Ga0496104_0018917 | 3300048907 | Bacteria | 6292 |
| 483 | Ga0496104_0271796 | 3300048907 | Bacteria | 1607 |
| 484 | Ga0496105_0032958 | 3300048908 | Bacteria | 4253 |
| 485 | Ga0496106_0088740 | 3300048909 | Bacteria | 2384 |
| 486 | Ga0496110_0149723 | 3300048913 | Bacteria | 2113 |
| 487 | Ga0496110_0289341 | 3300048913 | Bacteria | 1492 |
| 488 | Ga0496110_0333451 | 3300048913 | Bacteria | 1382 |
| 489 | Ga0496110_0721710 | 3300048913 | Bacteria | 899 |
| 490 | Ga0496112_0607967 | 3300048915 | Bacteria | 1025 |
| 491 | Ga0496113_0058521 | 3300048916 | Bacteria | 2900 |
| 492 | Ga0496114_0107672 | 3300048917 | Bacteria | 2385 |
| 493 | Ga0496115_0238454 | 3300048918 | Bacteria | 1499 |
| 494 | Ga0496116_0000061 | 3300048919 | Bacteria | 271860 |
| 495 | Ga0496116_0005599 | 3300048919 | Bacteria | 11573 |
| 496 | Ga0496116_0021753 | 3300048919 | Bacteria | 4826 |
| 497 | Ga0496116_0074465 | 3300048919 | Bacteria | 2135 |
| 498 | Ga0496116_0109512 | 3300048919 | Bacteria | 1628 |
| 499 | Ga0496116_0118184 | 3300048919 | Bacteria | 1540 |
| 500 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 501 | Ga0496117_0002365 | 3300048920 | Bacteria | 24063 |
| 502 | Ga0496117_0004483 | 3300048920 | Bacteria | 15362 |
| 503 | Ga0496117_0010604 | 3300048920 | Bacteria | 8365 |
| 504 | Ga0496117_0013487 | 3300048920 | Bacteria | 7125 |
| 505 | Ga0496118_0000319 | 3300048921 | Bacteria | 83025 |
| 506 | Ga0496118_0007494 | 3300048921 | Bacteria | 11546 |
| 507 | Ga0496118_0024477 | 3300048921 | Bacteria | 5207 |
| 508 | Ga0496118_0028865 | 3300048921 | Bacteria | 4663 |
| 509 | Ga0496118_0053316 | 3300048921 | Bacteria | 3076 |
| 510 | Ga0496119_0015656 | 3300048922 | Bacteria | 5819 |
| 511 | Ga0496119_0020416 | 3300048922 | Bacteria | 4835 |
| 512 | Ga0496119_0035179 | 3300048922 | Bacteria | 3285 |
| 513 | Ga0496119_0096302 | 3300048922 | Bacteria | 1670 |
| 514 | Ga0496119_0131094 | 3300048922 | Bacteria | 1366 |
| 515 | Ga0496120_0003839 | 3300048923 | Bacteria | 13203 |
| 516 | Ga0496120_0030917 | 3300048923 | Bacteria | 3248 |
| 517 | Ga0496120_0039142 | 3300048923 | Bacteria | 2800 |
| 518 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 519 | Ga0496121_0000751 | 3300048924 | Bacteria | 59594 |
| 520 | Ga0496121_0001108 | 3300048924 | Bacteria | 47472 |
| 521 | Ga0496121_0014048 | 3300048924 | Bacteria | 8546 |
| 522 | Ga0496121_0022881 | 3300048924 | Bacteria | 6040 |
| 523 | Ga0496121_0024923 | 3300048924 | Bacteria | 5701 |
| 524 | Ga0496121_0028004 | 3300048924 | Bacteria | 5257 |
| 525 | Ga0496121_0033069 | 3300048924 | Bacteria | 4688 |
| 526 | Ga0496121_0058880 | 3300048924 | Bacteria | 3172 |
| 527 | Ga0496121_0063385 | 3300048924 | Bacteria | 3021 |
| 528 | Ga0496121_0220374 | 3300048924 | Bacteria | 1337 |
| 529 | Ga0496121_0231473 | 3300048924 | Bacteria | 1294 |
| 530 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 531 | Ga0496122_0000025 | 3300048925 | Bacteria | 362915 |
| 532 | Ga0496122_0011969 | 3300048925 | Bacteria | 8704 |
| 533 | Ga0496122_0012830 | 3300048925 | Bacteria | 8287 |
| 534 | Ga0496122_0018017 | 3300048925 | Bacteria | 6549 |
| 535 | Ga0496122_0019101 | 3300048925 | Bacteria | 6283 |
| 536 | Ga0496122_0022990 | 3300048925 | Bacteria | 5517 |
| 537 | Ga0496122_0029942 | 3300048925 | Bacteria | 4574 |
| 538 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 539 | Ga0496123_0000032 | 3300048926 | Bacteria | 285282 |
| 540 | Ga0496123_0001843 | 3300048926 | Bacteria | 27830 |
| 541 | Ga0496123_0014765 | 3300048926 | Bacteria | 6449 |
| 542 | Ga0496123_0016765 | 3300048926 | Bacteria | 5927 |
| 543 | Ga0496123_0078600 | 3300048926 | Bacteria | 2020 |
| 544 | Ga0496123_0282856 | 3300048926 | Bacteria | 800 |
| 545 | Ga0496124_0001103 | 3300048927 | Bacteria | 42448 |
| 546 | Ga0496124_0003458 | 3300048927 | Bacteria | 19299 |
| 547 | Ga0496124_0004380 | 3300048927 | Bacteria | 16510 |
| 548 | Ga0496124_0009449 | 3300048927 | Bacteria | 10044 |
| 549 | Ga0496124_0021179 | 3300048927 | Bacteria | 5994 |
| 550 | Ga0496124_0052290 | 3300048927 | Bacteria | 3470 |
| 551 | Ga0496124_0105954 | 3300048927 | Bacteria | 2270 |
| 552 | Ga0496124_0111425 | 3300048927 | Bacteria | 2201 |
| 553 | Ga0496124_0130151 | 3300048927 | Bacteria | 2000 |
| 554 | Ga0496124_0132613 | 3300048927 | Bacteria | 1977 |
| 555 | Ga0496124_0208600 | 3300048927 | Bacteria | 1480 |
| 556 | Ga0496124_0214863 | 3300048927 | Bacteria | 1452 |
| 557 | Ga0496124_0257510 | 3300048927 | Bacteria | 1286 |
| 558 | Ga0496124_0520911 | 3300048927 | Bacteria | 792 |
| 559 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 560 | Ga0496125_0000692 | 3300048928 | Bacteria | 55634 |
| 561 | Ga0496125_0002540 | 3300048928 | Bacteria | 23527 |
| 562 | Ga0496125_0020129 | 3300048928 | Bacteria | 6273 |
| 563 | Ga0496125_0056623 | 3300048928 | Bacteria | 3182 |
| 564 | Ga0496125_0081691 | 3300048928 | Bacteria | 2467 |
| 565 | Ga0496125_0131192 | 3300048928 | Bacteria | 1764 |
| 566 | Ga0496126_0000397 | 3300048929 | Bacteria | 89305 |
| 567 | Ga0496126_0001855 | 3300048929 | Bacteria | 30802 |
| 568 | Ga0496126_0097712 | 3300048929 | Bacteria | 2573 |
| 569 | Ga0496126_0142165 | 3300048929 | Bacteria | 2064 |
| 570 | Ga0496126_0194293 | 3300048929 | Bacteria | 1717 |
| 571 | Ga0495678_010303 | 3300049459 | Bacteria | 4552 |
| 572 | Ga0495678_067728 | 3300049459 | Bacteria | 1318 |
| 573 | Ga0501031_0077079 | 3300049568 | Bacteria | 2171 |
| 574 | Ga0501033_0000059 | 3300049570 | Bacteria | 105311 |
| 575 | Ga0501033_0073761 | 3300049570 | Bacteria | 2505 |
| 576 | Ga0501033_0229682 | 3300049570 | Bacteria | 1319 |
| 577 | Ga0501034_0000681 | 3300049571 | Bacteria | 51656 |
| 578 | Ga0501034_0024880 | 3300049571 | Bacteria | 6091 |
| 579 | Ga0501034_0025162 | 3300049571 | Bacteria | 6059 |
| 580 | Ga0501034_0078998 | 3300049571 | Bacteria | 3293 |
| 581 | Ga0501034_0977035 | 3300049571 | Bacteria | 731 |
| 582 | Ga0501034_1041119 | 3300049571 | Bacteria | 701 |
| 583 | Ga0501036_0116900 | 3300049572 | Bacteria | 2252 |
| 584 | Ga0501037_0011663 | 3300049573 | Bacteria | 6471 |
| 585 | Ga0501037_0052820 | 3300049573 | Bacteria | 2972 |
| 586 | Ga0501038_0250388 | 3300049574 | Bacteria | 1403 |
| 587 | Ga0501039_0036877 | 3300049575 | Bacteria | 3772 |
| 588 | Ga0501039_0096796 | 3300049575 | Bacteria | 2301 |
| 589 | Ga0501039_0184246 | 3300049575 | Bacteria | 1642 |
| 590 | Ga0501047_0115549 | 3300049581 | Bacteria | 2565 |
| 591 | Ga0501047_0279616 | 3300049581 | Bacteria | 1514 |
| 592 | Ga0501070_0086425 | 3300049586 | Bacteria | 2596 |
| 593 | Ga0501071_0196109 | 3300049587 | Bacteria | 1516 |
| 594 | Ga0501080_0106106 | 3300049742 | Bacteria | 2604 |
| 595 | Ga0501080_0464002 | 3300049742 | Bacteria | 1134 |
| 596 | Ga0501083_0052169 | 3300049744 | Bacteria | 2749 |
| 597 | Ga0501280_003727 | 3300049776 | Bacteria | 2309 |
| 598 | Ga0501044_0466461 | 3300049823 | Bacteria | 1167 |
| 599 | nmdc:mga03683_5837_c1 | 3300050489 | Bacteria | 3265 |
| 600 | nmdc:mga03683_78978_c1 | 3300050489 | Bacteria | 1418 |
| 601 | nmdc:mga03683_85709_c1 | 3300050489 | Bacteria | 1367 |
| 602 | nmdc:mga03n38_44666_c1 | 3300050490 | Bacteria | 1948 |
| 603 | nmdc:mga00v17_1988_c1 | 3300050491 | Bacteria | 10552 |
| 604 | nmdc:mga00v17_391_c2 | 3300050491 | Bacteria | 3431 |
| 605 | nmdc:mga00v17_7150_c1 | 3300050491 | Bacteria | 5948 |
| 606 | nmdc:mga0yw44_135503_c1 | 3300050492 | Bacteria | 1597 |
| 607 | nmdc:mga0yw44_35218_c1 | 3300050492 | Bacteria | 2940 |
| 608 | nmdc:mga0yw44_71024_c1 | 3300050492 | Bacteria | 2160 |
| 609 | nmdc:mga0k408_19474_c1 | 3300050493 | Bacteria | 3794 |
| 610 | nmdc:mga0k408_219545_c1 | 3300050493 | Bacteria | 1135 |
| 611 | nmdc:mga0k408_222849_c1 | 3300050493 | Bacteria | 1126 |
| 612 | nmdc:mga0k408_45587_c1 | 3300050493 | Bacteria | 2530 |
| 613 | nmdc:mga06z11_400795_c1 | 3300050494 | Bacteria | 826 |
| 614 | nmdc:mga06z11_5504_c1 | 3300050494 | Bacteria | 5088 |
| 615 | nmdc:mga06z11_7601_c1 | 3300050494 | Bacteria | 4472 |
| 616 | nmdc:mga04h51_1221_c1 | 3300050495 | Bacteria | 5939 |
| 617 | nmdc:mga04h51_84905_c1 | 3300050495 | Bacteria | 1130 |
| 618 | nmdc:mga07m45_39154_c1 | 3300050496 | Bacteria | 2648 |
| 619 | nmdc:mga07m45_49778_c1 | 3300050496 | Bacteria | 2360 |
| 620 | nmdc:mga07m45_71936_c1 | 3300050496 | Bacteria | 1968 |
| 621 | nmdc:mga0sz30_110988_c1 | 3300050516 | Bacteria | 1202 |
| 622 | nmdc:mga0sz30_4325_c1 | 3300050516 | Bacteria | 3357 |
| 623 | nmdc:mga0sz30_4759_c1 | 3300050516 | Bacteria | 4931 |
| 624 | Ga0500610_0006053 | 3300053079 | Bacteria | 5031 |
| 625 | Ga0495619_0184110 | 3300053085 | Bacteria | 1445 |
| 626 | Ga0500578_0024130 | 3300053086 | Bacteria | 3906 |
| 627 | Ga0500643_001930 | 3300053087 | Bacteria | 11241 |
| 628 | Ga0500562_034819 | 3300053108 | Bacteria | 1333 |
| 629 | Ga0500569_001058 | 3300053109 | Bacteria | 5006 |
| 630 | Ga0500569_037011 | 3300053109 | Bacteria | 1408 |
| 631 | Ga0500595_012447 | 3300053119 | Bacteria | 3292 |
| 632 | Ga0500618_000396 | 3300053125 | Bacteria | 29987 |
| 633 | Ga0500618_009682 | 3300053125 | Bacteria | 2621 |
| 634 | Ga0500618_011885 | 3300053125 | Bacteria | 2297 |
| 635 | Ga0500618_058745 | 3300053125 | Bacteria | 866 |
| 636 | Ga0500658_0000646 | 3300053134 | Bacteria | 14414 |
| 637 | Ga0500559_0035898 | 3300053136 | Bacteria | 2142 |
| 638 | Ga0500559_0043963 | 3300053136 | Bacteria | 1953 |
| 639 | Ga0500568_0002207 | 3300053139 | Bacteria | 11706 |
| 640 | Ga0500568_0216500 | 3300053139 | Bacteria | 700 |
| 641 | Ga0500573_0030764 | 3300053140 | Bacteria | 3096 |
| 642 | Ga0500573_0033515 | 3300053140 | Bacteria | 2963 |
| 643 | Ga0500590_011111 | 3300053148 | Bacteria | 4555 |
| 644 | Ga0500604_0001014 | 3300053151 | Bacteria | 7840 |
| 645 | Ga0500616_0000805 | 3300053153 | Bacteria | 35836 |
| 646 | Ga0500616_0002791 | 3300053153 | Bacteria | 14065 |
| 647 | Ga0500616_0008883 | 3300053153 | Bacteria | 6173 |
| 648 | Ga0500616_0011601 | 3300053153 | Bacteria | 5194 |
| 649 | Ga0500622_0000628 | 3300053156 | Bacteria | 31779 |
| 650 | Ga0500622_0002327 | 3300053156 | Bacteria | 13880 |
| 651 | Ga0500624_001829 | 3300053157 | Bacteria | 3083 |
| 652 | Ga0500627_0064585 | 3300053158 | Bacteria | 1615 |
| 653 | Ga0500634_0000025 | 3300053161 | Bacteria | 81954 |
| 654 | Ga0500634_0010952 | 3300053161 | Bacteria | 4654 |
| 655 | Ga0500636_0000015 | 3300053177 | Bacteria | 123980 |
| 656 | Ga0500636_0015033 | 3300053177 | Bacteria | 4557 |
| 657 | Ga0500636_0153394 | 3300053177 | Bacteria | 1263 |
| 658 | Ga0501084_0875682 | 3300054114 | Bacteria | 756 |
| 659 | Ga0587077_002115 | 3300059493 | Bacteria | 2292 |
| 660 | Ga0587080_001009 | 3300059503 | Bacteria | 2838 |
| 661 | Ga0587080_036680 | 3300059503 | Bacteria | 877 |
| 662 | Ga0587083_0001680 | 3300059505 | Bacteria | 2559 |
| 663 | Ga0587090_000883 | 3300059510 | Bacteria | 2797 |
| 664 | Ga0587090_001476 | 3300059510 | Bacteria | 2392 |
| 665 | Ga0587075_016922 | 3300059644 | Bacteria | 1042 |
| 666 | Ga0587076_063086 | 3300059645 | Bacteria | 752 |
| 667 | Ga0587079_002090 | 3300059647 | Bacteria | 2385 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053139 | Ga0500568_0216500 | Ga0500568_0216500_32_610 | 192 |
| 2 | 3300050494 | nmdc:mga06z11_400795_c1 | nmdc:mga06z11_400795_c1_166_783 | 203 |
| 3 | 3300044901 | Ga0466960_0437234 | Ga0466960_0437234_105_728 | 204 |
| 4 | 3300048903 | Ga0496100_0192193 | Ga0496100_0192193_634_1257 | 205 |
| 5 | 3300048905 | Ga0496102_0062055 | Ga0496102_0062055_264_887 | 205 |
| 6 | 3300048906 | Ga0496103_0039140 | Ga0496103_0039140_2233_2856 | 205 |
| 7 | 3300048909 | Ga0496106_0088740 | Ga0496106_0088740_619_1242 | 205 |
| 8 | 3300048919 | Ga0496116_0118184 | Ga0496116_0118184_729_1352 | 205 |
| 9 | 3300048920 | Ga0496117_0002365 | Ga0496117_0002365_23371_23994 | 205 |
