F491919

General Info

Members Datasets Scaffolds Average Seq Length
1225 862 667 221

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0231473|Ga0496121_0231473_338_1114
Length 258
Sequence VGLLSQSDGESCGALAFWSKTDHKASHQFRHSKDRPMKAAVIVFPGLNRDRDMIAALTKIGGVAPAVVWHQEADIPDVDLIVIPGGFSYGDYLRCGAIAARSPMMDKVRERAAKGVKVLGVCNGFQILIEAGLLPGALMRNTSLKFVCREVKLEVTNTDNAFTSGYAKGQIIRCPVAHHDGNYFADAETLAALEGDGRVAFRYAEGTNPNGSMNNIAGILNAEKNVLGLMPHPENLIESAHGGVDGRALFAALLDKAA

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516143018 Ensifer sp. BR816 Isolate Nodule
40 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
41 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
42 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
43 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
44 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
45 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
46 2519899620 Rhizobium sp. Pop5 Isolate Nodule
47 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
48 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
49 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
50 2534681786 Brucella suis 92/29 Isolate Unclassified
51 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
52 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
53 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
54 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
55 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
56 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
57 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
58 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
59 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
60 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
61 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
62 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
63 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
64 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
65 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
66 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
67 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
68 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
69 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
70 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
71 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
72 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
73 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
74 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
75 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
76 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
77 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
78 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
79 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
80 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
81 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
82 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
83 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
84 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
85 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
86 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
87 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
88 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
89 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
90 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
91 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
92 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
93 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
94 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
95 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
96 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
97 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
98 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
99 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
100 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
101 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
102 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
103 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
104 2643221557 Ensifer sp. Root558 Isolate Unclassified
105 2643221558 Rhizobium sp. Root149 Isolate Unclassified
106 2643221568 Rhizobium sp. Root564 Isolate Unclassified
107 2643221580 Devosia sp. Root635 Isolate Unclassified
108 2643221582 Rhizobium sp. Root651 Isolate Unclassified
109 2643221591 Devosia sp. Root685 Isolate Unclassified
110 2643221599 Rhizobium sp. Root708 Isolate Unclassified
111 2643221607 Rhizobium sp. Root73 Isolate Unclassified
112 2643221610 Ensifer sp. Root74 Isolate Unclassified
113 2643221626 Ensifer sp. Root31 Isolate Unclassified
114 2643221629 Devosia sp. Root105 Isolate Unclassified
115 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
116 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
117 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
118 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
119 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
120 2643221655 Ensifer sp. Root1252 Isolate Unclassified
121 2643221659 Ensifer sp. Root127 Isolate Unclassified
122 2643221662 Devosia sp. Root413D1 Isolate Unclassified
123 2643221668 Ensifer sp. Root423 Isolate Unclassified
124 2643221674 Devosia sp. Root436 Isolate Unclassified
125 2643221675 Ensifer sp. Root1298 Isolate Unclassified
126 2643221680 Ensifer sp. Root1312 Isolate Unclassified
127 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
128 2643221688 Rhizobium sp. Root482 Isolate Unclassified
129 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
130 2643221693 Rhizobium sp. Root491 Isolate Unclassified
131 2643221698 Ensifer sp. Root142 Isolate Unclassified
132 2643221712 Ensifer sp. Root258 Isolate Unclassified
133 2643221718 Rhizobium sp. Root268 Isolate Unclassified
134 2643221719 Rhizobium sp. Root274 Isolate Unclassified
135 2643221723 Ensifer sp. Root278 Isolate Unclassified
136 2643221726 Ensifer sp. Root954 Isolate Unclassified
137 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
138 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
139 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
140 2718217882 Rhizobium sp. N741 Isolate Nodule
141 2718217927 Rhizobium sp. N324 Isolate Nodule
142 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
143 2718218009 Rhizobium sp. N561 Isolate Nodule
144 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
145 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
146 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
147 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
148 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
149 2718218363 Rhizobium sp. N113 Isolate Nodule
150 2718218365 Rhizobium sp. N731 Isolate Nodule
151 2718218366 Rhizobium sp. N621 Isolate Nodule
152 2718218423 Rhizobium sp. N941 Isolate Nodule
153 2721755514 Rhizobium sp. N6212 Isolate Nodule
154 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
155 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
156 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
157 2721755809 Rhizobium sp. N541 Isolate Nodule
158 2721755810 Rhizobium sp. N871 Isolate Nodule
159 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
160 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
161 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
162 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
163 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
164 2728369365 Rhizobium sp. N1341 Isolate Nodule
165 2728369397 Rhizobium sp. N1314 Isolate Nodule
166 2738541293 Rhizobium sp. GV031 Isolate Unclassified
167 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
168 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
169 2751185800 Brucella pituitosa AA2 Isolate Unclassified
170 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
171 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
172 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
173 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
174 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
175 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
176 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
177 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
178 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
179 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
180 2791355256 Rhizobium sp. M10 Isolate Nodule
181 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
182 2791355260 Rhizobium sp. L9 Isolate Nodule
183 2791355261 Rhizobium sp. J15 Isolate Nodule
184 2791355262 Rhizobium sp. M1 Isolate Nodule
185 2791355263 Rhizobium chutanense C5 Isolate Nodule
186 2791355264 Rhizobium sp. S9 Isolate Nodule
187 2791355265 Rhizobium sp. H4 Isolate Nodule
188 2791355266 Rhizobium sp. L43 Isolate Nodule
189 2791355267 Rhizobium sp. L18 Isolate Nodule
190 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
191 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
192 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
193 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
194 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
195 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
196 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
197 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
198 2802429633 Rhizobium anhuiense J3 Isolate Nodule
199 2802429634 Rhizobium anhuiense S10 Isolate Nodule
200 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
201 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
202 2802429637 Rhizobium anhuiense C15 Isolate Nodule
203 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
204 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
205 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
206 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
207 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
208 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
209 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
210 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
211 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
212 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
213 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
214 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
215 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
216 2838048938 Rhizobium pisi 27/80 Isolate Nodule
217 2838061910 Rhizobium phaseoli L15 Isolate Nodule
218 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
219 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
220 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
221 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
222 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
223 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
224 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
225 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
226 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
227 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
228 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
229 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
230 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
231 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
232 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
233 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
234 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
235 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
236 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
237 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
238 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
239 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
240 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
241 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
242 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
243 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
244 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
245 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
246 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
247 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
248 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
249 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
250 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
251 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
252 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
253 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
254 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
255 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
256 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
257 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
258 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
259 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
260 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
261 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
262 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
263 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
264 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
265 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
266 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
267 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
268 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
269 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
270 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
271 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
272 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
273 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
274 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
275 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
276 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
277 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
278 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
279 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
280 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
281 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
282 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
283 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
284 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
285 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
286 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
287 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
288 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
289 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
290 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
291 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
292 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
293 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
294 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
295 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
296 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
297 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
298 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
299 2844163670 Ensifer sp. 1H6 Isolate Unclassified
300 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
301 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
302 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
303 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
304 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
305 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
306 2854911287 Brucella lupini LUP21 Isolate Unclassified
307 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
308 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
309 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
310 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
311 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
312 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
313 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
314 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
315 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
316 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
317 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
318 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
319 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
320 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
321 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
322 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
323 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
324 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
325 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
326 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
327 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
328 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
329 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
330 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
331 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
332 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
333 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
334 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
335 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
336 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
337 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
338 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
339 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
340 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
341 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
342 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
343 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
344 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
345 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
346 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
347 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
348 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
349 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
350 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
351 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
352 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
353 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
354 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
355 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
356 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
357 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
358 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
359 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
360 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
361 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
362 2932401849 Devosia sp. 2618 Isolate Rhizosphere
363 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
364 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
365 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
366 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
367 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
368 2933599457 Rhizobium phaseoli M3 Isolate Nodule
369 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
370 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
371 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
372 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
373 2936381700 Rhizobium chutanense C16 Isolate Unclassified
374 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
375 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
376 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
377 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
378 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
379 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
380 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
381 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
382 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
383 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
384 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
385 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
386 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
387 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
388 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
389 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
390 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
391 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
392 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
393 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
394 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
395 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
396 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
397 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
398 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
399 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
400 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
401 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
402 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
403 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
404 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
405 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
406 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
407 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
408 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
409 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
410 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
411 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
412 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
413 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
414 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
415 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
416 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
417 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
418 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
419 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
420 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
421 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
422 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
423 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
424 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
425 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
426 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
427 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
428 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
429 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
430 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
431 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
432 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
433 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
434 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
435 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
436 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
437 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
438 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
439 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
440 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
441 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
442 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
443 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
444 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
445 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
446 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
447 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
448 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
449 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
450 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
451 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
452 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
453 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
454 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
455 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
456 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
457 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
458 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
459 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
460 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
461 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
462 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
463 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
464 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
465 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
466 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
467 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
468 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
469 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
470 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
471 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
472 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
473 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
474 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
475 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
476 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
477 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
478 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
479 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
480 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
481 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
482 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
483 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
484 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
485 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
486 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
487 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
488 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
489 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
490 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
491 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
492 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
493 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
494 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
495 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
496 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
497 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
498 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
499 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
500 2996887358 Rhizobium sp. R711 Isolate Nodule
501 2996893221 Rhizobium sp. R635 Isolate Nodule
502 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
503 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
504 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
505 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
506 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
507 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
508 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
509 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
510 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
511 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
512 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
513 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
514 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
515 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
516 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
517 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
518 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
519 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
520 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
521 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
522 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
523 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
524 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
525 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
526 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
527 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
528 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
529 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
530 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
531 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
532 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
533 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
534 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
535 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
536 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
537 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
538 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
539 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
540 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
541 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
542 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
543 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
544 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
545 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
546 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
547 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
548 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
549 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
550 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
551 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
552 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
553 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
554 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
555 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
556 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
557 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
558 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
559 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
560 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
561 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
562 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
563 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
564 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
565 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
566 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
567 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
568 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
569 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
570 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
571 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
572 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
573 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
574 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
575 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
576 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
577 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
578 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
579 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
580 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
581 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
582 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
583 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
584 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
585 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
586 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
587 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
588 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
589 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
590 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
591 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
592 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
593 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
594 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
595 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
596 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
597 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
598 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
599 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
600 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
601 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
602 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
603 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
604 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
605 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
606 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
607 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
608 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
609 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
610 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
611 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
612 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
613 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
614 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
615 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
616 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
617 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
618 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
619 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
620 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
621 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
622 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
623 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
624 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
625 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
626 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
627 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
628 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
629 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
630 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
631 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
632 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
633 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
634 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
635 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
636 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
637 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
638 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
639 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
640 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
641 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
642 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
643 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
644 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
645 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
646 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
647 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
648 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
649 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
650 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
651 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
652 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
653 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
654 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
655 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
656 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
657 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
658 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
659 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
660 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
661 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
662 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
663 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
664 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
665 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
666 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
667 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
668 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
669 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
670 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
671 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
672 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
673 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
674 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
675 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
676 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
677 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
678 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
679 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
680 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
681 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
682 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
683 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
684 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
685 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
686 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
687 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
688 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
689 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
690 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
691 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
692 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
693 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
694 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
695 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
696 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
697 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
698 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
699 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
700 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
701 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
702 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
703 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
704 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
705 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
706 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
707 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
708 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
709 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
710 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
711 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
712 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
713 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
714 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
715 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
716 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
717 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
718 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
719 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
720 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
721 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
722 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
723 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
724 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
725 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
726 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
727 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
728 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
729 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
730 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
731 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
732 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
733 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
734 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
735 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
736 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
737 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
738 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
739 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
740 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
741 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
742 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
743 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
744 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
745 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
746 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
747 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
748 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
749 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
750 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
751 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
752 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
753 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
754 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
755 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
756 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
757 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
758 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
759 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
760 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
761 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
762 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
763 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
764 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
765 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
766 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
767 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
768 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
769 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
770 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
771 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
772 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
773 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
774 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
775 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
776 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
777 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
778 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
779 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
780 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
781 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
782 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
783 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
784 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
785 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
786 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
787 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
788 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
789 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
790 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
791 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
792 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
793 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
794 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
795 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
796 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
797 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
798 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
799 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
800 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
801 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
802 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
803 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
804 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
805 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
806 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
807 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
808 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
809 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
810 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
811 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
812 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
813 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
814 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
815 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
816 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
817 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
818 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
819 8005258706 Rhizobium sp. R693 Isolate Nodule
820 8005275841 Rhizobium sp. N4311 Isolate Nodule
821 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
822 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
823 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
824 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
825 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
826 8005321885 Rhizobium sp. R72 Isolate Nodule
827 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
828 8005382845 Rhizobium sp. R634 Isolate Nodule
829 8005395548 Rhizobium sp. R339 Isolate Nodule
830 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
831 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
832 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
833 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
834 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
835 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
836 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
837 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
838 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
839 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
840 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
841 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
842 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
843 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
844 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
845 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
846 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
847 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
848 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
849 8018176218 Rhizobium sp. N122 Isolate Nodule
850 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
851 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
852 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
853 8024501048 Rhizobium sp. H4 Isolate Nodule
854 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
855 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
856 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
857 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
858 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
859 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
860 8056382006 Rhizobium croatiense 13T Isolate Nodule
861 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
862 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.39
Metatranscriptomes 1.06
Isolates 45.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 20
Nodule 33.47
Rhizoplane 2.29
Rhizosphere 26.45
Stem 0
Stem Tuber 0
Unclassified 17.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1012538 3300002074 Bacteria 1001
2 JGI25156J39149_1000174 3300002705 Bacteria 47087
3 JGI25162J39368_1000240 3300002737 Bacteria 54635
4 JGI25162J39368_1000394 3300002737 Bacteria 36901
5 JGI25154J39366_1000011 3300002738 Bacteria 296007
6 JGI25158J39367_1000755 3300002739 Bacteria 6207
7 JGI25157J39369_1000218 3300002741 Bacteria 47085
8 JGI25152J39213_1001242 3300002773 Bacteria 11655
9 JGI25152J39213_1003244 3300002773 Bacteria 5648
10 JGI25152J39213_1006666 3300002773 Bacteria 3091
11 JGI25152J39213_1007576 3300002773 Bacteria 2794
12 JGI25150J39212_1000070 3300002774 Bacteria 61799
13 JGI25159J45721_1000007 3300002987 Bacteria 176362
14 JGI25159J45721_1000161 3300002987 Bacteria 31760
15 JGI25151J46595_10000208 3300003187 Bacteria 71857
16 JGI25151J46595_10005630 3300003187 Bacteria 6440
17 JGI25165J46597_1000709 3300003214 Bacteria 26301
18 JGI25165J46597_1000755 3300003214 Bacteria 24825
19 JGI25165J46597_1005205 3300003214 Bacteria 2564
20 JGI25153J46596_10002457 3300003215 Bacteria 10678
21 JGI25153J46596_10005041 3300003215 Bacteria 6985
22 JGI25153J46596_10013861 3300003215 Bacteria 3383
23 JGI25153J46596_10015554 3300003215 Bacteria 3091
24 JGI25153J46596_10017728 3300003215 Bacteria 2794
25 JGI25153J46596_10021821 3300003215 Bacteria 2378
26 JGI25160J50197_1000010 3300003354 Bacteria 279365
27 JGI25160J50197_1000011 3300003354 Bacteria 275577
28 JGI25160J50197_1000521 3300003354 Bacteria 22453
29 JGI25160J50197_1004636 3300003354 Bacteria 5908
30 JGI25161J50226_1000006 3300003374 Bacteria 279563
31 JGI25161J50226_1000055 3300003374 Bacteria 104131
32 JGI25161J50226_1000706 3300003374 Bacteria 13094
33 JGI25161J50226_1001998 3300003374 Bacteria 5585
34 Ga0006562J51391_1006992 3300003578 Bacteria 2060
35 Ga0006562J51391_1014891 3300003578 Bacteria 2540
36 Ga0055539_1009431 3300003752 Bacteria 1211
37 Ga0055526_1002733 3300003771 Bacteria 11728
38 Ga0055526_1013247 3300003771 Bacteria 3504
39 Ga0055526_1017696 3300003771 Bacteria 2708
40 Ga0055526_1021046 3300003771 Bacteria 2287
41 Ga0055526_1022319 3300003771 Bacteria 2158
42 Ga0055524_1000766 3300003775 Bacteria 21629
43 Ga0055524_1001235 3300003775 Bacteria 15060
44 Ga0055524_1007386 3300003775 Bacteria 4673
45 Ga0055524_1014165 3300003775 Bacteria 2970
46 Ga0055524_1018212 3300003775 Bacteria 2446
47 Ga0055524_1021790 3300003775 Bacteria 2112
48 Ga0055536_1006737 3300003781 Bacteria 5272
49 Ga0055536_1012129 3300003781 Bacteria 3227
50 Ga0055536_1015981 3300003781 Bacteria 2536
51 Ga0055528_1000222 3300003790 Bacteria 47898
52 Ga0055528_1002861 3300003790 Bacteria 8991
53 Ga0055528_1016522 3300003790 Bacteria 2604
54 Ga0055528_1020890 3300003790 Bacteria 2102
55 Ga0055528_1026284 3300003790 Bacteria 1678
56 Ga0055528_1036795 3300003790 Bacteria 1162
57 Ga0055530_10007550 3300003791 Bacteria 4553
58 Ga0055530_10012914 3300003791 Bacteria 2884
59 Ga0055540_1001610 3300003792 Bacteria 13152
60 Ga0055540_1003323 3300003792 Bacteria 7832
61 Ga0055540_1008157 3300003792 Bacteria 3814
62 Ga0055540_1012797 3300003792 Bacteria 2608
63 Ga0055540_1025106 3300003792 Bacteria 1466
64 Ga0055540_1026118 3300003792 Bacteria 1417
65 Ga0055531_10003225 3300003794 Bacteria 10464
66 Ga0055531_10005192 3300003794 Bacteria 7664
67 Ga0055531_10034597 3300003794 Bacteria 1599
68 Ga0058692_1002551 3300003856 Bacteria 6035
69 Ga0058692_1003928 3300003856 Bacteria 4499
70 Ga0055543_1000014 3300004625 Bacteria 177906
71 Ga0055543_1000032 3300004625 Bacteria 130218
72 Ga0055543_1000179 3300004625 Bacteria 52563
73 Ga0055543_1000312 3300004625 Bacteria 33737
74 Ga0065165_1000018 3300005262 Bacteria 275082
75 Ga0065165_1000251 3300005262 Bacteria 93020
76 Ga0065165_1011958 3300005262 Bacteria 3570
77 Ga0065165_1015153 3300005262 Bacteria 2954
78 Ga0065165_1016666 3300005262 Bacteria 2741
79 Ga0070658_10129447 3300005327 Bacteria 2103
80 Ga0070658_10164634 3300005327 Bacteria 1862
81 Ga0070658_10246751 3300005327 Bacteria 1514
82 Ga0070670_100013586 3300005331 Bacteria 6979
83 Ga0070666_10307247 3300005335 Bacteria 1130
84 Ga0068868_100175080 3300005338 Bacteria 1778
85 Ga0070660_100029463 3300005339 Bacteria 4114
86 Ga0070660_100112458 3300005339 Bacteria 2167
87 Ga0070661_100037811 3300005344 Bacteria 3512
88 Ga0070661_100270971 3300005344 Bacteria 1315
89 Ga0070669_100071642 3300005353 Bacteria 2564
90 Ga0070675_100331681 3300005354 Bacteria 1346
91 Ga0070675_100600240 3300005354 Bacteria 998
92 Ga0070671_100098647 3300005355 Bacteria 2451
93 Ga0070674_100009304 3300005356 Bacteria 5881
94 Ga0070673_100285879 3300005364 Bacteria 1448
95 Ga0070673_100348882 3300005364 Bacteria 1313
96 Ga0070659_100013307 3300005366 Bacteria 6120
97 Ga0070659_100117275 3300005366 Bacteria 2153
98 Ga0070667_100254802 3300005367 Bacteria 1570
99 Ga0070708_100171611 3300005445 Bacteria 2025
100 Ga0070663_100367814 3300005455 Bacteria 1168
101 Ga0070663_100949656 3300005455 Bacteria 745
102 Ga0070678_100046022 3300005456 Bacteria 3126
103 Ga0070678_100179422 3300005456 Bacteria 1732
104 Ga0068853_100152949 3300005539 Bacteria 2078
105 Ga0068853_100157980 3300005539 Bacteria 2044
106 Ga0070672_100278328 3300005543 Bacteria 1414
107 Ga0070665_100114859 3300005548 Bacteria 2695