| 10 | 3300048921 | Ga0496118_0007494 | Ga0496118_0007494_10854_11477 | 205 |
| 11 | 3300048922 | Ga0496119_0015656 | Ga0496119_0015656_1728_2351 | 205 |
| 12 | 3300048923 | Ga0496120_0039142 | Ga0496120_0039142_771_1394 | 205 |
| 13 | 3300048924 | Ga0496121_0001108 | Ga0496121_0001108_23481_24104 | 205 |
| 14 | 3300048925 | Ga0496122_0022990 | Ga0496122_0022990_4187_4810 | 205 |
| 15 | 3300048926 | Ga0496123_0016765 | Ga0496123_0016765_4534_5157 | 205 |
| 16 | 3300050493 | nmdc:mga0k408_219545_c1 | nmdc:mga0k408_219545_c1_16_639 | 207 |
| 17 | 3300028794 | Ga0307515_10172811 | Ga0307515_101728111 | 210 |
| 18 | iso_pu_bacteria | 2643221629 | 2644167737 | 215 |
| 19 | iso_pu_bacteria | 2643221662 | 2644349197 | 215 |
| 20 | iso_pu_bacteria | 2534681786 | 2535484577 | 216 |
| 21 | iso_pu_bacteria | 2643221580 | 2643911425 | 216 |
| 22 | iso_pu_bacteria | 2643221591 | 2643963131 | 216 |
| 23 | iso_pu_bacteria | 2643221674 | 2644413986 | 216 |
| 24 | iso_pu_bacteria | 2751185800 | 2753359158 | 216 |
| 25 | iso_pu_bacteria | 2758568016 | 2758641404 | 216 |
| 26 | iso_pu_bacteria | 2854911287 | 2854915181 | 216 |
| 27 | iso_pu_bacteria | 2889790730 | 2889794793 | 216 |
| 28 | iso_pu_bacteria | 2889914905 | 2889916689 | 216 |
| 29 | iso_pu_bacteria | 2915650412 | 2915651670 | 216 |
| 30 | iso_pu_bacteria | 2932401849 | 2932402911 | 216 |
| 31 | iso_pu_bacteria | 2508501122 | 2509107572 | 217 |
| 32 | iso_pu_bacteria | 2509276019 | 2509375904 | 217 |
| 33 | iso_pu_bacteria | 2509276021 | 2509386727 | 217 |
| 34 | iso_pu_bacteria | 2509276033 | 2509443201 | 217 |
| 35 | iso_pu_bacteria | 2510065019 | 2510133267 | 217 |
| 36 | iso_pu_bacteria | 2510065057 | 2510306369 | 217 |
| 37 | iso_pu_bacteria | 2510461069 | 2510841630 | 217 |
| 38 | iso_pu_bacteria | 2510461076 | 2510894634 | 217 |
| 39 | iso_pu_bacteria | 2510917022 | 2511135072 | 217 |
| 40 | iso_pu_bacteria | 2510917028 | 2511182312 | 217 |
| 41 | iso_pu_bacteria | 2510917030 | 2511200043 | 217 |
| 42 | iso_pu_bacteria | 2511231052 | 2511501740 | 217 |
| 43 | iso_pu_bacteria | 2512047086 | 2512533185 | 217 |
| 44 | iso_pu_bacteria | 2512875026 | 2512971313 | 217 |
| 45 | iso_pu_bacteria | 2513237084 | 2513572326 | 217 |
| 46 | iso_pu_bacteria | 2513237085 | 2513579681 | 217 |
| 47 | iso_pu_bacteria | 2513237086 | 2513588369 | 217 |
| 48 | iso_pu_bacteria | 2513237088 | 2513594546 | 217 |
| 49 | iso_pu_bacteria | 2513237089 | 2513604023 | 217 |
| 50 | iso_pu_bacteria | 2513237091 | 2513619703 | 217 |
| 51 | iso_pu_bacteria | 2513237093 | 2513634449 | 217 |
| 52 | iso_pu_bacteria | 2513237103 | 2513708777 | 217 |
| 53 | iso_pu_bacteria | 2513237138 | 2513864605 | 217 |
| 54 | iso_pu_bacteria | 2513237140 | 2513883719 | 217 |
| 55 | iso_pu_bacteria | 2513237143 | 2513905423 | 217 |
| 56 | iso_pu_bacteria | 2513237144 | 2513913065 | 217 |
| 57 | iso_pu_bacteria | 2513237146 | 2513926286 | 217 |
| 58 | iso_pu_bacteria | 2513237156 | 2513988000 | 217 |
| 59 | iso_pu_bacteria | 2513237159 | 2513997250 | 217 |
| 60 | iso_pu_bacteria | 2513237160 | 2514006249 | 217 |
| 61 | iso_pu_bacteria | 2513237162 | 2514021583 | 217 |
| 62 | iso_pu_bacteria | 2515075009 | 2515112226 | 217 |
| 63 | iso_pu_bacteria | 2515154107 | 2515608612 | 217 |
| 64 | iso_pu_bacteria | 2515154113 | 2515637223 | 217 |
| 65 | iso_pu_bacteria | 2515154114 | 2515639728 | 217 |
| 66 | iso_pu_bacteria | 2515154116 | 2515657372 | 217 |
| 67 | iso_pu_bacteria | 2515154134 | 2515738624 | 217 |
| 68 | iso_pu_bacteria | 2516143018 | 2516209534 | 217 |
| 69 | iso_pu_bacteria | 2516653046 | 2516893040 | 217 |
| 70 | iso_pu_bacteria | 2516653077 | 2517035956 | 217 |
| 71 | iso_pu_bacteria | 2516653085 | 2517076351 | 217 |
| 72 | iso_pu_bacteria | 2517093000 | 2517095109 | 217 |
| 73 | iso_pu_bacteria | 2517287029 | 2517406742 | 217 |
| 74 | iso_pu_bacteria | 2517487022 | 2517569804 | 217 |
| 75 | iso_pu_bacteria | 2519899620 | 2520376019 | 217 |
| 76 | iso_pu_bacteria | 2524023207 | 2524448985 | 217 |
| 77 | iso_pu_bacteria | 2524023209 | 2524460318 | 217 |
| 78 | iso_pu_bacteria | 2529292951 | 2530645482 | 217 |
| 79 | iso_pu_bacteria | 2534681796 | 2535516459 | 217 |
| 80 | iso_pu_bacteria | 2537561587 | 2537873760 | 217 |
| 81 | iso_pu_bacteria | 2551306084 | 2551677789 | 217 |
| 82 | iso_pu_bacteria | 2551306085 | 2551686316 | 217 |
| 83 | iso_pu_bacteria | 2551306086 | 2551694810 | 217 |
| 84 | iso_pu_bacteria | 2551306087 | 2551698000 | 217 |
| 85 | iso_pu_bacteria | 2551306090 | 2551717142 | 217 |
| 86 | iso_pu_bacteria | 2551306091 | 2551730462 | 217 |
| 87 | iso_pu_bacteria | 2551306092 | 2551738176 | 217 |
| 88 | iso_pu_bacteria | 2551306093 | 2551743027 | 217 |
| 89 | iso_pu_bacteria | 2554235003 | 2554248005 | 217 |
| 90 | iso_pu_bacteria | 2558860100 | 2558868178 | 217 |
| 91 | iso_pu_bacteria | 2558860242 | 2559295123 | 217 |
| 92 | iso_pu_bacteria | 2558860983 | 2561466338 | 217 |
| 93 | iso_pu_bacteria | 2582581283 | 2585165949 | 217 |
| 94 | iso_pu_bacteria | 2582581294 | 2585200125 | 217 |
| 95 | iso_pu_bacteria | 2582581298 | 2585224303 | 217 |
| 96 | iso_pu_bacteria | 2582581299 | 2585230022 | 217 |
| 97 | iso_pu_bacteria | 2582581304 | 2585254721 | 217 |
| 98 | iso_pu_bacteria | 2582581306 | 2585267970 | 217 |
| 99 | iso_pu_bacteria | 2582581307 | 2585270813 | 217 |
| 100 | iso_pu_bacteria | 2582581308 | 2585277163 | 217 |
| 101 | iso_pu_bacteria | 2582581315 | 2585323828 | 217 |
| 102 | iso_pu_bacteria | 2582581316 | 2585331806 | 217 |
| 103 | iso_pu_bacteria | 2582581865 | 2585386926 | 217 |
| 104 | iso_pu_bacteria | 2582581866 | 2585396896 | 217 |
| 105 | iso_pu_bacteria | 2582581867 | 2585401972 | 217 |
| 106 | iso_pu_bacteria | 2585427526 | 2585527593 | 217 |
| 107 | iso_pu_bacteria | 2585427527 | 2585534101 | 217 |
| 108 | iso_pu_bacteria | 2585427528 | 2585537495 | 217 |
| 109 | iso_pu_bacteria | 2585427529 | 2585546424 | 217 |
| 110 | iso_pu_bacteria | 2585427530 | 2585552048 | 217 |
| 111 | iso_pu_bacteria | 2585427531 | 2585558535 | 217 |
| 112 | iso_pu_bacteria | 2585427590 | 2585821757 | 217 |
| 113 | iso_pu_bacteria | 2585427593 | 2585835445 | 217 |
| 114 | iso_pu_bacteria | 2585427594 | 2585846700 | 217 |
| 115 | iso_pu_bacteria | 2585427608 | 2585897901 | 217 |
| 116 | iso_pu_bacteria | 2585427609 | 2585904494 | 217 |
| 117 | iso_pu_bacteria | 2585428125 | 2587980389 | 217 |
| 118 | iso_pu_bacteria | 2599185156 | 2599331425 | 217 |
| 119 | iso_pu_bacteria | 2599185170 | 2599417763 | 217 |
| 120 | iso_pu_bacteria | 2599185210 | 2599601436 | 217 |
| 121 | iso_pu_bacteria | 2599185352 | 2600193270 | 217 |
| 122 | iso_pu_bacteria | 2600255279 | 2601612062 | 217 |
| 123 | iso_pu_bacteria | 2600255308 | 2601749154 | 217 |
| 124 | iso_pu_bacteria | 2615840624 | 2616292514 | 217 |
| 125 | iso_pu_bacteria | 2615840626 | 2616308541 | 217 |
| 126 | iso_pu_bacteria | 2615840698 | 2616557156 | 217 |
| 127 | iso_pu_bacteria | 2617270742 | 2617385130 | 217 |
| 128 | iso_pu_bacteria | 2643221557 | 2643803765 | 217 |
| 129 | iso_pu_bacteria | 2643221558 | 2643811749 | 217 |
| 130 | iso_pu_bacteria | 2643221568 | 2643854442 | 217 |
| 131 | iso_pu_bacteria | 2643221582 | 2643919535 | 217 |
| 132 | iso_pu_bacteria | 2643221599 | 2644003730 | 217 |
| 133 | iso_pu_bacteria | 2643221607 | 2644049220 | 217 |
| 134 | iso_pu_bacteria | 2643221610 | 2644067735 | 217 |
| 135 | iso_pu_bacteria | 2643221634 | 2644192803 | 217 |
| 136 | iso_pu_bacteria | 2643221636 | 2644204435 | 217 |
| 137 | iso_pu_bacteria | 2643221637 | 2644210399 | 217 |
| 138 | iso_pu_bacteria | 2643221643 | 2644239541 | 217 |
| 139 | iso_pu_bacteria | 2643221653 | 2644298461 | 217 |
| 140 | iso_pu_bacteria | 2643221668 | 2644377738 | 217 |
| 141 | iso_pu_bacteria | 2643221675 | 2644418789 | 217 |
| 142 | iso_pu_bacteria | 2643221680 | 2644452155 | 217 |
| 143 | iso_pu_bacteria | 2643221686 | 2644482254 | 217 |
| 144 | iso_pu_bacteria | 2643221688 | 2644494595 | 217 |
| 145 | iso_pu_bacteria | 2643221689 | 2644501895 | 217 |
| 146 | iso_pu_bacteria | 2643221693 | 2644520233 | 217 |
| 147 | iso_pu_bacteria | 2643221718 | 2644653951 | 217 |
| 148 | iso_pu_bacteria | 2643221719 | 2644656690 | 217 |
| 149 | iso_pu_bacteria | 2643221723 | 2644672660 | 217 |
| 150 | iso_pu_bacteria | 2643221726 | 2644690918 | 217 |
| 151 | iso_pu_bacteria | 2657244999 | 2657683926 | 217 |
| 152 | iso_pu_bacteria | 2667528174 | 2671111755 | 217 |
| 153 | iso_pu_bacteria | 2690316117 | 2692316000 | 217 |
| 154 | iso_pu_bacteria | 2718217882 | 2719181128 | 217 |
| 155 | iso_pu_bacteria | 2718217927 | 2719385741 | 217 |
| 156 | iso_pu_bacteria | 2718217997 | 2719665562 | 217 |
| 157 | iso_pu_bacteria | 2718218009 | 2719731877 | 217 |
| 158 | iso_pu_bacteria | 2718218199 | 2720491982 | 217 |
| 159 | iso_pu_bacteria | 2718218232 | 2720613249 | 217 |
| 160 | iso_pu_bacteria | 2718218233 | 2720620124 | 217 |
| 161 | iso_pu_bacteria | 2718218235 | 2720631549 | 217 |
| 162 | iso_pu_bacteria | 2718218269 | 2720775277 | 217 |
| 163 | iso_pu_bacteria | 2718218363 | 2721147222 | 217 |
| 164 | iso_pu_bacteria | 2718218365 | 2721158755 | 217 |
| 165 | iso_pu_bacteria | 2718218366 | 2721164140 | 217 |
| 166 | iso_pu_bacteria | 2718218423 | 2721399521 | 217 |
| 167 | iso_pu_bacteria | 2721755514 | 2722840310 | 217 |
| 168 | iso_pu_bacteria | 2721755556 | 2723026894 | 217 |
| 169 | iso_pu_bacteria | 2721755684 | 2723560510 | 217 |
| 170 | iso_pu_bacteria | 2721755685 | 2723567096 | 217 |
| 171 | iso_pu_bacteria | 2721755809 | 2724038334 | 217 |
| 172 | iso_pu_bacteria | 2721755810 | 2724044633 | 217 |
| 173 | iso_pu_bacteria | 2721755819 | 2724089884 | 217 |
| 174 | iso_pu_bacteria | 2721755822 | 2724104361 | 217 |
| 175 | iso_pu_bacteria | 2721755823 | 2724110156 | 217 |
| 176 | iso_pu_bacteria | 2724679232 | 2725951326 | 217 |
| 177 | iso_pu_bacteria | 2728369352 | 2730107830 | 217 |
| 178 | iso_pu_bacteria | 2728369365 | 2730164365 | 217 |
| 179 | iso_pu_bacteria | 2728369397 | 2730298387 | 217 |
| 180 | iso_pu_bacteria | 2738541293 | 2738802020 | 217 |
| 181 | iso_pu_bacteria | 2738541317 | 2738946177 | 217 |
| 182 | iso_pu_bacteria | 2738541333 | 2739036457 | 217 |
| 183 | iso_pu_bacteria | 2751185821 | 2753458362 | 217 |
| 184 | iso_pu_bacteria | 2765235942 | 2766063123 | 217 |
| 185 | iso_pu_bacteria | 2775507049 | 2776913654 | 217 |
| 186 | iso_pu_bacteria | 2775507266 | 2778173976 | 217 |
| 187 | iso_pu_bacteria | 2791355082 | 2792581995 | 217 |
| 188 | iso_pu_bacteria | 2791355091 | 2792620010 | 217 |
| 189 | iso_pu_bacteria | 2791355092 | 2792626571 | 217 |
| 190 | iso_pu_bacteria | 2791355094 | 2792639504 | 217 |
| 191 | iso_pu_bacteria | 2791355253 | 2793279587 | 217 |
| 192 | iso_pu_bacteria | 2791355256 | 2793294625 | 217 |
| 193 | iso_pu_bacteria | 2791355259 | 2793312197 | 217 |
| 194 | iso_pu_bacteria | 2791355260 | 2793322074 | 217 |
| 195 | iso_pu_bacteria | 2791355261 | 2793326620 | 217 |
| 196 | iso_pu_bacteria | 2791355262 | 2793335779 | 217 |
| 197 | iso_pu_bacteria | 2791355263 | 2793341475 | 217 |
| 198 | iso_pu_bacteria | 2791355264 | 2793349131 | 217 |
| 199 | iso_pu_bacteria | 2791355265 | 2793356743 | 217 |
| 200 | iso_pu_bacteria | 2791355266 | 2793361215 | 217 |
| 201 | iso_pu_bacteria | 2791355267 | 2793369303 | 217 |
| 202 | iso_pu_bacteria | 2802428858 | 2802719079 | 217 |
| 203 | iso_pu_bacteria | 2802428859 | 2802727310 | 217 |
| 204 | iso_pu_bacteria | 2802428860 | 2802732092 | 217 |
| 205 | iso_pu_bacteria | 2802428861 | 2802739022 | 217 |
| 206 | iso_pu_bacteria | 2802428862 | 2802744921 | 217 |
| 207 | iso_pu_bacteria | 2802428863 | 2802752197 | 217 |
| 208 | iso_pu_bacteria | 2802429268 | 2804752188 | 217 |
| 209 | iso_pu_bacteria | 2802429606 | 2805933616 | 217 |
| 210 | iso_pu_bacteria | 2802429633 | 2806046006 | 217 |
| 211 | iso_pu_bacteria | 2802429634 | 2806054386 | 217 |
| 212 | iso_pu_bacteria | 2802429635 | 2806060391 | 217 |