108 Ga0070665_100178769 3300005548 Bacteria 2123
109 Ga0070665_100223866 3300005548 Bacteria 1882
110 Ga0068855_100122067 3300005563 Bacteria 2982
111 Ga0068855_100423006 3300005563 Bacteria 1457
112 Ga0068854_100028834 3300005578 Bacteria 3839
113 Ga0068854_100412500 3300005578 Bacteria 1120
114 Ga0068852_100006203 3300005616 Bacteria 8619
115 Ga0068852_100007647 3300005616 Bacteria 7903
116 Ga0068852_100114076 3300005616 Bacteria 2462
117 Ga0068851_10221141 3300005834 Bacteria 1064
118 Ga0081455_10017257 3300005937 Bacteria 6928
119 Ga0075365_10086473 3300006038 Bacteria 2131
120 Ga0075365_10167231 3300006038 Bacteria 1534
121 Ga0075365_10287947 3300006038 Bacteria 1156
122 Ga0075365_10404484 3300006038 Bacteria 963
123 Ga0075368_10000104 3300006042 Bacteria 21606
124 Ga0075368_10065762 3300006042 Bacteria 1457
125 Ga0075363_100052670 3300006048 Bacteria 2173
126 Ga0075363_100355182 3300006048 Bacteria 856
127 Ga0075364_10012266 3300006051 Bacteria 5240
128 Ga0075364_10023511 3300006051 Bacteria 3902
129 Ga0075362_10001584 3300006177 Bacteria 7369
130 Ga0075362_10014041 3300006177 Bacteria 3223
131 Ga0075367_10006555 3300006178 Bacteria 5892
132 Ga0075367_10033762 3300006178 Bacteria 2951
133 Ga0075369_10001290 3300006186 Bacteria 8522
134 Ga0075369_10002414 3300006186 Bacteria 6663
135 Ga0075369_10159784 3300006186 Bacteria 1033
136 Ga0075366_10003548 3300006195 Bacteria 8248
137 Ga0075366_10031472 3300006195 Bacteria 3122
138 Ga0075370_10023082 3300006353 Bacteria 3423
139 Ga0075370_10033426 3300006353 Bacteria 2880
140 Ga0075370_10034017 3300006353 Bacteria 2856
141 Ga0075370_10062474 3300006353 Bacteria 2122
142 Ga0075370_10160838 3300006353 Bacteria 1318
143 Ga0075428_100442303 3300006844 Bacteria 1392
144 Ga0075431_100266156 3300006847 Bacteria 1738
145 Ga0079104_1000022 3300006946 Bacteria 223522
146 Ga0079104_1003384 3300006946 Bacteria 7472
147 Ga0099826_10000117 3300006948 Bacteria 36698
148 Ga0099826_10163770 3300006948 Bacteria 1257
149 Ga0105240_10000005 3300009093 Bacteria 702630
150 Ga0105243_10440864 3300009148 Bacteria 1219
151 Ga0105243_10982252 3300009148 Bacteria 846
152 Ga0105241_10166290 3300009174 Bacteria 1818
153 Ga0105248_10280754 3300009177 Bacteria 1875
154 Ga0105237_10002572 3300009545 Bacteria 22387
155 Ga0105238_10003838 3300009551 Bacteria 14926
156 Ga0105238_10279354 3300009551 Bacteria 1651
157 Ga0123341_1081385 3300009765 Bacteria 1263
158 Ga0123342_1015299 3300009766 Bacteria 7020
159 Ga0123342_1021619 3300009766 Bacteria 4491
160 Ga0105239_10001022 3300010375 Bacteria 39112
161 Ga0105239_10125354 3300010375 Bacteria 2854
162 Ga0157373_10283309 3300013100 Bacteria 1175
163 Ga0157371_10000240 3300013102 Bacteria 78391
164 Ga0157371_10022856 3300013102 Bacteria 4574
165 Ga0157371_10408298 3300013102 Bacteria 994
166 Ga0157370_10000322 3300013104 Bacteria 59997
167 Ga0157370_10017118 3300013104 Bacteria 7318
168 Ga0157370_10018937 3300013104 Bacteria 6921
169 Ga0157370_10114005 3300013104 Bacteria 2525
170 Ga0157369_10073641 3300013105 Bacteria 3664
171 Ga0157369_10082968 3300013105 Bacteria 3429
172 Ga0157378_10379844 3300013297 Bacteria 1387
173 Ga0157372_10037628 3300013307 Bacteria 5339
174 Ga0157372_10109904 3300013307 Bacteria 3157
175 Ga0157372_10754347 3300013307 Bacteria 1131
176 Ga0163163_10197904 3300014325 Bacteria 2058
177 Ga0183363_1246 3300015690 Bacteria 9239
178 Ga0163161_10655175 3300017792 Bacteria 870
179 Ga0214544_1016120 3300021320 Bacteria 7390
180 Ga0214542_1000245 3300021321 Bacteria 90699
181 Ga0214542_1018074 3300021321 Bacteria 6107
182 Ga0214543_1000010 3300021327 Bacteria 364844
183 Ga0214543_1000134 3300021327 Bacteria 102056
184 Ga0228711_1000007 3300022739 Bacteria 202413
185 Ga0228710_1000007 3300022740 Bacteria 189104
186 Ga0209435_100012 3300025206 Bacteria 401621
187 Ga0209436_100034 3300025208 Bacteria 80089
188 Ga0209436_100878 3300025208 Bacteria 12002
189 Ga0209437_100047 3300025233 Bacteria 405163
190 Ga0209437_100308 3300025233 Bacteria 66019
191 Ga0207425_1000024 3300025245 Bacteria 328978
192 Ga0207425_1002077 3300025245 Bacteria 7441
193 Ga0207425_1013645 3300025245 Bacteria 1870
194 Ga0207425_1024341 3300025245 Bacteria 1259
195 Ga0207425_1053174 3300025245 Bacteria 733
196 Ga0209646_1000026 3300025246 Bacteria 401621
197 Ga0209646_1017629 3300025246 Bacteria 1051
198 Ga0209026_1000014 3300025250 Bacteria 401621
199 Ga0209677_100371 3300025253 Bacteria 27456
200 Ga0209759_1000012 3300025256 Bacteria 401621
201 Ga0209759_1018976 3300025256 Bacteria 1647
202 Ga0209129_1000069 3300025258 Bacteria 212790
203 Ga0209129_1000133 3300025258 Bacteria 126018
204 Ga0209129_1001650 3300025258 Bacteria 12079
205 Ga0209129_1002620 3300025258 Bacteria 8565
206 Ga0209129_1003038 3300025258 Bacteria 7611
207 Ga0209129_1007594 3300025258 Bacteria 3193
208 Ga0209129_1008509 3300025258 Bacteria 2846
209 Ga0209233_1000048 3300025261 Bacteria 453669
210 Ga0209233_1000069 3300025261 Bacteria 367639
211 Ga0209233_1000221 3300025261 Bacteria 104090
212 Ga0209673_1000013 3300025273 Bacteria 571633
213 Ga0209673_1000048 3300025273 Bacteria 287976
214 Ga0209673_1000448 3300025273 Bacteria 70096
215 Ga0209673_1000505 3300025273 Bacteria 64374
216 Ga0209673_1001588 3300025273 Bacteria 20087
217 Ga0209673_1001697 3300025273 Bacteria 18711
218 Ga0209673_1003716 3300025273 Bacteria 8740
219 Ga0209673_1028005 3300025273 Bacteria 1823
220 Ga0209130_1000004 3300025284 Bacteria 633436
221 Ga0209130_1000021 3300025284 Bacteria 374278
222 Ga0209130_1000029 3300025284 Bacteria 323399
223 Ga0209676_1009491 3300025292 Bacteria 4190
224 Ga0209676_1035696 3300025292 Bacteria 1455
225 Ga0209025_1000033 3300025294 Bacteria 414511
226 Ga0209025_1000050 3300025294 Bacteria 331531
227 Ga0209025_1000445 3300025294 Bacteria 81092
228 Ga0209025_1000572 3300025294 Bacteria 66863
229 Ga0209025_1002013 3300025294 Bacteria 23196
230 Ga0209025_1003067 3300025294 Bacteria 16404
231 Ga0209025_1016746 3300025294 Bacteria 4292
232 Ga0209025_1019400 3300025294 Bacteria 3783
233 Ga0209025_1032542 3300025294 Bacteria 2434
234 Ga0209025_1051708 3300025294 Bacteria 1629
235 Ga0209025_1075212 3300025294 Bacteria 1175
236 Ga0209025_1076235 3300025294 Bacteria 1162
237 Ga0209564_1000288 3300025295 Bacteria 102088
238 Ga0209564_1000375 3300025295 Bacteria 82204
239 Ga0209564_1000570 3300025295 Bacteria 58555
240 Ga0209564_1001678 3300025295 Bacteria 21104
241 Ga0209564_1029031 3300025295 Bacteria 1751
242 Ga0209564_1040273 3300025295 Bacteria 1271
243 Ga0209564_1044251 3300025295 Bacteria 1157
244 Ga0209758_1000342 3300025297 Bacteria 86095
245 Ga0209758_1000421 3300025297 Bacteria 71884
246 Ga0209758_1000468 3300025297 Bacteria 66625
247 Ga0209758_1000629 3300025297 Bacteria 54026
248 Ga0209758_1002428 3300025297 Bacteria 19044
249 Ga0209758_1020357 3300025297 Bacteria 3143
250 Ga0209758_1020362 3300025297 Bacteria 3143
251 Ga0209758_1022889 3300025297 Bacteria 2846
252 Ga0209758_1024832 3300025297 Bacteria 2655
253 Ga0209758_1030767 3300025297 Bacteria 2216
254 Ga0209758_1037914 3300025297 Bacteria 1856
255 Ga0209050_1001717 3300025298 Bacteria 21872
256 Ga0209050_1004324 3300025298 Bacteria 9694
257 Ga0209256_1000354 3300025299 Bacteria 74714
258 Ga0209256_1000809 3300025299 Bacteria 40091
259 Ga0209256_1000852 3300025299 Bacteria 38024
260 Ga0209256_1003719 3300025299 Bacteria 10336
261 Ga0209256_1008152 3300025299 Bacteria 4928
262 Ga0209256_1008744 3300025299 Bacteria 4614
263 Ga0209256_1009059 3300025299 Bacteria 4446
264 Ga0209256_1038436 3300025299 Bacteria 1240
265 Ga0209256_1075280 3300025299 Bacteria 749
266 Ga0207426_1000003 3300025302 Bacteria 1063212
267 Ga0207426_1000010 3300025302 Bacteria 796003
268 Ga0207426_1000039 3300025302 Bacteria 439937
269 Ga0207426_1000074 3300025302 Bacteria 323399
270 Ga0207426_1001779 3300025302 Bacteria 16197
271 Ga0209051_1000445 3300025303 Bacteria 55846
272 Ga0209051_1002402 3300025303 Bacteria 13472
273 Ga0209051_1004526 3300025303 Bacteria 8526
274 Ga0209051_1005330 3300025303 Bacteria 7565
275 Ga0209051_1028809 3300025303 Bacteria 2185
276 Ga0209051_1045360 3300025303 Bacteria 1522
277 Ga0209051_1056382 3300025303 Bacteria 1267
278 Ga0209257_1002537 3300025304 Bacteria 17887
279 Ga0209257_1005388 3300025304 Bacteria 9016
280 Ga0209257_1013660 3300025304 Bacteria 3581
281 Ga0209257_1020481 3300025304 Bacteria 2443
282 Ga0209257_1030620 3300025304 Bacteria 1734
283 Ga0209257_1057283 3300025304 Bacteria 1072
284 Ga0207656_10244087 3300025321 Bacteria 878
285 Ga0207680_10351042 3300025903 Bacteria 1036
286 Ga0207705_10054317 3300025909 Bacteria 2887
287 Ga0207654_10314967 3300025911 Bacteria 1068
288 Ga0207695_10000011 3300025913 Bacteria 910221
289 Ga0207671_10000215 3300025914 Bacteria 87204
290 Ga0207671_10000674 3300025914 Bacteria 44575
291 Ga0207657_10015111 3300025919 Bacteria 7498
292 Ga0207657_10071717 3300025919 Bacteria 2932
293 Ga0207649_10036319 3300025920 Bacteria 2967
294 Ga0207649_10159130 3300025920 Bacteria 1563
295 Ga0207652_10433192 3300025921 Bacteria 1186
296 Ga0207650_10025328 3300025925 Bacteria 4226
297 Ga0207659_10256501 3300025926 Bacteria 1421
298 Ga0207644_10100880 3300025931 Bacteria 2168
299 Ga0207690_10056613 3300025932 Bacteria 2646
300 Ga0207706_10426761 3300025933 Bacteria 1148
301 Ga0207691_10080054 3300025940 Bacteria 2939
302 Ga0207711_10260335 3300025941 Bacteria 1594
303 Ga0207667_10003395 3300025949 Bacteria 19649
304 Ga0207667_10047558 3300025949 Bacteria 4540
305 Ga0207667_10168264 3300025949 Bacteria 2253
306 Ga0207667_11064612 3300025949 Bacteria 793
307 Ga0207640_10388493 3300025981 Bacteria 1133
308 Ga0207639_10312668 3300026041 Bacteria 1392
309 Ga0207678_10164807 3300026067 Bacteria 1892
310 Ga0207702_10051493 3300026078 Bacteria 3480
311 Ga0207702_10108226 3300026078 Bacteria 2466
312 Ga0207674_10017245 3300026116 Bacteria 7877
313 Ga0207683_10017007 3300026121 Bacteria 6190
314 Ga0207683_10214787 3300026121 Bacteria 1751
315 Ga0207698_10082949 3300026142 Bacteria 2593
316 Ga0207698_10274625 3300026142 Bacteria 1555
317 Ga0207698_10866981 3300026142 Bacteria 909
318 Ga0209281_1000128 3300027111 Bacteria 199265
319 Ga0209281_1000374 3300027111 Bacteria 71684
320 Ga0209371_1000058 3300027312 Bacteria 237920
321 Ga0209371_1024045 3300027312 Bacteria 1423
322 Ga0209282_1000034 3300027666 Bacteria 140100
323 Ga0209282_1037976 3300027666 Bacteria 2891
324 Ga0209813_10001551 3300027866 Bacteria 5151
325 Ga0268266_10000255 3300028379 Bacteria 89930
326 Ga0268266_10054398 3300028379 Bacteria 3439
327 Ga0268266_10174887 3300028379 Bacteria 1951
328 Ga0268266_10387595 3300028379 Bacteria 1319
329 Ga0307515_10000198 3300028794 Bacteria 147738
330 Ga0307515_10033455 3300028794 Bacteria 8462
331 Ga0307515_10039992 3300028794 Bacteria 7430
332 Ga0307515_10172811 3300028794 Bacteria 2145
333 Ga0268256_1000056 3300030500 Bacteria 231684
334 Ga0268256_1029812 3300030500 Bacteria 1330
335 Ga0265331_10087739 3300031250 Bacteria 1440
336 Ga0307513_10017351 3300031456 Bacteria 8633
337 Ga0307513_10106482 3300031456 Bacteria 2810
338 Ga0307405_10003205 3300031731 Bacteria 7456
339 Ga0307413_10084466 3300031824 Bacteria 2046
340 Ga0307410_10647580 3300031852 Bacteria 886
341 Ga0307406_10013129 3300031901 Bacteria 4738
342 Ga0307412_10002280 3300031911 Bacteria 10620
343 Ga0307412_10142993 3300031911 Bacteria 1755
344 Ga0307412_10492931 3300031911 Bacteria 1018
345 Ga0315914_1000010 3300031967 Bacteria 171642
346 Ga0307416_100331898 3300032002 Bacteria 1529
347 Ga0307414_10168684 3300032004 Bacteria 1747
348 Ga0307414_10911093 3300032004 Bacteria 806
349 Ga0307414_10923025 3300032004 Bacteria 801
350 Ga0315913_1000005 3300033430 Bacteria 171651
351 Ga0315915_1000012 3300033464 Bacteria 199284
352 Ga0373943_0428234 3300035170 Bacteria 766
353 Ga0316574_0388862 3300035398 Bacteria 879
354 Ga0373935_0129091 3300035692 Bacteria 1697
355 Ga0373927_0003766 3300035695 Bacteria 10769
356 Ga0395899_0172848 3300037312 Bacteria 1520
357 Ga0395900_0491873 3300037418 Bacteria 1178
358 Ga0395898_0047273 3300037466 Bacteria 4224
359 Ga0395898_0709546 3300037466 Bacteria 947
360 Ga0395905_0000913 3300037471 Bacteria 38168
361 Ga0395901_0198967 3300038443 Bacteria 2100
362 Ga0395901_0331385 3300038443 Bacteria 1573
363 Ga0237819_00289 3300038705 Bacteria 18507
364 Ga0439465_0002585 3300041413 Bacteria 5897
365 Ga0439465_0028154 3300041413 Bacteria 1781
366 Ga0451797_0628677 3300041453 Bacteria 1119
367 Ga0451798_0746823 3300041458 Bacteria 921
368 Ga0451833_0980777 3300041491 Bacteria 864
369 Ga0451833_1242594 3300041491 Bacteria 1686
370 Ga0451835_0538804 3300041492 Bacteria 1857
371 Ga0451837_0158764 3300041494 Bacteria 1482
372 Ga0451837_1611223 3300041494 Bacteria 1064
373 Ga0451839_0680386 3300041496 Bacteria 3577
374 Ga0451841_0496995 3300041498 Bacteria 1075
375 Ga0451845_0096118 3300041501 Bacteria 2347
376 Ga0451845_0189620 3300041501 Bacteria 1816
377 Ga0451846_27131 3300041502 Bacteria 1859
378 Ga0451847_0053929 3300041503 Bacteria 1691
379 Ga0451847_0256758 3300041503 Bacteria 811
380 Ga0451849_0151792 3300041505 Bacteria 3244
381 Ga0451851_0028592 3300041507 Bacteria 1065
382 Ga0451854_09483 3300041510 Bacteria 851
383 Ga0451855_0129778 3300041511 Bacteria 1396
384 Ga0451853_0540011 3300041512 Bacteria 1628
385 Ga0439445_0046947 3300042004 Bacteria 1159
386 Ga0439449_0027239 3300042007 Bacteria 2133
387 Ga0439449_0047804 3300042007 Bacteria 1584
388 Ga0439449_0067289 3300042007 Bacteria 1321
389 Ga0450906_018546 3300042145 Bacteria 1248
390 Ga0450918_012406 3300042531 Bacteria 1486
391 Ga0466965_0036166 3300044683 Bacteria 2422
392 Ga0466963_0018287 3300044694 Bacteria 4379
393 Ga0466968_0017268 3300044735 Bacteria 2883
394 Ga0466970_0105796 3300044765 Bacteria 1535
395 Ga0466957_0049509 3300044842 Bacteria 2555
396 Ga0466957_0524924 3300044842 Bacteria 823
397 Ga0466960_0437234 3300044901 Bacteria 758
398 Ga0495617_024465 3300046452 Bacteria 2038
399 Ga0495627_100028 3300046453 Bacteria 828
400 Ga0495629_0062875 3300046459 Bacteria 2592
401 Ga0495638_0000912 3300046460 Bacteria 30176
402 Ga0495638_0020127 3300046460 Bacteria 4409
403 Ga0495638_0237622 3300046460 Bacteria 1010
404 Ga0495650_0056153 3300046471 Bacteria 1599
405 Ga0495605_0008173 3300046474 Bacteria 5916
406 Ga0495605_0011529 3300046474 Bacteria 4923
407 Ga0495662_0010788 3300046476 Bacteria 4468
408 Ga0495585_0035896 3300046492 Bacteria 2799
409 Ga0495585_0095426 3300046492 Bacteria 1597
410 Ga0495585_0101850 3300046492 Bacteria 1535
411 Ga0495607_0024523 3300046501 Bacteria 3759
412 Ga0495607_0053485 3300046501 Bacteria 2333
413 Ga0495607_0184654 3300046501 Bacteria 1043
414 Ga0495583_0054448 3300046506 Bacteria 1811
415 Ga0495606_0002051 3300046507 Bacteria 24670
416 Ga0495606_0008842 3300046507 Bacteria 8632
417 Ga0495606_0090738 3300046507 Bacteria 1880
418 Ga0495606_0104484 3300046507 Bacteria 1719
419 Ga0495610_0002292 3300046512 Bacteria 16169
420 Ga0495610_0004005 3300046512 Bacteria 11119
421 Ga0495616_0035535 3300046513 Bacteria 2578
422 Ga0495620_0016413 3300046515 Bacteria 3716
423 Ga0495620_0030897 3300046515 Bacteria 2460
424 Ga0495620_0072935 3300046515 Bacteria 1401
425 Ga0495631_0005366 3300046518 Bacteria 6721
426 Ga0495631_0020864 3300046518 Bacteria 3056
427 Ga0495632_0021734 3300046519 Bacteria 3452
428 Ga0495643_0013503 3300046522 Bacteria 4884
429 Ga0495643_0025310 3300046522 Bacteria 3359
430 Ga0495643_0036628 3300046522 Bacteria 2694
431 Ga0495643_0088720 3300046522 Bacteria 1598
432 Ga0495643_0128687 3300046522 Bacteria 1273
433 Ga0495648_0024563 3300046524 Bacteria 4101
434 Ga0495663_0016020 3300046525 Bacteria 2117
435 Ga0495654_0006310 3300046530 Bacteria 6747
436 Ga0495654_0015845 3300046530 Bacteria 3996
437 Ga0495654_0136809 3300046530 Bacteria 1095
438 Ga0495587_0183369 3300046536 Bacteria 1186
439 Ga0495609_0017745 3300046538 Bacteria 3302
440 Ga0495609_0172511 3300046538 Bacteria 913
441 Ga0495633_0051268 3300046558 Bacteria 1945
442 Ga0495633_0116426 3300046558 Bacteria 1238
443 Ga0495656_0092219 3300046615 Bacteria 1387
444 Ga0495668_0007395 3300046616 Bacteria 7030
445 Ga0495668_0015062 3300046616 Bacteria 4523
446 Ga0495625_0025182 3300046660 Bacteria 4515
447 Ga0495625_0025662 3300046660 Bacteria 4466
448 Ga0495625_0298014 3300046660 Bacteria 1032
449 Ga0495625_0416977 3300046660 Bacteria 836
450 Ga0495635_0130621 3300046663 Bacteria 1712
451 Ga0495588_0024719 3300046674 Bacteria 2986
452 Ga0495588_0056886 3300046674 Bacteria 2020
453 Ga0495657_0104414 3300046675 Bacteria 1802
454 Ga0495670_0073173 3300046691 Bacteria 1737
455 Ga0495670_0108191 3300046691 Bacteria 1437
456 Ga0495649_0053179 3300046694 Bacteria 2193
457 Ga0495589_0106330 3300046794 Bacteria 1356
458 Ga0495600_0116323 3300046809 Bacteria 1740
459 Ga0495660_0023265 3300046810 Bacteria 3534
460 Ga0495660_0029530 3300046810 Bacteria 3092
461 Ga0495636_0016804 3300047318 Bacteria 2926
462 Ga0495672_0025375 3300047320 Bacteria 3795
463 Ga0495687_020080 3300047443 Bacteria 3264
464 Ga0495677_0158449 3300047445 Bacteria 873
465 Ga0495685_097265 3300047447 Bacteria 973
466 Ga0495673_0034766 3300047469 Bacteria 2328
467 Ga0495681_0014636 3300047470 Bacteria 4483
468 Ga0495681_0155790 3300047470 Bacteria 955
469 Ga0495686_0000647 3300047472 Bacteria 47618
470 Ga0495686_0015408 3300047472 Bacteria 5221
471 Ga0495686_0015712 3300047472 Bacteria 5158
472 Ga0495686_0020495 3300047472 Bacteria 4407
473 Ga0495686_0063374 3300047472 Bacteria 2291
474 Ga0495686_0156870 3300047472 Bacteria 1332
475 Ga0495686_0300845 3300047472 Bacteria 885
476 Ga0495626_0059980 3300048091 Bacteria 1735
477 Ga0496100_0192193 3300048903 Bacteria 1482
478 Ga0496101_0153477 3300048904 Bacteria 1762
479 Ga0496101_0670582 3300048904 Bacteria 819
480 Ga0496102_0062055 3300048905 Bacteria 3422
481 Ga0496103_0039140 3300048906 Bacteria 2913
482 Ga0496104_0018917 3300048907 Bacteria 6292
483 Ga0496104_0271796 3300048907 Bacteria 1607
484 Ga0496105_0032958 3300048908 Bacteria 4253
485 Ga0496106_0088740 3300048909 Bacteria 2384
486 Ga0496110_0149723 3300048913 Bacteria 2113
487 Ga0496110_0289341 3300048913 Bacteria 1492
488 Ga0496110_0333451 3300048913 Bacteria 1382
489 Ga0496110_0721710 3300048913 Bacteria 899
490 Ga0496112_0607967 3300048915 Bacteria 1025
491 Ga0496113_0058521 3300048916 Bacteria 2900
492 Ga0496114_0107672 3300048917 Bacteria 2385
493 Ga0496115_0238454 3300048918 Bacteria 1499
494 Ga0496116_0000061 3300048919 Bacteria 271860
495 Ga0496116_0005599 3300048919 Bacteria 11573
496 Ga0496116_0021753 3300048919 Bacteria 4826
497 Ga0496116_0074465 3300048919 Bacteria 2135
498 Ga0496116_0109512 3300048919 Bacteria 1628
499 Ga0496116_0118184 3300048919 Bacteria 1540
500 Ga0496117_0000002 3300048920 Bacteria 2483758
501 Ga0496117_0002365 3300048920 Bacteria 24063
502 Ga0496117_0004483 3300048920 Bacteria 15362
503 Ga0496117_0010604 3300048920 Bacteria 8365
504 Ga0496117_0013487 3300048920 Bacteria 7125
505 Ga0496118_0000319 3300048921 Bacteria 83025
506 Ga0496118_0007494 3300048921 Bacteria 11546
507 Ga0496118_0024477 3300048921 Bacteria 5207
508 Ga0496118_0028865 3300048921 Bacteria 4663
509 Ga0496118_0053316 3300048921 Bacteria 3076
510 Ga0496119_0015656 3300048922 Bacteria 5819
511 Ga0496119_0020416 3300048922 Bacteria 4835
512 Ga0496119_0035179 3300048922 Bacteria 3285
513 Ga0496119_0096302 3300048922 Bacteria 1670
514 Ga0496119_0131094 3300048922 Bacteria 1366
515 Ga0496120_0003839 3300048923 Bacteria 13203
516 Ga0496120_0030917 3300048923 Bacteria 3248
517 Ga0496120_0039142 3300048923 Bacteria 2800
518 Ga0496121_0000001 3300048924 Bacteria 1830318
519 Ga0496121_0000751 3300048924 Bacteria 59594
520 Ga0496121_0001108 3300048924 Bacteria 47472
521 Ga0496121_0014048 3300048924 Bacteria 8546
522 Ga0496121_0022881 3300048924 Bacteria 6040
523 Ga0496121_0024923 3300048924 Bacteria 5701
524 Ga0496121_0028004 3300048924 Bacteria 5257
525 Ga0496121_0033069 3300048924 Bacteria 4688
526 Ga0496121_0058880 3300048924 Bacteria 3172
527 Ga0496121_0063385 3300048924 Bacteria 3021
528 Ga0496121_0220374 3300048924 Bacteria 1337
529 Ga0496121_0231473 3300048924 Bacteria 1294
530 Ga0496122_0000001 3300048925 Bacteria 1827766
531 Ga0496122_0000025 3300048925 Bacteria 362915
532 Ga0496122_0011969 3300048925 Bacteria 8704
533 Ga0496122_0012830 3300048925 Bacteria 8287
534 Ga0496122_0018017 3300048925 Bacteria 6549
535 Ga0496122_0019101 3300048925 Bacteria 6283
536 Ga0496122_0022990 3300048925 Bacteria 5517
537 Ga0496122_0029942 3300048925 Bacteria 4574
538 Ga0496123_0000001 3300048926 Bacteria 1831497
539 Ga0496123_0000032 3300048926 Bacteria 285282
540 Ga0496123_0001843 3300048926 Bacteria 27830
541 Ga0496123_0014765 3300048926 Bacteria 6449
542 Ga0496123_0016765 3300048926 Bacteria 5927
543 Ga0496123_0078600 3300048926 Bacteria 2020
544 Ga0496123_0282856 3300048926 Bacteria 800
545 Ga0496124_0001103 3300048927 Bacteria 42448
546 Ga0496124_0003458 3300048927 Bacteria 19299
547 Ga0496124_0004380 3300048927 Bacteria 16510
548 Ga0496124_0009449 3300048927 Bacteria 10044
549 Ga0496124_0021179 3300048927 Bacteria 5994
550 Ga0496124_0052290 3300048927 Bacteria 3470
551 Ga0496124_0105954 3300048927 Bacteria 2270
552 Ga0496124_0111425 3300048927 Bacteria 2201
553 Ga0496124_0130151 3300048927 Bacteria 2000
554 Ga0496124_0132613 3300048927 Bacteria 1977
555 Ga0496124_0208600 3300048927 Bacteria 1480
556 Ga0496124_0214863 3300048927 Bacteria 1452
557 Ga0496124_0257510 3300048927 Bacteria 1286
558 Ga0496124_0520911 3300048927 Bacteria 792
559 Ga0496125_0000001 3300048928 Bacteria 1766138
560 Ga0496125_0000692 3300048928 Bacteria 55634
561 Ga0496125_0002540 3300048928 Bacteria 23527
562 Ga0496125_0020129 3300048928 Bacteria 6273
563 Ga0496125_0056623 3300048928 Bacteria 3182
564 Ga0496125_0081691 3300048928 Bacteria 2467
565 Ga0496125_0131192 3300048928 Bacteria 1764
566 Ga0496126_0000397 3300048929 Bacteria 89305
567 Ga0496126_0001855 3300048929 Bacteria 30802
568 Ga0496126_0097712 3300048929 Bacteria 2573
569 Ga0496126_0142165 3300048929 Bacteria 2064
570 Ga0496126_0194293 3300048929 Bacteria 1717
571 Ga0495678_010303 3300049459 Bacteria 4552
572 Ga0495678_067728 3300049459 Bacteria 1318
573 Ga0501031_0077079 3300049568 Bacteria 2171
574 Ga0501033_0000059 3300049570 Bacteria 105311
575 Ga0501033_0073761 3300049570 Bacteria 2505
576 Ga0501033_0229682 3300049570 Bacteria 1319
577 Ga0501034_0000681 3300049571 Bacteria 51656
578 Ga0501034_0024880 3300049571 Bacteria 6091
579 Ga0501034_0025162 3300049571 Bacteria 6059
580 Ga0501034_0078998 3300049571 Bacteria 3293
581 Ga0501034_0977035 3300049571 Bacteria 731
582 Ga0501034_1041119 3300049571 Bacteria 701
583 Ga0501036_0116900 3300049572 Bacteria 2252
584 Ga0501037_0011663 3300049573 Bacteria 6471
585 Ga0501037_0052820 3300049573 Bacteria 2972
586 Ga0501038_0250388 3300049574 Bacteria 1403
587 Ga0501039_0036877 3300049575 Bacteria 3772
588 Ga0501039_0096796 3300049575 Bacteria 2301
589 Ga0501039_0184246 3300049575 Bacteria 1642
590 Ga0501047_0115549 3300049581 Bacteria 2565
591 Ga0501047_0279616 3300049581 Bacteria 1514
592 Ga0501070_0086425 3300049586 Bacteria 2596
593 Ga0501071_0196109 3300049587 Bacteria 1516
594 Ga0501080_0106106 3300049742 Bacteria 2604
595 Ga0501080_0464002 3300049742 Bacteria 1134
596 Ga0501083_0052169 3300049744 Bacteria 2749
597 Ga0501280_003727 3300049776 Bacteria 2309
598 Ga0501044_0466461 3300049823 Bacteria 1167
599 nmdc:mga03683_5837_c1 3300050489 Bacteria 3265
600 nmdc:mga03683_78978_c1 3300050489 Bacteria 1418
601 nmdc:mga03683_85709_c1 3300050489 Bacteria 1367
602 nmdc:mga03n38_44666_c1 3300050490 Bacteria 1948
603 nmdc:mga00v17_1988_c1 3300050491 Bacteria 10552
604 nmdc:mga00v17_391_c2 3300050491 Bacteria 3431
605 nmdc:mga00v17_7150_c1 3300050491 Bacteria 5948
606 nmdc:mga0yw44_135503_c1 3300050492 Bacteria 1597
607 nmdc:mga0yw44_35218_c1 3300050492 Bacteria 2940
608 nmdc:mga0yw44_71024_c1 3300050492 Bacteria 2160
609 nmdc:mga0k408_19474_c1 3300050493 Bacteria 3794
610 nmdc:mga0k408_219545_c1 3300050493 Bacteria 1135
611 nmdc:mga0k408_222849_c1 3300050493 Bacteria 1126
612 nmdc:mga0k408_45587_c1 3300050493 Bacteria 2530
613 nmdc:mga06z11_400795_c1 3300050494 Bacteria 826
614 nmdc:mga06z11_5504_c1 3300050494 Bacteria 5088
615 nmdc:mga06z11_7601_c1 3300050494 Bacteria 4472
616 nmdc:mga04h51_1221_c1 3300050495 Bacteria 5939
617 nmdc:mga04h51_84905_c1 3300050495 Bacteria 1130
618 nmdc:mga07m45_39154_c1 3300050496 Bacteria 2648
619 nmdc:mga07m45_49778_c1 3300050496 Bacteria 2360
620 nmdc:mga07m45_71936_c1 3300050496 Bacteria 1968
621 nmdc:mga0sz30_110988_c1 3300050516 Bacteria 1202
622 nmdc:mga0sz30_4325_c1 3300050516 Bacteria 3357
623 nmdc:mga0sz30_4759_c1 3300050516 Bacteria 4931
624 Ga0500610_0006053 3300053079 Bacteria 5031
625 Ga0495619_0184110 3300053085 Bacteria 1445
626 Ga0500578_0024130 3300053086 Bacteria 3906
627 Ga0500643_001930 3300053087 Bacteria 11241
628 Ga0500562_034819 3300053108 Bacteria 1333
629 Ga0500569_001058 3300053109 Bacteria 5006
630 Ga0500569_037011 3300053109 Bacteria 1408
631 Ga0500595_012447 3300053119 Bacteria 3292
632 Ga0500618_000396 3300053125 Bacteria 29987
633 Ga0500618_009682 3300053125 Bacteria 2621
634 Ga0500618_011885 3300053125 Bacteria 2297
635 Ga0500618_058745 3300053125 Bacteria 866
636 Ga0500658_0000646 3300053134 Bacteria 14414
637 Ga0500559_0035898 3300053136 Bacteria 2142
638 Ga0500559_0043963 3300053136 Bacteria 1953
639 Ga0500568_0002207 3300053139 Bacteria 11706
640 Ga0500568_0216500 3300053139 Bacteria 700
641 Ga0500573_0030764 3300053140 Bacteria 3096
642 Ga0500573_0033515 3300053140 Bacteria 2963
643 Ga0500590_011111 3300053148 Bacteria 4555
644 Ga0500604_0001014 3300053151 Bacteria 7840
645 Ga0500616_0000805 3300053153 Bacteria 35836
646 Ga0500616_0002791 3300053153 Bacteria 14065
647 Ga0500616_0008883 3300053153 Bacteria 6173
648 Ga0500616_0011601 3300053153 Bacteria 5194
649 Ga0500622_0000628 3300053156 Bacteria 31779
650 Ga0500622_0002327 3300053156 Bacteria 13880
651 Ga0500624_001829 3300053157 Bacteria 3083
652 Ga0500627_0064585 3300053158 Bacteria 1615
653 Ga0500634_0000025 3300053161 Bacteria 81954
654 Ga0500634_0010952 3300053161 Bacteria 4654
655 Ga0500636_0000015 3300053177 Bacteria 123980
656 Ga0500636_0015033 3300053177 Bacteria 4557
657 Ga0500636_0153394 3300053177 Bacteria 1263
658 Ga0501084_0875682 3300054114 Bacteria 756
659 Ga0587077_002115 3300059493 Bacteria 2292
660 Ga0587080_001009 3300059503 Bacteria 2838
661 Ga0587080_036680 3300059503 Bacteria 877
662 Ga0587083_0001680 3300059505 Bacteria 2559
663 Ga0587090_000883 3300059510 Bacteria 2797
664 Ga0587090_001476 3300059510 Bacteria 2392
665 Ga0587075_016922 3300059644 Bacteria 1042
666 Ga0587076_063086 3300059645 Bacteria 752
667 Ga0587079_002090 3300059647 Bacteria 2385

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053139 Ga0500568_0216500 Ga0500568_0216500_32_610 192
2 3300050494 nmdc:mga06z11_400795_c1 nmdc:mga06z11_400795_c1_166_783 203
3 3300044901 Ga0466960_0437234 Ga0466960_0437234_105_728 204
4 3300048903 Ga0496100_0192193 Ga0496100_0192193_634_1257 205
5 3300048905 Ga0496102_0062055 Ga0496102_0062055_264_887 205
6 3300048906 Ga0496103_0039140 Ga0496103_0039140_2233_2856 205
7 3300048909 Ga0496106_0088740 Ga0496106_0088740_619_1242 205
8 3300048919 Ga0496116_0118184 Ga0496116_0118184_729_1352 205
9 3300048920 Ga0496117_0002365 Ga0496117_0002365_23371_23994 205
10 3300048921 Ga0496118_0007494 Ga0496118_0007494_10854_11477 205
11 3300048922 Ga0496119_0015656 Ga0496119_0015656_1728_2351 205
12 3300048923 Ga0496120_0039142 Ga0496120_0039142_771_1394 205
13 3300048924 Ga0496121_0001108 Ga0496121_0001108_23481_24104 205
14 3300048925 Ga0496122_0022990 Ga0496122_0022990_4187_4810 205
15 3300048926 Ga0496123_0016765 Ga0496123_0016765_4534_5157 205
16 3300050493 nmdc:mga0k408_219545_c1 nmdc:mga0k408_219545_c1_16_639 207
17 3300028794 Ga0307515_10172811 Ga0307515_101728111 210
18 iso_pu_bacteria 2643221629 2644167737 215
19 iso_pu_bacteria 2643221662 2644349197 215
20 iso_pu_bacteria 2534681786 2535484577 216
21 iso_pu_bacteria 2643221580 2643911425 216
22 iso_pu_bacteria 2643221591 2643963131 216
23 iso_pu_bacteria 2643221674 2644413986 216
24 iso_pu_bacteria 2751185800 2753359158 216
25 iso_pu_bacteria 2758568016 2758641404 216
26 iso_pu_bacteria 2854911287 2854915181 216
27 iso_pu_bacteria 2889790730 2889794793 216
28 iso_pu_bacteria 2889914905 2889916689 216
29 iso_pu_bacteria 2915650412 2915651670 216
30 iso_pu_bacteria 2932401849 2932402911 216
31 iso_pu_bacteria 2508501122 2509107572 217
32 iso_pu_bacteria 2509276019 2509375904 217
33 iso_pu_bacteria 2509276021 2509386727 217
34 iso_pu_bacteria 2509276033 2509443201 217
35 iso_pu_bacteria 2510065019 2510133267 217
36 iso_pu_bacteria 2510065057 2510306369 217
37 iso_pu_bacteria 2510461069 2510841630 217
38 iso_pu_bacteria 2510461076 2510894634 217
39 iso_pu_bacteria 2510917022 2511135072 217
40 iso_pu_bacteria 2510917028 2511182312 217
41 iso_pu_bacteria 2510917030 2511200043 217
42 iso_pu_bacteria 2511231052 2511501740 217
43 iso_pu_bacteria 2512047086 2512533185 217
44 iso_pu_bacteria 2512875026 2512971313 217
45 iso_pu_bacteria 2513237084 2513572326 217
46 iso_pu_bacteria 2513237085 2513579681 217
47 iso_pu_bacteria 2513237086 2513588369 217
48 iso_pu_bacteria 2513237088 2513594546 217
49 iso_pu_bacteria 2513237089 2513604023 217
50 iso_pu_bacteria 2513237091 2513619703 217
51 iso_pu_bacteria 2513237093 2513634449 217
52 iso_pu_bacteria 2513237103 2513708777 217
53 iso_pu_bacteria 2513237138 2513864605 217
54 iso_pu_bacteria 2513237140 2513883719 217
55 iso_pu_bacteria 2513237143 2513905423 217
56 iso_pu_bacteria 2513237144 2513913065 217
57 iso_pu_bacteria 2513237146 2513926286 217
58 iso_pu_bacteria 2513237156 2513988000 217
59 iso_pu_bacteria 2513237159 2513997250 217
60 iso_pu_bacteria 2513237160 2514006249 217
61 iso_pu_bacteria 2513237162 2514021583 217
62 iso_pu_bacteria 2515075009 2515112226 217
63 iso_pu_bacteria 2515154107 2515608612 217
64 iso_pu_bacteria 2515154113 2515637223 217
65 iso_pu_bacteria 2515154114 2515639728 217
66 iso_pu_bacteria 2515154116 2515657372 217
67 iso_pu_bacteria 2515154134 2515738624 217
68 iso_pu_bacteria 2516143018 2516209534 217
69 iso_pu_bacteria 2516653046 2516893040 217
70 iso_pu_bacteria 2516653077 2517035956 217
71 iso_pu_bacteria 2516653085 2517076351 217
72 iso_pu_bacteria 2517093000 2517095109 217
73 iso_pu_bacteria 2517287029 2517406742 217
74 iso_pu_bacteria 2517487022 2517569804 217
75 iso_pu_bacteria 2519899620 2520376019 217
76 iso_pu_bacteria 2524023207 2524448985 217
77 iso_pu_bacteria 2524023209 2524460318 217
78 iso_pu_bacteria 2529292951 2530645482 217
79 iso_pu_bacteria 2534681796 2535516459 217
80 iso_pu_bacteria 2537561587 2537873760 217
81 iso_pu_bacteria 2551306084 2551677789 217
82 iso_pu_bacteria 2551306085 2551686316 217
83 iso_pu_bacteria 2551306086 2551694810 217
84 iso_pu_bacteria 2551306087 2551698000 217
85 iso_pu_bacteria 2551306090 2551717142 217
86 iso_pu_bacteria 2551306091 2551730462 217
87 iso_pu_bacteria 2551306092 2551738176 217
88 iso_pu_bacteria 2551306093 2551743027 217
89 iso_pu_bacteria 2554235003 2554248005 217
90 iso_pu_bacteria 2558860100 2558868178 217
91 iso_pu_bacteria 2558860242 2559295123 217
92 iso_pu_bacteria 2558860983 2561466338 217
93 iso_pu_bacteria 2582581283 2585165949 217
94 iso_pu_bacteria 2582581294 2585200125 217
95 iso_pu_bacteria 2582581298 2585224303 217
96 iso_pu_bacteria 2582581299 2585230022 217
97 iso_pu_bacteria 2582581304 2585254721 217
98 iso_pu_bacteria 2582581306 2585267970 217
99 iso_pu_bacteria 2582581307 2585270813 217
100 iso_pu_bacteria 2582581308 2585277163 217
101 iso_pu_bacteria 2582581315 2585323828 217
102 iso_pu_bacteria 2582581316 2585331806 217
103 iso_pu_bacteria 2582581865 2585386926 217
104 iso_pu_bacteria 2582581866 2585396896 217
105 iso_pu_bacteria 2582581867 2585401972 217
106 iso_pu_bacteria 2585427526 2585527593 217
107 iso_pu_bacteria 2585427527 2585534101 217
108 iso_pu_bacteria 2585427528 2585537495 217
109 iso_pu_bacteria 2585427529 2585546424 217
110 iso_pu_bacteria 2585427530 2585552048 217
111 iso_pu_bacteria 2585427531 2585558535 217
112 iso_pu_bacteria 2585427590 2585821757 217
113 iso_pu_bacteria 2585427593 2585835445 217
114 iso_pu_bacteria 2585427594 2585846700 217
115 iso_pu_bacteria 2585427608 2585897901 217
116 iso_pu_bacteria 2585427609 2585904494 217
117 iso_pu_bacteria 2585428125 2587980389 217
118 iso_pu_bacteria 2599185156 2599331425 217
119 iso_pu_bacteria 2599185170 2599417763 217
120 iso_pu_bacteria 2599185210 2599601436 217
121 iso_pu_bacteria 2599185352 2600193270 217
122 iso_pu_bacteria 2600255279 2601612062 217
123 iso_pu_bacteria 2600255308 2601749154 217
124 iso_pu_bacteria 2615840624 2616292514 217
125 iso_pu_bacteria 2615840626 2616308541 217
126 iso_pu_bacteria 2615840698 2616557156 217
127 iso_pu_bacteria 2617270742 2617385130 217
128 iso_pu_bacteria 2643221557 2643803765 217
129 iso_pu_bacteria 2643221558 2643811749 217
130 iso_pu_bacteria 2643221568 2643854442 217
131 iso_pu_bacteria 2643221582 2643919535 217
132 iso_pu_bacteria 2643221599 2644003730 217
133 iso_pu_bacteria 2643221607 2644049220 217
134 iso_pu_bacteria 2643221610 2644067735 217
135 iso_pu_bacteria 2643221634 2644192803 217
136 iso_pu_bacteria 2643221636 2644204435 217
137 iso_pu_bacteria 2643221637 2644210399 217
138 iso_pu_bacteria 2643221643 2644239541 217
139 iso_pu_bacteria 2643221653 2644298461 217
140 iso_pu_bacteria 2643221668 2644377738 217
141 iso_pu_bacteria 2643221675 2644418789 217
142 iso_pu_bacteria 2643221680 2644452155 217
143 iso_pu_bacteria 2643221686 2644482254 217
144 iso_pu_bacteria 2643221688 2644494595 217
145 iso_pu_bacteria 2643221689 2644501895 217
146 iso_pu_bacteria 2643221693 2644520233 217
147 iso_pu_bacteria 2643221718 2644653951 217
148 iso_pu_bacteria 2643221719 2644656690 217
149 iso_pu_bacteria 2643221723 2644672660 217
150 iso_pu_bacteria 2643221726 2644690918 217
151 iso_pu_bacteria 2657244999 2657683926 217
152 iso_pu_bacteria 2667528174 2671111755 217
153 iso_pu_bacteria 2690316117 2692316000 217
154 iso_pu_bacteria 2718217882 2719181128 217
155 iso_pu_bacteria 2718217927 2719385741 217
156 iso_pu_bacteria 2718217997 2719665562 217
157 iso_pu_bacteria 2718218009 2719731877 217
158 iso_pu_bacteria 2718218199 2720491982 217
159 iso_pu_bacteria 2718218232 2720613249 217
160 iso_pu_bacteria 2718218233 2720620124 217
161 iso_pu_bacteria 2718218235 2720631549 217
162 iso_pu_bacteria 2718218269 2720775277 217
163 iso_pu_bacteria 2718218363 2721147222 217
164 iso_pu_bacteria 2718218365 2721158755 217
165 iso_pu_bacteria 2718218366 2721164140 217
166 iso_pu_bacteria 2718218423 2721399521 217
167 iso_pu_bacteria 2721755514 2722840310 217
168 iso_pu_bacteria 2721755556 2723026894 217
169 iso_pu_bacteria 2721755684 2723560510 217
170 iso_pu_bacteria 2721755685 2723567096 217
171 iso_pu_bacteria 2721755809 2724038334 217
172 iso_pu_bacteria 2721755810 2724044633 217
173 iso_pu_bacteria 2721755819 2724089884 217
174 iso_pu_bacteria 2721755822 2724104361 217
175 iso_pu_bacteria 2721755823 2724110156 217
176 iso_pu_bacteria 2724679232 2725951326 217
177 iso_pu_bacteria 2728369352 2730107830 217
178 iso_pu_bacteria 2728369365 2730164365 217
179 iso_pu_bacteria 2728369397 2730298387 217
180 iso_pu_bacteria 2738541293 2738802020 217
181 iso_pu_bacteria 2738541317 2738946177 217
182 iso_pu_bacteria 2738541333 2739036457 217
183 iso_pu_bacteria 2751185821 2753458362 217
184 iso_pu_bacteria 2765235942 2766063123 217
185 iso_pu_bacteria 2775507049 2776913654 217
186 iso_pu_bacteria 2775507266 2778173976 217
187 iso_pu_bacteria 2791355082 2792581995 217
188 iso_pu_bacteria 2791355091 2792620010 217
189 iso_pu_bacteria 2791355092 2792626571 217
190 iso_pu_bacteria 2791355094 2792639504 217
191 iso_pu_bacteria 2791355253 2793279587 217
192 iso_pu_bacteria 2791355256 2793294625 217
193 iso_pu_bacteria 2791355259 2793312197 217
194 iso_pu_bacteria 2791355260 2793322074 217
195 iso_pu_bacteria 2791355261 2793326620 217
196 iso_pu_bacteria 2791355262 2793335779 217
197 iso_pu_bacteria 2791355263 2793341475 217
198 iso_pu_bacteria 2791355264 2793349131 217
199 iso_pu_bacteria 2791355265 2793356743 217
200 iso_pu_bacteria 2791355266 2793361215 217
201 iso_pu_bacteria 2791355267 2793369303 217
202 iso_pu_bacteria 2802428858 2802719079 217
203 iso_pu_bacteria 2802428859 2802727310 217
204 iso_pu_bacteria 2802428860 2802732092 217
205 iso_pu_bacteria 2802428861 2802739022 217
206 iso_pu_bacteria 2802428862 2802744921 217
207 iso_pu_bacteria 2802428863 2802752197 217
208 iso_pu_bacteria 2802429268 2804752188 217
209 iso_pu_bacteria 2802429606 2805933616 217
210 iso_pu_bacteria 2802429633 2806046006 217
211 iso_pu_bacteria 2802429634 2806054386 217
212 iso_pu_bacteria 2802429635 2806060391 217
213 iso_pu_bacteria 2802429636 2806065152 217
214 iso_pu_bacteria 2802429637 2806072416 217
215 iso_pu_bacteria 2808606387 2808985163 217
216 iso_pu_bacteria 2818991272 2819241678 217
217 iso_pu_bacteria 2818991439 2819559594 217
218 iso_pu_bacteria 2818991448 2819612835 217
219 iso_pu_bacteria 2818991453 2819637948 217
220 iso_pu_bacteria 2837651117 2837652768 217
221 iso_pu_bacteria 2838016132 2838021515 217
222 iso_pu_bacteria 2838022645 2838027922 217
223 iso_pu_bacteria 2838029111 2838030133 217
224 iso_pu_bacteria 2838035591 2838038020 217
225 iso_pu_bacteria 2838042994 2838043379 217
226 iso_pu_bacteria 2838048938 2838052470 217
227 iso_pu_bacteria 2838061910 2838065995 217
228 iso_pu_bacteria 2838068647 2838073541 217
229 iso_pu_bacteria 2838074704 2838078838 217
230 iso_pu_bacteria 2838661181 2838667269 217
231 iso_pu_bacteria 2838668709 2838672075 217
232 iso_pu_bacteria 2838675328 2838676023 217
233 iso_pu_bacteria 2838680041 2838682273 217
234 iso_pu_bacteria 2838686498 2838689445 217
235 iso_pu_bacteria 2838694306 2838696844 217
236 iso_pu_bacteria 2838701080 2838704645 217
237 iso_pu_bacteria 2838707686 2838709915 217
238 iso_pu_bacteria 2838714209 2838714905 217
239 iso_pu_bacteria 2838719591 2838721294 217
240 iso_pu_bacteria 2838724970 2838725665 217
241 iso_pu_bacteria 2838729681 2838730778 217
242 iso_pu_bacteria 2838742623 2838743719 217
243 iso_pu_bacteria 2841846520 2841848261 217
244 iso_pu_bacteria 2841851746 2841857795 217
245 iso_pu_bacteria 2841859092 2841859194 217
246 iso_pu_bacteria 2841864319 2841864607 217
247 iso_pu_bacteria 2842077413 2842078089 217
248 iso_pu_bacteria 2842110456 2842110546 217
249 iso_pu_bacteria 2842118031 2842119402 217
250 iso_pu_bacteria 2842124991 2842125709 217
251 iso_pu_bacteria 2842130223 2842130918 217
252 iso_pu_bacteria 2842146304 2842148615 217
253 iso_pu_bacteria 2842152218 2842153912 217
254 iso_pu_bacteria 2842156927 2842157468 217
255 iso_pu_bacteria 2842163707 2842164659 217
256 iso_pu_bacteria 2842170452 2842171149 217
257 iso_pu_bacteria 2842175837 2842177532 217
258 iso_pu_bacteria 2842180545 2842180947 217
259 iso_pu_bacteria 2842187318 2842188014 217
260 iso_pu_bacteria 2842192696 2842194555 217
261 iso_pu_bacteria 2842198810 2842203763 217
262 iso_pu_bacteria 2842205361 2842206084 217
263 iso_pu_bacteria 2842211629 2842212325 217
264 iso_pu_bacteria 2842217011 2842217179 217
265 iso_pu_bacteria 2842224351 2842226056 217
266 iso_pu_bacteria 2842229732 2842230994 217
267 iso_pu_bacteria 2842237096 2842239328 217
268 iso_pu_bacteria 2842243621 2842244898 217
269 iso_pu_bacteria 2842250916 2842254325 217
270 iso_pu_bacteria 2842257432 2842258711 217
271 iso_pu_bacteria 2842264693 2842266093 217
272 iso_pu_bacteria 2842271015 2842273465 217
273 iso_pu_bacteria 2842278818 2842279541 217
274 iso_pu_bacteria 2842285085 2842286187 217
275 iso_pu_bacteria 2842291075 2842291752 217
276 iso_pu_bacteria 2842298080 2842302084 217
277 iso_pu_bacteria 2842304105 2842304242 217
278 iso_pu_bacteria 2842311132 2842313867 217
279 iso_pu_bacteria 2842317721 2842317953 217
280 iso_pu_bacteria 2842341865 2842345886 217
281 iso_pu_bacteria 2842357229 2842357449 217
282 iso_pu_bacteria 2842363717 2842364485 217
283 iso_pu_bacteria 2842370503 2842372839 217
284 iso_pu_bacteria 2842377471 2842378148 217
285 iso_pu_bacteria 2842384541 2842385911 217
286 iso_pu_bacteria 2842395702 2842397615 217
287 iso_pu_bacteria 2842402390 2842403547 217
288 iso_pu_bacteria 2842409023 2842409080 217
289 iso_pu_bacteria 2842415677 2842415734 217
290 iso_pu_bacteria 2842422224 2842427953 217
291 iso_pu_bacteria 2842428310 2842429270 217
292 iso_pu_bacteria 2842434925 2842435883 217
293 iso_pu_bacteria 2842441272 2842442230 217
294 iso_pu_bacteria 2842447887 2842450522 217
295 iso_pu_bacteria 2842462802 2842463691 217
296 iso_pu_bacteria 2842469257 2842470212 217
297 iso_pu_bacteria 2842475841 2842476582 217
298 iso_pu_bacteria 2842482326 2842484875 217
299 iso_pu_bacteria 2842489311 2842489979 217
300 iso_pu_bacteria 2842495871 2842496223 217
301 iso_pu_bacteria 2842502639 2842503661 217
302 iso_pu_bacteria 2842509118 2842515248 217
303 iso_pu_bacteria 2842515876 2842515978 217
304 iso_pu_bacteria 2842521101 2842522506 217
305 iso_pu_bacteria 2842922631 2842923823 217
306 iso_pu_bacteria 2844163670 2844167387 217
307 iso_pu_bacteria 2844454524 2844459214 217
308 iso_pu_bacteria 2847417321 2847418934 217
309 iso_pu_bacteria 2848992105 2848993971 217
310 iso_pu_bacteria 2850079185 2850081981 217
311 iso_pu_bacteria 2852387548 2852389856 217
312 iso_pu_bacteria 2854896431 2854899515 217
313 iso_pu_bacteria 2854916844 2854918335 217
314 iso_pu_bacteria 2855839649 2855841186 217
315 iso_pu_bacteria 2855872281 2855876612 217
316 iso_pu_bacteria 2857516855 2857518669 217
317 iso_pu_bacteria 2858800743 2858801835 217
318 iso_pu_bacteria 2891373044 2891374433 217
319 iso_pu_bacteria 2894817345 2894819005 217
320 iso_pu_bacteria 2899792073 2899794022 217
321 iso_pu_bacteria 2899845264 2899848018 217
322 iso_pu_bacteria 2913295892 2913301003 217
323 iso_pu_bacteria 2913308742 2913311238 217
324 iso_pu_bacteria 2915980308 2915981561 217
325 iso_pu_bacteria 2915986958 2915988022 217
326 iso_pu_bacteria 2915993759 2915997513 217
327 iso_pu_bacteria 2916000859 2916001856 217
328 iso_pu_bacteria 2916007675 2916009644 217
329 iso_pu_bacteria 2916014648 2916018011 217
330 iso_pu_bacteria 2916021584 2916027388 217
331 iso_pu_bacteria 2916028427 2916035009 217
332 iso_pu_bacteria 2916041962 2916048113 217
333 iso_pu_bacteria 2916048683 2916050935 217
334 iso_pu_bacteria 2916055098 2916055416 217
335 iso_pu_bacteria 2916061851 2916066044 217
336 iso_pu_bacteria 2916068649 2916068847 217
337 iso_pu_bacteria 2916076590 2916080452 217
338 iso_pu_bacteria 2919100787 2919107026 217
339 iso_pu_bacteria 2919114240 2919114994 217
340 iso_pu_bacteria 2919166419 2919168777 217
341 iso_pu_bacteria 2919408235 2919411728 217
342 iso_pu_bacteria 2920760137 2920766244 217
343 iso_pu_bacteria 2920822456 2920824542 217
344 iso_pu_bacteria 2921201388 2921204554 217
345 iso_pu_bacteria 2921208531 2921209915 217
346 iso_pu_bacteria 2921250672 2921255089 217
347 iso_pu_bacteria 2921257292 2921262034 217
348 iso_pu_bacteria 2921263974 2921267548 217
349 iso_pu_bacteria 2921289301 2921290800 217
350 iso_pu_bacteria 2923556063 2923557891 217
351 iso_pu_bacteria 2924150972 2924154642 217
352 iso_pu_bacteria 2924158325 2924159731 217
353 iso_pu_bacteria 2924165586 2924168768 217
354 iso_pu_bacteria 2924172951 2924177428 217
355 iso_pu_bacteria 2924179722 2924180030 217
356 iso_pu_bacteria 2924186466 2924189718 217
357 iso_pu_bacteria 2924207177 2924211317 217