| 213 | iso_pu_bacteria | 2802429636 | 2806065152 | 217 |
| 214 | iso_pu_bacteria | 2802429637 | 2806072416 | 217 |
| 215 | iso_pu_bacteria | 2808606387 | 2808985163 | 217 |
| 216 | iso_pu_bacteria | 2818991272 | 2819241678 | 217 |
| 217 | iso_pu_bacteria | 2818991439 | 2819559594 | 217 |
| 218 | iso_pu_bacteria | 2818991448 | 2819612835 | 217 |
| 219 | iso_pu_bacteria | 2818991453 | 2819637948 | 217 |
| 220 | iso_pu_bacteria | 2837651117 | 2837652768 | 217 |
| 221 | iso_pu_bacteria | 2838016132 | 2838021515 | 217 |
| 222 | iso_pu_bacteria | 2838022645 | 2838027922 | 217 |
| 223 | iso_pu_bacteria | 2838029111 | 2838030133 | 217 |
| 224 | iso_pu_bacteria | 2838035591 | 2838038020 | 217 |
| 225 | iso_pu_bacteria | 2838042994 | 2838043379 | 217 |
| 226 | iso_pu_bacteria | 2838048938 | 2838052470 | 217 |
| 227 | iso_pu_bacteria | 2838061910 | 2838065995 | 217 |
| 228 | iso_pu_bacteria | 2838068647 | 2838073541 | 217 |
| 229 | iso_pu_bacteria | 2838074704 | 2838078838 | 217 |
| 230 | iso_pu_bacteria | 2838661181 | 2838667269 | 217 |
| 231 | iso_pu_bacteria | 2838668709 | 2838672075 | 217 |
| 232 | iso_pu_bacteria | 2838675328 | 2838676023 | 217 |
| 233 | iso_pu_bacteria | 2838680041 | 2838682273 | 217 |
| 234 | iso_pu_bacteria | 2838686498 | 2838689445 | 217 |
| 235 | iso_pu_bacteria | 2838694306 | 2838696844 | 217 |
| 236 | iso_pu_bacteria | 2838701080 | 2838704645 | 217 |
| 237 | iso_pu_bacteria | 2838707686 | 2838709915 | 217 |
| 238 | iso_pu_bacteria | 2838714209 | 2838714905 | 217 |
| 239 | iso_pu_bacteria | 2838719591 | 2838721294 | 217 |
| 240 | iso_pu_bacteria | 2838724970 | 2838725665 | 217 |
| 241 | iso_pu_bacteria | 2838729681 | 2838730778 | 217 |
| 242 | iso_pu_bacteria | 2838742623 | 2838743719 | 217 |
| 243 | iso_pu_bacteria | 2841846520 | 2841848261 | 217 |
| 244 | iso_pu_bacteria | 2841851746 | 2841857795 | 217 |
| 245 | iso_pu_bacteria | 2841859092 | 2841859194 | 217 |
| 246 | iso_pu_bacteria | 2841864319 | 2841864607 | 217 |
| 247 | iso_pu_bacteria | 2842077413 | 2842078089 | 217 |
| 248 | iso_pu_bacteria | 2842110456 | 2842110546 | 217 |
| 249 | iso_pu_bacteria | 2842118031 | 2842119402 | 217 |
| 250 | iso_pu_bacteria | 2842124991 | 2842125709 | 217 |
| 251 | iso_pu_bacteria | 2842130223 | 2842130918 | 217 |
| 252 | iso_pu_bacteria | 2842146304 | 2842148615 | 217 |
| 253 | iso_pu_bacteria | 2842152218 | 2842153912 | 217 |
| 254 | iso_pu_bacteria | 2842156927 | 2842157468 | 217 |
| 255 | iso_pu_bacteria | 2842163707 | 2842164659 | 217 |
| 256 | iso_pu_bacteria | 2842170452 | 2842171149 | 217 |
| 257 | iso_pu_bacteria | 2842175837 | 2842177532 | 217 |
| 258 | iso_pu_bacteria | 2842180545 | 2842180947 | 217 |
| 259 | iso_pu_bacteria | 2842187318 | 2842188014 | 217 |
| 260 | iso_pu_bacteria | 2842192696 | 2842194555 | 217 |
| 261 | iso_pu_bacteria | 2842198810 | 2842203763 | 217 |
| 262 | iso_pu_bacteria | 2842205361 | 2842206084 | 217 |
| 263 | iso_pu_bacteria | 2842211629 | 2842212325 | 217 |
| 264 | iso_pu_bacteria | 2842217011 | 2842217179 | 217 |
| 265 | iso_pu_bacteria | 2842224351 | 2842226056 | 217 |
| 266 | iso_pu_bacteria | 2842229732 | 2842230994 | 217 |
| 267 | iso_pu_bacteria | 2842237096 | 2842239328 | 217 |
| 268 | iso_pu_bacteria | 2842243621 | 2842244898 | 217 |
| 269 | iso_pu_bacteria | 2842250916 | 2842254325 | 217 |
| 270 | iso_pu_bacteria | 2842257432 | 2842258711 | 217 |
| 271 | iso_pu_bacteria | 2842264693 | 2842266093 | 217 |
| 272 | iso_pu_bacteria | 2842271015 | 2842273465 | 217 |
| 273 | iso_pu_bacteria | 2842278818 | 2842279541 | 217 |
| 274 | iso_pu_bacteria | 2842285085 | 2842286187 | 217 |
| 275 | iso_pu_bacteria | 2842291075 | 2842291752 | 217 |
| 276 | iso_pu_bacteria | 2842298080 | 2842302084 | 217 |
| 277 | iso_pu_bacteria | 2842304105 | 2842304242 | 217 |
| 278 | iso_pu_bacteria | 2842311132 | 2842313867 | 217 |
| 279 | iso_pu_bacteria | 2842317721 | 2842317953 | 217 |
| 280 | iso_pu_bacteria | 2842341865 | 2842345886 | 217 |
| 281 | iso_pu_bacteria | 2842357229 | 2842357449 | 217 |
| 282 | iso_pu_bacteria | 2842363717 | 2842364485 | 217 |
| 283 | iso_pu_bacteria | 2842370503 | 2842372839 | 217 |
| 284 | iso_pu_bacteria | 2842377471 | 2842378148 | 217 |
| 285 | iso_pu_bacteria | 2842384541 | 2842385911 | 217 |
| 286 | iso_pu_bacteria | 2842395702 | 2842397615 | 217 |
| 287 | iso_pu_bacteria | 2842402390 | 2842403547 | 217 |
| 288 | iso_pu_bacteria | 2842409023 | 2842409080 | 217 |
| 289 | iso_pu_bacteria | 2842415677 | 2842415734 | 217 |
| 290 | iso_pu_bacteria | 2842422224 | 2842427953 | 217 |
| 291 | iso_pu_bacteria | 2842428310 | 2842429270 | 217 |
| 292 | iso_pu_bacteria | 2842434925 | 2842435883 | 217 |
| 293 | iso_pu_bacteria | 2842441272 | 2842442230 | 217 |
| 294 | iso_pu_bacteria | 2842447887 | 2842450522 | 217 |
| 295 | iso_pu_bacteria | 2842462802 | 2842463691 | 217 |
| 296 | iso_pu_bacteria | 2842469257 | 2842470212 | 217 |
| 297 | iso_pu_bacteria | 2842475841 | 2842476582 | 217 |
| 298 | iso_pu_bacteria | 2842482326 | 2842484875 | 217 |
| 299 | iso_pu_bacteria | 2842489311 | 2842489979 | 217 |
| 300 | iso_pu_bacteria | 2842495871 | 2842496223 | 217 |
| 301 | iso_pu_bacteria | 2842502639 | 2842503661 | 217 |
| 302 | iso_pu_bacteria | 2842509118 | 2842515248 | 217 |
| 303 | iso_pu_bacteria | 2842515876 | 2842515978 | 217 |
| 304 | iso_pu_bacteria | 2842521101 | 2842522506 | 217 |
| 305 | iso_pu_bacteria | 2842922631 | 2842923823 | 217 |
| 306 | iso_pu_bacteria | 2844163670 | 2844167387 | 217 |
| 307 | iso_pu_bacteria | 2844454524 | 2844459214 | 217 |
| 308 | iso_pu_bacteria | 2847417321 | 2847418934 | 217 |
| 309 | iso_pu_bacteria | 2848992105 | 2848993971 | 217 |
| 310 | iso_pu_bacteria | 2850079185 | 2850081981 | 217 |
| 311 | iso_pu_bacteria | 2852387548 | 2852389856 | 217 |
| 312 | iso_pu_bacteria | 2854896431 | 2854899515 | 217 |
| 313 | iso_pu_bacteria | 2854916844 | 2854918335 | 217 |
| 314 | iso_pu_bacteria | 2855839649 | 2855841186 | 217 |
| 315 | iso_pu_bacteria | 2855872281 | 2855876612 | 217 |
| 316 | iso_pu_bacteria | 2857516855 | 2857518669 | 217 |
| 317 | iso_pu_bacteria | 2858800743 | 2858801835 | 217 |
| 318 | iso_pu_bacteria | 2891373044 | 2891374433 | 217 |
| 319 | iso_pu_bacteria | 2894817345 | 2894819005 | 217 |
| 320 | iso_pu_bacteria | 2899792073 | 2899794022 | 217 |
| 321 | iso_pu_bacteria | 2899845264 | 2899848018 | 217 |
| 322 | iso_pu_bacteria | 2913295892 | 2913301003 | 217 |
| 323 | iso_pu_bacteria | 2913308742 | 2913311238 | 217 |
| 324 | iso_pu_bacteria | 2915980308 | 2915981561 | 217 |
| 325 | iso_pu_bacteria | 2915986958 | 2915988022 | 217 |
| 326 | iso_pu_bacteria | 2915993759 | 2915997513 | 217 |
| 327 | iso_pu_bacteria | 2916000859 | 2916001856 | 217 |
| 328 | iso_pu_bacteria | 2916007675 | 2916009644 | 217 |
| 329 | iso_pu_bacteria | 2916014648 | 2916018011 | 217 |
| 330 | iso_pu_bacteria | 2916021584 | 2916027388 | 217 |
| 331 | iso_pu_bacteria | 2916028427 | 2916035009 | 217 |
| 332 | iso_pu_bacteria | 2916041962 | 2916048113 | 217 |
| 333 | iso_pu_bacteria | 2916048683 | 2916050935 | 217 |
| 334 | iso_pu_bacteria | 2916055098 | 2916055416 | 217 |
| 335 | iso_pu_bacteria | 2916061851 | 2916066044 | 217 |
| 336 | iso_pu_bacteria | 2916068649 | 2916068847 | 217 |
| 337 | iso_pu_bacteria | 2916076590 | 2916080452 | 217 |
| 338 | iso_pu_bacteria | 2919100787 | 2919107026 | 217 |
| 339 | iso_pu_bacteria | 2919114240 | 2919114994 | 217 |
| 340 | iso_pu_bacteria | 2919166419 | 2919168777 | 217 |
| 341 | iso_pu_bacteria | 2919408235 | 2919411728 | 217 |
| 342 | iso_pu_bacteria | 2920760137 | 2920766244 | 217 |
| 343 | iso_pu_bacteria | 2920822456 | 2920824542 | 217 |
| 344 | iso_pu_bacteria | 2921201388 | 2921204554 | 217 |
| 345 | iso_pu_bacteria | 2921208531 | 2921209915 | 217 |
| 346 | iso_pu_bacteria | 2921250672 | 2921255089 | 217 |
| 347 | iso_pu_bacteria | 2921257292 | 2921262034 | 217 |
| 348 | iso_pu_bacteria | 2921263974 | 2921267548 | 217 |
| 349 | iso_pu_bacteria | 2921289301 | 2921290800 | 217 |
| 350 | iso_pu_bacteria | 2923556063 | 2923557891 | 217 |
| 351 | iso_pu_bacteria | 2924150972 | 2924154642 | 217 |
| 352 | iso_pu_bacteria | 2924158325 | 2924159731 | 217 |
| 353 | iso_pu_bacteria | 2924165586 | 2924168768 | 217 |
| 354 | iso_pu_bacteria | 2924172951 | 2924177428 | 217 |
| 355 | iso_pu_bacteria | 2924179722 | 2924180030 | 217 |
| 356 | iso_pu_bacteria | 2924186466 | 2924189718 | 217 |
| 357 | iso_pu_bacteria | 2924207177 | 2924211317 | 217 |
| 358 | iso_pu_bacteria | 2924214083 | 2924217403 | 217 |
| 359 | iso_pu_bacteria | 2924221636 | 2924226211 | 217 |
| 360 | iso_pu_bacteria | 2926754445 | 2926755960 | 217 |
| 361 | iso_pu_bacteria | 2926760298 | 2926763057 | 217 |
| 362 | iso_pu_bacteria | 2929138655 | 2929139968 | 217 |
| 363 | iso_pu_bacteria | 2933006813 | 2933008558 | 217 |
| 364 | iso_pu_bacteria | 2933011516 | 2933011647 | 217 |
| 365 | iso_pu_bacteria | 2933570622 | 2933571518 | 217 |
| 366 | iso_pu_bacteria | 2933586486 | 2933586575 | 217 |
| 367 | iso_pu_bacteria | 2933594066 | 2933596849 | 217 |
| 368 | iso_pu_bacteria | 2933599457 | 2933603977 | 217 |
| 369 | iso_pu_bacteria | 2935894831 | 2935897300 | 217 |
| 370 | iso_pu_bacteria | 2935901341 | 2935904691 | 217 |
| 371 | iso_pu_bacteria | 2936367885 | 2936372768 | 217 |
| 372 | iso_pu_bacteria | 2936375103 | 2936376641 | 217 |
| 373 | iso_pu_bacteria | 2936381700 | 2936385026 | 217 |
| 374 | iso_pu_bacteria | 2936996657 | 2937002615 | 217 |
| 375 | iso_pu_bacteria | 2937002841 | 2937006079 | 217 |
| 376 | iso_pu_bacteria | 2937009748 | 2937010180 | 217 |
| 377 | iso_pu_bacteria | 2937016420 | 2937022917 | 217 |
| 378 | iso_pu_bacteria | 2937023124 | 2937025866 | 217 |
| 379 | iso_pu_bacteria | 2937029754 | 2937032600 | 217 |
| 380 | iso_pu_bacteria | 2937036028 | 2937041181 | 217 |
| 381 | iso_pu_bacteria | 2937042894 | 2937044982 | 217 |
| 382 | iso_pu_bacteria | 2937049772 | 2937051891 | 217 |
| 383 | iso_pu_bacteria | 2937056579 | 2937057188 | 217 |
| 384 | iso_pu_bacteria | 2937063883 | 2937066379 | 217 |
| 385 | iso_pu_bacteria | 2937071275 | 2937073660 | 217 |
| 386 | iso_pu_bacteria | 2937078374 | 2937079232 | 217 |
| 387 | iso_pu_bacteria | 2937084907 | 2937085758 | 217 |
| 388 | iso_pu_bacteria | 2937091812 | 2937098477 | 217 |
| 389 | iso_pu_bacteria | 2937098957 | 2937099188 | 217 |
| 390 | iso_pu_bacteria | 2937106411 | 2937112839 | 217 |
| 391 | iso_pu_bacteria | 2937113482 | 2937116315 | 217 |
| 392 | iso_pu_bacteria | 2937119839 | 2937120350 | 217 |
| 393 | iso_pu_bacteria | 2957375807 | 2957381562 | 217 |
| 394 | iso_pu_bacteria | 2957388812 | 2957391884 | 217 |
| 395 | iso_pu_bacteria | 2957395598 | 2957399220 | 217 |
| 396 | iso_pu_bacteria | 2957415311 | 2957419500 | 217 |
| 397 | iso_pu_bacteria | 2957422303 | 2957425318 | 217 |
| 398 | iso_pu_bacteria | 2957430029 | 2957434813 | 217 |
| 399 | iso_pu_bacteria | 2957437181 | 2957443346 | 217 |
| 400 | iso_pu_bacteria | 2957443900 | 2957447496 | 217 |
| 401 | iso_pu_bacteria | 2957450854 | 2957456909 | 217 |
| 402 | iso_pu_bacteria | 2957457609 | 2957462715 | 217 |
| 403 | iso_pu_bacteria | 2957471148 | 2957477354 | 217 |
| 404 | iso_pu_bacteria | 2957478035 | 2957481534 | 217 |
| 405 | iso_pu_bacteria | 2957484790 | 2957485985 | 217 |
| 406 | iso_pu_bacteria | 2957491536 | 2957496057 | 217 |
| 407 | iso_pu_bacteria | 2957498199 | 2957499123 | 217 |
| 408 | iso_pu_bacteria | 2957505466 | 2957509378 | 217 |
| 409 | iso_pu_bacteria | 2960584000 | 2960584672 | 217 |
| 410 | iso_pu_bacteria | 2960591022 | 2960597230 | 217 |
| 411 | iso_pu_bacteria | 2960597568 | 2960598135 | 217 |
| 412 | iso_pu_bacteria | 2960603979 | 2960610687 | 217 |
| 413 | iso_pu_bacteria | 2960610863 | 2960614206 | 217 |
| 414 | iso_pu_bacteria | 2960617483 | 2960618906 | 217 |
| 415 | iso_pu_bacteria | 2960624210 | 2960625514 | 217 |
| 416 | iso_pu_bacteria | 2960631154 | 2960631810 | 217 |