358 iso_pu_bacteria 2924214083 2924217403 217
359 iso_pu_bacteria 2924221636 2924226211 217
360 iso_pu_bacteria 2926754445 2926755960 217
361 iso_pu_bacteria 2926760298 2926763057 217
362 iso_pu_bacteria 2929138655 2929139968 217
363 iso_pu_bacteria 2933006813 2933008558 217
364 iso_pu_bacteria 2933011516 2933011647 217
365 iso_pu_bacteria 2933570622 2933571518 217
366 iso_pu_bacteria 2933586486 2933586575 217
367 iso_pu_bacteria 2933594066 2933596849 217
368 iso_pu_bacteria 2933599457 2933603977 217
369 iso_pu_bacteria 2935894831 2935897300 217
370 iso_pu_bacteria 2935901341 2935904691 217
371 iso_pu_bacteria 2936367885 2936372768 217
372 iso_pu_bacteria 2936375103 2936376641 217
373 iso_pu_bacteria 2936381700 2936385026 217
374 iso_pu_bacteria 2936996657 2937002615 217
375 iso_pu_bacteria 2937002841 2937006079 217
376 iso_pu_bacteria 2937009748 2937010180 217
377 iso_pu_bacteria 2937016420 2937022917 217
378 iso_pu_bacteria 2937023124 2937025866 217
379 iso_pu_bacteria 2937029754 2937032600 217
380 iso_pu_bacteria 2937036028 2937041181 217
381 iso_pu_bacteria 2937042894 2937044982 217
382 iso_pu_bacteria 2937049772 2937051891 217
383 iso_pu_bacteria 2937056579 2937057188 217
384 iso_pu_bacteria 2937063883 2937066379 217
385 iso_pu_bacteria 2937071275 2937073660 217
386 iso_pu_bacteria 2937078374 2937079232 217
387 iso_pu_bacteria 2937084907 2937085758 217
388 iso_pu_bacteria 2937091812 2937098477 217
389 iso_pu_bacteria 2937098957 2937099188 217
390 iso_pu_bacteria 2937106411 2937112839 217
391 iso_pu_bacteria 2937113482 2937116315 217
392 iso_pu_bacteria 2937119839 2937120350 217
393 iso_pu_bacteria 2957375807 2957381562 217
394 iso_pu_bacteria 2957388812 2957391884 217
395 iso_pu_bacteria 2957395598 2957399220 217
396 iso_pu_bacteria 2957415311 2957419500 217
397 iso_pu_bacteria 2957422303 2957425318 217
398 iso_pu_bacteria 2957430029 2957434813 217
399 iso_pu_bacteria 2957437181 2957443346 217
400 iso_pu_bacteria 2957443900 2957447496 217
401 iso_pu_bacteria 2957450854 2957456909 217
402 iso_pu_bacteria 2957457609 2957462715 217
403 iso_pu_bacteria 2957471148 2957477354 217
404 iso_pu_bacteria 2957478035 2957481534 217
405 iso_pu_bacteria 2957484790 2957485985 217
406 iso_pu_bacteria 2957491536 2957496057 217
407 iso_pu_bacteria 2957498199 2957499123 217
408 iso_pu_bacteria 2957505466 2957509378 217
409 iso_pu_bacteria 2960584000 2960584672 217
410 iso_pu_bacteria 2960591022 2960597230 217
411 iso_pu_bacteria 2960597568 2960598135 217
412 iso_pu_bacteria 2960603979 2960610687 217
413 iso_pu_bacteria 2960610863 2960614206 217
414 iso_pu_bacteria 2960617483 2960618906 217
415 iso_pu_bacteria 2960624210 2960625514 217
416 iso_pu_bacteria 2960631154 2960631810 217
417 iso_pu_bacteria 2960637947 2960642173 217
418 iso_pu_bacteria 2960645483 2960651987 217
419 iso_pu_bacteria 2960652885 2960655324 217
420 iso_pu_bacteria 2960660292 2960664010 217
421 iso_pu_bacteria 2960667422 2960672813 217
422 iso_pu_bacteria 2960680706 2960687182 217
423 iso_pu_bacteria 2960687367 2960691440 217
424 iso_pu_bacteria 2960693952 2960697877 217
425 iso_pu_bacteria 2964607997 2964612293 217
426 iso_pu_bacteria 2964615318 2964620279 217
427 iso_pu_bacteria 2964628898 2964632297 217
428 iso_pu_bacteria 2964636051 2964638991 217
429 iso_pu_bacteria 2964643177 2964646775 217
430 iso_pu_bacteria 2964649959 2964654829 217
431 iso_pu_bacteria 2964656573 2964659344 217
432 iso_pu_bacteria 2964663802 2964669795 217
433 iso_pu_bacteria 2964678106 2964684342 217
434 iso_pu_bacteria 2964691889 2964695412 217
435 iso_pu_bacteria 2964705432 2964711479 217
436 iso_pu_bacteria 2964712639 2964713616 217
437 iso_pu_bacteria 2964719344 2964720474 217
438 iso_pu_bacteria 2967664464 2967666272 217
439 iso_pu_bacteria 2967671571 2967675301 217
440 iso_pu_bacteria 2967678726 2967682684 217
441 iso_pu_bacteria 2967686174 2967687454 217
442 iso_pu_bacteria 2967693043 2967699652 217
443 iso_pu_bacteria 2967699805 2967702715 217
444 iso_pu_bacteria 2967706974 2967712914 217
445 iso_pu_bacteria 2967714385 2967715284 217
446 iso_pu_bacteria 2967721400 2967726473 217
447 iso_pu_bacteria 2967728569 2967729206 217
448 iso_pu_bacteria 2967735183 2967741427 217
449 iso_pu_bacteria 2967742019 2967745116 217
450 iso_pu_bacteria 2967748971 2967753843 217
451 iso_pu_bacteria 2967755722 2967757186 217
452 iso_pu_bacteria 2967762386 2967763669 217
453 iso_pu_bacteria 2967775926 2967781147 217
454 iso_pu_bacteria 2970019648 2970022444 217
455 iso_pu_bacteria 2970026789 2970031471 217
456 iso_pu_bacteria 2970033650 2970038652 217
457 iso_pu_bacteria 2970040964 2970045727 217
458 iso_pu_bacteria 2970047711 2970052336 217
459 iso_pu_bacteria 2970054988 2970058201 217
460 iso_pu_bacteria 2970061556 2970068529 217
461 iso_pu_bacteria 2970068827 2970073694 217
462 iso_pu_bacteria 2970076120 2970078484 217
463 iso_pu_bacteria 2970082768 2970087295 217
464 iso_pu_bacteria 2970095765 2970099707 217
465 iso_pu_bacteria 2970102677 2970105167 217
466 iso_pu_bacteria 2970109326 2970110450 217
467 iso_pu_bacteria 2970116247 2970117783 217
468 iso_pu_bacteria 2970122695 2970126211 217
469 iso_pu_bacteria 2970129317 2970130419 217
470 iso_pu_bacteria 2970136068 2970140317 217
471 iso_pu_bacteria 2970143518 2970146927 217
472 iso_pu_bacteria 2970149975 2970150389 217
473 iso_pu_bacteria 2970156795 2970157551 217
474 iso_pu_bacteria 2970164137 2970166499 217
475 iso_pu_bacteria 2970177841 2970182442 217
476 iso_pu_bacteria 2970184632 2970185726 217
477 iso_pu_bacteria 2970191845 2970192783 217
478 iso_pu_bacteria 2977516862 2977517221 217
479 iso_pu_bacteria 2977523885 2977527940 217
480 iso_pu_bacteria 2977530762 2977532837 217
481 iso_pu_bacteria 2977544691 2977549183 217
482 iso_pu_bacteria 2977551784 2977552748 217
483 iso_pu_bacteria 2977565890 2977569511 217
484 iso_pu_bacteria 2977572785 2977574987 217
485 iso_pu_bacteria 2977579622 2977586171 217
486 iso_pu_bacteria 2978969890 2978971462 217
487 iso_pu_bacteria 2979089926 2979094449 217
488 iso_pu_bacteria 2979095461 2979098168 217
489 iso_pu_bacteria 2979100975 2979103690 217
490 iso_pu_bacteria 2984509177 2984511746 217
491 iso_pu_bacteria 2984518228 2984521893 217
492 iso_pu_bacteria 2984537506 2984541191 217
493 iso_pu_bacteria 2984587000 2984588608 217
494 iso_pu_bacteria 2984601300 2984603472 217
495 iso_pu_bacteria 2989349275 2989353333 217
496 iso_pu_bacteria 2989776772 2989778989 217
497 iso_pu_bacteria 2996310559 2996310782 217
498 iso_pu_bacteria 2996887358 2996891661 217
499 iso_pu_bacteria 2996893221 2996898193 217
500 iso_pu_bacteria 3003930520 3003933634 217
501 iso_pu_bacteria 3005416602 3005420144 217
502 iso_pu_bacteria 3005445848 3005447467 217
503 iso_pu_bacteria 3005452660 3005454179 217
504 iso_pu_bacteria 639633055 639648485 217
505 iso_pu_bacteria 643692032 643825822 217
506 iso_pu_bacteria 648276728 648737410 217
507 iso_pu_bacteria 650716007 650740327 217
508 iso_pu_bacteria 8003570095 8003571377 217
509 iso_pu_bacteria 8003992118 8003993691 217
510 iso_pu_bacteria 8003999396 8004001168 217
511 iso_pu_bacteria 8005246636 8005248542 217
512 iso_pu_bacteria 8005258706 8005262991 217
513 iso_pu_bacteria 8005275841 8005280518 217
514 iso_pu_bacteria 8005282627 8005283138 217
515 iso_pu_bacteria 8005289223 8005290303 217
516 iso_pu_bacteria 8005301065 8005302502 217
517 iso_pu_bacteria 8005307578 8005314482 217
518 iso_pu_bacteria 8005314921 8005317095 217
519 iso_pu_bacteria 8005321885 8005326188 217
520 iso_pu_bacteria 8005376324 8005379149 217
521 iso_pu_bacteria 8005382845 8005388280 217
522 iso_pu_bacteria 8005395548 8005397194 217
523 iso_pu_bacteria 8005430974 8005432087 217
524 iso_pu_bacteria 8005460587 8005462887 217
525 iso_pu_bacteria 8005484373 8005485107 217
526 iso_pu_bacteria 8005497431 8005500286 217
527 iso_pu_bacteria 8005542996 8005545108 217
528 iso_pu_bacteria 8005556819 8005557769 217
529 iso_pu_bacteria 8005563573 8005568941 217
530 iso_pu_bacteria 8005570704 8005574756 217
531 iso_pu_bacteria 8005619151 8005621663 217
532 iso_pu_bacteria 8005626139 8005626481 217
533 iso_pu_bacteria 8005645114 8005645271 217
534 iso_pu_bacteria 8005658619 8005659684 217
535 iso_pu_bacteria 8005668836 8005671702 217
536 iso_pu_bacteria 8005682033 8005683230 217
537 iso_pu_bacteria 8005688590 8005694515 217
538 iso_pu_bacteria 8005695170 8005700076 217
539 iso_pu_bacteria 8018127388 8018129858 217
540 iso_pu_bacteria 8018150411 8018155364 217
541 iso_pu_bacteria 8018163183 8018166854 217
542 iso_pu_bacteria 8018176218 8018179889 217
543 iso_pu_bacteria 8023680758 8023685442 217
544 iso_pu_bacteria 8024479707 8024483598 217
545 iso_pu_bacteria 8024486573 8024492301 217
546 iso_pu_bacteria 8024501048 8024506643 217
547 iso_pu_bacteria 8046767195 8046773833 217
548 iso_pu_bacteria 8049293176 8049294731 217
549 iso_pu_bacteria 8054460903 8054462682 217
550 iso_pu_bacteria 8054558443 8054559647 217
551 iso_pu_bacteria 8055431914 8055435981 217
552 iso_pu_bacteria 8056375014 8056376577 217
553 iso_pu_bacteria 8056382006 8056388147 217
554 iso_pu_bacteria 8057575449 8057576791 217
555 iso_pu_bacteria 8057874678 8057875120 217
556 3300053136 Ga0500559_0043963 Ga0500559_0043963_245_907 218
557 iso_pu_bacteria 2510917026 2511174046 218
558 iso_pu_bacteria 2585427633 2585995796 218
559 iso_pu_bacteria 2585427634 2586000358 218
560 iso_pu_bacteria 2599185236 2599721055 218
561 iso_pu_bacteria 2600254933 2600374557 218
562 iso_pu_bacteria 2818991461 2819687273 218
563 iso_pu_bacteria 2821123053 2821127846 218
564 iso_pu_bacteria 2838736955 2838738270 218
565 iso_pu_bacteria 2841840854 2841841360 218
566 iso_pu_bacteria 2842140634 2842141138 218
567 iso_pu_bacteria 2857531043 2857534413 218
568 iso_pu_bacteria 2919171160 2919175200 218
569 iso_pu_bacteria 2989771324 2989773578 218
570 iso_pu_bacteria 3005409236 3005415187 218
571 3300005327 Ga0070658_10129447 Ga0070658_101294472 219
572 3300005327 Ga0070658_10164634 Ga0070658_101646343 219
573 3300005327 Ga0070658_10246751 Ga0070658_102467512 219
574 3300005338 Ga0068868_100175080 Ga0068868_1001750802 219
575 3300005339 Ga0070660_100029463 Ga0070660_1000294632 219
576 3300005339 Ga0070660_100112458 Ga0070660_1001124581 219
577 3300005344 Ga0070661_100037811 Ga0070661_1000378115 219
578 3300005344 Ga0070661_100270971 Ga0070661_1002709711 219
579 3300005356 Ga0070674_100009304 Ga0070674_1000093047 219
580 3300005364 Ga0070673_100285879 Ga0070673_1002858792 219
581 3300005364 Ga0070673_100348882 Ga0070673_1003488821 219
582 3300005366 Ga0070659_100013307 Ga0070659_1000133075 219
583 3300005366 Ga0070659_100117275 Ga0070659_1001172752 219
584 3300005455 Ga0070663_100367814 Ga0070663_1003678141 219
585 3300005456 Ga0070678_100046022 Ga0070678_1000460222 219
586 3300005539 Ga0068853_100152949 Ga0068853_1001529492 219
587 3300005539 Ga0068853_100157980 Ga0068853_1001579802 219
588 3300005543 Ga0070672_100278328 Ga0070672_1002783282 219
589 3300005548 Ga0070665_100114859 Ga0070665_1001148594 219
590 3300005548 Ga0070665_100223866 Ga0070665_1002238662 219
591 3300005563 Ga0068855_100122067 Ga0068855_1001220675 219
592 3300005563 Ga0068855_100423006 Ga0068855_1004230062 219
593 3300005578 Ga0068854_100028834 Ga0068854_1000288343 219
594 3300005578 Ga0068854_100412500 Ga0068854_1004125002 219
595 3300005616 Ga0068852_100006203 Ga0068852_10000620313 219
596 3300005616 Ga0068852_100007647 Ga0068852_10000764710 219
597 3300005834 Ga0068851_10221141 Ga0068851_102211412 219
598 3300006038 Ga0075365_10404484 Ga0075365_104044842 219
599 3300006042 Ga0075368_10065762 Ga0075368_100657622 219
600 3300006177 Ga0075362_10014041 Ga0075362_100140412 219
601 3300006195 Ga0075366_10031472 Ga0075366_100314721 219
602 3300006353 Ga0075370_10062474 Ga0075370_100624743 219
603 3300009174 Ga0105241_10166290 Ga0105241_101662903 219
604 3300009545 Ga0105237_10002572 Ga0105237_100025728 219
605 3300009551 Ga0105238_10003838 Ga0105238_1000383813 219
606 3300009551 Ga0105238_10279354 Ga0105238_102793543 219
607 3300010375 Ga0105239_10001022 Ga0105239_100010227 219
608 3300010375 Ga0105239_10125354 Ga0105239_101253545 219
609 3300013102 Ga0157371_10022856 Ga0157371_100228563 219
610 3300013104 Ga0157370_10017118 Ga0157370_100171182 219
611 3300013104 Ga0157370_10114005 Ga0157370_101140053 219
612 3300013297 Ga0157378_10379844 Ga0157378_103798442 219
613 3300013307 Ga0157372_10037628 Ga0157372_100376284 219
614 3300013307 Ga0157372_10109904 Ga0157372_101099042 219
615 3300014325 Ga0163163_10197904 Ga0163163_101979042 219
616 3300025321 Ga0207656_10244087 Ga0207656_102440871 219
617 3300025909 Ga0207705_10054317 Ga0207705_100543174 219
618 3300025911 Ga0207654_10314967 Ga0207654_103149672 219
619 3300025914 Ga0207671_10000215 Ga0207671_1000021538 219
620 3300025919 Ga0207657_10015111 Ga0207657_100151113 219
621 3300025919 Ga0207657_10071717 Ga0207657_100717174 219
622 3300025920 Ga0207649_10036319 Ga0207649_100363193 219
623 3300025920 Ga0207649_10159130 Ga0207649_101591302 219
624 3300025921 Ga0207652_10433192 Ga0207652_104331922 219
625 3300025932 Ga0207690_10056613 Ga0207690_100566133 219
626 3300025940 Ga0207691_10080054 Ga0207691_100800542 219
627 3300025949 Ga0207667_10003395 Ga0207667_1000339521 219
628 3300025949 Ga0207667_10047558 Ga0207667_100475581 219
629 3300025949 Ga0207667_11064612 Ga0207667_110646121 219
630 3300025981 Ga0207640_10388493 Ga0207640_103884931 219
631 3300026041 Ga0207639_10312668 Ga0207639_103126683 219
632 3300026078 Ga0207702_10108226 Ga0207702_101082263 219
633 3300026116 Ga0207674_10017245 Ga0207674_100172453 219
634 3300026121 Ga0207683_10017007 Ga0207683_100170073 219
635 3300026142 Ga0207698_10274625 Ga0207698_102746252 219
636 3300028379 Ga0268266_10000255 Ga0268266_1000025574 219
637 3300028379 Ga0268266_10387595 Ga0268266_103875952 219
638 3300031250 Ga0265331_10087739 Ga0265331_100877391 219
639 3300037312 Ga0395899_0172848 Ga0395899_0172848_731_1396 219
640 3300037466 Ga0395898_0709546 Ga0395898_0709546_29_694 219
641 3300038443 Ga0395901_0331385 Ga0395901_0331385_198_863 219
642 3300044842 Ga0466957_0049509 Ga0466957_0049509_1186_1851 219
643 3300044842 Ga0466957_0524924 Ga0466957_0524924_18_683 219
644 3300047472 Ga0495686_0020495 Ga0495686_0020495_2146_2811 219
645 3300048924 Ga0496121_0220374 Ga0496121_0220374_497_1162 219
646 3300049570 Ga0501033_0073761 Ga0501033_0073761_1552_2217 219
647 3300049571 Ga0501034_0025162 Ga0501034_0025162_1909_2574 219
648 3300049572 Ga0501036_0116900 Ga0501036_0116900_1438_2103 219
649 3300049575 Ga0501039_0036877 Ga0501039_0036877_2298_2963 219
650 3300049581 Ga0501047_0115549 Ga0501047_0115549_111_776 219
651 3300049586 Ga0501070_0086425 Ga0501070_0086425_1546_2211 219
652 3300049587 Ga0501071_0196109 Ga0501071_0196109_79_744 219
653 3300050489 nmdc:mga03683_5837_c1 nmdc:mga03683_5837_c1_351_1016 219
654 3300050492 nmdc:mga0yw44_135503_c1 nmdc:mga0yw44_135503_c1_762_1427 219
655 3300050493 nmdc:mga0k408_45587_c1 nmdc:mga0k408_45587_c1_1216_1881 219
656 3300050495 nmdc:mga04h51_84905_c1 nmdc:mga04h51_84905_c1_151_816 219
657 3300050496 nmdc:mga07m45_39154_c1 nmdc:mga07m45_39154_c1_1020_1685 219
658 3300053108 Ga0500562_034819 Ga0500562_034819_544_1209 219
659 3300053119 Ga0500595_012447 Ga0500595_012447_193_858 219
660 3300054114 Ga0501084_0875682 Ga0501084_0875682_52_717 219
661 3300003578 Ga0006562J51391_1006992 Ga0006562J51391_10069923 220
662 3300005455 Ga0070663_100949656 Ga0070663_1009496561 220
663 3300013307 Ga0157372_10754347 Ga0157372_107543471 220
664 3300031824 Ga0307413_10084466 Ga0307413_100844662 220
665 3300031852 Ga0307410_10647580 Ga0307410_106475801 220
666 3300031911 Ga0307412_10142993 Ga0307412_101429931 220
667 3300032004 Ga0307414_10168684 Ga0307414_101686842 220
668 3300032004 Ga0307414_10911093 Ga0307414_109110932 220
669 3300035398 Ga0316574_0388862 Ga0316574_0388862_89_757 220
670 3300046507 Ga0495606_0008842 Ga0495606_0008842_7424_8092 220
671 3300048922 Ga0496119_0035179 Ga0496119_0035179_86_757 220
672 3300048924 Ga0496121_0058880 Ga0496121_0058880_1662_2330 220
673 3300048926 Ga0496123_0014765 Ga0496123_0014765_104_775 220
674 3300048928 Ga0496125_0131192 Ga0496125_0131192_523_1191 220
675 3300048929 Ga0496126_0194293 Ga0496126_0194293_185_853 220
676 3300049568 Ga0501031_0077079 Ga0501031_0077079_850_1518 220
677 3300049571 Ga0501034_0000681 Ga0501034_0000681_8686_9354 220
678 3300049571 Ga0501034_0977035 Ga0501034_0977035_41_709 220
679 3300049573 Ga0501037_0052820 Ga0501037_0052820_286_954 220
680 3300049575 Ga0501039_0096796 Ga0501039_0096796_325_993 220
681 3300049575 Ga0501039_0184246 Ga0501039_0184246_668_1336 220
682 3300049742 Ga0501080_0106106 Ga0501080_0106106_436_1104 220
683 3300050493 nmdc:mga0k408_222849_c1 nmdc:mga0k408_222849_c1_19_681 220
684 3300053151 Ga0500604_0001014 Ga0500604_0001014_2124_2792 220
685 3300053153 Ga0500616_0008883 Ga0500616_0008883_3410_4078 220
686 3300053161 Ga0500634_0000025 Ga0500634_0000025_44789_45457 220
687 3300002705 JGI25156J39149_1000174 JGI25156J39149_100017426 221
688 3300002737 JGI25162J39368_1000240 JGI25162J39368_100024034 221
689 3300002737 JGI25162J39368_1000394 JGI25162J39368_100039432 221
690 3300002738 JGI25154J39366_1000011 JGI25154J39366_100001128 221
691 3300002739 JGI25158J39367_1000755 JGI25158J39367_10007554 221
692 3300002741 JGI25157J39369_1000218 JGI25157J39369_100021826 221
693 3300002773 JGI25152J39213_1001242 JGI25152J39213_10012426 221
694 3300002773 JGI25152J39213_1003244 JGI25152J39213_10032446 221
695 3300002773 JGI25152J39213_1006666 JGI25152J39213_10066664 221
696 3300002773 JGI25152J39213_1007576 JGI25152J39213_10075764 221
697 3300002774 JGI25150J39212_1000070 JGI25150J39212_100007025 221
698 3300002987 JGI25159J45721_1000007 JGI25159J45721_1000007106 221
699 3300002987 JGI25159J45721_1000161 JGI25159J45721_10001617 221
700 3300003187 JGI25151J46595_10000208 JGI25151J46595_1000020830 221
701 3300003187 JGI25151J46595_10005630 JGI25151J46595_100056304 221
702 3300003214 JGI25165J46597_1000709 JGI25165J46597_100070921 221
703 3300003214 JGI25165J46597_1000755 JGI25165J46597_10007558 221
704 3300003214 JGI25165J46597_1005205 JGI25165J46597_10052053 221
705 3300003215 JGI25153J46596_10002457 JGI25153J46596_100024575 221
706 3300003215 JGI25153J46596_10005041 JGI25153J46596_100050415 221
707 3300003215 JGI25153J46596_10013861 JGI25153J46596_100138612 221
708 3300003215 JGI25153J46596_10015554 JGI25153J46596_100155544 221
709 3300003215 JGI25153J46596_10017728 JGI25153J46596_100177284 221
710 3300003215 JGI25153J46596_10021821 JGI25153J46596_100218213 221
711 3300003354 JGI25160J50197_1000010 JGI25160J50197_1000010143 221
712 3300003354 JGI25160J50197_1000011 JGI25160J50197_1000011151 221
713 3300003354 JGI25160J50197_1000521 JGI25160J50197_10005217 221
714 3300003354 JGI25160J50197_1004636 JGI25160J50197_10046364 221
715 3300003374 JGI25161J50226_1000006 JGI25161J50226_1000006143 221
716 3300003374 JGI25161J50226_1000055 JGI25161J50226_100005567 221
717 3300003374 JGI25161J50226_1000706 JGI25161J50226_100070612 221
718 3300003374 JGI25161J50226_1001998 JGI25161J50226_10019987 221
719 3300003578 Ga0006562J51391_1014891 Ga0006562J51391_10148915 221
720 3300003752 Ga0055539_1009431 Ga0055539_10094311 221
721 3300003771 Ga0055526_1002733 Ga0055526_10027336 221
722 3300003771 Ga0055526_1013247 Ga0055526_10132474 221
723 3300003771 Ga0055526_1017696 Ga0055526_10176964 221
724 3300003771 Ga0055526_1021046 Ga0055526_10210464 221
725 3300003771 Ga0055526_1022319 Ga0055526_10223193 221
726 3300003775 Ga0055524_1000766 Ga0055524_10007662 221
727 3300003775 Ga0055524_1001235 Ga0055524_100123515 221
728 3300003775 Ga0055524_1007386 Ga0055524_10073862 221
729 3300003775 Ga0055524_1014165 Ga0055524_10141651 221
730 3300003775 Ga0055524_1018212 Ga0055524_10182121 221
731 3300003775 Ga0055524_1021790 Ga0055524_10217903 221
732 3300003781 Ga0055536_1012129 Ga0055536_10121295 221
733 3300003781 Ga0055536_1015981 Ga0055536_10159812 221
734 3300003790 Ga0055528_1000222 Ga0055528_100022241 221
735 3300003790 Ga0055528_1002861 Ga0055528_10028615 221
736 3300003790 Ga0055528_1016522 Ga0055528_10165222 221
737 3300003790 Ga0055528_1020890 Ga0055528_10208903 221
738 3300003790 Ga0055528_1026284 Ga0055528_10262843 221
739 3300003790 Ga0055528_1036795 Ga0055528_10367951 221
740 3300003791 Ga0055530_10007550 Ga0055530_100075502 221
741 3300003792 Ga0055540_1003323 Ga0055540_10033234 221
742 3300003792 Ga0055540_1008157 Ga0055540_10081575 221
743 3300003792 Ga0055540_1012797 Ga0055540_10127971 221
744 3300003792 Ga0055540_1025106 Ga0055540_10251061 221
745 3300003792 Ga0055540_1026118 Ga0055540_10261182 221
746 3300003794 Ga0055531_10005192 Ga0055531_100051928 221
747 3300003794 Ga0055531_10034597 Ga0055531_100345973 221
748 3300003856 Ga0058692_1002551 Ga0058692_10025513 221
749 3300003856 Ga0058692_1003928 Ga0058692_10039283 221
750 3300004625 Ga0055543_1000014 Ga0055543_100001449 221
751 3300004625 Ga0055543_1000032 Ga0055543_1000032121 221
752 3300004625 Ga0055543_1000179 Ga0055543_100017913 221
753 3300004625 Ga0055543_1000312 Ga0055543_100031229 221
754 3300005262 Ga0065165_1000018 Ga0065165_1000018151 221
755 3300005262 Ga0065165_1000251 Ga0065165_100025153 221
756 3300005262 Ga0065165_1015153 Ga0065165_10151534 221
757 3300005262 Ga0065165_1016666 Ga0065165_10166664 221
758 3300005331 Ga0070670_100013586 Ga0070670_1000135865 221
759 3300005335 Ga0070666_10307247 Ga0070666_103072472 221
760 3300005353 Ga0070669_100071642 Ga0070669_1000716422 221
761 3300005354 Ga0070675_100600240 Ga0070675_1006002402 221
762 3300005355 Ga0070671_100098647 Ga0070671_1000986473 221
763 3300005367 Ga0070667_100254802 Ga0070667_1002548022 221
764 3300005616 Ga0068852_100114076 Ga0068852_1001140764 221
765 3300006038 Ga0075365_10167231 Ga0075365_101672312 221
766 3300006038 Ga0075365_10287947 Ga0075365_102879472 221
767 3300006042 Ga0075368_10000104 Ga0075368_1000010415 221
768 3300006048 Ga0075363_100052670 Ga0075363_1000526704 221
769 3300006048 Ga0075363_100355182 Ga0075363_1003551822 221
770 3300006051 Ga0075364_10012266 Ga0075364_100122665 221
771 3300006177 Ga0075362_10001584 Ga0075362_100015845 221
772 3300006178 Ga0075367_10006555 Ga0075367_100065554 221
773 3300006178 Ga0075367_10033762 Ga0075367_100337623 221
774 3300006186 Ga0075369_10001290 Ga0075369_100012904 221
775 3300006186 Ga0075369_10002414 Ga0075369_100024144 221
776 3300006186 Ga0075369_10159784 Ga0075369_101597842 221
777 3300006195 Ga0075366_10003548 Ga0075366_100035483 221
778 3300006353 Ga0075370_10023082 Ga0075370_100230824 221
779 3300006353 Ga0075370_10033426 Ga0075370_100334265 221
780 3300006353 Ga0075370_10034017 Ga0075370_100340173 221
781 3300006946 Ga0079104_1003384 Ga0079104_10033845 221
782 3300006948 Ga0099826_10000117 Ga0099826_1000011732 221
783 3300006948 Ga0099826_10163770 Ga0099826_101637702 221
784 3300009093 Ga0105240_10000005 Ga0105240_10000005556 221
785 3300009148 Ga0105243_10440864 Ga0105243_104408642 221
786 3300009148 Ga0105243_10982252 Ga0105243_109822521 221
787 3300009177 Ga0105248_10280754 Ga0105248_102807543 221
788 3300009765 Ga0123341_1081385 Ga0123341_10813851 221
789 3300009766 Ga0123342_1015299 Ga0123342_10152996 221
790 3300009766 Ga0123342_1021619 Ga0123342_10216193 221
791 3300013100 Ga0157373_10283309 Ga0157373_102833092 221
792 3300013102 Ga0157371_10000240 Ga0157371_1000024068 221
793 3300013104 Ga0157370_10000322 Ga0157370_100003229 221
794 3300013104 Ga0157370_10018937 Ga0157370_100189373 221
795 3300013105 Ga0157369_10073641 Ga0157369_100736412 221
796 3300015690 Ga0183363_1246 Ga0183363_12463 221
797 3300021320 Ga0214544_1016120 Ga0214544_10161204 221
798 3300021321 Ga0214542_1000245 Ga0214542_100024567 221
799 3300021321 Ga0214542_1018074 Ga0214542_10180742 221
800 3300021327 Ga0214543_1000010 Ga0214543_100001041 221
801 3300021327 Ga0214543_1000134 Ga0214543_100013492 221
802 3300022739 Ga0228711_1000007 Ga0228711_100000799 221
803 3300022740 Ga0228710_1000007 Ga0228710_100000786 221
804 3300025206 Ga0209435_100012 Ga0209435_10001228 221
805 3300025208 Ga0209436_100034 Ga0209436_10003450 221
806 3300025208 Ga0209436_100878 Ga0209436_1008786 221
807 3300025233 Ga0209437_100047 Ga0209437_100047266 221
808 3300025233 Ga0209437_100308 Ga0209437_10030830 221
809 3300025245 Ga0207425_1000024 Ga0207425_100002443 221
810 3300025245 Ga0207425_1002077 Ga0207425_10020775 221
811 3300025245 Ga0207425_1013645 Ga0207425_10136453 221
812 3300025245 Ga0207425_1024341 Ga0207425_10243411 221
813 3300025245 Ga0207425_1053174 Ga0207425_10531741 221
814 3300025246 Ga0209646_1000026 Ga0209646_100002628 221
815 3300025246 Ga0209646_1017629 Ga0209646_10176292 221
816 3300025250 Ga0209026_1000014 Ga0209026_100001428 221
817 3300025253 Ga0209677_100371 Ga0209677_10037120 221
818 3300025256 Ga0209759_1000012 Ga0209759_100001228 221
819 3300025256 Ga0209759_1018976 Ga0209759_10189763 221
820 3300025258 Ga0209129_1000069 Ga0209129_1000069171 221
821 3300025258 Ga0209129_1000133 Ga0209129_100013371 221
822 3300025258 Ga0209129_1001650 Ga0209129_10016508 221
823 3300025258 Ga0209129_1002620 Ga0209129_10026206 221
824 3300025258 Ga0209129_1003038 Ga0209129_10030387 221
825 3300025258 Ga0209129_1007594 Ga0209129_10075944 221
826 3300025258 Ga0209129_1008509 Ga0209129_10085094 221
827 3300025261 Ga0209233_1000048 Ga0209233_1000048136 221
828 3300025261 Ga0209233_1000069 Ga0209233_1000069299 221
829 3300025261 Ga0209233_1000221 Ga0209233_100022182 221
830 3300025273 Ga0209673_1000013 Ga0209673_1000013487 221
831 3300025273 Ga0209673_1000048 Ga0209673_1000048140 221
832 3300025273 Ga0209673_1000448 Ga0209673_100044836 221
833 3300025273 Ga0209673_1000505 Ga0209673_100050536 221
834 3300025273 Ga0209673_1001588 Ga0209673_10015889 221
835 3300025273 Ga0209673_1001697 Ga0209673_100169719 221
836 3300025273 Ga0209673_1003716 Ga0209673_10037169 221
837 3300025273 Ga0209673_1028005 Ga0209673_10280054 221
838 3300025284 Ga0209130_1000004 Ga0209130_1000004144 221
839 3300025284 Ga0209130_1000021 Ga0209130_1000021125 221
840 3300025284 Ga0209130_1000029 Ga0209130_1000029104 221
841 3300025292 Ga0209676_1035696 Ga0209676_10356964 221
842 3300025294 Ga0209025_1000033 Ga0209025_100003394 221
843 3300025294 Ga0209025_1000050 Ga0209025_1000050284 221
844 3300025294 Ga0209025_1000445 Ga0209025_100044511 221
845 3300025294 Ga0209025_1000572 Ga0209025_100057256 221
846 3300025294 Ga0209025_1002013 Ga0209025_100201312 221
847 3300025294 Ga0209025_1003067 Ga0209025_10030675 221
848 3300025294 Ga0209025_1016746 Ga0209025_10167466 221
849 3300025294 Ga0209025_1019400 Ga0209025_10194005 221
850 3300025294 Ga0209025_1032542 Ga0209025_10325425 221
851 3300025294 Ga0209025_1051708 Ga0209025_10517083 221
852 3300025294 Ga0209025_1075212 Ga0209025_10752122 221
853 3300025294 Ga0209025_1076235 Ga0209025_10762352 221
854 3300025295 Ga0209564_1000288 Ga0209564_100028884 221
855 3300025295 Ga0209564_1000375 Ga0209564_100037552 221
856 3300025295 Ga0209564_1000570 Ga0209564_100057024 221
857 3300025295 Ga0209564_1001678 Ga0209564_100167823 221
858 3300025295 Ga0209564_1029031 Ga0209564_10290313 221
859 3300025295 Ga0209564_1040273 Ga0209564_10402733 221
860 3300025295 Ga0209564_1044251 Ga0209564_10442512 221
861 3300025297 Ga0209758_1000342 Ga0209758_100034235 221
862 3300025297 Ga0209758_1000421 Ga0209758_100042129 221
863 3300025297 Ga0209758_1000468 Ga0209758_100046810 221
864 3300025297 Ga0209758_1002428 Ga0209758_10024283 221
865 3300025297 Ga0209758_1020357 Ga0209758_10203574 221
866 3300025297 Ga0209758_1020362 Ga0209758_10203622 221
867 3300025297 Ga0209758_1022889 Ga0209758_10228894 221
868 3300025297 Ga0209758_1024832 Ga0209758_10248324 221
869 3300025297 Ga0209758_1030767 Ga0209758_10307672 221
870 3300025297 Ga0209758_1037914 Ga0209758_10379144 221
871 3300025298 Ga0209050_1001717 Ga0209050_10017175 221
872 3300025299 Ga0209256_1000354 Ga0209256_100035423 221
873 3300025299 Ga0209256_1000809 Ga0209256_10008094 221
874 3300025299 Ga0209256_1000852 Ga0209256_10008523 221
875 3300025299 Ga0209256_1003719 Ga0209256_10037198 221
876 3300025299 Ga0209256_1008152 Ga0209256_10081523 221
877 3300025299 Ga0209256_1008744 Ga0209256_10087445 221
878 3300025299 Ga0209256_1009059 Ga0209256_10090591 221
879 3300025299 Ga0209256_1038436 Ga0209256_10384361 221
880 3300025299 Ga0209256_1075280 Ga0209256_10752801 221
881 3300025302 Ga0207426_1000003 Ga0207426_1000003584 221
882 3300025302 Ga0207426_1000010 Ga0207426_1000010233 221
883 3300025302 Ga0207426_1000039 Ga0207426_100003956 221
884 3300025302 Ga0207426_1000074 Ga0207426_1000074194 221
885 3300025302 Ga0207426_1001779 Ga0207426_100177910 221
886 3300025303 Ga0209051_1000445 Ga0209051_100044539 221
887 3300025303 Ga0209051_1004526 Ga0209051_10045266 221
888 3300025303 Ga0209051_1005330 Ga0209051_10053304 221
889 3300025303 Ga0209051_1028809 Ga0209051_10288093 221
890 3300025303 Ga0209051_1045360 Ga0209051_10453602 221
891 3300025303 Ga0209051_1056382 Ga0209051_10563822 221
892 3300025304 Ga0209257_1005388 Ga0209257_10053887 221
893 3300025304 Ga0209257_1013660 Ga0209257_10136603 221
894 3300025304 Ga0209257_1020481 Ga0209257_10204814 221
895 3300025304 Ga0209257_1030620 Ga0209257_10306203 221
896 3300025304 Ga0209257_1057283 Ga0209257_10572831 221
897 3300025903 Ga0207680_10351042 Ga0207680_103510421 221
898 3300025913 Ga0207695_10000011 Ga0207695_10000011362 221
899 3300025914 Ga0207671_10000674 Ga0207671_1000067434 221
900 3300025925 Ga0207650_10025328 Ga0207650_100253285 221
901 3300025931 Ga0207644_10100880 Ga0207644_101008802 221
902 3300025941 Ga0207711_10260335 Ga0207711_102603352 221
903 3300025949 Ga0207667_10168264 Ga0207667_101682643 221
904 3300026067 Ga0207678_10164807 Ga0207678_101648072 221
905 3300026078 Ga0207702_10051493 Ga0207702_100514933 221
906 3300026142 Ga0207698_10082949 Ga0207698_100829493 221
907 3300026142 Ga0207698_10866981 Ga0207698_108669812 221
908 3300027111 Ga0209281_1000128 Ga0209281_1000128105 221
909 3300027312 Ga0209371_1000058 Ga0209371_1000058179 221
910 3300027312 Ga0209371_1024045 Ga0209371_10240452 221
911 3300027666 Ga0209282_1000034 Ga0209282_100003439 221
912 3300027666 Ga0209282_1037976 Ga0209282_10379764 221
913 3300027866 Ga0209813_10001551 Ga0209813_100015514 221
914 3300028379 Ga0268266_10054398 Ga0268266_100543983 221
915 3300028794 Ga0307515_10000198 Ga0307515_1000019859 221
916 3300028794 Ga0307515_10033455 Ga0307515_100334557 221
917 3300028794 Ga0307515_10039992 Ga0307515_100399929 221
918 3300030500 Ga0268256_1000056 Ga0268256_1000056169 221
919 3300030500 Ga0268256_1029812 Ga0268256_10298121 221
920 3300031456 Ga0307513_10017351 Ga0307513_100173517 221
921 3300031456 Ga0307513_10106482 Ga0307513_101064825 221
922 3300031731 Ga0307405_10003205 Ga0307405_100032055 221
923 3300031901 Ga0307406_10013129 Ga0307406_100131294 221
924 3300031911 Ga0307412_10002280 Ga0307412_100022809 221
925 3300031911 Ga0307412_10492931 Ga0307412_104929311 221
926 3300031967 Ga0315914_1000010 Ga0315914_100001077 221
927 3300032002 Ga0307416_100331898 Ga0307416_1003318983 221
928 3300033430 Ga0315913_1000005 Ga0315913_100000577 221
929 3300033464 Ga0315915_1000012 Ga0315915_100001286 221
930 3300035170 Ga0373943_0428234 Ga0373943_0428234_60_731 221
931 3300035692 Ga0373935_0129091 Ga0373935_0129091_68_739 221
932 3300035695 Ga0373927_0003766 Ga0373927_0003766_9351_10022 221
933 3300038705 Ga0237819_00289 Ga0237819_00289_3237_3902 221
934 3300041413 Ga0439465_0002585 Ga0439465_0002585_800_1471 221
935 3300041413 Ga0439465_0028154 Ga0439465_0028154_928_1599 221
936 3300041453 Ga0451797_0628677 Ga0451797_0628677_268_939 221
937 3300041458 Ga0451798_0746823 Ga0451798_0746823_31_702 221
938 3300041491 Ga0451833_0980777 Ga0451833_0980777_99_770 221
939 3300041491 Ga0451833_1242594 Ga0451833_1242594_61_732 221
940 3300041492 Ga0451835_0538804 Ga0451835_0538804_713_1384 221
941 3300041494 Ga0451837_0158764 Ga0451837_0158764_730_1401 221
942 3300041494 Ga0451837_1611223 Ga0451837_1611223_299_970 221
943 3300041496 Ga0451839_0680386 Ga0451839_0680386_108_779 221
944 3300041498 Ga0451841_0496995 Ga0451841_0496995_104_775 221
945 3300041501 Ga0451845_0096118 Ga0451845_0096118_1582_2253 221
946 3300041501 Ga0451845_0189620 Ga0451845_0189620_95_766 221
947 3300041502 Ga0451846_27131 Ga0451846_27131_581_1252 221
948 3300041503 Ga0451847_0053929 Ga0451847_0053929_913_1584 221
949 3300041503 Ga0451847_0256758 Ga0451847_0256758_59_730 221
950 3300041505 Ga0451849_0151792 Ga0451849_0151792_2479_3150 221
951 3300041507 Ga0451851_0028592 Ga0451851_0028592_300_971 221
952 3300041510 Ga0451854_09483 Ga0451854_09483_34_705 221
953 3300041511 Ga0451855_0129778 Ga0451855_0129778_665_1336 221
954 3300041512 Ga0451853_0540011 Ga0451853_0540011_850_1521 221
955 3300042004 Ga0439445_0046947 Ga0439445_0046947_208_879 221
956 3300042007 Ga0439449_0027239 Ga0439449_0027239_780_1451 221
957 3300042007 Ga0439449_0047804 Ga0439449_0047804_240_911 221
958 3300042007 Ga0439449_0067289 Ga0439449_0067289_596_1267 221
959 3300042145 Ga0450906_018546 Ga0450906_018546_441_1112 221
960 3300042531 Ga0450918_012406 Ga0450918_012406_212_883 221
961 3300044694 Ga0466963_0018287 Ga0466963_0018287_601_1272 221
962 3300046452 Ga0495617_024465 Ga0495617_024465_829_1500 221
963 3300046453 Ga0495627_100028 Ga0495627_100028_134_805 221
964 3300046459 Ga0495629_0062875 Ga0495629_0062875_585_1256 221
965 3300046460 Ga0495638_0000912 Ga0495638_0000912_19221_19892 221
966 3300046460 Ga0495638_0020127 Ga0495638_0020127_2397_3068 221