| 417 | iso_pu_bacteria | 2960637947 | 2960642173 | 217 |
| 418 | iso_pu_bacteria | 2960645483 | 2960651987 | 217 |
| 419 | iso_pu_bacteria | 2960652885 | 2960655324 | 217 |
| 420 | iso_pu_bacteria | 2960660292 | 2960664010 | 217 |
| 421 | iso_pu_bacteria | 2960667422 | 2960672813 | 217 |
| 422 | iso_pu_bacteria | 2960680706 | 2960687182 | 217 |
| 423 | iso_pu_bacteria | 2960687367 | 2960691440 | 217 |
| 424 | iso_pu_bacteria | 2960693952 | 2960697877 | 217 |
| 425 | iso_pu_bacteria | 2964607997 | 2964612293 | 217 |
| 426 | iso_pu_bacteria | 2964615318 | 2964620279 | 217 |
| 427 | iso_pu_bacteria | 2964628898 | 2964632297 | 217 |
| 428 | iso_pu_bacteria | 2964636051 | 2964638991 | 217 |
| 429 | iso_pu_bacteria | 2964643177 | 2964646775 | 217 |
| 430 | iso_pu_bacteria | 2964649959 | 2964654829 | 217 |
| 431 | iso_pu_bacteria | 2964656573 | 2964659344 | 217 |
| 432 | iso_pu_bacteria | 2964663802 | 2964669795 | 217 |
| 433 | iso_pu_bacteria | 2964678106 | 2964684342 | 217 |
| 434 | iso_pu_bacteria | 2964691889 | 2964695412 | 217 |
| 435 | iso_pu_bacteria | 2964705432 | 2964711479 | 217 |
| 436 | iso_pu_bacteria | 2964712639 | 2964713616 | 217 |
| 437 | iso_pu_bacteria | 2964719344 | 2964720474 | 217 |
| 438 | iso_pu_bacteria | 2967664464 | 2967666272 | 217 |
| 439 | iso_pu_bacteria | 2967671571 | 2967675301 | 217 |
| 440 | iso_pu_bacteria | 2967678726 | 2967682684 | 217 |
| 441 | iso_pu_bacteria | 2967686174 | 2967687454 | 217 |
| 442 | iso_pu_bacteria | 2967693043 | 2967699652 | 217 |
| 443 | iso_pu_bacteria | 2967699805 | 2967702715 | 217 |
| 444 | iso_pu_bacteria | 2967706974 | 2967712914 | 217 |
| 445 | iso_pu_bacteria | 2967714385 | 2967715284 | 217 |
| 446 | iso_pu_bacteria | 2967721400 | 2967726473 | 217 |
| 447 | iso_pu_bacteria | 2967728569 | 2967729206 | 217 |
| 448 | iso_pu_bacteria | 2967735183 | 2967741427 | 217 |
| 449 | iso_pu_bacteria | 2967742019 | 2967745116 | 217 |
| 450 | iso_pu_bacteria | 2967748971 | 2967753843 | 217 |
| 451 | iso_pu_bacteria | 2967755722 | 2967757186 | 217 |
| 452 | iso_pu_bacteria | 2967762386 | 2967763669 | 217 |
| 453 | iso_pu_bacteria | 2967775926 | 2967781147 | 217 |
| 454 | iso_pu_bacteria | 2970019648 | 2970022444 | 217 |
| 455 | iso_pu_bacteria | 2970026789 | 2970031471 | 217 |
| 456 | iso_pu_bacteria | 2970033650 | 2970038652 | 217 |
| 457 | iso_pu_bacteria | 2970040964 | 2970045727 | 217 |
| 458 | iso_pu_bacteria | 2970047711 | 2970052336 | 217 |
| 459 | iso_pu_bacteria | 2970054988 | 2970058201 | 217 |
| 460 | iso_pu_bacteria | 2970061556 | 2970068529 | 217 |
| 461 | iso_pu_bacteria | 2970068827 | 2970073694 | 217 |
| 462 | iso_pu_bacteria | 2970076120 | 2970078484 | 217 |
| 463 | iso_pu_bacteria | 2970082768 | 2970087295 | 217 |
| 464 | iso_pu_bacteria | 2970095765 | 2970099707 | 217 |
| 465 | iso_pu_bacteria | 2970102677 | 2970105167 | 217 |
| 466 | iso_pu_bacteria | 2970109326 | 2970110450 | 217 |
| 467 | iso_pu_bacteria | 2970116247 | 2970117783 | 217 |
| 468 | iso_pu_bacteria | 2970122695 | 2970126211 | 217 |
| 469 | iso_pu_bacteria | 2970129317 | 2970130419 | 217 |
| 470 | iso_pu_bacteria | 2970136068 | 2970140317 | 217 |
| 471 | iso_pu_bacteria | 2970143518 | 2970146927 | 217 |
| 472 | iso_pu_bacteria | 2970149975 | 2970150389 | 217 |
| 473 | iso_pu_bacteria | 2970156795 | 2970157551 | 217 |
| 474 | iso_pu_bacteria | 2970164137 | 2970166499 | 217 |
| 475 | iso_pu_bacteria | 2970177841 | 2970182442 | 217 |
| 476 | iso_pu_bacteria | 2970184632 | 2970185726 | 217 |
| 477 | iso_pu_bacteria | 2970191845 | 2970192783 | 217 |
| 478 | iso_pu_bacteria | 2977516862 | 2977517221 | 217 |
| 479 | iso_pu_bacteria | 2977523885 | 2977527940 | 217 |
| 480 | iso_pu_bacteria | 2977530762 | 2977532837 | 217 |
| 481 | iso_pu_bacteria | 2977544691 | 2977549183 | 217 |
| 482 | iso_pu_bacteria | 2977551784 | 2977552748 | 217 |
| 483 | iso_pu_bacteria | 2977565890 | 2977569511 | 217 |
| 484 | iso_pu_bacteria | 2977572785 | 2977574987 | 217 |
| 485 | iso_pu_bacteria | 2977579622 | 2977586171 | 217 |
| 486 | iso_pu_bacteria | 2978969890 | 2978971462 | 217 |
| 487 | iso_pu_bacteria | 2979089926 | 2979094449 | 217 |
| 488 | iso_pu_bacteria | 2979095461 | 2979098168 | 217 |
| 489 | iso_pu_bacteria | 2979100975 | 2979103690 | 217 |
| 490 | iso_pu_bacteria | 2984509177 | 2984511746 | 217 |
| 491 | iso_pu_bacteria | 2984518228 | 2984521893 | 217 |
| 492 | iso_pu_bacteria | 2984537506 | 2984541191 | 217 |
| 493 | iso_pu_bacteria | 2984587000 | 2984588608 | 217 |
| 494 | iso_pu_bacteria | 2984601300 | 2984603472 | 217 |
| 495 | iso_pu_bacteria | 2989349275 | 2989353333 | 217 |
| 496 | iso_pu_bacteria | 2989776772 | 2989778989 | 217 |
| 497 | iso_pu_bacteria | 2996310559 | 2996310782 | 217 |
| 498 | iso_pu_bacteria | 2996887358 | 2996891661 | 217 |
| 499 | iso_pu_bacteria | 2996893221 | 2996898193 | 217 |
| 500 | iso_pu_bacteria | 3003930520 | 3003933634 | 217 |
| 501 | iso_pu_bacteria | 3005416602 | 3005420144 | 217 |
| 502 | iso_pu_bacteria | 3005445848 | 3005447467 | 217 |
| 503 | iso_pu_bacteria | 3005452660 | 3005454179 | 217 |
| 504 | iso_pu_bacteria | 639633055 | 639648485 | 217 |
| 505 | iso_pu_bacteria | 643692032 | 643825822 | 217 |
| 506 | iso_pu_bacteria | 648276728 | 648737410 | 217 |
| 507 | iso_pu_bacteria | 650716007 | 650740327 | 217 |
| 508 | iso_pu_bacteria | 8003570095 | 8003571377 | 217 |
| 509 | iso_pu_bacteria | 8003992118 | 8003993691 | 217 |
| 510 | iso_pu_bacteria | 8003999396 | 8004001168 | 217 |
| 511 | iso_pu_bacteria | 8005246636 | 8005248542 | 217 |
| 512 | iso_pu_bacteria | 8005258706 | 8005262991 | 217 |
| 513 | iso_pu_bacteria | 8005275841 | 8005280518 | 217 |
| 514 | iso_pu_bacteria | 8005282627 | 8005283138 | 217 |
| 515 | iso_pu_bacteria | 8005289223 | 8005290303 | 217 |
| 516 | iso_pu_bacteria | 8005301065 | 8005302502 | 217 |
| 517 | iso_pu_bacteria | 8005307578 | 8005314482 | 217 |
| 518 | iso_pu_bacteria | 8005314921 | 8005317095 | 217 |
| 519 | iso_pu_bacteria | 8005321885 | 8005326188 | 217 |
| 520 | iso_pu_bacteria | 8005376324 | 8005379149 | 217 |
| 521 | iso_pu_bacteria | 8005382845 | 8005388280 | 217 |
| 522 | iso_pu_bacteria | 8005395548 | 8005397194 | 217 |
| 523 | iso_pu_bacteria | 8005430974 | 8005432087 | 217 |
| 524 | iso_pu_bacteria | 8005460587 | 8005462887 | 217 |
| 525 | iso_pu_bacteria | 8005484373 | 8005485107 | 217 |
| 526 | iso_pu_bacteria | 8005497431 | 8005500286 | 217 |
| 527 | iso_pu_bacteria | 8005542996 | 8005545108 | 217 |
| 528 | iso_pu_bacteria | 8005556819 | 8005557769 | 217 |
| 529 | iso_pu_bacteria | 8005563573 | 8005568941 | 217 |
| 530 | iso_pu_bacteria | 8005570704 | 8005574756 | 217 |
| 531 | iso_pu_bacteria | 8005619151 | 8005621663 | 217 |
| 532 | iso_pu_bacteria | 8005626139 | 8005626481 | 217 |
| 533 | iso_pu_bacteria | 8005645114 | 8005645271 | 217 |
| 534 | iso_pu_bacteria | 8005658619 | 8005659684 | 217 |
| 535 | iso_pu_bacteria | 8005668836 | 8005671702 | 217 |
| 536 | iso_pu_bacteria | 8005682033 | 8005683230 | 217 |
| 537 | iso_pu_bacteria | 8005688590 | 8005694515 | 217 |
| 538 | iso_pu_bacteria | 8005695170 | 8005700076 | 217 |
| 539 | iso_pu_bacteria | 8018127388 | 8018129858 | 217 |
| 540 | iso_pu_bacteria | 8018150411 | 8018155364 | 217 |
| 541 | iso_pu_bacteria | 8018163183 | 8018166854 | 217 |
| 542 | iso_pu_bacteria | 8018176218 | 8018179889 | 217 |
| 543 | iso_pu_bacteria | 8023680758 | 8023685442 | 217 |
| 544 | iso_pu_bacteria | 8024479707 | 8024483598 | 217 |
| 545 | iso_pu_bacteria | 8024486573 | 8024492301 | 217 |
| 546 | iso_pu_bacteria | 8024501048 | 8024506643 | 217 |
| 547 | iso_pu_bacteria | 8046767195 | 8046773833 | 217 |
| 548 | iso_pu_bacteria | 8049293176 | 8049294731 | 217 |
| 549 | iso_pu_bacteria | 8054460903 | 8054462682 | 217 |
| 550 | iso_pu_bacteria | 8054558443 | 8054559647 | 217 |
| 551 | iso_pu_bacteria | 8055431914 | 8055435981 | 217 |
| 552 | iso_pu_bacteria | 8056375014 | 8056376577 | 217 |
| 553 | iso_pu_bacteria | 8056382006 | 8056388147 | 217 |
| 554 | iso_pu_bacteria | 8057575449 | 8057576791 | 217 |
| 555 | iso_pu_bacteria | 8057874678 | 8057875120 | 217 |
| 556 | 3300053136 | Ga0500559_0043963 | Ga0500559_0043963_245_907 | 218 |
| 557 | iso_pu_bacteria | 2510917026 | 2511174046 | 218 |
| 558 | iso_pu_bacteria | 2585427633 | 2585995796 | 218 |
| 559 | iso_pu_bacteria | 2585427634 | 2586000358 | 218 |
| 560 | iso_pu_bacteria | 2599185236 | 2599721055 | 218 |
| 561 | iso_pu_bacteria | 2600254933 | 2600374557 | 218 |
| 562 | iso_pu_bacteria | 2818991461 | 2819687273 | 218 |
| 563 | iso_pu_bacteria | 2821123053 | 2821127846 | 218 |
| 564 | iso_pu_bacteria | 2838736955 | 2838738270 | 218 |
| 565 | iso_pu_bacteria | 2841840854 | 2841841360 | 218 |
| 566 | iso_pu_bacteria | 2842140634 | 2842141138 | 218 |
| 567 | iso_pu_bacteria | 2857531043 | 2857534413 | 218 |
| 568 | iso_pu_bacteria | 2919171160 | 2919175200 | 218 |
| 569 | iso_pu_bacteria | 2989771324 | 2989773578 | 218 |
| 570 | iso_pu_bacteria | 3005409236 | 3005415187 | 218 |
| 571 | 3300005327 | Ga0070658_10129447 | Ga0070658_101294472 | 219 |
| 572 | 3300005327 | Ga0070658_10164634 | Ga0070658_101646343 | 219 |
| 573 | 3300005327 | Ga0070658_10246751 | Ga0070658_102467512 | 219 |
| 574 | 3300005338 | Ga0068868_100175080 | Ga0068868_1001750802 | 219 |
| 575 | 3300005339 | Ga0070660_100029463 | Ga0070660_1000294632 | 219 |
| 576 | 3300005339 | Ga0070660_100112458 | Ga0070660_1001124581 | 219 |
| 577 | 3300005344 | Ga0070661_100037811 | Ga0070661_1000378115 | 219 |
| 578 | 3300005344 | Ga0070661_100270971 | Ga0070661_1002709711 | 219 |
| 579 | 3300005356 | Ga0070674_100009304 | Ga0070674_1000093047 | 219 |
| 580 | 3300005364 | Ga0070673_100285879 | Ga0070673_1002858792 | 219 |
| 581 | 3300005364 | Ga0070673_100348882 | Ga0070673_1003488821 | 219 |
| 582 | 3300005366 | Ga0070659_100013307 | Ga0070659_1000133075 | 219 |
| 583 | 3300005366 | Ga0070659_100117275 | Ga0070659_1001172752 | 219 |
| 584 | 3300005455 | Ga0070663_100367814 | Ga0070663_1003678141 | 219 |
| 585 | 3300005456 | Ga0070678_100046022 | Ga0070678_1000460222 | 219 |
| 586 | 3300005539 | Ga0068853_100152949 | Ga0068853_1001529492 | 219 |
| 587 | 3300005539 | Ga0068853_100157980 | Ga0068853_1001579802 | 219 |
| 588 | 3300005543 | Ga0070672_100278328 | Ga0070672_1002783282 | 219 |
| 589 | 3300005548 | Ga0070665_100114859 | Ga0070665_1001148594 | 219 |
| 590 | 3300005548 | Ga0070665_100223866 | Ga0070665_1002238662 | 219 |
| 591 | 3300005563 | Ga0068855_100122067 | Ga0068855_1001220675 | 219 |
| 592 | 3300005563 | Ga0068855_100423006 | Ga0068855_1004230062 | 219 |
| 593 | 3300005578 | Ga0068854_100028834 | Ga0068854_1000288343 | 219 |
| 594 | 3300005578 | Ga0068854_100412500 | Ga0068854_1004125002 | 219 |
| 595 | 3300005616 | Ga0068852_100006203 | Ga0068852_10000620313 | 219 |
| 596 | 3300005616 | Ga0068852_100007647 | Ga0068852_10000764710 | 219 |
| 597 | 3300005834 | Ga0068851_10221141 | Ga0068851_102211412 | 219 |
| 598 | 3300006038 | Ga0075365_10404484 | Ga0075365_104044842 | 219 |
| 599 | 3300006042 | Ga0075368_10065762 | Ga0075368_100657622 | 219 |
| 600 | 3300006177 | Ga0075362_10014041 | Ga0075362_100140412 | 219 |
| 601 | 3300006195 | Ga0075366_10031472 | Ga0075366_100314721 | 219 |
| 602 | 3300006353 | Ga0075370_10062474 | Ga0075370_100624743 | 219 |
| 603 | 3300009174 | Ga0105241_10166290 | Ga0105241_101662903 | 219 |
| 604 | 3300009545 | Ga0105237_10002572 | Ga0105237_100025728 | 219 |
| 605 | 3300009551 | Ga0105238_10003838 | Ga0105238_1000383813 | 219 |
| 606 | 3300009551 | Ga0105238_10279354 | Ga0105238_102793543 | 219 |
| 607 | 3300010375 | Ga0105239_10001022 | Ga0105239_100010227 | 219 |
| 608 | 3300010375 | Ga0105239_10125354 | Ga0105239_101253545 | 219 |
| 609 | 3300013102 | Ga0157371_10022856 | Ga0157371_100228563 | 219 |
| 610 | 3300013104 | Ga0157370_10017118 | Ga0157370_100171182 | 219 |
| 611 | 3300013104 | Ga0157370_10114005 | Ga0157370_101140053 | 219 |
| 612 | 3300013297 | Ga0157378_10379844 | Ga0157378_103798442 | 219 |
| 613 | 3300013307 | Ga0157372_10037628 | Ga0157372_100376284 | 219 |
| 614 | 3300013307 | Ga0157372_10109904 | Ga0157372_101099042 | 219 |
| 615 | 3300014325 | Ga0163163_10197904 | Ga0163163_101979042 | 219 |
| 616 | 3300025321 | Ga0207656_10244087 | Ga0207656_102440871 | 219 |
| 617 | 3300025909 | Ga0207705_10054317 | Ga0207705_100543174 | 219 |
| 618 | 3300025911 | Ga0207654_10314967 | Ga0207654_103149672 | 219 |
| 619 | 3300025914 | Ga0207671_10000215 | Ga0207671_1000021538 | 219 |
| 620 | 3300025919 | Ga0207657_10015111 | Ga0207657_100151113 | 219 |
| 621 | 3300025919 | Ga0207657_10071717 | Ga0207657_100717174 | 219 |
| 622 | 3300025920 | Ga0207649_10036319 | Ga0207649_100363193 | 219 |
| 623 | 3300025920 | Ga0207649_10159130 | Ga0207649_101591302 | 219 |
| 624 | 3300025921 | Ga0207652_10433192 | Ga0207652_104331922 | 219 |
| 625 | 3300025932 | Ga0207690_10056613 | Ga0207690_100566133 | 219 |
| 626 | 3300025940 | Ga0207691_10080054 | Ga0207691_100800542 | 219 |
| 627 | 3300025949 | Ga0207667_10003395 | Ga0207667_1000339521 | 219 |
| 628 | 3300025949 | Ga0207667_10047558 | Ga0207667_100475581 | 219 |
| 629 | 3300025949 | Ga0207667_11064612 | Ga0207667_110646121 | 219 |
| 630 | 3300025981 | Ga0207640_10388493 | Ga0207640_103884931 | 219 |
| 631 | 3300026041 | Ga0207639_10312668 | Ga0207639_103126683 | 219 |
| 632 | 3300026078 | Ga0207702_10108226 | Ga0207702_101082263 | 219 |
| 633 | 3300026116 | Ga0207674_10017245 | Ga0207674_100172453 | 219 |
| 634 | 3300026121 | Ga0207683_10017007 | Ga0207683_100170073 | 219 |
| 635 | 3300026142 | Ga0207698_10274625 | Ga0207698_102746252 | 219 |
| 636 | 3300028379 | Ga0268266_10000255 | Ga0268266_1000025574 | 219 |
| 637 | 3300028379 | Ga0268266_10387595 | Ga0268266_103875952 | 219 |
| 638 | 3300031250 | Ga0265331_10087739 | Ga0265331_100877391 | 219 |
| 639 | 3300037312 | Ga0395899_0172848 | Ga0395899_0172848_731_1396 | 219 |
| 640 | 3300037466 | Ga0395898_0709546 | Ga0395898_0709546_29_694 | 219 |
| 641 | 3300038443 | Ga0395901_0331385 | Ga0395901_0331385_198_863 | 219 |
| 642 | 3300044842 | Ga0466957_0049509 | Ga0466957_0049509_1186_1851 | 219 |
| 643 | 3300044842 | Ga0466957_0524924 | Ga0466957_0524924_18_683 | 219 |
| 644 | 3300047472 | Ga0495686_0020495 | Ga0495686_0020495_2146_2811 | 219 |
| 645 | 3300048924 | Ga0496121_0220374 | Ga0496121_0220374_497_1162 | 219 |
| 646 | 3300049570 | Ga0501033_0073761 | Ga0501033_0073761_1552_2217 | 219 |
| 647 | 3300049571 | Ga0501034_0025162 | Ga0501034_0025162_1909_2574 | 219 |
| 648 | 3300049572 | Ga0501036_0116900 | Ga0501036_0116900_1438_2103 | 219 |
| 649 | 3300049575 | Ga0501039_0036877 | Ga0501039_0036877_2298_2963 | 219 |
| 650 | 3300049581 | Ga0501047_0115549 | Ga0501047_0115549_111_776 | 219 |
| 651 | 3300049586 | Ga0501070_0086425 | Ga0501070_0086425_1546_2211 | 219 |
| 652 | 3300049587 | Ga0501071_0196109 | Ga0501071_0196109_79_744 | 219 |
| 653 | 3300050489 | nmdc:mga03683_5837_c1 | nmdc:mga03683_5837_c1_351_1016 | 219 |
| 654 | 3300050492 | nmdc:mga0yw44_135503_c1 | nmdc:mga0yw44_135503_c1_762_1427 | 219 |
| 655 | 3300050493 | nmdc:mga0k408_45587_c1 | nmdc:mga0k408_45587_c1_1216_1881 | 219 |
| 656 | 3300050495 | nmdc:mga04h51_84905_c1 | nmdc:mga04h51_84905_c1_151_816 | 219 |
| 657 | 3300050496 | nmdc:mga07m45_39154_c1 | nmdc:mga07m45_39154_c1_1020_1685 | 219 |
| 658 | 3300053108 | Ga0500562_034819 | Ga0500562_034819_544_1209 | 219 |
| 659 | 3300053119 | Ga0500595_012447 | Ga0500595_012447_193_858 | 219 |
| 660 | 3300054114 | Ga0501084_0875682 | Ga0501084_0875682_52_717 | 219 |
| 661 | 3300003578 | Ga0006562J51391_1006992 | Ga0006562J51391_10069923 | 220 |
| 662 | 3300005455 | Ga0070663_100949656 | Ga0070663_1009496561 | 220 |
| 663 | 3300013307 | Ga0157372_10754347 | Ga0157372_107543471 | 220 |
| 664 | 3300031824 | Ga0307413_10084466 | Ga0307413_100844662 | 220 |
| 665 | 3300031852 | Ga0307410_10647580 | Ga0307410_106475801 | 220 |
| 666 | 3300031911 | Ga0307412_10142993 | Ga0307412_101429931 | 220 |
| 667 | 3300032004 | Ga0307414_10168684 | Ga0307414_101686842 | 220 |
| 668 | 3300032004 | Ga0307414_10911093 | Ga0307414_109110932 | 220 |
| 669 | 3300035398 | Ga0316574_0388862 | Ga0316574_0388862_89_757 | 220 |
| 670 | 3300046507 | Ga0495606_0008842 | Ga0495606_0008842_7424_8092 | 220 |
| 671 | 3300048922 | Ga0496119_0035179 | Ga0496119_0035179_86_757 | 220 |
| 672 | 3300048924 | Ga0496121_0058880 | Ga0496121_0058880_1662_2330 | 220 |
| 673 | 3300048926 | Ga0496123_0014765 | Ga0496123_0014765_104_775 | 220 |
| 674 | 3300048928 | Ga0496125_0131192 | Ga0496125_0131192_523_1191 | 220 |
| 675 | 3300048929 | Ga0496126_0194293 | Ga0496126_0194293_185_853 | 220 |
| 676 | 3300049568 | Ga0501031_0077079 | Ga0501031_0077079_850_1518 | 220 |
| 677 | 3300049571 | Ga0501034_0000681 | Ga0501034_0000681_8686_9354 | 220 |
| 678 | 3300049571 | Ga0501034_0977035 | Ga0501034_0977035_41_709 | 220 |
| 679 | 3300049573 | Ga0501037_0052820 | Ga0501037_0052820_286_954 | 220 |
| 680 | 3300049575 | Ga0501039_0096796 | Ga0501039_0096796_325_993 | 220 |
| 681 | 3300049575 | Ga0501039_0184246 | Ga0501039_0184246_668_1336 | 220 |
| 682 | 3300049742 | Ga0501080_0106106 | Ga0501080_0106106_436_1104 | 220 |
| 683 | 3300050493 | nmdc:mga0k408_222849_c1 | nmdc:mga0k408_222849_c1_19_681 | 220 |
| 684 | 3300053151 | Ga0500604_0001014 | Ga0500604_0001014_2124_2792 | 220 |
| 685 | 3300053153 | Ga0500616_0008883 | Ga0500616_0008883_3410_4078 | 220 |
| 686 | 3300053161 | Ga0500634_0000025 | Ga0500634_0000025_44789_45457 | 220 |
| 687 | 3300002705 | JGI25156J39149_1000174 | JGI25156J39149_100017426 | 221 |
| 688 | 3300002737 | JGI25162J39368_1000240 | JGI25162J39368_100024034 | 221 |
| 689 | 3300002737 | JGI25162J39368_1000394 | JGI25162J39368_100039432 | 221 |
| 690 | 3300002738 | JGI25154J39366_1000011 | JGI25154J39366_100001128 | 221 |
| 691 | 3300002739 | JGI25158J39367_1000755 | JGI25158J39367_10007554 | 221 |
| 692 | 3300002741 | JGI25157J39369_1000218 | JGI25157J39369_100021826 | 221 |
| 693 | 3300002773 | JGI25152J39213_1001242 | JGI25152J39213_10012426 | 221 |
| 694 | 3300002773 | JGI25152J39213_1003244 | JGI25152J39213_10032446 | 221 |
| 695 | 3300002773 | JGI25152J39213_1006666 | JGI25152J39213_10066664 | 221 |
| 696 | 3300002773 | JGI25152J39213_1007576 | JGI25152J39213_10075764 | 221 |
| 697 | 3300002774 | JGI25150J39212_1000070 | JGI25150J39212_100007025 | 221 |
| 698 | 3300002987 | JGI25159J45721_1000007 | JGI25159J45721_1000007106 | 221 |
| 699 | 3300002987 | JGI25159J45721_1000161 | JGI25159J45721_10001617 | 221 |
| 700 | 3300003187 | JGI25151J46595_10000208 | JGI25151J46595_1000020830 | 221 |
| 701 | 3300003187 | JGI25151J46595_10005630 | JGI25151J46595_100056304 | 221 |
| 702 | 3300003214 | JGI25165J46597_1000709 | JGI25165J46597_100070921 | 221 |
| 703 | 3300003214 | JGI25165J46597_1000755 | JGI25165J46597_10007558 | 221 |
| 704 | 3300003214 | JGI25165J46597_1005205 | JGI25165J46597_10052053 | 221 |
| 705 | 3300003215 | JGI25153J46596_10002457 | JGI25153J46596_100024575 | 221 |
| 706 | 3300003215 | JGI25153J46596_10005041 | JGI25153J46596_100050415 | 221 |
| 707 | 3300003215 | JGI25153J46596_10013861 | JGI25153J46596_100138612 | 221 |
| 708 | 3300003215 | JGI25153J46596_10015554 | JGI25153J46596_100155544 | 221 |
| 709 | 3300003215 | JGI25153J46596_10017728 | JGI25153J46596_100177284 | 221 |
| 710 | 3300003215 | JGI25153J46596_10021821 | JGI25153J46596_100218213 | 221 |
| 711 | 3300003354 | JGI25160J50197_1000010 | JGI25160J50197_1000010143 | 221 |
| 712 | 3300003354 | JGI25160J50197_1000011 | JGI25160J50197_1000011151 | 221 |
| 713 | 3300003354 | JGI25160J50197_1000521 | JGI25160J50197_10005217 | 221 |
| 714 | 3300003354 | JGI25160J50197_1004636 | JGI25160J50197_10046364 | 221 |
| 715 | 3300003374 | JGI25161J50226_1000006 | JGI25161J50226_1000006143 | 221 |
| 716 | 3300003374 | JGI25161J50226_1000055 | JGI25161J50226_100005567 | 221 |
| 717 | 3300003374 | JGI25161J50226_1000706 | JGI25161J50226_100070612 | 221 |
| 718 | 3300003374 | JGI25161J50226_1001998 | JGI25161J50226_10019987 | 221 |
| 719 | 3300003578 | Ga0006562J51391_1014891 | Ga0006562J51391_10148915 | 221 |
| 720 | 3300003752 | Ga0055539_1009431 | Ga0055539_10094311 | 221 |
| 721 | 3300003771 | Ga0055526_1002733 | Ga0055526_10027336 | 221 |
| 722 | 3300003771 | Ga0055526_1013247 | Ga0055526_10132474 | 221 |
| 723 | 3300003771 | Ga0055526_1017696 | Ga0055526_10176964 | 221 |
| 724 | 3300003771 | Ga0055526_1021046 | Ga0055526_10210464 | 221 |
| 725 | 3300003771 | Ga0055526_1022319 | Ga0055526_10223193 | 221 |
| 726 | 3300003775 | Ga0055524_1000766 | Ga0055524_10007662 | 221 |
| 727 | 3300003775 | Ga0055524_1001235 | Ga0055524_100123515 | 221 |
| 728 | 3300003775 | Ga0055524_1007386 | Ga0055524_10073862 | 221 |
| 729 | 3300003775 | Ga0055524_1014165 | Ga0055524_10141651 | 221 |
| 730 | 3300003775 | Ga0055524_1018212 | Ga0055524_10182121 | 221 |
| 731 | 3300003775 | Ga0055524_1021790 | Ga0055524_10217903 | 221 |
| 732 | 3300003781 | Ga0055536_1012129 | Ga0055536_10121295 | 221 |
| 733 | 3300003781 | Ga0055536_1015981 | Ga0055536_10159812 | 221 |
| 734 | 3300003790 | Ga0055528_1000222 | Ga0055528_100022241 | 221 |
| 735 | 3300003790 | Ga0055528_1002861 | Ga0055528_10028615 | 221 |
| 736 | 3300003790 | Ga0055528_1016522 | Ga0055528_10165222 | 221 |
| 737 | 3300003790 | Ga0055528_1020890 | Ga0055528_10208903 | 221 |
| 738 | 3300003790 | Ga0055528_1026284 | Ga0055528_10262843 | 221 |
| 739 | 3300003790 | Ga0055528_1036795 | Ga0055528_10367951 | 221 |
| 740 | 3300003791 | Ga0055530_10007550 | Ga0055530_100075502 | 221 |
| 741 | 3300003792 | Ga0055540_1003323 | Ga0055540_10033234 | 221 |
| 742 | 3300003792 | Ga0055540_1008157 | Ga0055540_10081575 | 221 |
| 743 | 3300003792 | Ga0055540_1012797 | Ga0055540_10127971 | 221 |
| 744 | 3300003792 | Ga0055540_1025106 | Ga0055540_10251061 | 221 |
| 745 | 3300003792 | Ga0055540_1026118 | Ga0055540_10261182 | 221 |
| 746 | 3300003794 | Ga0055531_10005192 | Ga0055531_100051928 | 221 |
| 747 | 3300003794 | Ga0055531_10034597 | Ga0055531_100345973 | 221 |
| 748 | 3300003856 | Ga0058692_1002551 | Ga0058692_10025513 | 221 |
| 749 | 3300003856 | Ga0058692_1003928 | Ga0058692_10039283 | 221 |
| 750 | 3300004625 | Ga0055543_1000014 | Ga0055543_100001449 | 221 |
| 751 | 3300004625 | Ga0055543_1000032 | Ga0055543_1000032121 | 221 |
| 752 | 3300004625 | Ga0055543_1000179 | Ga0055543_100017913 | 221 |
| 753 | 3300004625 | Ga0055543_1000312 | Ga0055543_100031229 | 221 |
| 754 | 3300005262 | Ga0065165_1000018 | Ga0065165_1000018151 | 221 |
| 755 | 3300005262 | Ga0065165_1000251 | Ga0065165_100025153 | 221 |
| 756 | 3300005262 | Ga0065165_1015153 | Ga0065165_10151534 | 221 |
| 757 | 3300005262 | Ga0065165_1016666 | Ga0065165_10166664 | 221 |
| 758 | 3300005331 | Ga0070670_100013586 | Ga0070670_1000135865 | 221 |
| 759 | 3300005335 | Ga0070666_10307247 | Ga0070666_103072472 | 221 |
| 760 | 3300005353 | Ga0070669_100071642 | Ga0070669_1000716422 | 221 |
| 761 | 3300005354 | Ga0070675_100600240 | Ga0070675_1006002402 | 221 |
| 762 | 3300005355 | Ga0070671_100098647 | Ga0070671_1000986473 | 221 |
| 763 | 3300005367 | Ga0070667_100254802 | Ga0070667_1002548022 | 221 |
| 764 | 3300005616 | Ga0068852_100114076 | Ga0068852_1001140764 | 221 |
| 765 | 3300006038 | Ga0075365_10167231 | Ga0075365_101672312 | 221 |
| 766 | 3300006038 | Ga0075365_10287947 | Ga0075365_102879472 | 221 |
| 767 | 3300006042 | Ga0075368_10000104 | Ga0075368_1000010415 | 221 |
| 768 | 3300006048 | Ga0075363_100052670 | Ga0075363_1000526704 | 221 |
| 769 | 3300006048 | Ga0075363_100355182 | Ga0075363_1003551822 | 221 |
| 770 | 3300006051 | Ga0075364_10012266 | Ga0075364_100122665 | 221 |
| 771 | 3300006177 | Ga0075362_10001584 | Ga0075362_100015845 | 221 |