967 3300046471 Ga0495650_0056153 Ga0495650_0056153_606_1277 221
968 3300046474 Ga0495605_0008173 Ga0495605_0008173_2961_3632 221
969 3300046474 Ga0495605_0011529 Ga0495605_0011529_3578_4249 221
970 3300046476 Ga0495662_0010788 Ga0495662_0010788_388_1059 221
971 3300046492 Ga0495585_0035896 Ga0495585_0035896_99_770 221
972 3300046492 Ga0495585_0095426 Ga0495585_0095426_294_965 221
973 3300046492 Ga0495585_0101850 Ga0495585_0101850_268_939 221
974 3300046501 Ga0495607_0024523 Ga0495607_0024523_3055_3726 221
975 3300046501 Ga0495607_0184654 Ga0495607_0184654_108_779 221
976 3300046506 Ga0495583_0054448 Ga0495583_0054448_447_1118 221
977 3300046507 Ga0495606_0002051 Ga0495606_0002051_2451_3122 221
978 3300046507 Ga0495606_0090738 Ga0495606_0090738_700_1371 221
979 3300046507 Ga0495606_0104484 Ga0495606_0104484_103_774 221
980 3300046512 Ga0495610_0002292 Ga0495610_0002292_12187_12858 221
981 3300046512 Ga0495610_0004005 Ga0495610_0004005_10370_11041 221
982 3300046513 Ga0495616_0035535 Ga0495616_0035535_1125_1796 221
983 3300046515 Ga0495620_0016413 Ga0495620_0016413_737_1408 221
984 3300046515 Ga0495620_0030897 Ga0495620_0030897_247_918 221
985 3300046515 Ga0495620_0072935 Ga0495620_0072935_76_747 221
986 3300046518 Ga0495631_0005366 Ga0495631_0005366_3346_4017 221
987 3300046518 Ga0495631_0020864 Ga0495631_0020864_55_726 221
988 3300046519 Ga0495632_0021734 Ga0495632_0021734_1139_1810 221
989 3300046522 Ga0495643_0013503 Ga0495643_0013503_1844_2515 221
990 3300046522 Ga0495643_0025310 Ga0495643_0025310_2410_3081 221
991 3300046522 Ga0495643_0036628 Ga0495643_0036628_34_705 221
992 3300046522 Ga0495643_0088720 Ga0495643_0088720_612_1283 221
993 3300046522 Ga0495643_0128687 Ga0495643_0128687_58_729 221
994 3300046524 Ga0495648_0024563 Ga0495648_0024563_3286_3957 221
995 3300046525 Ga0495663_0016020 Ga0495663_0016020_1014_1685 221
996 3300046530 Ga0495654_0015845 Ga0495654_0015845_2713_3384 221
997 3300046530 Ga0495654_0136809 Ga0495654_0136809_72_743 221
998 3300046536 Ga0495587_0183369 Ga0495587_0183369_319_990 221
999 3300046538 Ga0495609_0017745 Ga0495609_0017745_1554_2225 221
1000 3300046538 Ga0495609_0172511 Ga0495609_0172511_122_793 221
1001 3300046558 Ga0495633_0051268 Ga0495633_0051268_655_1326 221
1002 3300046558 Ga0495633_0116426 Ga0495633_0116426_471_1142 221
1003 3300046615 Ga0495656_0092219 Ga0495656_0092219_229_900 221
1004 3300046616 Ga0495668_0007395 Ga0495668_0007395_5682_6353 221
1005 3300046616 Ga0495668_0015062 Ga0495668_0015062_3183_3854 221
1006 3300046660 Ga0495625_0025182 Ga0495625_0025182_3621_4292 221
1007 3300046660 Ga0495625_0025662 Ga0495625_0025662_3688_4359 221
1008 3300046660 Ga0495625_0298014 Ga0495625_0298014_286_957 221
1009 3300046660 Ga0495625_0416977 Ga0495625_0416977_36_707 221
1010 3300046663 Ga0495635_0130621 Ga0495635_0130621_440_1111 221
1011 3300046674 Ga0495588_0024719 Ga0495588_0024719_933_1604 221
1012 3300046674 Ga0495588_0056886 Ga0495588_0056886_420_1091 221
1013 3300046675 Ga0495657_0104414 Ga0495657_0104414_629_1300 221
1014 3300046691 Ga0495670_0073173 Ga0495670_0073173_790_1461 221
1015 3300046691 Ga0495670_0108191 Ga0495670_0108191_296_967 221
1016 3300046694 Ga0495649_0053179 Ga0495649_0053179_272_943 221
1017 3300046794 Ga0495589_0106330 Ga0495589_0106330_416_1087 221
1018 3300046809 Ga0495600_0116323 Ga0495600_0116323_164_835 221
1019 3300046810 Ga0495660_0023265 Ga0495660_0023265_608_1279 221
1020 3300046810 Ga0495660_0029530 Ga0495660_0029530_98_769 221
1021 3300047318 Ga0495636_0016804 Ga0495636_0016804_663_1334 221
1022 3300047320 Ga0495672_0025375 Ga0495672_0025375_2332_3003 221
1023 3300047443 Ga0495687_020080 Ga0495687_020080_817_1488 221
1024 3300047445 Ga0495677_0158449 Ga0495677_0158449_104_775 221
1025 3300047447 Ga0495685_097265 Ga0495685_097265_37_708 221
1026 3300047469 Ga0495673_0034766 Ga0495673_0034766_601_1272 221
1027 3300047470 Ga0495681_0014636 Ga0495681_0014636_3427_4098 221
1028 3300047470 Ga0495681_0155790 Ga0495681_0155790_41_712 221
1029 3300047472 Ga0495686_0000647 Ga0495686_0000647_23189_23860 221
1030 3300047472 Ga0495686_0015408 Ga0495686_0015408_3190_3861 221
1031 3300047472 Ga0495686_0015712 Ga0495686_0015712_3670_4341 221
1032 3300047472 Ga0495686_0156870 Ga0495686_0156870_97_768 221
1033 3300047472 Ga0495686_0300845 Ga0495686_0300845_167_838 221
1034 3300048091 Ga0495626_0059980 Ga0495626_0059980_613_1284 221
1035 3300048904 Ga0496101_0153477 Ga0496101_0153477_1000_1671 221
1036 3300048904 Ga0496101_0670582 Ga0496101_0670582_70_741 221
1037 3300048913 Ga0496110_0721710 Ga0496110_0721710_159_830 221
1038 3300048917 Ga0496114_0107672 Ga0496114_0107672_54_725 221
1039 3300048919 Ga0496116_0000061 Ga0496116_0000061_99254_99925 221
1040 3300048919 Ga0496116_0005599 Ga0496116_0005599_3165_3836 221
1041 3300048919 Ga0496116_0021753 Ga0496116_0021753_3179_3850 221
1042 3300048919 Ga0496116_0074465 Ga0496116_0074465_951_1622 221
1043 3300048919 Ga0496116_0109512 Ga0496116_0109512_476_1147 221
1044 3300048920 Ga0496117_0000002 Ga0496117_0000002_709158_709829 221
1045 3300048920 Ga0496117_0004483 Ga0496117_0004483_11432_12103 221
1046 3300048920 Ga0496117_0010604 Ga0496117_0010604_7360_8031 221
1047 3300048920 Ga0496117_0013487 Ga0496117_0013487_3948_4619 221
1048 3300048921 Ga0496118_0000319 Ga0496118_0000319_75085_75756 221
1049 3300048921 Ga0496118_0024477 Ga0496118_0024477_3598_4269 221
1050 3300048921 Ga0496118_0028865 Ga0496118_0028865_3232_3903 221
1051 3300048921 Ga0496118_0053316 Ga0496118_0053316_567_1238 221
1052 3300048922 Ga0496119_0020416 Ga0496119_0020416_1755_2426 221
1053 3300048922 Ga0496119_0096302 Ga0496119_0096302_714_1385 221
1054 3300048922 Ga0496119_0131094 Ga0496119_0131094_640_1311 221
1055 3300048923 Ga0496120_0003839 Ga0496120_0003839_195_866 221
1056 3300048923 Ga0496120_0030917 Ga0496120_0030917_1664_2335 221
1057 3300048924 Ga0496121_0000001 Ga0496121_0000001_1356490_1357161 221
1058 3300048924 Ga0496121_0014048 Ga0496121_0014048_3887_4558 221
1059 3300048924 Ga0496121_0022881 Ga0496121_0022881_3374_4045 221
1060 3300048924 Ga0496121_0024923 Ga0496121_0024923_3875_4546 221
1061 3300048924 Ga0496121_0028004 Ga0496121_0028004_3058_3729 221
1062 3300048925 Ga0496122_0000001 Ga0496122_0000001_75714_76385 221
1063 3300048925 Ga0496122_0011969 Ga0496122_0011969_5047_5718 221
1064 3300048925 Ga0496122_0012830 Ga0496122_0012830_3235_3906 221
1065 3300048925 Ga0496122_0018017 Ga0496122_0018017_5366_6037 221
1066 3300048925 Ga0496122_0019101 Ga0496122_0019101_2716_3387 221
1067 3300048925 Ga0496122_0029942 Ga0496122_0029942_3365_4036 221
1068 3300048926 Ga0496123_0000001 Ga0496123_0000001_79445_80116 221
1069 3300048926 Ga0496123_0001843 Ga0496123_0001843_2870_3541 221
1070 3300048926 Ga0496123_0282856 Ga0496123_0282856_70_741 221
1071 3300048927 Ga0496124_0001103 Ga0496124_0001103_19563_20234 221
1072 3300048927 Ga0496124_0003458 Ga0496124_0003458_3489_4160 221
1073 3300048927 Ga0496124_0004380 Ga0496124_0004380_2602_3273 221
1074 3300048927 Ga0496124_0009449 Ga0496124_0009449_6382_7053 221
1075 3300048927 Ga0496124_0021179 Ga0496124_0021179_760_1431 221
1076 3300048927 Ga0496124_0052290 Ga0496124_0052290_1166_1837 221
1077 3300048927 Ga0496124_0105954 Ga0496124_0105954_71_742 221
1078 3300048927 Ga0496124_0111425 Ga0496124_0111425_483_1154 221
1079 3300048927 Ga0496124_0130151 Ga0496124_0130151_499_1170 221
1080 3300048927 Ga0496124_0132613 Ga0496124_0132613_1004_1675 221
1081 3300048927 Ga0496124_0257510 Ga0496124_0257510_71_742 221
1082 3300048928 Ga0496125_0000001 Ga0496125_0000001_1516027_1516698 221
1083 3300048928 Ga0496125_0002540 Ga0496125_0002540_16250_16921 221
1084 3300048928 Ga0496125_0020129 Ga0496125_0020129_2012_2683 221
1085 3300048928 Ga0496125_0056623 Ga0496125_0056623_639_1310 221
1086 3300048928 Ga0496125_0081691 Ga0496125_0081691_907_1578 221
1087 3300048929 Ga0496126_0000397 Ga0496126_0000397_59106_59777 221
1088 3300048929 Ga0496126_0001855 Ga0496126_0001855_2889_3560 221
1089 3300048929 Ga0496126_0097712 Ga0496126_0097712_1033_1704 221
1090 3300048929 Ga0496126_0142165 Ga0496126_0142165_1223_1894 221
1091 3300049459 Ga0495678_010303 Ga0495678_010303_2984_3655 221
1092 3300049570 Ga0501033_0000059 Ga0501033_0000059_13957_14628 221
1093 3300049571 Ga0501034_0024880 Ga0501034_0024880_4287_4958 221
1094 3300049571 Ga0501034_1041119 Ga0501034_1041119_13_684 221
1095 3300049573 Ga0501037_0011663 Ga0501037_0011663_3135_3806 221
1096 3300049574 Ga0501038_0250388 Ga0501038_0250388_507_1178 221
1097 3300049776 Ga0501280_003727 Ga0501280_003727_1423_2094 221
1098 3300049823 Ga0501044_0466461 Ga0501044_0466461_132_803 221
1099 3300050489 nmdc:mga03683_78978_c1 nmdc:mga03683_78978_c1_30_701 221
1100 3300050489 nmdc:mga03683_85709_c1 nmdc:mga03683_85709_c1_407_1078 221
1101 3300050490 nmdc:mga03n38_44666_c1 nmdc:mga03n38_44666_c1_217_888 221
1102 3300050491 nmdc:mga00v17_1988_c1 nmdc:mga00v17_1988_c1_4599_5270 221
1103 3300050491 nmdc:mga00v17_7150_c1 nmdc:mga00v17_7150_c1_4564_5235 221
1104 3300050492 nmdc:mga0yw44_71024_c1 nmdc:mga0yw44_71024_c1_1120_1791 221
1105 3300050493 nmdc:mga0k408_19474_c1 nmdc:mga0k408_19474_c1_1611_2282 221
1106 3300050494 nmdc:mga06z11_5504_c1 nmdc:mga06z11_5504_c1_3000_3671 221
1107 3300050494 nmdc:mga06z11_7601_c1 nmdc:mga06z11_7601_c1_2597_3268 221
1108 3300050495 nmdc:mga04h51_1221_c1 nmdc:mga04h51_1221_c1_1491_2162 221
1109 3300050496 nmdc:mga07m45_49778_c1 nmdc:mga07m45_49778_c1_484_1155 221
1110 3300050496 nmdc:mga07m45_71936_c1 nmdc:mga07m45_71936_c1_1163_1834 221
1111 3300050516 nmdc:mga0sz30_110988_c1 nmdc:mga0sz30_110988_c1_208_879 221
1112 3300050516 nmdc:mga0sz30_4325_c1 nmdc:mga0sz30_4325_c1_1018_1689 221
1113 3300050516 nmdc:mga0sz30_4759_c1 nmdc:mga0sz30_4759_c1_125_796 221
1114 3300053079 Ga0500610_0006053 Ga0500610_0006053_836_1507 221
1115 3300053085 Ga0495619_0184110 Ga0495619_0184110_652_1323 221
1116 3300053086 Ga0500578_0024130 Ga0500578_0024130_770_1441 221
1117 3300053109 Ga0500569_001058 Ga0500569_001058_2296_2967 221
1118 3300053109 Ga0500569_037011 Ga0500569_037011_464_1135 221
1119 3300053125 Ga0500618_011885 Ga0500618_011885_990_1661 221
1120 3300053125 Ga0500618_058745 Ga0500618_058745_140_811 221
1121 3300053134 Ga0500658_0000646 Ga0500658_0000646_3726_4397 221
1122 3300053139 Ga0500568_0002207 Ga0500568_0002207_791_1462 221
1123 3300053140 Ga0500573_0030764 Ga0500573_0030764_1714_2385 221
1124 3300053140 Ga0500573_0033515 Ga0500573_0033515_60_731 221
1125 3300053148 Ga0500590_011111 Ga0500590_011111_289_960 221
1126 3300053153 Ga0500616_0002791 Ga0500616_0002791_7158_7829 221
1127 3300053153 Ga0500616_0011601 Ga0500616_0011601_1844_2515 221
1128 3300053156 Ga0500622_0000628 Ga0500622_0000628_3942_4613 221
1129 3300053157 Ga0500624_001829 Ga0500624_001829_1335_2006 221
1130 3300053158 Ga0500627_0064585 Ga0500627_0064585_120_791 221
1131 3300053161 Ga0500634_0010952 Ga0500634_0010952_3879_4553 221
1132 3300053177 Ga0500636_0000015 Ga0500636_0000015_3120_3791 221
1133 3300053177 Ga0500636_0015033 Ga0500636_0015033_1216_1887 221
1134 3300053177 Ga0500636_0153394 Ga0500636_0153394_192_863 221
1135 3300059493 Ga0587077_002115 Ga0587077_002115_1328_2002 221
1136 3300059503 Ga0587080_001009 Ga0587080_001009_1753_2424 221
1137 3300059503 Ga0587080_036680 Ga0587080_036680_112_783 221
1138 3300059505 Ga0587083_0001680 Ga0587083_0001680_535_1206 221
1139 3300059510 Ga0587090_000883 Ga0587090_000883_629_1300 221
1140 3300059510 Ga0587090_001476 Ga0587090_001476_1330_2001 221
1141 3300059644 Ga0587075_016922 Ga0587075_016922_180_851 221
1142 3300059645 Ga0587076_063086 Ga0587076_063086_29_700 221
1143 3300059647 Ga0587079_002090 Ga0587079_002090_1346_2017 221
1144 3300003781 Ga0055536_1006737 Ga0055536_10067374 222
1145 3300003791 Ga0055530_10012914 Ga0055530_100129144 222
1146 3300003792 Ga0055540_1001610 Ga0055540_10016108 222
1147 3300003794 Ga0055531_10003225 Ga0055531_1000322510 222
1148 3300005262 Ga0065165_1011958 Ga0065165_10119584 222
1149 3300005456 Ga0070678_100179422 Ga0070678_1001794222 222
1150 3300005548 Ga0070665_100178769 Ga0070665_1001787694 222
1151 3300006038 Ga0075365_10086473 Ga0075365_100864734 222
1152 3300006051 Ga0075364_10023511 Ga0075364_100235111 222
1153 3300006946 Ga0079104_1000022 Ga0079104_1000022206 222
1154 3300013102 Ga0157371_10408298 Ga0157371_104082982 222
1155 3300013105 Ga0157369_10082968 Ga0157369_100829684 222
1156 3300017792 Ga0163161_10655175 Ga0163161_106551751 222
1157 3300025292 Ga0209676_1009491 Ga0209676_10094917 222
1158 3300025297 Ga0209758_1000629 Ga0209758_100062944 222
1159 3300025298 Ga0209050_1004324 Ga0209050_10043249 222
1160 3300025303 Ga0209051_1002402 Ga0209051_10024024 222
1161 3300025304 Ga0209257_1002537 Ga0209257_100253715 222
1162 3300026121 Ga0207683_10214787 Ga0207683_102147872 222
1163 3300027111 Ga0209281_1000374 Ga0209281_100037447 222
1164 3300028379 Ga0268266_10174887 Ga0268266_101748872 222
1165 3300032004 Ga0307414_10923025 Ga0307414_109230252 222
1166 3300037418 Ga0395900_0491873 Ga0395900_0491873_19_693 222
1167 3300037471 Ga0395905_0000913 Ga0395905_0000913_34964_35638 222
1168 3300044683 Ga0466965_0036166 Ga0466965_0036166_859_1533 222
1169 3300044735 Ga0466968_0017268 Ga0466968_0017268_1740_2414 222
1170 3300044765 Ga0466970_0105796 Ga0466970_0105796_674_1348 222
1171 3300046460 Ga0495638_0237622 Ga0495638_0237622_47_721 222
1172 3300046501 Ga0495607_0053485 Ga0495607_0053485_556_1230 222
1173 3300046530 Ga0495654_0006310 Ga0495654_0006310_3072_3746 222
1174 3300047472 Ga0495686_0063374 Ga0495686_0063374_255_929 222
1175 3300048913 Ga0496110_0289341 Ga0496110_0289341_208_882 222
1176 3300048924 Ga0496121_0000751 Ga0496121_0000751_57217_57891 222
1177 3300048924 Ga0496121_0033069 Ga0496121_0033069_1121_1795 222
1178 3300048924 Ga0496121_0063385 Ga0496121_0063385_1661_2341 222
1179 3300048924 Ga0496121_0231473 Ga0496121_0231473_338_1114 222
1180 3300048925 Ga0496122_0000025 Ga0496122_0000025_177599_178273 222
1181 3300048926 Ga0496123_0000032 Ga0496123_0000032_185940_186614 222
1182 3300048926 Ga0496123_0078600 Ga0496123_0078600_982_1656 222
1183 3300048927 Ga0496124_0208600 Ga0496124_0208600_676_1350 222
1184 3300048927 Ga0496124_0214863 Ga0496124_0214863_265_939 222
1185 3300048927 Ga0496124_0520911 Ga0496124_0520911_76_750 222
1186 3300048928 Ga0496125_0000692 Ga0496125_0000692_28036_28812 222
1187 3300049459 Ga0495678_067728 Ga0495678_067728_153_827 222
1188 3300049570 Ga0501033_0229682 Ga0501033_0229682_458_1132 222
1189 3300049571 Ga0501034_0078998 Ga0501034_0078998_897_1571 222
1190 3300049581 Ga0501047_0279616 Ga0501047_0279616_101_775 222
1191 3300049742 Ga0501080_0464002 Ga0501080_0464002_188_862 222
1192 3300049744 Ga0501083_0052169 Ga0501083_0052169_779_1453 222
1193 3300050491 nmdc:mga00v17_391_c2 nmdc:mga00v17_391_c2_781_1455 222
1194 3300050492 nmdc:mga0yw44_35218_c1 nmdc:mga0yw44_35218_c1_1576_2256 222
1195 3300053087 Ga0500643_001930 Ga0500643_001930_7010_7678 222
1196 3300053125 Ga0500618_000396 Ga0500618_000396_26331_27005 222
1197 3300053125 Ga0500618_009682 Ga0500618_009682_1277_1951 222
1198 3300053136 Ga0500559_0035898 Ga0500559_0035898_562_1236 222
1199 3300053153 Ga0500616_0000805 Ga0500616_0000805_33416_34096 222
1200 3300053156 Ga0500622_0002327 Ga0500622_0002327_4962_5636 222
1201 3300005354 Ga0070675_100331681 Ga0070675_1003316812 223
1202 3300025926 Ga0207659_10256501 Ga0207659_102565012 223
1203 3300025933 Ga0207706_10426761 Ga0207706_104267612 223
1204 iso_pu_bacteria 2643221626 2644148445 223
1205 iso_pu_bacteria 2643221655 2644309276 223
1206 iso_pu_bacteria 2643221659 2644333103 223
1207 iso_pu_bacteria 2643221698 2644545725 223
1208 iso_pu_bacteria 2643221712 2644615218 223
1209 iso_pu_bacteria 2941499720 2941503729 223
1210 3300006844 Ga0075428_100442303 Ga0075428_1004423032 224
1211 3300037466 Ga0395898_0047273 Ga0395898_0047273_386_1087 224
1212 3300038443 Ga0395901_0198967 Ga0395901_0198967_463_1164 224
1213 3300048907 Ga0496104_0018917 Ga0496104_0018917_2980_3681 224
1214 3300048907 Ga0496104_0271796 Ga0496104_0271796_456_1157 224
1215 3300048908 Ga0496105_0032958 Ga0496105_0032958_3120_3821 224
1216 3300048913 Ga0496110_0149723 Ga0496110_0149723_838_1539 224
1217 3300048913 Ga0496110_0333451 Ga0496110_0333451_332_1033 224
1218 3300048915 Ga0496112_0607967 Ga0496112_0607967_163_864 224
1219 3300048916 Ga0496113_0058521 Ga0496113_0058521_1824_2525 224
1220 3300048918 Ga0496115_0238454 Ga0496115_0238454_428_1129 224
1221 3300005445 Ga0070708_100171611 Ga0070708_1001716112 225
1222 3300005937 Ga0081455_10017257 Ga0081455_1001725710 225
1223 3300006353 Ga0075370_10160838 Ga0075370_101608382 225
1224 3300006847 Ga0075431_100266156 Ga0075431_1002661561 225
1225 3300002074 JGI24748J21848_1012538 JGI24748J21848_10125382 226