| 772 | 3300006178 | Ga0075367_10006555 | Ga0075367_100065554 | 221 |
| 773 | 3300006178 | Ga0075367_10033762 | Ga0075367_100337623 | 221 |
| 774 | 3300006186 | Ga0075369_10001290 | Ga0075369_100012904 | 221 |
| 775 | 3300006186 | Ga0075369_10002414 | Ga0075369_100024144 | 221 |
| 776 | 3300006186 | Ga0075369_10159784 | Ga0075369_101597842 | 221 |
| 777 | 3300006195 | Ga0075366_10003548 | Ga0075366_100035483 | 221 |
| 778 | 3300006353 | Ga0075370_10023082 | Ga0075370_100230824 | 221 |
| 779 | 3300006353 | Ga0075370_10033426 | Ga0075370_100334265 | 221 |
| 780 | 3300006353 | Ga0075370_10034017 | Ga0075370_100340173 | 221 |
| 781 | 3300006946 | Ga0079104_1003384 | Ga0079104_10033845 | 221 |
| 782 | 3300006948 | Ga0099826_10000117 | Ga0099826_1000011732 | 221 |
| 783 | 3300006948 | Ga0099826_10163770 | Ga0099826_101637702 | 221 |
| 784 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005556 | 221 |
| 785 | 3300009148 | Ga0105243_10440864 | Ga0105243_104408642 | 221 |
| 786 | 3300009148 | Ga0105243_10982252 | Ga0105243_109822521 | 221 |
| 787 | 3300009177 | Ga0105248_10280754 | Ga0105248_102807543 | 221 |
| 788 | 3300009765 | Ga0123341_1081385 | Ga0123341_10813851 | 221 |
| 789 | 3300009766 | Ga0123342_1015299 | Ga0123342_10152996 | 221 |
| 790 | 3300009766 | Ga0123342_1021619 | Ga0123342_10216193 | 221 |
| 791 | 3300013100 | Ga0157373_10283309 | Ga0157373_102833092 | 221 |
| 792 | 3300013102 | Ga0157371_10000240 | Ga0157371_1000024068 | 221 |
| 793 | 3300013104 | Ga0157370_10000322 | Ga0157370_100003229 | 221 |
| 794 | 3300013104 | Ga0157370_10018937 | Ga0157370_100189373 | 221 |
| 795 | 3300013105 | Ga0157369_10073641 | Ga0157369_100736412 | 221 |
| 796 | 3300015690 | Ga0183363_1246 | Ga0183363_12463 | 221 |
| 797 | 3300021320 | Ga0214544_1016120 | Ga0214544_10161204 | 221 |
| 798 | 3300021321 | Ga0214542_1000245 | Ga0214542_100024567 | 221 |
| 799 | 3300021321 | Ga0214542_1018074 | Ga0214542_10180742 | 221 |
| 800 | 3300021327 | Ga0214543_1000010 | Ga0214543_100001041 | 221 |
| 801 | 3300021327 | Ga0214543_1000134 | Ga0214543_100013492 | 221 |
| 802 | 3300022739 | Ga0228711_1000007 | Ga0228711_100000799 | 221 |
| 803 | 3300022740 | Ga0228710_1000007 | Ga0228710_100000786 | 221 |
| 804 | 3300025206 | Ga0209435_100012 | Ga0209435_10001228 | 221 |
| 805 | 3300025208 | Ga0209436_100034 | Ga0209436_10003450 | 221 |
| 806 | 3300025208 | Ga0209436_100878 | Ga0209436_1008786 | 221 |
| 807 | 3300025233 | Ga0209437_100047 | Ga0209437_100047266 | 221 |
| 808 | 3300025233 | Ga0209437_100308 | Ga0209437_10030830 | 221 |
| 809 | 3300025245 | Ga0207425_1000024 | Ga0207425_100002443 | 221 |
| 810 | 3300025245 | Ga0207425_1002077 | Ga0207425_10020775 | 221 |
| 811 | 3300025245 | Ga0207425_1013645 | Ga0207425_10136453 | 221 |
| 812 | 3300025245 | Ga0207425_1024341 | Ga0207425_10243411 | 221 |
| 813 | 3300025245 | Ga0207425_1053174 | Ga0207425_10531741 | 221 |
| 814 | 3300025246 | Ga0209646_1000026 | Ga0209646_100002628 | 221 |
| 815 | 3300025246 | Ga0209646_1017629 | Ga0209646_10176292 | 221 |
| 816 | 3300025250 | Ga0209026_1000014 | Ga0209026_100001428 | 221 |
| 817 | 3300025253 | Ga0209677_100371 | Ga0209677_10037120 | 221 |
| 818 | 3300025256 | Ga0209759_1000012 | Ga0209759_100001228 | 221 |
| 819 | 3300025256 | Ga0209759_1018976 | Ga0209759_10189763 | 221 |
| 820 | 3300025258 | Ga0209129_1000069 | Ga0209129_1000069171 | 221 |
| 821 | 3300025258 | Ga0209129_1000133 | Ga0209129_100013371 | 221 |
| 822 | 3300025258 | Ga0209129_1001650 | Ga0209129_10016508 | 221 |
| 823 | 3300025258 | Ga0209129_1002620 | Ga0209129_10026206 | 221 |
| 824 | 3300025258 | Ga0209129_1003038 | Ga0209129_10030387 | 221 |
| 825 | 3300025258 | Ga0209129_1007594 | Ga0209129_10075944 | 221 |
| 826 | 3300025258 | Ga0209129_1008509 | Ga0209129_10085094 | 221 |
| 827 | 3300025261 | Ga0209233_1000048 | Ga0209233_1000048136 | 221 |
| 828 | 3300025261 | Ga0209233_1000069 | Ga0209233_1000069299 | 221 |
| 829 | 3300025261 | Ga0209233_1000221 | Ga0209233_100022182 | 221 |
| 830 | 3300025273 | Ga0209673_1000013 | Ga0209673_1000013487 | 221 |
| 831 | 3300025273 | Ga0209673_1000048 | Ga0209673_1000048140 | 221 |
| 832 | 3300025273 | Ga0209673_1000448 | Ga0209673_100044836 | 221 |
| 833 | 3300025273 | Ga0209673_1000505 | Ga0209673_100050536 | 221 |
| 834 | 3300025273 | Ga0209673_1001588 | Ga0209673_10015889 | 221 |
| 835 | 3300025273 | Ga0209673_1001697 | Ga0209673_100169719 | 221 |
| 836 | 3300025273 | Ga0209673_1003716 | Ga0209673_10037169 | 221 |
| 837 | 3300025273 | Ga0209673_1028005 | Ga0209673_10280054 | 221 |
| 838 | 3300025284 | Ga0209130_1000004 | Ga0209130_1000004144 | 221 |
| 839 | 3300025284 | Ga0209130_1000021 | Ga0209130_1000021125 | 221 |
| 840 | 3300025284 | Ga0209130_1000029 | Ga0209130_1000029104 | 221 |
| 841 | 3300025292 | Ga0209676_1035696 | Ga0209676_10356964 | 221 |
| 842 | 3300025294 | Ga0209025_1000033 | Ga0209025_100003394 | 221 |
| 843 | 3300025294 | Ga0209025_1000050 | Ga0209025_1000050284 | 221 |
| 844 | 3300025294 | Ga0209025_1000445 | Ga0209025_100044511 | 221 |
| 845 | 3300025294 | Ga0209025_1000572 | Ga0209025_100057256 | 221 |
| 846 | 3300025294 | Ga0209025_1002013 | Ga0209025_100201312 | 221 |
| 847 | 3300025294 | Ga0209025_1003067 | Ga0209025_10030675 | 221 |
| 848 | 3300025294 | Ga0209025_1016746 | Ga0209025_10167466 | 221 |
| 849 | 3300025294 | Ga0209025_1019400 | Ga0209025_10194005 | 221 |
| 850 | 3300025294 | Ga0209025_1032542 | Ga0209025_10325425 | 221 |
| 851 | 3300025294 | Ga0209025_1051708 | Ga0209025_10517083 | 221 |
| 852 | 3300025294 | Ga0209025_1075212 | Ga0209025_10752122 | 221 |
| 853 | 3300025294 | Ga0209025_1076235 | Ga0209025_10762352 | 221 |
| 854 | 3300025295 | Ga0209564_1000288 | Ga0209564_100028884 | 221 |
| 855 | 3300025295 | Ga0209564_1000375 | Ga0209564_100037552 | 221 |
| 856 | 3300025295 | Ga0209564_1000570 | Ga0209564_100057024 | 221 |
| 857 | 3300025295 | Ga0209564_1001678 | Ga0209564_100167823 | 221 |
| 858 | 3300025295 | Ga0209564_1029031 | Ga0209564_10290313 | 221 |
| 859 | 3300025295 | Ga0209564_1040273 | Ga0209564_10402733 | 221 |
| 860 | 3300025295 | Ga0209564_1044251 | Ga0209564_10442512 | 221 |
| 861 | 3300025297 | Ga0209758_1000342 | Ga0209758_100034235 | 221 |
| 862 | 3300025297 | Ga0209758_1000421 | Ga0209758_100042129 | 221 |
| 863 | 3300025297 | Ga0209758_1000468 | Ga0209758_100046810 | 221 |
| 864 | 3300025297 | Ga0209758_1002428 | Ga0209758_10024283 | 221 |
| 865 | 3300025297 | Ga0209758_1020357 | Ga0209758_10203574 | 221 |
| 866 | 3300025297 | Ga0209758_1020362 | Ga0209758_10203622 | 221 |
| 867 | 3300025297 | Ga0209758_1022889 | Ga0209758_10228894 | 221 |
| 868 | 3300025297 | Ga0209758_1024832 | Ga0209758_10248324 | 221 |
| 869 | 3300025297 | Ga0209758_1030767 | Ga0209758_10307672 | 221 |
| 870 | 3300025297 | Ga0209758_1037914 | Ga0209758_10379144 | 221 |
| 871 | 3300025298 | Ga0209050_1001717 | Ga0209050_10017175 | 221 |
| 872 | 3300025299 | Ga0209256_1000354 | Ga0209256_100035423 | 221 |
| 873 | 3300025299 | Ga0209256_1000809 | Ga0209256_10008094 | 221 |
| 874 | 3300025299 | Ga0209256_1000852 | Ga0209256_10008523 | 221 |
| 875 | 3300025299 | Ga0209256_1003719 | Ga0209256_10037198 | 221 |
| 876 | 3300025299 | Ga0209256_1008152 | Ga0209256_10081523 | 221 |
| 877 | 3300025299 | Ga0209256_1008744 | Ga0209256_10087445 | 221 |
| 878 | 3300025299 | Ga0209256_1009059 | Ga0209256_10090591 | 221 |
| 879 | 3300025299 | Ga0209256_1038436 | Ga0209256_10384361 | 221 |
| 880 | 3300025299 | Ga0209256_1075280 | Ga0209256_10752801 | 221 |
| 881 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003584 | 221 |
| 882 | 3300025302 | Ga0207426_1000010 | Ga0207426_1000010233 | 221 |
| 883 | 3300025302 | Ga0207426_1000039 | Ga0207426_100003956 | 221 |
| 884 | 3300025302 | Ga0207426_1000074 | Ga0207426_1000074194 | 221 |
| 885 | 3300025302 | Ga0207426_1001779 | Ga0207426_100177910 | 221 |
| 886 | 3300025303 | Ga0209051_1000445 | Ga0209051_100044539 | 221 |
| 887 | 3300025303 | Ga0209051_1004526 | Ga0209051_10045266 | 221 |
| 888 | 3300025303 | Ga0209051_1005330 | Ga0209051_10053304 | 221 |
| 889 | 3300025303 | Ga0209051_1028809 | Ga0209051_10288093 | 221 |
| 890 | 3300025303 | Ga0209051_1045360 | Ga0209051_10453602 | 221 |
| 891 | 3300025303 | Ga0209051_1056382 | Ga0209051_10563822 | 221 |
| 892 | 3300025304 | Ga0209257_1005388 | Ga0209257_10053887 | 221 |
| 893 | 3300025304 | Ga0209257_1013660 | Ga0209257_10136603 | 221 |
| 894 | 3300025304 | Ga0209257_1020481 | Ga0209257_10204814 | 221 |
| 895 | 3300025304 | Ga0209257_1030620 | Ga0209257_10306203 | 221 |
| 896 | 3300025304 | Ga0209257_1057283 | Ga0209257_10572831 | 221 |
| 897 | 3300025903 | Ga0207680_10351042 | Ga0207680_103510421 | 221 |
| 898 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011362 | 221 |
| 899 | 3300025914 | Ga0207671_10000674 | Ga0207671_1000067434 | 221 |
| 900 | 3300025925 | Ga0207650_10025328 | Ga0207650_100253285 | 221 |
| 901 | 3300025931 | Ga0207644_10100880 | Ga0207644_101008802 | 221 |
| 902 | 3300025941 | Ga0207711_10260335 | Ga0207711_102603352 | 221 |
| 903 | 3300025949 | Ga0207667_10168264 | Ga0207667_101682643 | 221 |
| 904 | 3300026067 | Ga0207678_10164807 | Ga0207678_101648072 | 221 |
| 905 | 3300026078 | Ga0207702_10051493 | Ga0207702_100514933 | 221 |
| 906 | 3300026142 | Ga0207698_10082949 | Ga0207698_100829493 | 221 |
| 907 | 3300026142 | Ga0207698_10866981 | Ga0207698_108669812 | 221 |
| 908 | 3300027111 | Ga0209281_1000128 | Ga0209281_1000128105 | 221 |
| 909 | 3300027312 | Ga0209371_1000058 | Ga0209371_1000058179 | 221 |
| 910 | 3300027312 | Ga0209371_1024045 | Ga0209371_10240452 | 221 |
| 911 | 3300027666 | Ga0209282_1000034 | Ga0209282_100003439 | 221 |
| 912 | 3300027666 | Ga0209282_1037976 | Ga0209282_10379764 | 221 |
| 913 | 3300027866 | Ga0209813_10001551 | Ga0209813_100015514 | 221 |
| 914 | 3300028379 | Ga0268266_10054398 | Ga0268266_100543983 | 221 |
| 915 | 3300028794 | Ga0307515_10000198 | Ga0307515_1000019859 | 221 |
| 916 | 3300028794 | Ga0307515_10033455 | Ga0307515_100334557 | 221 |
| 917 | 3300028794 | Ga0307515_10039992 | Ga0307515_100399929 | 221 |
| 918 | 3300030500 | Ga0268256_1000056 | Ga0268256_1000056169 | 221 |
| 919 | 3300030500 | Ga0268256_1029812 | Ga0268256_10298121 | 221 |
| 920 | 3300031456 | Ga0307513_10017351 | Ga0307513_100173517 | 221 |
| 921 | 3300031456 | Ga0307513_10106482 | Ga0307513_101064825 | 221 |
| 922 | 3300031731 | Ga0307405_10003205 | Ga0307405_100032055 | 221 |
| 923 | 3300031901 | Ga0307406_10013129 | Ga0307406_100131294 | 221 |
| 924 | 3300031911 | Ga0307412_10002280 | Ga0307412_100022809 | 221 |
| 925 | 3300031911 | Ga0307412_10492931 | Ga0307412_104929311 | 221 |
| 926 | 3300031967 | Ga0315914_1000010 | Ga0315914_100001077 | 221 |
| 927 | 3300032002 | Ga0307416_100331898 | Ga0307416_1003318983 | 221 |
| 928 | 3300033430 | Ga0315913_1000005 | Ga0315913_100000577 | 221 |
| 929 | 3300033464 | Ga0315915_1000012 | Ga0315915_100001286 | 221 |
| 930 | 3300035170 | Ga0373943_0428234 | Ga0373943_0428234_60_731 | 221 |
| 931 | 3300035692 | Ga0373935_0129091 | Ga0373935_0129091_68_739 | 221 |
| 932 | 3300035695 | Ga0373927_0003766 | Ga0373927_0003766_9351_10022 | 221 |
| 933 | 3300038705 | Ga0237819_00289 | Ga0237819_00289_3237_3902 | 221 |
| 934 | 3300041413 | Ga0439465_0002585 | Ga0439465_0002585_800_1471 | 221 |
| 935 | 3300041413 | Ga0439465_0028154 | Ga0439465_0028154_928_1599 | 221 |
| 936 | 3300041453 | Ga0451797_0628677 | Ga0451797_0628677_268_939 | 221 |
| 937 | 3300041458 | Ga0451798_0746823 | Ga0451798_0746823_31_702 | 221 |
| 938 | 3300041491 | Ga0451833_0980777 | Ga0451833_0980777_99_770 | 221 |
| 939 | 3300041491 | Ga0451833_1242594 | Ga0451833_1242594_61_732 | 221 |
| 940 | 3300041492 | Ga0451835_0538804 | Ga0451835_0538804_713_1384 | 221 |
| 941 | 3300041494 | Ga0451837_0158764 | Ga0451837_0158764_730_1401 | 221 |
| 942 | 3300041494 | Ga0451837_1611223 | Ga0451837_1611223_299_970 | 221 |
| 943 | 3300041496 | Ga0451839_0680386 | Ga0451839_0680386_108_779 | 221 |
| 944 | 3300041498 | Ga0451841_0496995 | Ga0451841_0496995_104_775 | 221 |
| 945 | 3300041501 | Ga0451845_0096118 | Ga0451845_0096118_1582_2253 | 221 |
| 946 | 3300041501 | Ga0451845_0189620 | Ga0451845_0189620_95_766 | 221 |
| 947 | 3300041502 | Ga0451846_27131 | Ga0451846_27131_581_1252 | 221 |
| 948 | 3300041503 | Ga0451847_0053929 | Ga0451847_0053929_913_1584 | 221 |
| 949 | 3300041503 | Ga0451847_0256758 | Ga0451847_0256758_59_730 | 221 |
| 950 | 3300041505 | Ga0451849_0151792 | Ga0451849_0151792_2479_3150 | 221 |
| 951 | 3300041507 | Ga0451851_0028592 | Ga0451851_0028592_300_971 | 221 |
| 952 | 3300041510 | Ga0451854_09483 | Ga0451854_09483_34_705 | 221 |
| 953 | 3300041511 | Ga0451855_0129778 | Ga0451855_0129778_665_1336 | 221 |
| 954 | 3300041512 | Ga0451853_0540011 | Ga0451853_0540011_850_1521 | 221 |
| 955 | 3300042004 | Ga0439445_0046947 | Ga0439445_0046947_208_879 | 221 |
| 956 | 3300042007 | Ga0439449_0027239 | Ga0439449_0027239_780_1451 | 221 |
| 957 | 3300042007 | Ga0439449_0047804 | Ga0439449_0047804_240_911 | 221 |
| 958 | 3300042007 | Ga0439449_0067289 | Ga0439449_0067289_596_1267 | 221 |
| 959 | 3300042145 | Ga0450906_018546 | Ga0450906_018546_441_1112 | 221 |
| 960 | 3300042531 | Ga0450918_012406 | Ga0450918_012406_212_883 | 221 |
| 961 | 3300044694 | Ga0466963_0018287 | Ga0466963_0018287_601_1272 | 221 |
| 962 | 3300046452 | Ga0495617_024465 | Ga0495617_024465_829_1500 | 221 |
| 963 | 3300046453 | Ga0495627_100028 | Ga0495627_100028_134_805 | 221 |
| 964 | 3300046459 | Ga0495629_0062875 | Ga0495629_0062875_585_1256 | 221 |
| 965 | 3300046460 | Ga0495638_0000912 | Ga0495638_0000912_19221_19892 | 221 |
| 966 | 3300046460 | Ga0495638_0020127 | Ga0495638_0020127_2397_3068 | 221 |
| 967 | 3300046471 | Ga0495650_0056153 | Ga0495650_0056153_606_1277 | 221 |
| 968 | 3300046474 | Ga0495605_0008173 | Ga0495605_0008173_2961_3632 | 221 |
| 969 | 3300046474 | Ga0495605_0011529 | Ga0495605_0011529_3578_4249 | 221 |
| 970 | 3300046476 | Ga0495662_0010788 | Ga0495662_0010788_388_1059 | 221 |
| 971 | 3300046492 | Ga0495585_0035896 | Ga0495585_0035896_99_770 | 221 |
| 972 | 3300046492 | Ga0495585_0095426 | Ga0495585_0095426_294_965 | 221 |
| 973 | 3300046492 | Ga0495585_0101850 | Ga0495585_0101850_268_939 | 221 |
| 974 | 3300046501 | Ga0495607_0024523 | Ga0495607_0024523_3055_3726 | 221 |
| 975 | 3300046501 | Ga0495607_0184654 | Ga0495607_0184654_108_779 | 221 |
| 976 | 3300046506 | Ga0495583_0054448 | Ga0495583_0054448_447_1118 | 221 |
| 977 | 3300046507 | Ga0495606_0002051 | Ga0495606_0002051_2451_3122 | 221 |
| 978 | 3300046507 | Ga0495606_0090738 | Ga0495606_0090738_700_1371 | 221 |
| 979 | 3300046507 | Ga0495606_0104484 | Ga0495606_0104484_103_774 | 221 |
| 980 | 3300046512 | Ga0495610_0002292 | Ga0495610_0002292_12187_12858 | 221 |
| 981 | 3300046512 | Ga0495610_0004005 | Ga0495610_0004005_10370_11041 | 221 |
| 982 | 3300046513 | Ga0495616_0035535 | Ga0495616_0035535_1125_1796 | 221 |
| 983 | 3300046515 | Ga0495620_0016413 | Ga0495620_0016413_737_1408 | 221 |
| 984 | 3300046515 | Ga0495620_0030897 | Ga0495620_0030897_247_918 | 221 |
| 985 | 3300046515 | Ga0495620_0072935 | Ga0495620_0072935_76_747 | 221 |
| 986 | 3300046518 | Ga0495631_0005366 | Ga0495631_0005366_3346_4017 | 221 |
| 987 | 3300046518 | Ga0495631_0020864 | Ga0495631_0020864_55_726 | 221 |
| 988 | 3300046519 | Ga0495632_0021734 | Ga0495632_0021734_1139_1810 | 221 |
| 989 | 3300046522 | Ga0495643_0013503 | Ga0495643_0013503_1844_2515 | 221 |
| 990 | 3300046522 | Ga0495643_0025310 | Ga0495643_0025310_2410_3081 | 221 |
| 991 | 3300046522 | Ga0495643_0036628 | Ga0495643_0036628_34_705 | 221 |
| 992 | 3300046522 | Ga0495643_0088720 | Ga0495643_0088720_612_1283 | 221 |
| 993 | 3300046522 | Ga0495643_0128687 | Ga0495643_0128687_58_729 | 221 |
| 994 | 3300046524 | Ga0495648_0024563 | Ga0495648_0024563_3286_3957 | 221 |
| 995 | 3300046525 | Ga0495663_0016020 | Ga0495663_0016020_1014_1685 | 221 |
| 996 | 3300046530 | Ga0495654_0015845 | Ga0495654_0015845_2713_3384 | 221 |
| 997 | 3300046530 | Ga0495654_0136809 | Ga0495654_0136809_72_743 | 221 |
| 998 | 3300046536 | Ga0495587_0183369 | Ga0495587_0183369_319_990 | 221 |
| 999 | 3300046538 | Ga0495609_0017745 | Ga0495609_0017745_1554_2225 | 221 |
| 1000 | 3300046538 | Ga0495609_0172511 | Ga0495609_0172511_122_793 | 221 |
| 1001 | 3300046558 | Ga0495633_0051268 | Ga0495633_0051268_655_1326 | 221 |
| 1002 | 3300046558 | Ga0495633_0116426 | Ga0495633_0116426_471_1142 | 221 |
| 1003 | 3300046615 | Ga0495656_0092219 | Ga0495656_0092219_229_900 | 221 |
| 1004 | 3300046616 | Ga0495668_0007395 | Ga0495668_0007395_5682_6353 | 221 |
| 1005 | 3300046616 | Ga0495668_0015062 | Ga0495668_0015062_3183_3854 | 221 |
| 1006 | 3300046660 | Ga0495625_0025182 | Ga0495625_0025182_3621_4292 | 221 |
| 1007 | 3300046660 | Ga0495625_0025662 | Ga0495625_0025662_3688_4359 | 221 |
| 1008 | 3300046660 | Ga0495625_0298014 | Ga0495625_0298014_286_957 | 221 |
| 1009 | 3300046660 | Ga0495625_0416977 | Ga0495625_0416977_36_707 | 221 |
| 1010 | 3300046663 | Ga0495635_0130621 | Ga0495635_0130621_440_1111 | 221 |
| 1011 | 3300046674 | Ga0495588_0024719 | Ga0495588_0024719_933_1604 | 221 |
| 1012 | 3300046674 | Ga0495588_0056886 | Ga0495588_0056886_420_1091 | 221 |
| 1013 | 3300046675 | Ga0495657_0104414 | Ga0495657_0104414_629_1300 | 221 |
| 1014 | 3300046691 | Ga0495670_0073173 | Ga0495670_0073173_790_1461 | 221 |
| 1015 | 3300046691 | Ga0495670_0108191 | Ga0495670_0108191_296_967 | 221 |
| 1016 | 3300046694 | Ga0495649_0053179 | Ga0495649_0053179_272_943 | 221 |
| 1017 | 3300046794 | Ga0495589_0106330 | Ga0495589_0106330_416_1087 | 221 |
| 1018 | 3300046809 | Ga0495600_0116323 | Ga0495600_0116323_164_835 | 221 |
| 1019 | 3300046810 | Ga0495660_0023265 | Ga0495660_0023265_608_1279 | 221 |
| 1020 | 3300046810 | Ga0495660_0029530 | Ga0495660_0029530_98_769 | 221 |
| 1021 | 3300047318 | Ga0495636_0016804 | Ga0495636_0016804_663_1334 | 221 |
| 1022 | 3300047320 | Ga0495672_0025375 | Ga0495672_0025375_2332_3003 | 221 |
| 1023 | 3300047443 | Ga0495687_020080 | Ga0495687_020080_817_1488 | 221 |
| 1024 | 3300047445 | Ga0495677_0158449 | Ga0495677_0158449_104_775 | 221 |
| 1025 | 3300047447 | Ga0495685_097265 | Ga0495685_097265_37_708 | 221 |
| 1026 | 3300047469 | Ga0495673_0034766 | Ga0495673_0034766_601_1272 | 221 |
| 1027 | 3300047470 | Ga0495681_0014636 | Ga0495681_0014636_3427_4098 | 221 |
| 1028 | 3300047470 | Ga0495681_0155790 | Ga0495681_0155790_41_712 | 221 |
| 1029 | 3300047472 | Ga0495686_0000647 | Ga0495686_0000647_23189_23860 | 221 |
| 1030 | 3300047472 | Ga0495686_0015408 | Ga0495686_0015408_3190_3861 | 221 |
| 1031 | 3300047472 | Ga0495686_0015712 | Ga0495686_0015712_3670_4341 | 221 |
| 1032 | 3300047472 | Ga0495686_0156870 | Ga0495686_0156870_97_768 | 221 |
| 1033 | 3300047472 | Ga0495686_0300845 | Ga0495686_0300845_167_838 | 221 |
| 1034 | 3300048091 | Ga0495626_0059980 | Ga0495626_0059980_613_1284 | 221 |
| 1035 | 3300048904 | Ga0496101_0153477 | Ga0496101_0153477_1000_1671 | 221 |
| 1036 | 3300048904 | Ga0496101_0670582 | Ga0496101_0670582_70_741 | 221 |
| 1037 | 3300048913 | Ga0496110_0721710 | Ga0496110_0721710_159_830 | 221 |
| 1038 | 3300048917 | Ga0496114_0107672 | Ga0496114_0107672_54_725 | 221 |
| 1039 | 3300048919 | Ga0496116_0000061 | Ga0496116_0000061_99254_99925 | 221 |
| 1040 | 3300048919 | Ga0496116_0005599 | Ga0496116_0005599_3165_3836 | 221 |
| 1041 | 3300048919 | Ga0496116_0021753 | Ga0496116_0021753_3179_3850 | 221 |
| 1042 | 3300048919 | Ga0496116_0074465 | Ga0496116_0074465_951_1622 | 221 |
| 1043 | 3300048919 | Ga0496116_0109512 | Ga0496116_0109512_476_1147 | 221 |
| 1044 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_709158_709829 | 221 |
| 1045 | 3300048920 | Ga0496117_0004483 | Ga0496117_0004483_11432_12103 | 221 |
| 1046 | 3300048920 | Ga0496117_0010604 | Ga0496117_0010604_7360_8031 | 221 |
| 1047 | 3300048920 | Ga0496117_0013487 | Ga0496117_0013487_3948_4619 | 221 |
| 1048 | 3300048921 | Ga0496118_0000319 | Ga0496118_0000319_75085_75756 | 221 |
| 1049 | 3300048921 | Ga0496118_0024477 | Ga0496118_0024477_3598_4269 | 221 |
| 1050 | 3300048921 | Ga0496118_0028865 | Ga0496118_0028865_3232_3903 | 221 |
| 1051 | 3300048921 | Ga0496118_0053316 | Ga0496118_0053316_567_1238 | 221 |
| 1052 | 3300048922 | Ga0496119_0020416 | Ga0496119_0020416_1755_2426 | 221 |
| 1053 | 3300048922 | Ga0496119_0096302 | Ga0496119_0096302_714_1385 | 221 |
| 1054 | 3300048922 | Ga0496119_0131094 | Ga0496119_0131094_640_1311 | 221 |
| 1055 | 3300048923 | Ga0496120_0003839 | Ga0496120_0003839_195_866 | 221 |
| 1056 | 3300048923 | Ga0496120_0030917 | Ga0496120_0030917_1664_2335 | 221 |
| 1057 | 3300048924 | Ga0496121_0000001 | Ga0496121_0000001_1356490_1357161 | 221 |
| 1058 | 3300048924 | Ga0496121_0014048 | Ga0496121_0014048_3887_4558 | 221 |
| 1059 | 3300048924 | Ga0496121_0022881 | Ga0496121_0022881_3374_4045 | 221 |
| 1060 | 3300048924 | Ga0496121_0024923 | Ga0496121_0024923_3875_4546 | 221 |
| 1061 | 3300048924 | Ga0496121_0028004 | Ga0496121_0028004_3058_3729 | 221 |
| 1062 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_75714_76385 | 221 |
| 1063 | 3300048925 | Ga0496122_0011969 | Ga0496122_0011969_5047_5718 | 221 |
| 1064 | 3300048925 | Ga0496122_0012830 | Ga0496122_0012830_3235_3906 | 221 |
| 1065 | 3300048925 | Ga0496122_0018017 | Ga0496122_0018017_5366_6037 | 221 |
| 1066 | 3300048925 | Ga0496122_0019101 | Ga0496122_0019101_2716_3387 | 221 |
| 1067 | 3300048925 | Ga0496122_0029942 | Ga0496122_0029942_3365_4036 | 221 |
| 1068 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_79445_80116 | 221 |
| 1069 | 3300048926 | Ga0496123_0001843 | Ga0496123_0001843_2870_3541 | 221 |
| 1070 | 3300048926 | Ga0496123_0282856 | Ga0496123_0282856_70_741 | 221 |
| 1071 | 3300048927 | Ga0496124_0001103 | Ga0496124_0001103_19563_20234 | 221 |
| 1072 | 3300048927 | Ga0496124_0003458 | Ga0496124_0003458_3489_4160 | 221 |
| 1073 | 3300048927 | Ga0496124_0004380 | Ga0496124_0004380_2602_3273 | 221 |
| 1074 | 3300048927 | Ga0496124_0009449 | Ga0496124_0009449_6382_7053 | 221 |
| 1075 | 3300048927 | Ga0496124_0021179 | Ga0496124_0021179_760_1431 | 221 |
| 1076 | 3300048927 | Ga0496124_0052290 | Ga0496124_0052290_1166_1837 | 221 |
| 1077 | 3300048927 | Ga0496124_0105954 | Ga0496124_0105954_71_742 | 221 |
| 1078 | 3300048927 | Ga0496124_0111425 | Ga0496124_0111425_483_1154 | 221 |
| 1079 | 3300048927 | Ga0496124_0130151 | Ga0496124_0130151_499_1170 | 221 |
| 1080 | 3300048927 | Ga0496124_0132613 | Ga0496124_0132613_1004_1675 | 221 |
| 1081 | 3300048927 | Ga0496124_0257510 | Ga0496124_0257510_71_742 | 221 |
| 1082 | 3300048928 | Ga0496125_0000001 | Ga0496125_0000001_1516027_1516698 | 221 |
| 1083 | 3300048928 | Ga0496125_0002540 | Ga0496125_0002540_16250_16921 | 221 |
| 1084 | 3300048928 | Ga0496125_0020129 | Ga0496125_0020129_2012_2683 | 221 |
| 1085 | 3300048928 | Ga0496125_0056623 | Ga0496125_0056623_639_1310 | 221 |
| 1086 | 3300048928 | Ga0496125_0081691 | Ga0496125_0081691_907_1578 | 221 |
| 1087 | 3300048929 | Ga0496126_0000397 | Ga0496126_0000397_59106_59777 | 221 |
| 1088 | 3300048929 | Ga0496126_0001855 | Ga0496126_0001855_2889_3560 | 221 |
| 1089 | 3300048929 | Ga0496126_0097712 | Ga0496126_0097712_1033_1704 | 221 |
| 1090 | 3300048929 | Ga0496126_0142165 | Ga0496126_0142165_1223_1894 | 221 |
| 1091 | 3300049459 | Ga0495678_010303 | Ga0495678_010303_2984_3655 | 221 |
| 1092 | 3300049570 | Ga0501033_0000059 | Ga0501033_0000059_13957_14628 | 221 |
| 1093 | 3300049571 | Ga0501034_0024880 | Ga0501034_0024880_4287_4958 | 221 |
| 1094 | 3300049571 | Ga0501034_1041119 | Ga0501034_1041119_13_684 | 221 |
| 1095 | 3300049573 | Ga0501037_0011663 | Ga0501037_0011663_3135_3806 | 221 |