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13507

GATase_5

CobB/CobQ-like glutamine amidotransferase domain

36

244

0.91

PF07685

GATase_3

CobB/CobQ-like glutamine amidotransferase domain

38

135

0.82

PF01965

DJ-1_PfpI

DJ-1/PfpI family

57

165

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.9054 1 222
3d54-assembly3.cif.gz_D structure of purlqs from thermotoga maritima 0.8973 1 222
6jta-assembly1.cif.gz_A crystal structure of d464a l465a mutant of fgam synthetase 0.8482 1 222
6lyl-assembly1.cif.gz_A crystal structure of s1052d mutant of formylglycinamidine synthetase 0.8478 1 222
3ugj-assembly1.cif.gz_A formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling 0.8445 1 222
ID Description Score Start End Superfamily
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9394 3 221 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9318 1 220 3.40.50.880
af_Q2FZJ1_1_219_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.927 3 221 3.40.50.880
af_P9WHL5_1_222_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9157 1 220 3.40.50.880
af_Q59042_1_229_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9125 3 223 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A380DNJ3-F1-model_v4 Phosphoribosylformylglycinamidine synthase (EC 6.3.5.3) 0.9578 112 225 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A4Q3Z080-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ 0.9578 129 222 GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0016787
AF-A0A351DLM1-F1-model_v4 deleted 0.9568 116 225
AF-Q3EWN9-F1-model_v4 deleted 0.9513 72 225
AF-A0A2E7UG65-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurQ (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit I) (FGAR amidotransferase I) (FGAR-AT I) (Glutaminase PurQ) (EC 3.5.1.2) (Phosphoribosylformylglycinamidine synthase subunit I) 0.9494 3 226 GO:0004359
GO:0004642
GO:0005524
GO:0005737
GO:0006189
GO:0006541

Feature Viewer

pLDDT pTM Quality
89.24 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map