| 1096 | 3300049574 | Ga0501038_0250388 | Ga0501038_0250388_507_1178 | 221 |
| 1097 | 3300049776 | Ga0501280_003727 | Ga0501280_003727_1423_2094 | 221 |
| 1098 | 3300049823 | Ga0501044_0466461 | Ga0501044_0466461_132_803 | 221 |
| 1099 | 3300050489 | nmdc:mga03683_78978_c1 | nmdc:mga03683_78978_c1_30_701 | 221 |
| 1100 | 3300050489 | nmdc:mga03683_85709_c1 | nmdc:mga03683_85709_c1_407_1078 | 221 |
| 1101 | 3300050490 | nmdc:mga03n38_44666_c1 | nmdc:mga03n38_44666_c1_217_888 | 221 |
| 1102 | 3300050491 | nmdc:mga00v17_1988_c1 | nmdc:mga00v17_1988_c1_4599_5270 | 221 |
| 1103 | 3300050491 | nmdc:mga00v17_7150_c1 | nmdc:mga00v17_7150_c1_4564_5235 | 221 |
| 1104 | 3300050492 | nmdc:mga0yw44_71024_c1 | nmdc:mga0yw44_71024_c1_1120_1791 | 221 |
| 1105 | 3300050493 | nmdc:mga0k408_19474_c1 | nmdc:mga0k408_19474_c1_1611_2282 | 221 |
| 1106 | 3300050494 | nmdc:mga06z11_5504_c1 | nmdc:mga06z11_5504_c1_3000_3671 | 221 |
| 1107 | 3300050494 | nmdc:mga06z11_7601_c1 | nmdc:mga06z11_7601_c1_2597_3268 | 221 |
| 1108 | 3300050495 | nmdc:mga04h51_1221_c1 | nmdc:mga04h51_1221_c1_1491_2162 | 221 |
| 1109 | 3300050496 | nmdc:mga07m45_49778_c1 | nmdc:mga07m45_49778_c1_484_1155 | 221 |
| 1110 | 3300050496 | nmdc:mga07m45_71936_c1 | nmdc:mga07m45_71936_c1_1163_1834 | 221 |
| 1111 | 3300050516 | nmdc:mga0sz30_110988_c1 | nmdc:mga0sz30_110988_c1_208_879 | 221 |
| 1112 | 3300050516 | nmdc:mga0sz30_4325_c1 | nmdc:mga0sz30_4325_c1_1018_1689 | 221 |
| 1113 | 3300050516 | nmdc:mga0sz30_4759_c1 | nmdc:mga0sz30_4759_c1_125_796 | 221 |
| 1114 | 3300053079 | Ga0500610_0006053 | Ga0500610_0006053_836_1507 | 221 |
| 1115 | 3300053085 | Ga0495619_0184110 | Ga0495619_0184110_652_1323 | 221 |
| 1116 | 3300053086 | Ga0500578_0024130 | Ga0500578_0024130_770_1441 | 221 |
| 1117 | 3300053109 | Ga0500569_001058 | Ga0500569_001058_2296_2967 | 221 |
| 1118 | 3300053109 | Ga0500569_037011 | Ga0500569_037011_464_1135 | 221 |
| 1119 | 3300053125 | Ga0500618_011885 | Ga0500618_011885_990_1661 | 221 |
| 1120 | 3300053125 | Ga0500618_058745 | Ga0500618_058745_140_811 | 221 |
| 1121 | 3300053134 | Ga0500658_0000646 | Ga0500658_0000646_3726_4397 | 221 |
| 1122 | 3300053139 | Ga0500568_0002207 | Ga0500568_0002207_791_1462 | 221 |
| 1123 | 3300053140 | Ga0500573_0030764 | Ga0500573_0030764_1714_2385 | 221 |
| 1124 | 3300053140 | Ga0500573_0033515 | Ga0500573_0033515_60_731 | 221 |
| 1125 | 3300053148 | Ga0500590_011111 | Ga0500590_011111_289_960 | 221 |
| 1126 | 3300053153 | Ga0500616_0002791 | Ga0500616_0002791_7158_7829 | 221 |
| 1127 | 3300053153 | Ga0500616_0011601 | Ga0500616_0011601_1844_2515 | 221 |
| 1128 | 3300053156 | Ga0500622_0000628 | Ga0500622_0000628_3942_4613 | 221 |
| 1129 | 3300053157 | Ga0500624_001829 | Ga0500624_001829_1335_2006 | 221 |
| 1130 | 3300053158 | Ga0500627_0064585 | Ga0500627_0064585_120_791 | 221 |
| 1131 | 3300053161 | Ga0500634_0010952 | Ga0500634_0010952_3879_4553 | 221 |
| 1132 | 3300053177 | Ga0500636_0000015 | Ga0500636_0000015_3120_3791 | 221 |
| 1133 | 3300053177 | Ga0500636_0015033 | Ga0500636_0015033_1216_1887 | 221 |
| 1134 | 3300053177 | Ga0500636_0153394 | Ga0500636_0153394_192_863 | 221 |
| 1135 | 3300059493 | Ga0587077_002115 | Ga0587077_002115_1328_2002 | 221 |
| 1136 | 3300059503 | Ga0587080_001009 | Ga0587080_001009_1753_2424 | 221 |
| 1137 | 3300059503 | Ga0587080_036680 | Ga0587080_036680_112_783 | 221 |
| 1138 | 3300059505 | Ga0587083_0001680 | Ga0587083_0001680_535_1206 | 221 |
| 1139 | 3300059510 | Ga0587090_000883 | Ga0587090_000883_629_1300 | 221 |
| 1140 | 3300059510 | Ga0587090_001476 | Ga0587090_001476_1330_2001 | 221 |
| 1141 | 3300059644 | Ga0587075_016922 | Ga0587075_016922_180_851 | 221 |
| 1142 | 3300059645 | Ga0587076_063086 | Ga0587076_063086_29_700 | 221 |
| 1143 | 3300059647 | Ga0587079_002090 | Ga0587079_002090_1346_2017 | 221 |
| 1144 | 3300003781 | Ga0055536_1006737 | Ga0055536_10067374 | 222 |
| 1145 | 3300003791 | Ga0055530_10012914 | Ga0055530_100129144 | 222 |
| 1146 | 3300003792 | Ga0055540_1001610 | Ga0055540_10016108 | 222 |
| 1147 | 3300003794 | Ga0055531_10003225 | Ga0055531_1000322510 | 222 |
| 1148 | 3300005262 | Ga0065165_1011958 | Ga0065165_10119584 | 222 |
| 1149 | 3300005456 | Ga0070678_100179422 | Ga0070678_1001794222 | 222 |
| 1150 | 3300005548 | Ga0070665_100178769 | Ga0070665_1001787694 | 222 |
| 1151 | 3300006038 | Ga0075365_10086473 | Ga0075365_100864734 | 222 |
| 1152 | 3300006051 | Ga0075364_10023511 | Ga0075364_100235111 | 222 |
| 1153 | 3300006946 | Ga0079104_1000022 | Ga0079104_1000022206 | 222 |
| 1154 | 3300013102 | Ga0157371_10408298 | Ga0157371_104082982 | 222 |
| 1155 | 3300013105 | Ga0157369_10082968 | Ga0157369_100829684 | 222 |
| 1156 | 3300017792 | Ga0163161_10655175 | Ga0163161_106551751 | 222 |
| 1157 | 3300025292 | Ga0209676_1009491 | Ga0209676_10094917 | 222 |
| 1158 | 3300025297 | Ga0209758_1000629 | Ga0209758_100062944 | 222 |
| 1159 | 3300025298 | Ga0209050_1004324 | Ga0209050_10043249 | 222 |
| 1160 | 3300025303 | Ga0209051_1002402 | Ga0209051_10024024 | 222 |
| 1161 | 3300025304 | Ga0209257_1002537 | Ga0209257_100253715 | 222 |
| 1162 | 3300026121 | Ga0207683_10214787 | Ga0207683_102147872 | 222 |
| 1163 | 3300027111 | Ga0209281_1000374 | Ga0209281_100037447 | 222 |
| 1164 | 3300028379 | Ga0268266_10174887 | Ga0268266_101748872 | 222 |
| 1165 | 3300032004 | Ga0307414_10923025 | Ga0307414_109230252 | 222 |
| 1166 | 3300037418 | Ga0395900_0491873 | Ga0395900_0491873_19_693 | 222 |
| 1167 | 3300037471 | Ga0395905_0000913 | Ga0395905_0000913_34964_35638 | 222 |
| 1168 | 3300044683 | Ga0466965_0036166 | Ga0466965_0036166_859_1533 | 222 |
| 1169 | 3300044735 | Ga0466968_0017268 | Ga0466968_0017268_1740_2414 | 222 |
| 1170 | 3300044765 | Ga0466970_0105796 | Ga0466970_0105796_674_1348 | 222 |
| 1171 | 3300046460 | Ga0495638_0237622 | Ga0495638_0237622_47_721 | 222 |
| 1172 | 3300046501 | Ga0495607_0053485 | Ga0495607_0053485_556_1230 | 222 |
| 1173 | 3300046530 | Ga0495654_0006310 | Ga0495654_0006310_3072_3746 | 222 |
| 1174 | 3300047472 | Ga0495686_0063374 | Ga0495686_0063374_255_929 | 222 |
| 1175 | 3300048913 | Ga0496110_0289341 | Ga0496110_0289341_208_882 | 222 |
| 1176 | 3300048924 | Ga0496121_0000751 | Ga0496121_0000751_57217_57891 | 222 |
| 1177 | 3300048924 | Ga0496121_0033069 | Ga0496121_0033069_1121_1795 | 222 |
| 1178 | 3300048924 | Ga0496121_0063385 | Ga0496121_0063385_1661_2341 | 222 |
| 1179 | 3300048924 | Ga0496121_0231473 | Ga0496121_0231473_338_1114 | 222 |
| 1180 | 3300048925 | Ga0496122_0000025 | Ga0496122_0000025_177599_178273 | 222 |
| 1181 | 3300048926 | Ga0496123_0000032 | Ga0496123_0000032_185940_186614 | 222 |
| 1182 | 3300048926 | Ga0496123_0078600 | Ga0496123_0078600_982_1656 | 222 |
| 1183 | 3300048927 | Ga0496124_0208600 | Ga0496124_0208600_676_1350 | 222 |
| 1184 | 3300048927 | Ga0496124_0214863 | Ga0496124_0214863_265_939 | 222 |
| 1185 | 3300048927 | Ga0496124_0520911 | Ga0496124_0520911_76_750 | 222 |
| 1186 | 3300048928 | Ga0496125_0000692 | Ga0496125_0000692_28036_28812 | 222 |
| 1187 | 3300049459 | Ga0495678_067728 | Ga0495678_067728_153_827 | 222 |
| 1188 | 3300049570 | Ga0501033_0229682 | Ga0501033_0229682_458_1132 | 222 |
| 1189 | 3300049571 | Ga0501034_0078998 | Ga0501034_0078998_897_1571 | 222 |
| 1190 | 3300049581 | Ga0501047_0279616 | Ga0501047_0279616_101_775 | 222 |
| 1191 | 3300049742 | Ga0501080_0464002 | Ga0501080_0464002_188_862 | 222 |
| 1192 | 3300049744 | Ga0501083_0052169 | Ga0501083_0052169_779_1453 | 222 |
| 1193 | 3300050491 | nmdc:mga00v17_391_c2 | nmdc:mga00v17_391_c2_781_1455 | 222 |
| 1194 | 3300050492 | nmdc:mga0yw44_35218_c1 | nmdc:mga0yw44_35218_c1_1576_2256 | 222 |
| 1195 | 3300053087 | Ga0500643_001930 | Ga0500643_001930_7010_7678 | 222 |
| 1196 | 3300053125 | Ga0500618_000396 | Ga0500618_000396_26331_27005 | 222 |
| 1197 | 3300053125 | Ga0500618_009682 | Ga0500618_009682_1277_1951 | 222 |
| 1198 | 3300053136 | Ga0500559_0035898 | Ga0500559_0035898_562_1236 | 222 |
| 1199 | 3300053153 | Ga0500616_0000805 | Ga0500616_0000805_33416_34096 | 222 |
| 1200 | 3300053156 | Ga0500622_0002327 | Ga0500622_0002327_4962_5636 | 222 |
| 1201 | 3300005354 | Ga0070675_100331681 | Ga0070675_1003316812 | 223 |
| 1202 | 3300025926 | Ga0207659_10256501 | Ga0207659_102565012 | 223 |
| 1203 | 3300025933 | Ga0207706_10426761 | Ga0207706_104267612 | 223 |
| 1204 | iso_pu_bacteria | 2643221626 | 2644148445 | 223 |
| 1205 | iso_pu_bacteria | 2643221655 | 2644309276 | 223 |
| 1206 | iso_pu_bacteria | 2643221659 | 2644333103 | 223 |
| 1207 | iso_pu_bacteria | 2643221698 | 2644545725 | 223 |
| 1208 | iso_pu_bacteria | 2643221712 | 2644615218 | 223 |
| 1209 | iso_pu_bacteria | 2941499720 | 2941503729 | 223 |
| 1210 | 3300006844 | Ga0075428_100442303 | Ga0075428_1004423032 | 224 |
| 1211 | 3300037466 | Ga0395898_0047273 | Ga0395898_0047273_386_1087 | 224 |
| 1212 | 3300038443 | Ga0395901_0198967 | Ga0395901_0198967_463_1164 | 224 |
| 1213 | 3300048907 | Ga0496104_0018917 | Ga0496104_0018917_2980_3681 | 224 |
| 1214 | 3300048907 | Ga0496104_0271796 | Ga0496104_0271796_456_1157 | 224 |
| 1215 | 3300048908 | Ga0496105_0032958 | Ga0496105_0032958_3120_3821 | 224 |
| 1216 | 3300048913 | Ga0496110_0149723 | Ga0496110_0149723_838_1539 | 224 |
| 1217 | 3300048913 | Ga0496110_0333451 | Ga0496110_0333451_332_1033 | 224 |
| 1218 | 3300048915 | Ga0496112_0607967 | Ga0496112_0607967_163_864 | 224 |
| 1219 | 3300048916 | Ga0496113_0058521 | Ga0496113_0058521_1824_2525 | 224 |
| 1220 | 3300048918 | Ga0496115_0238454 | Ga0496115_0238454_428_1129 | 224 |
| 1221 | 3300005445 | Ga0070708_100171611 | Ga0070708_1001716112 | 225 |
| 1222 | 3300005937 | Ga0081455_10017257 | Ga0081455_1001725710 | 225 |
| 1223 | 3300006353 | Ga0075370_10160838 | Ga0075370_101608382 | 225 |
| 1224 | 3300006847 | Ga0075431_100266156 | Ga0075431_1002661561 | 225 |
| 1225 | 3300002074 | JGI24748J21848_1012538 | JGI24748J21848_10125382 | 226 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3d54-assembly3.cif.gz_D | structure of purlqs from thermotoga maritima | 0.9054 | 1 | 222 |
| 3d54-assembly3.cif.gz_D | structure of purlqs from thermotoga maritima | 0.8973 | 1 | 222 |
| 6jta-assembly1.cif.gz_A | crystal structure of d464a l465a mutant of fgam synthetase | 0.8482 | 1 | 222 |
| 6lyl-assembly1.cif.gz_A | crystal structure of s1052d mutant of formylglycinamidine synthetase | 0.8478 | 1 | 222 |
| 3ugj-assembly1.cif.gz_A | formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling | 0.8445 | 1 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZJ1_1_219_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9394 | 3 | 221 | 3.40.50.880 |
| af_P9WHL5_1_222_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9318 | 1 | 220 | 3.40.50.880 |
| af_Q2FZJ1_1_219_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.927 | 3 | 221 | 3.40.50.880 |
| af_P9WHL5_1_222_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9157 | 1 | 220 | 3.40.50.880 |
| af_Q59042_1_229_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9125 | 3 | 223 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A380DNJ3-F1-model_v4 | Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3) | 0.9578 | 112 | 225 |
GO:0004642
GO:0005524 GO:0005737 GO:0006189 GO:0016787 |
| AF-A0A4Q3Z080-F1-model_v4 | Phosphoribosylformylglycinamidine synthase subunit PurQ | 0.9578 | 129 | 222 |
GO:0004642
GO:0005524 GO:0005737 GO:0006189 GO:0016787 |
| AF-A0A351DLM1-F1-model_v4 | deleted | 0.9568 | 116 | 225 |
|
| AF-Q3EWN9-F1-model_v4 | deleted | 0.9513 | 72 | 225 |
|
| AF-A0A2E7UG65-F1-model_v4 | Phosphoribosylformylglycinamidine synthase subunit PurQ (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (Glutaminase PurQ) (EC 3.5.1.2) (Phosphoribosylformylglycinamidine synthase subunit I) | 0.9494 | 3 | 226 |
GO:0004359
GO:0004642 GO:0005524 GO:0005737 GO:0006189 GO:0006541 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar