F491911

General Info

Members Datasets Scaffolds Average Seq Length
1225 372 1222 80

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10047165|Ga0070658_100471654
Length 84
Sequence MPMPASEIEALIKAAIPGAEVTIRDLAGDGDHYAARVVSGSFAGLSRVRQHQAVYSALGGRMGGELHALQLETAVPSNLETESD

Samples

Sample ID Description Type Environment
1 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
2 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
21 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
34 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
50 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
102 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
103 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
104 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
105 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
123 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
134 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
135 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
218 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
227 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
228 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
229 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
230 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
231 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
232 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
233 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
234 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
235 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
236 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
237 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
238 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
239 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
240 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
241 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
242 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
254 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
255 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
263 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
267 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
268 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
269 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
270 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
271 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
272 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
273 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
283 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
284 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
289 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
290 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
294 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
295 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
296 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
297 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
298 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
299 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
300 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
301 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
302 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
309 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
310 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
311 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
312 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
313 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
325 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
326 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
327 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
328 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
329 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
330 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
331 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
332 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
333 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
334 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
335 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
336 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
339 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
340 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
341 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
342 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
343 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
348 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
349 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
352 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
353 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
354 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
355 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
356 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
357 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
371 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
372 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 3.02
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.12
Nodule 0
Rhizoplane 3.27
Rhizosphere 92.9
Stem 0
Stem Tuber 0.08
Unclassified 1.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000574 3300001915 Bacteria 11196
2 JGI24741J21665_1003070 3300001915 Bacteria 4108
3 JGI24741J21665_1024408 3300001915 Bacteria 928
4 JGI24746J21847_1031500 3300001977 Bacteria 731
5 JGI24740J21852_10003386 3300001979 Bacteria 7020
6 JGI24740J21852_10007509 3300001979 Bacteria 4424
7 JGI24740J21852_10016949 3300001979 Bacteria 2618
8 JGI24740J21852_10150693 3300001979 Bacteria 578
9 JGI24739J22299_10003122 3300001989 Bacteria 6321
10 JGI24739J22299_10044098 3300001989 Bacteria 1470
11 JGI24737J22298_10009060 3300001990 Bacteria 3318
12 JGI24737J22298_10018116 3300001990 Bacteria 2261
13 JGI24743J22301_10032538 3300001991 Bacteria 1030
14 JGI24735J21928_10012457 3300002067 Bacteria 2687
15 JGI24735J21928_10022433 3300002067 Bacteria 1922
16 JGI24735J21928_10024923 3300002067 Bacteria 1807
17 JGI24735J21928_10144871 3300002067 Bacteria 686
18 JGI24735J21928_10161405 3300002067 Bacteria 647
19 JGI24738J21930_10004861 3300002075 Bacteria 3263
20 JGI24738J21930_10017021 3300002075 Bacteria 1531
21 JGI24738J21930_10063331 3300002075 Bacteria 760
22 JGI24738J21930_10081562 3300002075 Bacteria 677
23 JGI24742J22300_10040275 3300002244 Bacteria 831
24 JGI24751J29686_10037870 3300002459 Bacteria 998
25 JGI25153J46596_10000654 3300003215 Bacteria 21202
26 Ga0055525_1000186 3300003759 Bacteria 75686
27 Ga0055542_1000025 3300003762 Bacteria 263538
28 Ga0055529_1000014 3300003763 Bacteria 367283
29 Ga0058863_11548226 3300004799 Bacteria 607
30 Ga0058862_12551368 3300004803 Bacteria 695
31 Ga0065714_10192658 3300005288 Bacteria 922
32 Ga0065712_10014525 3300005290 Bacteria 2421
33 Ga0065712_10290432 3300005290 Bacteria 878
34 Ga0065712_10486333 3300005290 Bacteria 659
35 Ga0065715_10044194 3300005293 Bacteria 1110
36 Ga0065715_10166649 3300005293 Bacteria 1580
37 Ga0065715_10344649 3300005293 Bacteria 924
38 Ga0065707_10397432 3300005295 Bacteria 857
39 Ga0070658_10003033 3300005327 Bacteria 13895
40 Ga0070658_10005053 3300005327 Bacteria 10737
41 Ga0070658_10013956 3300005327 Bacteria 6450
42 Ga0070658_10023751 3300005327 Bacteria 4917
43 Ga0070658_10030122 3300005327 Bacteria 4361
44 Ga0070658_10047165 3300005327 Bacteria 3486
45 Ga0070658_10228097 3300005327 Bacteria 1576
46 Ga0070658_10401846 3300005327 Bacteria 1177
47 Ga0070658_10481176 3300005327 Bacteria 1071
48 Ga0070658_10626652 3300005327 Bacteria 933
49 Ga0070658_10884413 3300005327 Bacteria 776
50 Ga0070658_10886760 3300005327 Bacteria 775
51 Ga0070658_10924530 3300005327 Bacteria 758
52 Ga0070658_10992059 3300005327 Bacteria 730
53 Ga0070658_10997067 3300005327 Bacteria 728
54 Ga0070658_11170847 3300005327 Bacteria 668
55 Ga0070658_11544463 3300005327 Bacteria 575
56 Ga0070658_11767854 3300005327 Bacteria 535
57 Ga0070676_10020664 3300005328 Bacteria 3679
58 Ga0070676_10023992 3300005328 Bacteria 3432
59 Ga0070676_10043678 3300005328 Bacteria 2605
60 Ga0070676_10627931 3300005328 Bacteria 777
61 Ga0070683_100017485 3300005329 Bacteria 6338
62 Ga0070683_100027613 3300005329 Bacteria 5121
63 Ga0070683_100051173 3300005329 Bacteria 3824
64 Ga0070683_100102513 3300005329 Bacteria 2695
65 Ga0070683_100202665 3300005329 Bacteria 1884
66 Ga0070683_100463365 3300005329 Bacteria 1210
67 Ga0070670_100016670 3300005331 Bacteria 6306
68 Ga0070670_100033067 3300005331 Bacteria 4455
69 Ga0070670_100107868 3300005331 Bacteria 2399
70 Ga0070670_100126346 3300005331 Bacteria 2207
71 Ga0070670_100334854 3300005331 Bacteria 1328
72 Ga0070670_100346935 3300005331 Bacteria 1304
73 Ga0070670_100703483 3300005331 Bacteria 909
74 Ga0070677_10319149 3300005333 Bacteria 795
75 Ga0070677_10661119 3300005333 Bacteria 585
76 Ga0068869_100015238 3300005334 Bacteria 5152
77 Ga0068869_101840964 3300005334 Bacteria 542
78 Ga0070666_10047540 3300005335 Bacteria 2881
79 Ga0070666_10899016 3300005335 Bacteria 655
80 Ga0070680_100007626 3300005336 Bacteria 8253
81 Ga0070680_100090995 3300005336 Bacteria 2525
82 Ga0070680_100097411 3300005336 Bacteria 2439
83 Ga0070680_100185298 3300005336 Bacteria 1753
84 Ga0070680_100307517 3300005336 Bacteria 1344
85 Ga0070680_100466653 3300005336 Bacteria 1079
86 Ga0070680_100657020 3300005336 Bacteria 901
87 Ga0070680_100698588 3300005336 Bacteria 873
88 Ga0070682_100047105 3300005337 Bacteria 2679
89 Ga0070682_100231965 3300005337 Bacteria 1320
90 Ga0070682_100271303 3300005337 Bacteria 1232
91 Ga0070682_100299723 3300005337 Bacteria 1179
92 Ga0070682_101308714 3300005337 Bacteria 616
93 Ga0068868_100373993 3300005338 Bacteria 1225
94 Ga0068868_100882337 3300005338 Bacteria 812
95 Ga0070660_100004030 3300005339 Bacteria 10144
96 Ga0070660_100106072 3300005339 Bacteria 2231
97 Ga0070660_100122768 3300005339 Bacteria 2073
98 Ga0070660_100141224 3300005339 Bacteria 1932
99 Ga0070660_100214414 3300005339 Bacteria 1563
100 Ga0070660_100246043 3300005339 Bacteria 1457
101 Ga0070660_100286629 3300005339 Bacteria 1348
102 Ga0070660_100437103 3300005339 Bacteria 1084
103 Ga0070660_100526942 3300005339 Bacteria 984
104 Ga0070660_101306935 3300005339 Bacteria 615
105 Ga0070660_101863904 3300005339 Bacteria 512
106 Ga0070689_100331758 3300005340 Bacteria 1272
107 Ga0070689_102187362 3300005340 Bacteria 507
108 Ga0070691_11055913 3300005341 Bacteria 510
109 Ga0070687_100275385 3300005343 Bacteria 1057
110 Ga0070687_100564088 3300005343 Bacteria 777
111 Ga0070661_100015195 3300005344 Bacteria 5432
112 Ga0070661_100043876 3300005344 Bacteria 3266
113 Ga0070661_100062023 3300005344 Bacteria 2745
114 Ga0070661_100083218 3300005344 Bacteria 2363
115 Ga0070661_100113377 3300005344 Bacteria 2026
116 Ga0070661_100114134 3300005344 Bacteria 2019
117 Ga0070661_100137487 3300005344 Bacteria 1839
118 Ga0070661_100140734 3300005344 Bacteria 1818
119 Ga0070661_100396394 3300005344 Bacteria 1091
120 Ga0070661_100491291 3300005344 Bacteria 981
121 Ga0070661_100514397 3300005344 Bacteria 959
122 Ga0070661_100653206 3300005344 Bacteria 854
123 Ga0070661_100874413 3300005344 Bacteria 741
124 Ga0070692_10006719 3300005345 Bacteria 5012
125 Ga0070692_10095812 3300005345 Bacteria 1620
126 Ga0070692_10168401 3300005345 Bacteria 1261
127 Ga0070692_10516558 3300005345 Bacteria 777
128 Ga0070668_100099808 3300005347 Bacteria 2299
129 Ga0070668_100107128 3300005347 Bacteria 2222
130 Ga0070668_100745715 3300005347 Bacteria 866
131 Ga0070668_101150317 3300005347 Bacteria 702
132 Ga0070669_100019184 3300005353 Bacteria 4886
133 Ga0070669_100034144 3300005353 Bacteria 3683
134 Ga0070669_100226259 3300005353 Bacteria 1481
135 Ga0070669_100319810 3300005353 Bacteria 1253
136 Ga0070675_100116015 3300005354 Bacteria 2270
137 Ga0070675_100508948 3300005354 Bacteria 1086
138 Ga0070675_101495551 3300005354 Bacteria 623
139 Ga0070671_100080797 3300005355 Bacteria 2718
140 Ga0070671_100109435 3300005355 Bacteria 2320
141 Ga0070671_101999777 3300005355 Bacteria 516
142 Ga0070674_100013554 3300005356 Bacteria 5043
143 Ga0070674_100040032 3300005356 Bacteria 3168
144 Ga0070674_100165147 3300005356 Bacteria 1683
145 Ga0070674_100452126 3300005356 Bacteria 1060
146 Ga0070673_100009087 3300005364 Bacteria 6653
147 Ga0070673_100084413 3300005364 Bacteria 2583
148 Ga0070673_100158336 3300005364 Bacteria 1924
149 Ga0070688_101677261 3300005365 Bacteria 520
150 Ga0070659_100024161 3300005366 Bacteria 4657
151 Ga0070659_100060497 3300005366 Bacteria 2992
152 Ga0070659_100089448 3300005366 Bacteria 2466
153 Ga0070659_100186354 3300005366 Bacteria 1705
154 Ga0070659_100251977 3300005366 Bacteria 1463
155 Ga0070659_100645242 3300005366 Bacteria 912
156 Ga0070659_100746368 3300005366 Bacteria 849
157 Ga0070659_100918432 3300005366 Bacteria 766
158 Ga0070659_101032815 3300005366 Bacteria 722
159 Ga0070659_101080407 3300005366 Bacteria 707
160 Ga0070667_100018909 3300005367 Bacteria 5712
161 Ga0070667_100026863 3300005367 Bacteria 4790
162 Ga0070667_100049910 3300005367 Bacteria 3525
163 Ga0070667_100067671 3300005367 Bacteria 3037
164 Ga0070667_100073243 3300005367 Bacteria 2920
165 Ga0070667_100499694 3300005367 Bacteria 1115
166 Ga0070709_11140387 3300005434 Bacteria 625
167 Ga0070714_100062769 3300005435 Bacteria 3193
168 Ga0070714_102024280 3300005435 Bacteria 562
169 Ga0070713_100254453 3300005436 Bacteria 1603
170 Ga0070663_100017589 3300005455 Bacteria 4669
171 Ga0070663_100027030 3300005455 Bacteria 3892
172 Ga0070663_100068437 3300005455 Bacteria 2578
173 Ga0070663_100086004 3300005455 Bacteria 2321
174 Ga0070663_100097035 3300005455 Bacteria 2193
175 Ga0070663_100418732 3300005455 Bacteria 1098
176 Ga0070663_100478395 3300005455 Bacteria 1031
177 Ga0070678_100001546 3300005456 Bacteria 12294
178 Ga0070678_100493989 3300005456 Bacteria 1079
179 Ga0070662_100019046 3300005457 Bacteria 4654
180 Ga0070662_100022014 3300005457 Bacteria 4358
181 Ga0070662_100048427 3300005457 Bacteria 3062
182 Ga0070662_100157773 3300005457 Bacteria 1772
183 Ga0070662_100567193 3300005457 Bacteria 952
184 Ga0070662_100641514 3300005457 Bacteria 895
185 Ga0070662_101131513 3300005457 Bacteria 672
186 Ga0070662_101494089 3300005457 Bacteria 583
187 Ga0070662_101534036 3300005457 Bacteria 575
188 Ga0070662_101582428 3300005457 Bacteria 565
189 Ga0070681_10042024 3300005458 Bacteria 4582
190 Ga0070681_10078833 3300005458 Bacteria 3251
191 Ga0070681_10290651 3300005458 Bacteria 1544
192 Ga0070681_10315092 3300005458 Bacteria 1474
193 Ga0070681_10615525 3300005458 Bacteria 1000
194 Ga0070681_10915582 3300005458 Bacteria 795
195 Ga0070681_11130400 3300005458 Bacteria 704
196 Ga0068867_100007054 3300005459 Bacteria 7939
197 Ga0068867_100243056 3300005459 Bacteria 1461
198 Ga0070706_100210185 3300005467 Bacteria 1817
199 Ga0070679_100003115 3300005530 Bacteria 15159
200 Ga0070679_100179972 3300005530 Bacteria 2087
201 Ga0070679_100297099 3300005530 Bacteria 1566
202 Ga0070679_100552228 3300005530 Bacteria 1095
203 Ga0070679_101274320 3300005530 Bacteria 680
204 Ga0070679_101550212 3300005530 Bacteria 610
205 Ga0070684_100081437 3300005535 Bacteria 2864
206 Ga0070684_100113302 3300005535 Bacteria 2434
207 Ga0070684_100461227 3300005535 Bacteria 1175
208 Ga0070684_102297183 3300005535 Bacteria 509
209 Ga0068853_100009859 3300005539 Bacteria 7709
210 Ga0068853_100087735 3300005539 Bacteria 2730
211 Ga0068853_100149046 3300005539 Bacteria 2105
212 Ga0068853_100181686 3300005539 Bacteria 1908
213 Ga0068853_100223803 3300005539 Bacteria 1719
214 Ga0068853_100346853 3300005539 Bacteria 1380
215 Ga0068853_101107910 3300005539 Bacteria 763
216 Ga0068853_101947438 3300005539 Bacteria 570
217 Ga0068853_102109450 3300005539 Bacteria 546
218 Ga0068853_102255729 3300005539 Bacteria 528
219 Ga0070672_100011421 3300005543 Bacteria 6194
220 Ga0070672_100040262 3300005543 Bacteria 3584
221 Ga0070672_100210427 3300005543 Bacteria 1628
222 Ga0070672_100398175 3300005543 Bacteria 1180
223 Ga0070672_100832824 3300005543 Bacteria 813
224 Ga0070695_100120838 3300005545 Bacteria 1792
225 Ga0070695_100182023 3300005545 Bacteria 1490
226 Ga0070695_100741494 3300005545 Bacteria 783
227 Ga0070696_100022927 3300005546 Bacteria 4245
228 Ga0070696_101012197 3300005546 Bacteria 695
229 Ga0070693_100065915 3300005547 Bacteria 2118
230 Ga0070693_100171300 3300005547 Bacteria 1391
231 Ga0070693_100613832 3300005547 Bacteria 787
232 Ga0070693_100683202 3300005547 Bacteria 750
233 Ga0070693_100708773 3300005547 Bacteria 738
234 Ga0070693_101137890 3300005547 Bacteria 597
235 Ga0070665_100000323 3300005548 Bacteria 73605
236 Ga0070665_100001399 3300005548 Bacteria 28354
237 Ga0070665_100005110 3300005548 Bacteria 13605
238 Ga0070665_100070713 3300005548 Bacteria 3496
239 Ga0070665_100367729 3300005548 Bacteria 1445
240 Ga0070665_101352964 3300005548 Bacteria 722
241 Ga0070665_101386589 3300005548 Bacteria 712
242 Ga0070704_100073619 3300005549 Bacteria 2489
243 Ga0070704_100432263 3300005549 Bacteria 1130
244 Ga0068855_100046390 3300005563 Bacteria 5137
245 Ga0068855_100054251 3300005563 Bacteria 4711
246 Ga0068855_100220101 3300005563 Bacteria 2129
247 Ga0068855_100371225 3300005563 Bacteria 1572
248 Ga0068855_100441424 3300005563 Bacteria 1421
249 Ga0068855_100903744 3300005563 Bacteria 933
250 Ga0068855_101144702 3300005563 Bacteria 811
251 Ga0068855_101380706 3300005563 Bacteria 727
252 Ga0068855_101483741 3300005563 Bacteria 697
253 Ga0068855_101659796 3300005563 Bacteria 653
254 Ga0070664_100015524 3300005564 Bacteria 6232
255 Ga0070664_100049987 3300005564 Bacteria 3537
256 Ga0070664_100082530 3300005564 Bacteria 2772
257 Ga0070664_100589262 3300005564 Bacteria 1031
258 Ga0070664_100621887 3300005564 Bacteria 1002
259 Ga0070664_100738338 3300005564 Bacteria 918
260 Ga0068857_100004600 3300005577 Bacteria 11689
261 Ga0068857_100349189 3300005577 Bacteria 1370
262 Ga0068857_100352778 3300005577 Bacteria 1362
263 Ga0068857_100380079 3300005577 Bacteria 1311
264 Ga0068857_100394755 3300005577 Bacteria 1287
265 Ga0068857_101250903 3300005577 Bacteria 719
266 Ga0068857_101847367 3300005577 Bacteria 592
267 Ga0068854_100015755 3300005578 Bacteria 5019
268 Ga0068854_100026943 3300005578 Bacteria 3955
269 Ga0068854_100034678 3300005578 Bacteria 3527
270 Ga0068854_100054916 3300005578 Bacteria 2866
271 Ga0068854_100077177 3300005578 Bacteria 2451
272 Ga0068854_100193471 3300005578 Bacteria 1595
273 Ga0068854_100216388 3300005578 Bacteria 1513
274 Ga0068854_100313653 3300005578 Bacteria 1272
275 Ga0068854_100399554 3300005578 Bacteria 1137
276 Ga0068854_100506449 3300005578 Bacteria 1017
277 Ga0068854_100579257 3300005578 Bacteria 955
278 Ga0068854_101745151 3300005578 Bacteria 570
279 Ga0068856_100009109 3300005614 Bacteria 9650
280 Ga0068856_100033877 3300005614 Bacteria 5001
281 Ga0068856_100055001 3300005614 Bacteria 3927
282 Ga0068856_100230040 3300005614 Bacteria 1869
283 Ga0068856_100478875 3300005614 Bacteria 1266
284 Ga0068856_100574550 3300005614 Bacteria 1148
285 Ga0068856_100585036 3300005614 Bacteria 1137
286 Ga0068856_101683563 3300005614 Bacteria 647
287 Ga0070702_100516805 3300005615 Bacteria 880
288 Ga0068852_100006017 3300005616 Bacteria 8739
289 Ga0068852_100021463 3300005616 Bacteria 5157
290 Ga0068852_100055591 3300005616 Bacteria 3417
291 Ga0068852_100116320 3300005616 Bacteria 2439
292 Ga0068852_100157469 3300005616 Bacteria 2117
293 Ga0068852_100231454 3300005616 Bacteria 1762
294 Ga0068852_100318011 3300005616 Bacteria 1511
295 Ga0068852_100695289 3300005616 Bacteria 1027
296 Ga0068852_101225811 3300005616 Bacteria 771
297 Ga0068852_101639316 3300005616 Bacteria 666
298 Ga0068859_100102736 3300005617 Bacteria 2916
299 Ga0068859_100885891 3300005617 Bacteria 978
300 Ga0068864_100147193 3300005618 Bacteria 2130
301 Ga0068866_10932671 3300005718 Bacteria 613
302 Ga0068861_100165393 3300005719 Bacteria 1829
303 Ga0068861_101325370 3300005719 Bacteria 701
304 Ga0068851_10012530 3300005834 Bacteria 3998
305 Ga0068851_10255874 3300005834 Bacteria 994
306 Ga0068851_10719625 3300005834 Bacteria 615
307 Ga0068870_10006029 3300005840 Bacteria 5325
308 Ga0068863_100010125 3300005841 Bacteria 9168
309 Ga0068863_100464881 3300005841 Bacteria 1243
310 Ga0068863_100650857 3300005841 Bacteria 1045
311 Ga0068858_100029611 3300005842 Bacteria 5085
312 Ga0068860_100004967 3300005843 Bacteria 13557
313 Ga0068860_100005579 3300005843 Bacteria 12718
314 Ga0068860_100024695 3300005843 Bacteria 5804
315 Ga0068862_100007377 3300005844 Bacteria 9124
316 Ga0068862_100019573 3300005844 Bacteria 5652
317 Ga0068862_100041542 3300005844 Bacteria 3913
318 Ga0068862_100054847 3300005844 Bacteria 3413
319 Ga0068862_100562290 3300005844 Bacteria 1090
320 Ga0068862_100798091 3300005844 Bacteria 922
321 Ga0068862_101789094 3300005844 Bacteria 623
322 Ga0081539_10016201 3300005985 Bacteria 5345
323 Ga0070712_101260551 3300006175 Bacteria 644
324 Ga0075366_10032304 3300006195 Bacteria 3081
325 Ga0097621_100002273 3300006237 Bacteria 13155
326 Ga0097621_100237316 3300006237 Bacteria 1593
327 Ga0097621_100510476 3300006237 Bacteria 1090
328 Ga0068871_100021080 3300006358 Bacteria 5003
329 Ga0068871_100077978 3300006358 Bacteria 2739
330 Ga0068865_100175505 3300006881 Bacteria 1646
331 Ga0068865_100805880 3300006881 Bacteria 810
332 Ga0068865_101023437 3300006881 Bacteria 724
333 Ga0097620_100102727 3300006931 Bacteria 2916
334 Ga0097620_100885961 3300006931 Bacteria 978
335 Ga0105240_10286632 3300009093 Bacteria 1890
336 Ga0105240_10357548 3300009093 Bacteria 1655
337 Ga0111539_10133352 3300009094 Bacteria 2908
338 Ga0105243_10000033 3300009148 Bacteria 180464
339 Ga0105243_11499179 3300009148 Bacteria 698
340 Ga0105241_10001031 3300009174 Bacteria 21221
341 Ga0105241_10071745 3300009174 Bacteria 2689
342 Ga0105241_10357331 3300009174 Bacteria 1270
343 Ga0105242_11049311 3300009176 Bacteria 826
344 Ga0105248_10141793 3300009177 Bacteria 2711
345 Ga0105237_10234305 3300009545 Bacteria 1837
346 Ga0105237_11848810 3300009545 Bacteria 612
347 Ga0105238_10232397 3300009551 Bacteria 1820
348 Ga0105238_11426341 3300009551 Bacteria 720
349 Ga0105249_10035144 3300009553 Bacteria 4543
350 Ga0105249_10278186 3300009553 Bacteria 1670
351 Ga0105239_10639586 3300010375 Bacteria 1215
352 Ga0105239_13264315 3300010375 Bacteria 528
353 Ga0105246_10131530 3300011119 Bacteria 1870
354 Ga0105246_10137348 3300011119 Bacteria 1834
355 Ga0105246_11079740 3300011119 Bacteria 732
356 Ga0157317_1002353 3300012475 Bacteria 1113
357 Ga0157314_1022480 3300012500 Bacteria 653
358 Ga0157324_1015623 3300012506 Bacteria 713
359 Ga0157327_1031939 3300012512 Bacteria 662
360 Ga0157326_1004163 3300012513 Bacteria 1518
361 Ga0157373_10028852 3300013100 Bacteria 4002
362 Ga0157373_10039547 3300013100 Bacteria 3377
363 Ga0157373_10058470 3300013100 Bacteria 2734
364 Ga0157373_10080646 3300013100 Bacteria 2295
365 Ga0157373_10169664 3300013100 Bacteria 1535
366 Ga0157373_10260483 3300013100 Bacteria 1227
367 Ga0157373_10296946 3300013100 Bacteria 1146
368 Ga0157373_10497764 3300013100 Bacteria 880
369 Ga0157373_10654490 3300013100 Bacteria 767
370 Ga0157373_10955889 3300013100 Bacteria 638
371 Ga0157373_11040336 3300013100 Bacteria 612
372 Ga0157371_10000059 3300013102 Bacteria 170541
373 Ga0157371_10043673 3300013102 Bacteria 3192
374 Ga0157371_10069985 3300013102 Bacteria 2484
375 Ga0157371_10106041 3300013102 Bacteria 1994
376 Ga0157371_10108598 3300013102 Bacteria 1969
377 Ga0157371_10115756 3300013102 Bacteria 1904
378 Ga0157371_10169813 3300013102 Bacteria 1558
379 Ga0157371_10179348 3300013102 Bacteria 1515
380 Ga0157371_10285046 3300013102 Bacteria 1194
381 Ga0157371_10309676 3300013102 Bacteria 1144
382 Ga0157371_10647490 3300013102 Bacteria 788
383 Ga0157371_10890708 3300013102 Bacteria 674
384 Ga0157370_10013215 3300013104 Bacteria 8512
385 Ga0157370_10019603 3300013104 Bacteria 6776
386 Ga0157370_10067434 3300013104 Bacteria 3382
387 Ga0157370_10102536 3300013104 Bacteria 2679
388 Ga0157370_10422400 3300013104 Bacteria 1226
389 Ga0157370_10648743 3300013104 Bacteria 965
390 Ga0157370_11854381 3300013104 Bacteria 541
391 Ga0157369_10033065 3300013105 Bacteria 5685
392 Ga0157369_10063471 3300013105 Bacteria 3979
393 Ga0157369_10069759 3300013105 Bacteria 3776
394 Ga0157369_10137983 3300013105 Bacteria 2581
395 Ga0157369_10481979 3300013105 Bacteria 1284
396 Ga0157369_10756850 3300013105 Bacteria 999
397 Ga0157369_10819940 3300013105 Bacteria 955
398 Ga0157369_12270758 3300013105 Bacteria 550
399 Ga0157374_10896058 3300013296 Bacteria 905
400 Ga0157374_11476392 3300013296 Bacteria 703
401 Ga0157374_12327861 3300013296 Bacteria 563
402 Ga0163162_10503383 3300013306 Bacteria 1342
403 Ga0163162_12901193 3300013306 Bacteria 552
404 Ga0157372_10006811 3300013307 Bacteria 12151
405 Ga0157372_10112553 3300013307 Bacteria 3118
406 Ga0157372_10407227 3300013307 Bacteria 1585
407 Ga0157372_11028217 3300013307 Bacteria 954
408 Ga0157372_11506807 3300013307 Bacteria 775
409 Ga0157372_11972427 3300013307 Unclassified 671
410 Ga0157372_13314890 3300013307 Bacteria 513
411 Ga0157375_10897230 3300013308 Bacteria 1031
412 Ga0157375_12809219 3300013308 Bacteria 582
413 Ga0157380_13287948 3300014326 Bacteria 517
414 Ga0182008_10439260 3300014497 Bacteria 707
415 Ga0182008_10766435 3300014497 Bacteria 557
416 Ga0157377_10076128 3300014745 Bacteria 1951
417 Ga0157377_10408223 3300014745 Bacteria 927
418 Ga0157377_10644846 3300014745 Bacteria 761
419 Ga0157377_10843626 3300014745 Bacteria 680
420 Ga0157379_11026788 3300014968 Bacteria 787
421 Ga0157376_10416101 3300014969 Bacteria 1303
422 Ga0163161_10951971 3300017792 Bacteria 730
423 Ga0197907_11013996 3300020069 Bacteria 801
424 Ga0206356_10386422 3300020070 Bacteria 720
425 Ga0206356_11392800 3300020070 Bacteria 655
426 Ga0206355_1505226 3300020076 Bacteria 1771
427 Ga0206351_10293905 3300020077 Bacteria 823
428 Ga0206351_10865377 3300020077 Bacteria 818
429 Ga0206352_10134520 3300020078 Bacteria 955
430 Ga0206352_10816031 3300020078 Bacteria 1497
431 Ga0206350_10874698 3300020080 Bacteria 1297
432 Ga0206350_11230029 3300020080 Bacteria 648
433 Ga0206354_10606539 3300020081 Bacteria 1111
434 Ga0206354_11398537 3300020081 Bacteria 982
435 Ga0206353_10737954 3300020082 Bacteria 1076
436 Ga0154015_1709903 3300020610 Bacteria 957
437 Ga0213875_10013137 3300021388 Bacteria 4073
438 Ga0224712_10078172 3300022467 Bacteria 1359
439 Ga0224712_10282104 3300022467 Bacteria 773
440 Ga0209563_100145 3300025230 Bacteria 75938
441 Ga0209437_125768 3300025233 Bacteria 648
442 Ga0209646_1019071 3300025246 Bacteria 1000
443 Ga0209026_1016930 3300025250 Bacteria 1173
444 Ga0209677_104936 3300025253 Bacteria 3640
445 Ga0209148_1000011 3300025254 Bacteria 1196503
446 Ga0209233_1019338 3300025261 Bacteria 1812
447 Ga0209455_1000006 3300025272 Bacteria 1196503
448 Ga0209758_1000001 3300025297 Bacteria 1981790
449 Ga0207697_10004884 3300025315 Bacteria 6321
450 Ga0207697_10019628 3300025315 Bacteria 2770
451 Ga0207697_10021840 3300025315 Bacteria 2622
452 Ga0207656_10024814 3300025321 Bacteria 2428
453 Ga0207656_10061171 3300025321 Bacteria 1652
454 Ga0207656_10146452 3300025321 Bacteria 1116
455 Ga0207656_10404315 3300025321 Bacteria 686
456 Ga0207682_10230202 3300025893 Bacteria 859
457 Ga0207692_10714320 3300025898 Bacteria 651
458 Ga0207642_10158786 3300025899 Bacteria 1212
459 Ga0207688_10004546 3300025901 Bacteria 7554
460 Ga0207688_10377762 3300025901 Bacteria 876
461 Ga0207680_10024970 3300025903 Bacteria 3290
462 Ga0207680_10226005 3300025903 Bacteria 1285
463 Ga0207680_10882236 3300025903 Bacteria 641
464 Ga0207680_10927382 3300025903 Bacteria 624
465 Ga0207647_10003878 3300025904 Bacteria 11181
466 Ga0207647_10011023 3300025904 Bacteria 6359
467 Ga0207647_10020394 3300025904 Bacteria 4446
468 Ga0207647_10064754 3300025904 Bacteria 2220
469 Ga0207647_10082181 3300025904 Bacteria 1930
470 Ga0207647_10082408 3300025904 Bacteria 1927
471 Ga0207647_10219410 3300025904 Bacteria 1096
472 Ga0207647_10419453 3300025904 Bacteria 752
473 Ga0207647_10580543 3300025904 Bacteria 620
474 Ga0207645_10026662 3300025907 Bacteria 3733
475 Ga0207645_10027083 3300025907 Bacteria 3704
476 Ga0207645_10100575 3300025907 Bacteria 1865
477 Ga0207645_10112424 3300025907 Bacteria 1764
478 Ga0207645_10121377 3300025907 Bacteria 1696
479 Ga0207645_10629415 3300025907 Bacteria 729
480 Ga0207643_10009827 3300025908 Bacteria 5139
481 Ga0207705_10000203 3300025909 Bacteria 60016
482 Ga0207705_10001816 3300025909 Bacteria 16820
483 Ga0207705_10032460 3300025909 Bacteria 3732
484 Ga0207705_10084985 3300025909 Bacteria 2311
485 Ga0207705_10125340 3300025909 Bacteria 1908
486 Ga0207705_10128666 3300025909 Bacteria 1883
487 Ga0207705_10139066 3300025909 Bacteria 1812
488 Ga0207705_10142518 3300025909 Bacteria 1790
489 Ga0207705_10156441 3300025909 Bacteria 1710
490 Ga0207705_10221090 3300025909 Bacteria 1439
491 Ga0207705_10503984 3300025909 Bacteria 940
492 Ga0207705_10506544 3300025909 Bacteria 938
493 Ga0207705_10729054 3300025909 Bacteria 770
494 Ga0207705_10765177 3300025909 Bacteria 750
495 Ga0207705_10797086 3300025909 Bacteria 733
496 Ga0207705_11117309 3300025909 Bacteria 607
497 Ga0207705_11406050 3300025909 Bacteria 530
498 Ga0207684_10177253 3300025910 Bacteria 1838
499 Ga0207654_10000897 3300025911 Bacteria 16495
500 Ga0207707_10058038 3300025912 Bacteria 3368
501 Ga0207707_10131196 3300025912 Bacteria 2191
502 Ga0207707_10146939 3300025912 Bacteria 2061
503 Ga0207707_10231331 3300025912 Bacteria 1608
504 Ga0207707_10755014 3300025912 Bacteria 813
505 Ga0207707_11243609 3300025912 Bacteria 601
506 Ga0207695_10020907 3300025913 Bacteria 7480
507 Ga0207695_10294250 3300025913 Bacteria 1515
508 Ga0207695_11148807 3300025913 Bacteria 657
509 Ga0207671_10042103 3300025914 Bacteria 3381
510 Ga0207671_10075279 3300025914 Bacteria 2524
511 Ga0207671_10523946 3300025914 Bacteria 945
512 Ga0207693_10653858 3300025915 Bacteria 816
513 Ga0207660_10069557 3300025917 Bacteria 2557
514 Ga0207660_10083256 3300025917 Bacteria 2355
515 Ga0207660_10195455 3300025917 Bacteria 1577
516 Ga0207660_10388479 3300025917 Bacteria 1122
517 Ga0207660_10934203 3300025917 Bacteria 708
518 Ga0207660_11072497 3300025917 Bacteria 657
519 Ga0207660_11744975 3300025917 Bacteria 500
520 Ga0207662_10013077 3300025918 Bacteria 4636
521 Ga0207657_10000468 3300025919 Bacteria 42779
522 Ga0207657_10000856 3300025919 Bacteria 32149
523 Ga0207657_10021935 3300025919 Bacteria 5996
524 Ga0207657_10026345 3300025919 Bacteria 5344
525 Ga0207657_10037144 3300025919 Bacteria 4355
526 Ga0207657_10040078 3300025919 Bacteria 4154
527 Ga0207657_10057510 3300025919 Bacteria 3351
528 Ga0207657_10103051 3300025919 Bacteria 2366
529 Ga0207657_10156752 3300025919 Bacteria 1851
530 Ga0207657_10236181 3300025919 Bacteria 1461
531 Ga0207657_10326539 3300025919 Bacteria 1213
532 Ga0207657_10480893 3300025919 Bacteria 973
533 Ga0207657_10563326 3300025919 Bacteria 890
534 Ga0207649_10000319 3300025920 Bacteria 36478
535 Ga0207649_10008668 3300025920 Bacteria 5554
536 Ga0207649_10041457 3300025920 Bacteria 2802
537 Ga0207649_10158574 3300025920 Bacteria 1566
538 Ga0207649_10192175 3300025920 Bacteria 1436
539 Ga0207649_10290875 3300025920 Bacteria 1191
540 Ga0207649_10356968 3300025920 Bacteria 1083
541 Ga0207649_11619387 3300025920 Bacteria 512
542 Ga0207652_10047862 3300025921 Bacteria 3653
543 Ga0207652_10149332 3300025921 Bacteria 2092
544 Ga0207652_10153364 3300025921 Bacteria 2063
545 Ga0207652_10272982 3300025921 Bacteria 1525
546 Ga0207652_10642473 3300025921 Bacteria 949
547 Ga0207652_10710235 3300025921 Bacteria 896
548 Ga0207652_10858948 3300025921 Bacteria 803
549 Ga0207652_11349090 3300025921 Bacteria 616
550 Ga0207681_10009916 3300025923 Bacteria 5829
551 Ga0207681_10013371 3300025923 Bacteria 5078
552 Ga0207681_10034526 3300025923 Bacteria 3326
553 Ga0207681_11282484 3300025923 Bacteria 615
554 Ga0207694_10006961 3300025924 Bacteria 8586
555 Ga0207694_10129875 3300025924 Bacteria 2019
556 Ga0207650_10018685 3300025925 Bacteria 4867
557 Ga0207650_10042250 3300025925 Bacteria 3344
558 Ga0207650_10080011 3300025925 Bacteria 2476
559 Ga0207650_10151016 3300025925 Bacteria 1833
560 Ga0207650_10213373 3300025925 Bacteria 1551
561 Ga0207650_10301013 3300025925 Bacteria 1310
562 Ga0207650_10393373 3300025925 Bacteria 1146
563 Ga0207650_10615646 3300025925 Bacteria 914
564 Ga0207650_11478776 3300025925 Bacteria 578
565 Ga0207700_10211441 3300025928 Bacteria 1640
566 Ga0207664_10094182 3300025929 Bacteria 2461
567 Ga0207644_10471624 3300025931 Bacteria 1033
568 Ga0207644_10963850 3300025931 Bacteria 715
569 Ga0207690_10006519 3300025932 Bacteria 6919
570 Ga0207690_10025795 3300025932 Bacteria 3695
571 Ga0207690_10114217 3300025932 Bacteria 1950
572 Ga0207690_10159055 3300025932 Bacteria 1682
573 Ga0207690_10292828 3300025932 Bacteria 1271
574 Ga0207690_10346174 3300025932 Bacteria 1174
575 Ga0207690_10384574 3300025932 Bacteria 1116
576 Ga0207690_10453076 3300025932 Bacteria 1031
577 Ga0207690_10551989 3300025932 Bacteria 937
578 Ga0207690_10814121 3300025932 Bacteria 772
579 Ga0207690_10988548 3300025932 Bacteria 700
580 Ga0207690_10992681 3300025932 Bacteria 698
581 Ga0207690_11758884 3300025932 Bacteria 518
582 Ga0207706_10008360 3300025933 Bacteria 9548
583 Ga0207706_10037355 3300025933 Bacteria 4314
584 Ga0207706_10053750 3300025933 Bacteria 3555
585 Ga0207706_10304811 3300025933 Bacteria 1387
586 Ga0207706_10332790 3300025933 Bacteria 1321
587 Ga0207706_10398949 3300025933 Bacteria 1192
588 Ga0207706_10469612 3300025933 Bacteria 1087
589 Ga0207706_10490465 3300025933 Bacteria 1061
590 Ga0207706_10773848 3300025933 Bacteria 817
591 Ga0207706_10890494 3300025933 Bacteria 752
592 Ga0207706_10892739 3300025933 Bacteria 751
593 Ga0207709_10000059 3300025935 Bacteria 211914
594 Ga0207709_11220527 3300025935 Bacteria 620
595 Ga0207670_10367260 3300025936 Bacteria 1143
596 Ga0207670_10369019 3300025936 Bacteria 1140
597 Ga0207670_10397087 3300025936 Bacteria 1102
598 Ga0207669_10000341 3300025937 Bacteria 21234
599 Ga0207669_10011156 3300025937 Bacteria 4361
600 Ga0207669_10023707 3300025937 Bacteria 3283
601 Ga0207669_10607785 3300025937 Bacteria 889
602 Ga0207704_10248674 3300025938 Bacteria 1333
603 Ga0207704_10594665 3300025938 Bacteria 905
604 Ga0207704_11964545 3300025938 Bacteria 503
605 Ga0207691_10044806 3300025940 Bacteria 4070
606 Ga0207691_10150303 3300025940 Bacteria 2048
607 Ga0207691_10538601 3300025940 Bacteria 990
608 Ga0207691_10600742 3300025940 Bacteria 931
609 Ga0207691_10791987 3300025940 Bacteria 797
610 Ga0207711_10559919 3300025941 Bacteria 1066
611 Ga0207689_10017112 3300025942 Bacteria 6136
612 Ga0207661_10218362 3300025944 Bacteria 1684
613 Ga0207661_10245895 3300025944 Bacteria 1588
614 Ga0207661_10412577 3300025944 Bacteria 1226
615 Ga0207661_11041549 3300025944 Bacteria 753
616 Ga0207661_11318040 3300025944 Bacteria 663
617 Ga0207661_11335906 3300025944 Bacteria 658
618 Ga0207679_10096623 3300025945 Bacteria 2299
619 Ga0207679_10174394 3300025945 Bacteria 1773
620 Ga0207679_10185811 3300025945 Bacteria 1723
621 Ga0207679_10255223 3300025945 Bacteria 1493
622 Ga0207679_10340230 3300025945 Bacteria 1305
623 Ga0207679_10522605 3300025945 Bacteria 1062
624 Ga0207679_10720233 3300025945 Bacteria 906
625 Ga0207679_10930405 3300025945 Bacteria 796
626 Ga0207679_11365553 3300025945 Bacteria 650
627 Ga0207679_11385712 3300025945 Bacteria 645
628 Ga0207667_10000002 3300025949 Bacteria 895662
629 Ga0207667_10016335 3300025949 Bacteria 8389
630 Ga0207667_10149462 3300025949 Bacteria 2404
631 Ga0207667_10346521 3300025949 Bacteria 1515
632 Ga0207667_10354441 3300025949 Bacteria 1496
633 Ga0207667_10925505 3300025949 Bacteria 862
634 Ga0207667_11289242 3300025949 Bacteria 707
635 Ga0207667_11502804 3300025949 Bacteria 644
636 Ga0207667_12262479 3300025949 Bacteria 500
637 Ga0207651_10643480 3300025960 Bacteria 930
638 Ga0207651_10692172 3300025960 Bacteria 897
639 Ga0207651_10815909 3300025960 Bacteria 828
640 Ga0207651_10885611 3300025960 Bacteria 794
641 Ga0207651_11092042 3300025960 Bacteria 715
642 Ga0207712_10005915 3300025961 Bacteria 7713
643 Ga0207712_10979462 3300025961 Bacteria 750
644 Ga0207668_10012882 3300025972 Bacteria 5132
645 Ga0207668_10094827 3300025972 Bacteria 2201
646 Ga0207668_10578373 3300025972 Bacteria 976
647 Ga0207668_10989196 3300025972 Bacteria 751
648 Ga0207668_11886448 3300025972 Bacteria 539
649 Ga0207640_10000689 3300025981 Bacteria 19681
650 Ga0207640_10064801 3300025981 Bacteria 2435
651 Ga0207640_10083870 3300025981 Bacteria 2186
652 Ga0207640_10410551 3300025981 Bacteria 1105
653 Ga0207640_10490626 3300025981 Bacteria 1021
654 Ga0207640_10636788 3300025981 Bacteria 907
655 Ga0207640_10653722 3300025981 Bacteria 896
656 Ga0207640_10693270 3300025981 Bacteria 872
657 Ga0207640_10721009 3300025981 Bacteria 857
658 Ga0207640_10991592 3300025981 Bacteria 738
659 Ga0207640_11009206 3300025981 Bacteria 732
660 Ga0207640_11020046 3300025981 Bacteria 729
661 Ga0207640_11244582 3300025981 Bacteria 663
662 Ga0207658_10026701 3300025986 Bacteria 4050
663 Ga0207658_10037213 3300025986 Bacteria 3494
664 Ga0207658_10071364 3300025986 Bacteria 2630
665 Ga0207658_10591532 3300025986 Bacteria 996
666 Ga0207658_10766616 3300025986 Bacteria 874
667 Ga0207677_10509819 3300026023 Bacteria 1042
668 Ga0207677_10697188 3300026023 Bacteria 901
669 Ga0207677_10927892 3300026023 Bacteria 786
670 Ga0207703_10025125 3300026035 Bacteria 4685
671 Ga0207639_10000124 3300026041 Bacteria 57560
672 Ga0207639_10030851 3300026041 Bacteria 3934
673 Ga0207639_10044664 3300026041 Bacteria 3333
674 Ga0207639_10273101 3300026041 Bacteria 1484
675 Ga0207639_10395352 3300026041 Bacteria 1244
676 Ga0207639_10568920 3300026041 Bacteria 1042
677 Ga0207639_10661373 3300026041 Bacteria 967
678 Ga0207639_10914052 3300026041 Bacteria 820
679 Ga0207678_10000357 3300026067 Bacteria 41546
680 Ga0207678_10001147 3300026067 Bacteria 24303
681 Ga0207678_10004733 3300026067 Bacteria 12224
682 Ga0207678_10018816 3300026067 Bacteria 6066
683 Ga0207678_10026062 3300026067 Bacteria 5101
684 Ga0207678_10029003 3300026067 Bacteria 4829
685 Ga0207678_10100933 3300026067 Bacteria 2465
686 Ga0207678_10106755 3300026067 Bacteria 2389
687 Ga0207678_10142732 3300026067 Bacteria 2044
688 Ga0207678_10236935 3300026067 Bacteria 1563
689 Ga0207678_10318086 3300026067 Bacteria 1339
690 Ga0207678_10321921 3300026067 Bacteria 1330
691 Ga0207678_10530845 3300026067 Bacteria 1028
692 Ga0207678_11815540 3300026067 Unclassified 533
693 Ga0207702_10003062 3300026078 Bacteria 15548
694 Ga0207702_10004365 3300026078 Bacteria 12607
695 Ga0207702_10119256 3300026078 Bacteria 2359
696 Ga0207702_10175180 3300026078 Bacteria 1970
697 Ga0207702_10329577 3300026078 Bacteria 1456
698 Ga0207641_10068185 3300026088 Bacteria 3049
699 Ga0207641_10368135 3300026088 Bacteria 1374
700 Ga0207641_10521756 3300026088 Bacteria 1156
701 Ga0207648_10009350 3300026089 Bacteria 9392
702 Ga0207648_10273954 3300026089 Bacteria 1508
703 Ga0207648_10706118 3300026089 Bacteria 935
704 Ga0207676_10028583 3300026095 Bacteria 4166
705 Ga0207676_11923638 3300026095 Bacteria 590
706 Ga0207674_10000730 3300026116 Bacteria 42917
707 Ga0207674_10005891 3300026116 Bacteria 14531
708 Ga0207674_10013176 3300026116 Bacteria 9199
709 Ga0207674_10013965 3300026116 Bacteria 8883
710 Ga0207674_10018179 3300026116 Bacteria 7649
711 Ga0207674_10233515 3300026116 Bacteria 1787
712 Ga0207674_10261486 3300026116 Bacteria 1678
713 Ga0207674_10425602 3300026116 Bacteria 1283
714 Ga0207674_10566208 3300026116 Bacteria 1098
715 Ga0207675_100512725 3300026118 Bacteria 1195
716 Ga0207675_100549609 3300026118 Bacteria 1154
717 Ga0207675_102321509 3300026118 Bacteria 550
718 Ga0207683_10014396 3300026121 Bacteria 6735
719 Ga0207683_10029198 3300026121 Bacteria 4774
720 Ga0207698_10011565 3300026142 Bacteria 5729
721 Ga0207698_10013806 3300026142 Bacteria 5345
722 Ga0207698_10092159 3300026142 Bacteria 2483
723 Ga0207698_10135776 3300026142 Bacteria 2110
724 Ga0207698_10307539 3300026142 Bacteria 1478
725 Ga0207698_10327727 3300026142 Bacteria 1437
726 Ga0207698_10367687 3300026142 Bacteria 1364
727 Ga0207698_10681423 3300026142 Bacteria 1021
728 Ga0207698_10846002 3300026142 Bacteria 920
729 Ga0209967_1011483 3300027364 Bacteria 1243
730 Ga0268266_10000002 3300028379 Bacteria 3059047
731 Ga0268266_10000452 3300028379 Bacteria 60195
732 Ga0268266_10007592 3300028379 Bacteria 9765
733 Ga0268266_10076162 3300028379 Bacteria 2915
734 Ga0268266_10438357 3300028379 Bacteria 1240
735 Ga0268266_10479174 3300028379 Bacteria 1186
736 Ga0268265_10003010 3300028380 Bacteria 12309
737 Ga0268265_10011047 3300028380 Bacteria 6099
738 Ga0268265_10013924 3300028380 Bacteria 5475
739 Ga0268265_10061170 3300028380 Bacteria 2889
740 Ga0268265_10242497 3300028380 Bacteria 1591
741 Ga0268265_11855722 3300028380 Bacteria 609
742 Ga0268264_10004146 3300028381 Bacteria 12400
743 Ga0268264_10011541 3300028381 Bacteria 7300
744 Ga0268264_10082954 3300028381 Bacteria 2744
745 Ga0307408_100036575 3300031548 Bacteria 3452
746 Ga0307408_100189378 3300031548 Bacteria 1656
747 Ga0307408_100266195 3300031548 Bacteria 1421
748 Ga0307408_100326406 3300031548 Bacteria 1294
749 Ga0307408_100524900 3300031548 Bacteria 1040
750 Ga0307408_100579931 3300031548 Bacteria 994
751 Ga0307408_100631195 3300031548 Bacteria 955
752 Ga0307408_101090399 3300031548 Bacteria 740
753 Ga0307408_101124381 3300031548 Bacteria 730
754 Ga0307408_101930741 3300031548 Bacteria 566
755 Ga0307405_10021558 3300031731 Bacteria 3624
756 Ga0307405_10111192 3300031731 Bacteria 1856
757 Ga0307405_10165710 3300031731 Bacteria 1570
758 Ga0307405_10179072 3300031731 Bacteria 1520
759 Ga0307405_10214362 3300031731 Bacteria 1408
760 Ga0307405_10260187 3300031731 Bacteria 1296
761 Ga0307405_10316370 3300031731 Bacteria 1190
762 Ga0307405_10328893 3300031731 Bacteria 1170
763 Ga0307405_10371429 3300031731 Bacteria 1110
764 Ga0307405_10420225 3300031731 Bacteria 1052
765 Ga0307413_10008092 3300031824 Bacteria 4937
766 Ga0307413_10013850 3300031824 Bacteria 4074
767 Ga0307413_10072035 3300031824 Bacteria 2180
768 Ga0307413_10209531 3300031824 Bacteria 1414
769 Ga0307413_10236039 3300031824 Bacteria 1346
770 Ga0307413_10426032 3300031824 Bacteria 1046
771 Ga0307413_10603871 3300031824 Bacteria 898
772 Ga0307413_10719061 3300031824 Bacteria 831
773 Ga0307413_10872911 3300031824 Bacteria 762
774 Ga0307413_11119742 3300031824 Bacteria 681
775 Ga0307413_11569605 3300031824 Bacteria 584
776 Ga0307413_12040744 3300031824 Bacteria 517
777 Ga0307410_10052601 3300031852 Bacteria 2752
778 Ga0307410_10189933 3300031852 Bacteria 1561
779 Ga0307410_10192471 3300031852 Bacteria 1552
780 Ga0307410_10192558 3300031852 Bacteria 1551
781 Ga0307410_10271850 3300031852 Bacteria 1326
782 Ga0307410_10274331 3300031852 Bacteria 1320
783 Ga0307410_10294036 3300031852 Bacteria 1279
784 Ga0307410_10407750 3300031852 Bacteria 1099
785 Ga0307410_10751535 3300031852 Bacteria 826
786 Ga0307410_11293709 3300031852 Bacteria 637
787 Ga0307410_11461625 3300031852 Bacteria 601
788 Ga0307406_10069949 3300031901 Bacteria 2296
789 Ga0307406_10091044 3300031901 Bacteria 2054
790 Ga0307406_10114532 3300031901 Bacteria 1862
791 Ga0307406_10220604 3300031901 Bacteria 1409
792 Ga0307406_10271518 3300031901 Bacteria 1288
793 Ga0307406_10564930 3300031901 Bacteria 933
794 Ga0307406_10669233 3300031901 Bacteria 863
795 Ga0307406_11571410 3300031901 Bacteria 580
796 Ga0307407_10030985 3300031903 Bacteria 2892
797 Ga0307407_10250636 3300031903 Bacteria 1213
798 Ga0307407_10298090 3300031903 Bacteria 1123
799 Ga0307407_10354072 3300031903 Bacteria 1040
800 Ga0307407_10518154 3300031903 Bacteria 876
801 Ga0307407_10734114 3300031903 Bacteria 746
802 Ga0307407_11384569 3300031903 Bacteria 554
803 Ga0307407_11517923 3300031903 Bacteria 530
804 Ga0307407_11685321 3300031903 Bacteria 504
805 Ga0307412_10001165 3300031911 Bacteria 15055
806 Ga0307412_10052332 3300031911 Bacteria 2703
807 Ga0307412_10153714 3300031911 Bacteria 1701
808 Ga0307412_10160694 3300031911 Bacteria 1668
809 Ga0307412_10257505 3300031911 Bacteria 1358
810 Ga0307412_10337741 3300031911 Bacteria 1204
811 Ga0307412_10408633 3300031911 Bacteria 1107
812 Ga0307412_10468554 3300031911 Bacteria 1042
813 Ga0307412_10537412 3300031911 Bacteria 979
814 Ga0307412_10606907 3300031911 Bacteria 927
815 Ga0307412_10955735 3300031911 Bacteria 754
816 Ga0307412_11095365 3300031911 Bacteria 708
817 Ga0307412_11661736 3300031911 Bacteria 584
818 Ga0307412_11793072 3300031911 Bacteria 564
819 Ga0307409_100074131 3300031995 Bacteria 2718
820 Ga0307409_100353795 3300031995 Bacteria 1387
821 Ga0307409_100549682 3300031995 Bacteria 1133
822 Ga0307409_100594830 3300031995 Bacteria 1092
823 Ga0307409_100711804 3300031995 Bacteria 1004
824 Ga0307409_100754675 3300031995 Bacteria 977
825 Ga0307409_101733238 3300031995 Bacteria 653
826 Ga0307409_101741075 3300031995 Bacteria 652
827 Ga0307409_102093789 3300031995 Bacteria 595
828 Ga0307409_102948260 3300031995 Bacteria 502
829 Ga0307416_100152722 3300032002 Bacteria 2120
830 Ga0307416_100153329 3300032002 Bacteria 2117
831 Ga0307416_100206250 3300032002 Bacteria 1870
832 Ga0307416_100376208 3300032002 Bacteria 1448
833 Ga0307416_100546686 3300032002 Bacteria 1231
834 Ga0307416_100704033 3300032002 Bacteria 1099
835 Ga0307416_100990144 3300032002 Bacteria 943
836 Ga0307416_101023308 3300032002 Bacteria 929
837 Ga0307416_101163215 3300032002 Bacteria 877
838 Ga0307416_101372708 3300032002 Bacteria 812
839 Ga0307416_101514386 3300032002 Bacteria 776
840 Ga0307416_101816699 3300032002 Bacteria 713
841 Ga0307416_102727023 3300032002 Bacteria 590
842 Ga0307416_102952341 3300032002 Bacteria 569
843 Ga0307416_103008986 3300032002 Bacteria 564
844 Ga0307416_103096295 3300032002 Bacteria 556
845 Ga0307414_10000343 3300032004 Bacteria 26284
846 Ga0307414_10021194 3300032004 Bacteria 4071
847 Ga0307414_10041633 3300032004 Bacteria 3114
848 Ga0307414_10154867 3300032004 Bacteria 1812
849 Ga0307414_10392121 3300032004 Bacteria 1203
850 Ga0307414_10479898 3300032004 Bacteria 1096
851 Ga0307414_10783771 3300032004 Bacteria 868
852 Ga0307414_10978705 3300032004 Bacteria 778
853 Ga0307414_11163553 3300032004 Bacteria 713
854 Ga0307414_11331702 3300032004 Bacteria 666
855 Ga0307414_11717018 3300032004 Bacteria 585
856 Ga0307411_10102213 3300032005 Bacteria 2030
857 Ga0307411_10149026 3300032005 Bacteria 1736
858 Ga0307411_10164328 3300032005 Bacteria 1667
859 Ga0307411_10180607 3300032005 Bacteria 1601
860 Ga0307411_10270793 3300032005 Bacteria 1346
861 Ga0307411_10351521 3300032005 Bacteria 1202
862 Ga0307411_10559042 3300032005 Bacteria 977
863 Ga0307411_10633902 3300032005 Bacteria 923
864 Ga0307411_11032611 3300032005 Bacteria 737
865 Ga0307411_11603045 3300032005 Bacteria 600
866 Ga0307415_100045833 3300032126 Bacteria 2934
867 Ga0307415_100134218 3300032126 Bacteria 1879
868 Ga0307415_100164695 3300032126 Bacteria 1723
869 Ga0307415_100251349 3300032126 Bacteria 1436
870 Ga0307415_100308804 3300032126 Bacteria 1313
871 Ga0307415_100434342 3300032126 Bacteria 1130
872 Ga0307415_100441682 3300032126 Bacteria 1122
873 Ga0307415_100446001 3300032126 Bacteria 1117
874 Ga0307415_100479183 3300032126 Bacteria 1083
875 Ga0307415_100805508 3300032126 Bacteria 858
876 Ga0307415_101181059 3300032126 Bacteria 720
877 Ga0307415_101682620 3300032126 Bacteria 611
878 Ga0307415_101692456 3300032126 Bacteria 610
879 Ga0307415_101807011 3300032126 Bacteria 591
880 Ga0307415_102353342 3300032126 Bacteria 523
881 Ga0373952_0191951 3300035092 Bacteria 594
882 Ga0373945_0446294 3300035116 Bacteria 571
883 Ga0373943_0300803 3300035170 Bacteria 911
884 Ga0373946_0361913 3300035171 Bacteria 727
885 Ga0373946_0710935 3300035171 Bacteria 526
886 Ga0373931_0561851 3300035691 Bacteria 742
887 Ga0373935_0012992 3300035692 Bacteria 5019
888 Ga0373935_0525575 3300035692 Bacteria 861
889 Ga0373933_0170497 3300035724 Bacteria 1385
890 Ga0395899_0000103 3300037312 Bacteria 147274
891 Ga0395899_0001919 3300037312 Bacteria 17147
892 Ga0395899_0044654 3300037312 Bacteria 3301
893 Ga0395899_0050965 3300037312 Bacteria 3072
894 Ga0395899_0126104 3300037312 Bacteria 1831
895 Ga0395899_0156292 3300037312 Bacteria 1613
896 Ga0395899_0193247 3300037312 Bacteria 1423
897 Ga0395899_0193979 3300037312 Bacteria 1420
898 Ga0395899_0216701 3300037312 Bacteria 1328
899 Ga0395899_0217347 3300037312 Bacteria 1325
900 Ga0395899_0245336 3300037312 Bacteria 1231
901 Ga0395899_0337493 3300037312 Bacteria 1011
902 Ga0395899_0416617 3300037312 Bacteria 886
903 Ga0395899_0529614 3300037312 Bacteria 760
904 Ga0395899_0669683 3300037312 Bacteria 654
905 Ga0395899_0779728 3300037312 Bacteria 592
906 Ga0395900_0001171 3300037418 Bacteria 32731
907 Ga0395900_0009006 3300037418 Bacteria 10235
908 Ga0395900_0014276 3300037418 Bacteria 8109
909 Ga0395900_0018553 3300037418 Bacteria 7094
910 Ga0395900_0027132 3300037418 Bacteria 5863
911 Ga0395900_0052179 3300037418 Bacteria 4210
912 Ga0395900_0065379 3300037418 Bacteria 3736
913 Ga0395900_0080027 3300037418 Bacteria 3358
914 Ga0395900_0092958 3300037418 Bacteria 3098
915 Ga0395900_0108414 3300037418 Bacteria 2853
916 Ga0395900_0144204 3300037418 Bacteria 2436
917 Ga0395900_0190670 3300037418 Bacteria 2079
918 Ga0395900_0265260 3300037418 Bacteria 1713
919 Ga0395900_0318708 3300037418 Bacteria 1535
920 Ga0395900_0340724 3300037418 Bacteria 1475
921 Ga0395900_0368354 3300037418 Bacteria 1407
922 Ga0395900_0431266 3300037418 Bacteria 1277
923 Ga0395900_0533452 3300037418 Bacteria 1120
924 Ga0395900_0606174 3300037418 Bacteria 1035
925 Ga0395900_0685477 3300037418 Bacteria 959
926 Ga0395900_1036317 3300037418 Bacteria 739
927 Ga0395900_1374095 3300037418 Bacteria 619
928 Ga0395900_1650602 3300037418 Bacteria 552
929 Ga0395900_1736782 3300037418 Bacteria 535
930 Ga0395898_0000053 3300037466 Bacteria 279600
931 Ga0395898_0001741 3300037466 Bacteria 28718
932 Ga0395898_0059944 3300037466 Bacteria 3700
933 Ga0395898_0104192 3300037466 Bacteria 2721
934 Ga0395898_0174873 3300037466 Bacteria 2052
935 Ga0395898_0177082 3300037466 Bacteria 2038
936 Ga0395898_0739086 3300037466 Bacteria 925
937 Ga0395898_1051845 3300037466 Bacteria 748
938 Ga0395905_0000031 3300037471 Bacteria 286757
939 Ga0395905_0001079 3300037471 Bacteria 34311
940 Ga0395905_0010154 3300037471 Bacteria 9177
941 Ga0395905_0010668 3300037471 Bacteria 8912
942 Ga0395905_0013100 3300037471 Bacteria 7961
943 Ga0395905_0016805 3300037471 Bacteria 6951
944 Ga0395905_0020072 3300037471 Bacteria 6332
945 Ga0395905_0022886 3300037471 Bacteria 5906
946 Ga0395905_0030876 3300037471 Bacteria 5046
947 Ga0395905_0049853 3300037471 Bacteria 3924
948 Ga0395905_0104535 3300037471 Bacteria 2659
949 Ga0395905_0127455 3300037471 Bacteria 2393
950 Ga0395905_0158570 3300037471 Bacteria 2127
951 Ga0395905_0180626 3300037471 Bacteria 1981
952 Ga0395905_0243444 3300037471 Bacteria 1680
953 Ga0395905_0277537 3300037471 Bacteria 1562
954 Ga0395905_0301969 3300037471 Bacteria 1488
955 Ga0395905_0317740 3300037471 Bacteria 1447
956 Ga0395905_0432860 3300037471 Bacteria 1212
957 Ga0395905_0489681 3300037471 Bacteria 1129
958 Ga0395905_0670974 3300037471 Bacteria 939
959 Ga0395905_0809719 3300037471 Bacteria 840
960 Ga0395905_1115582 3300037471 Bacteria 692
961 Ga0395905_1311537 3300037471 Bacteria 628
962 Ga0436364_0831628 3300037853 Bacteria 731
963 Ga0436364_1360610 3300037853 Bacteria 32497
964 Ga0395901_0000140 3300038443 Bacteria 94487
965 Ga0395901_0000163 3300038443 Bacteria 87103
966 Ga0395901_0001340 3300038443 Bacteria 25815
967 Ga0395901_0002772 3300038443 Bacteria 17659
968 Ga0395901_0019566 3300038443 Bacteria 6919
969 Ga0395901_0037956 3300038443 Bacteria 4982
970 Ga0395901_0048374 3300038443 Bacteria 4416
971 Ga0395901_0082771 3300038443 Bacteria 3353
972 Ga0395901_0120754 3300038443 Bacteria 2754
973 Ga0395901_0132520 3300038443 Bacteria 2619
974 Ga0395901_0152943 3300038443 Bacteria 2424
975 Ga0395901_0306549 3300038443 Bacteria 1645
976 Ga0395901_0373498 3300038443 Bacteria 1468
977 Ga0395901_0950586 3300038443 Bacteria 838
978 Ga0395901_1045016 3300038443 Bacteria 790
979 Ga0395901_1323834 3300038443 Bacteria 681
980 Ga0436363_1532858 3300039450 Bacteria 773
981 Ga0436362_0013497 3300039453 Bacteria 580
982 Ga0451789_0444458 3300041443 Bacteria 566
983 Ga0451800_0026858 3300041459 Bacteria 571
984 Ga0451800_1450778 3300041459 Bacteria 1004
985 Ga0451802_1464898 3300041460 Bacteria 676
986 Ga0451833_0589453 3300041491 Bacteria 596
987 Ga0451833_0716403 3300041491 Bacteria 641
988 Ga0451841_0430204 3300041498 Bacteria 751
989 Ga0439448_0099506 3300042005 Bacteria 987
990 Ga0439448_0123401 3300042005 Bacteria 890
991 Ga0450914_000284 3300042118 Bacteria 2117
992 Ga0450890_008119 3300042127 Bacteria 1342
993 Ga0450892_009128 3300042130 Bacteria 855
994 Ga0450903_027394 3300042138 Bacteria 867
995 Ga0450905_000624 3300042142 Bacteria 4354
996 Ga0450889_000401 3300042144 Bacteria 4830
997 Ga0439458_0000872 3300042157 Bacteria 7816
998 Ga0450893_0107181 3300042532 Bacteria 574
999 Ga0466969_0311748 3300044656 Bacteria 712
1000 Ga0466965_0283629 3300044683 Bacteria 895
1001 Ga0466965_0379291 3300044683 Bacteria 778
1002 Ga0466966_0029734 3300044684 Bacteria 3552
1003 Ga0466966_0152890 3300044684 Bacteria 1407
1004 Ga0466966_0437630 3300044684 Bacteria 786
1005 Ga0466961_0072117 3300044693 Bacteria 2191
1006 Ga0466961_0407017 3300044693 Bacteria 825
1007 Ga0466963_0014100 3300044694 Bacteria 4924
1008 Ga0466963_0050663 3300044694 Bacteria 2748
1009 Ga0466963_0319687 3300044694 Bacteria 1092
1010 Ga0466963_0988452 3300044694 Bacteria 592
1011 Ga0466964_0155458 3300044706 Bacteria 1064
1012 Ga0466964_0646528 3300044706 Bacteria 584
1013 Ga0466971_0090696 3300044719 Bacteria 1399
1014 Ga0466971_0159112 3300044719 Bacteria 1057
1015 Ga0466970_0094310 3300044765 Bacteria 1626
1016 Ga0466957_0086010 3300044842 Bacteria 1964
1017 Ga0466957_0199266 3300044842 Bacteria 1314
1018 Ga0466957_0242823 3300044842 Bacteria 1195
1019 Ga0466957_0589524 3300044842 Bacteria 777
1020 Ga0466960_0060197 3300044901 Bacteria 1860
1021 Ga0466960_0526951 3300044901 Bacteria 695
1022 Ga0466959_0026777 3300045049 Bacteria 4276
1023 Ga0466959_0065062 3300045049 Bacteria 2646
1024 Ga0466959_0415737 3300045049 Bacteria 913
1025 Ga0466958_0204037 3300045836 Bacteria 1258
1026 Ga0466958_0205971 3300045836 Bacteria 1252
1027 Ga0466958_0579658 3300045836 Bacteria 729
1028 Ga0466967_0015683 3300045976 Bacteria 5949
1029 Ga0466967_0099217 3300045976 Bacteria 2660
1030 Ga0466967_0112196 3300045976 Bacteria 2506
1031 Ga0466967_0141669 3300045976 Bacteria 2240
1032 Ga0466967_0175489 3300045976 Bacteria 2019
1033 Ga0466967_0242317 3300045976 Bacteria 1720
1034 Ga0466967_0406998 3300045976 Bacteria 1324
1035 Ga0466967_0737720 3300045976 Bacteria 976
1036 Ga0466967_0794470 3300045976 Bacteria 939
1037 Ga0466967_0799106 3300045976 Bacteria 937
1038 Ga0466967_0799488 3300045976 Bacteria 936
1039 Ga0466967_0947079 3300045976 Bacteria 857
1040 Ga0466967_1069857 3300045976 Bacteria 803
1041 Ga0495617_235760 3300046452 Bacteria 566
1042 Ga0495638_0000051 3300046460 Bacteria 206003
1043 Ga0495585_0066796 3300046492 Bacteria 1968
1044 Ga0495585_0292015 3300046492 Bacteria 803
1045 Ga0495585_0319097 3300046492 Bacteria 760
1046 Ga0495596_0011244 3300046500 Bacteria 3867
1047 Ga0495607_0258104 3300046501 Bacteria 836
1048 Ga0495583_0000498 3300046506 Bacteria 56923
1049 Ga0495583_0013060 3300046506 Bacteria 4658
1050 Ga0495606_0009337 3300046507 Bacteria 8313
1051 Ga0495606_0083378 3300046507 Bacteria 1982
1052 Ga0495610_0089165 3300046512 Bacteria 1401
1053 Ga0495610_0179669 3300046512 Bacteria 881
1054 Ga0495616_0040154 3300046513 Bacteria 2393
1055 Ga0495616_0447787 3300046513 Bacteria 523
1056 Ga0495631_0125497 3300046518 Bacteria 1103
1057 Ga0495631_0259100 3300046518 Bacteria 741
1058 Ga0495632_0000511 3300046519 Bacteria 36529
1059 Ga0495637_0006994 3300046520 Bacteria 5621
1060 Ga0495637_0299266 3300046520 Bacteria 571
1061 Ga0495643_0001726 3300046522 Bacteria 18888
1062 Ga0495643_0003070 3300046522 Bacteria 12540
1063 Ga0495643_0144798 3300046522 Bacteria 1181
1064 Ga0495648_0000032 3300046524 Bacteria 205970
1065 Ga0495648_0000459 3300046524 Bacteria 44196
1066 Ga0495663_0046415 3300046525 Bacteria 1334
1067 Ga0495642_0134621 3300046528 Bacteria 1065
1068 Ga0495654_0177303 3300046530 Bacteria 925
1069 Ga0495654_0226710 3300046530 Bacteria 788
1070 Ga0495654_0412971 3300046530 Bacteria 535
1071 Ga0495609_0084505 3300046538 Bacteria 1385
1072 Ga0495597_0020763 3300046542 Bacteria 3056
1073 Ga0495633_0005764 3300046558 Bacteria 7484
1074 Ga0495633_0370354 3300046558 Bacteria 648
1075 Ga0495668_0000072 3300046616 Bacteria 167170
1076 Ga0495668_0080229 3300046616 Bacteria 1790
1077 Ga0495668_0258468 3300046616 Bacteria 953
1078 Ga0495668_0266233 3300046616 Bacteria 938
1079 Ga0495668_0613338 3300046616 Bacteria 601
1080 Ga0495668_0786234 3300046616 Bacteria 527
1081 Ga0495611_0126392 3300046648 Bacteria 1192
1082 Ga0495611_0237986 3300046648 Bacteria 845
1083 Ga0495669_0000148 3300046684 Bacteria 44972
1084 Ga0495669_0000393 3300046684 Bacteria 21758
1085 Ga0495669_0030586 3300046684 Bacteria 2363
1086 Ga0495669_0033908 3300046684 Bacteria 2249
1087 Ga0495669_0084230 3300046684 Bacteria 1462
1088 Ga0495670_0156861 3300046691 Bacteria 1195
1089 Ga0495670_0233962 3300046691 Bacteria 977
1090 Ga0495670_0446584 3300046691 Bacteria 700
1091 Ga0495671_0000020 3300046692 Bacteria 268306
1092 Ga0495671_0233113 3300046692 Bacteria 890
1093 Ga0495649_0065105 3300046694 Bacteria 1957
1094 Ga0495649_0147940 3300046694 Bacteria 1234
1095 Ga0495589_0492604 3300046794 Bacteria 560
1096 Ga0495660_0167317 3300046810 Bacteria 1073
1097 Ga0495683_0006914 3300047323 Bacteria 6164
1098 Ga0495683_0136688 3300047323 Bacteria 1151
1099 Ga0495683_0199262 3300047323 Bacteria 904
1100 Ga0495687_000068 3300047443 Bacteria 161081
1101 Ga0495687_000563 3300047443 Bacteria 43682
1102 Ga0495677_0001813 3300047445 Bacteria 8542
1103 Ga0495677_0040255 3300047445 Bacteria 1709
1104 Ga0495677_0263929 3300047445 Bacteria 674
1105 Ga0495673_0000076 3300047469 Bacteria 205985
1106 Ga0495673_0069654 3300047469 Bacteria 1483
1107 Ga0495681_0026199 3300047470 Bacteria 3040
1108 Ga0496101_0064826 3300048904 Bacteria 2662
1109 Ga0496101_0584746 3300048904 Bacteria 883
1110 Ga0496101_1466766 3300048904 Bacteria 531
1111 Ga0496102_0002779 3300048905 Bacteria 14916
1112 Ga0496103_0000517 3300048906 Bacteria 31756
1113 Ga0496103_0518791 3300048906 Bacteria 762
1114 Ga0496103_0585493 3300048906 Bacteria 711
1115 Ga0496103_0606375 3300048906 Bacteria 697
1116 Ga0496104_0087808 3300048907 Bacteria 2970
1117 Ga0496105_0009488 3300048908 Bacteria 7614
1118 Ga0496105_1249292 3300048908 Bacteria 545
1119 Ga0496107_0030953 3300048910 Bacteria 3816
1120 Ga0496107_0060972 3300048910 Bacteria 2731
1121 Ga0496107_0286217 3300048910 Bacteria 1227
1122 Ga0496107_0508859 3300048910 Bacteria 893
1123 Ga0496108_0001668 3300048911 Bacteria 17616
1124 Ga0496108_0570193 3300048911 Bacteria 987
1125 Ga0496108_0613460 3300048911 Bacteria 947
1126 Ga0496109_0009641 3300048912 Bacteria 8237
1127 Ga0496109_0247125 3300048912 Bacteria 1680
1128 Ga0496109_0512533 3300048912 Bacteria 1132
1129 Ga0496110_0014892 3300048913 Bacteria 6463
1130 Ga0496110_0074688 3300048913 Bacteria 3011
1131 Ga0496111_0103646 3300048914 Bacteria 2092
1132 Ga0496111_0302908 3300048914 Bacteria 1185
1133 Ga0496111_0374996 3300048914 Bacteria 1052
1134 Ga0496111_0893601 3300048914 Bacteria 640
1135 Ga0496112_0107967 3300048915 Bacteria 2753
1136 Ga0496112_0161406 3300048915 Bacteria 2208
1137 Ga0496112_0979400 3300048915 Bacteria 766
1138 Ga0496112_1435847 3300048915 Bacteria 604
1139 Ga0496112_1713334 3300048915 Bacteria 541
1140 Ga0496113_0197489 3300048916 Bacteria 1598
1141 Ga0496113_0957338 3300048916 Bacteria 675
1142 Ga0496114_0006445 3300048917 Bacteria 9242
1143 Ga0496115_0000269 3300048918 Bacteria 45856
1144 Ga0496116_0013371 3300048919 Bacteria 6624
1145 Ga0496117_0000887 3300048920 Bacteria 46091
1146 Ga0496118_0001717 3300048921 Bacteria 31948
1147 Ga0496119_0027215 3300048922 Bacteria 3937
1148 Ga0496120_0058805 3300048923 Bacteria 2158
1149 Ga0496121_0004850 3300048924 Bacteria 17692
1150 Ga0496122_0065656 3300048925 Bacteria 2629
1151 Ga0496123_0044148 3300048926 Bacteria 3051
1152 Ga0496124_0000960 3300048927 Bacteria 45969
1153 Ga0496125_0000956 3300048928 Bacteria 45452
1154 Ga0496126_0000321 3300048929 Bacteria 102445
1155 Ga0501307_089580 3300049162 Bacteria 512
1156 Ga0501314_003183 3300049530 Bacteria 1312
1157 Ga0501315_051347 3300049531 Bacteria 648
1158 Ga0501315_103210 3300049531 Bacteria 506
1159 Ga0501320_051028 3300049536 Bacteria 564
1160 Ga0501340_024555 3300049556 Bacteria 522
1161 Ga0501034_0071253 3300049571 Bacteria 3485
1162 Ga0501034_1431488 3300049571 Bacteria 566
1163 Ga0501036_1055510 3300049572 Bacteria 664
1164 Ga0501067_0086541 3300049583 Bacteria 1739
1165 Ga0501069_0419726 3300049585 Bacteria 793
1166 Ga0501070_0079705 3300049586 Bacteria 2710
1167 Ga0501073_0366769 3300049589 Bacteria 995
1168 Ga0501073_0830577 3300049589 Bacteria 637
1169 Ga0501076_1090308 3300049592 Bacteria 658
1170 Ga0501198_035964 3300049649 Bacteria 843
1171 Ga0501216_052628 3300049660 Bacteria 804
1172 Ga0501217_205419 3300049661 Bacteria 616
1173 Ga0501223_000342 3300049663 Bacteria 11557
1174 Ga0501223_039106 3300049663 Bacteria 921
1175 Ga0501224_000033 3300049664 Bacteria 39112
1176 Ga0501224_012317 3300049664 Bacteria 1260
1177 Ga0501224_019321 3300049664 Bacteria 1015
1178 Ga0501233_000413 3300049668 Bacteria 6716
1179 Ga0501249_102848 3300049679 Bacteria 685
1180 Ga0501252_053084 3300049682 Bacteria 617
1181 Ga0501253_023179 3300049683 Bacteria 1114
1182 Ga0501259_181116 3300049688 Bacteria 534
1183 Ga0501225_0000097 3300049705 Bacteria 28134
1184 Ga0501234_002770 3300049707 Bacteria 2760
1185 Ga0501079_0760038 3300049741 Bacteria 763
1186 Ga0501080_0349068 3300049742 Bacteria 1336
1187 Ga0501267_041614 3300049764 Bacteria 575
1188 Ga0501268_079279 3300049765 Bacteria 676
1189 Ga0501204_073868 3300049850 Bacteria 567
1190 Ga0501226_000056 3300049853 Bacteria 39071
1191 nmdc:mga0k408_33368_c1 3300050493 Bacteria 2944
1192 nmdc:mga07m45_700468_c1 3300050496 Bacteria 582
1193 nmdc:mga08y16_17079_c1 3300050511 Bacteria 7641
1194 nmdc:mga0sz30_327691_c1 3300050516 Bacteria 684
1195 Ga0500610_0000607 3300053079 Bacteria 10987
1196 Ga0500643_000644 3300053087 Bacteria 23511
1197 Ga0500643_050118 3300053087 Bacteria 1196
1198 Ga0500642_0016417 3300053130 Bacteria 2811
1199 Ga0500559_0003794 3300053136 Bacteria 7323
1200 Ga0500604_0291253 3300053151 Bacteria 566
1201 Ga0500627_0170962 3300053158 Bacteria 979
1202 Ga0500633_0187874 3300053160 Bacteria 774
1203 Ga0500645_000002 3300053730 Bacteria 388892
1204 Ga0500609_037558 3300053731 Bacteria 668
1205 Ga0500661_000092 3300055283 Bacteria 14368
1206 Ga0587070_152514 3300059491 Bacteria 580
1207 Ga0587073_0064600 3300059492 Bacteria 868
1208 Ga0587077_172107 3300059493 Bacteria 581
1209 Ga0587086_101265 3300059507 Bacteria 531
1210 Ga0587088_003439 3300059508 Bacteria 1918
1211 Ga0587089_028254 3300059509 Bacteria 814
1212 Ga0587090_034627 3300059510 Bacteria 861
1213 Ga0587091_013659 3300059511 Bacteria 1309
1214 Ga0587094_029529 3300059513 Bacteria 843
1215 Ga0587128_120699 3300059630 Bacteria 570
1216 Ga0587067_215998 3300059640 Bacteria 517
1217 Ga0587069_086497 3300059642 Bacteria 620
1218 Ga0587071_070236 3300060344 Bacteria 761
1219 Ga0466962_0094623 3300061719 Bacteria 1432
1220 Ga0466962_0264489 3300061719 Bacteria 847
1221 Ga0466962_0599542 3300061719 Bacteria 561
1222 Ga0530510_0906501 3300061734 Bacteria 674

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025914 Ga0207671_10523946 Ga0207671_105239462 66
2 3300049664 Ga0501224_012317 Ga0501224_012317_278_502 68
3 iso_pu_bacteria 2885427238 2885427690 70
4 iso_pu_bacteria 2946787523 2946789282 72
5 iso_pu_bacteria 8057101203 8057101256 72
6 3300005333 Ga0070677_10319149 Ga0070677_103191492 74
7 3300025909 Ga0207705_10506544 Ga0207705_105065443 74
8 3300025921 Ga0207652_10149332 Ga0207652_101493323 74
9 3300026067 Ga0207678_10318086 Ga0207678_103180862 74
10 3300031852 Ga0307410_10271850 Ga0307410_102718503 74
11 3300031852 Ga0307410_10751535 Ga0307410_107515352 74
12 3300032004 Ga0307414_11717018 Ga0307414_117170182 74
13 3300032005 Ga0307411_10351521 Ga0307411_103515212 74
14 3300035170 Ga0373943_0300803 Ga0373943_0300803_225_470 74
15 3300035171 Ga0373946_0361913 Ga0373946_0361913_195_440 74
16 3300035691 Ga0373931_0561851 Ga0373931_0561851_490_732 74
17 3300035692 Ga0373935_0012992 Ga0373935_0012992_2815_3060 74
18 3300035724 Ga0373933_0170497 Ga0373933_0170497_93_338 74
19 3300037312 Ga0395899_0001919 Ga0395899_0001919_1014_1247 74
20 3300037312 Ga0395899_0126104 Ga0395899_0126104_1554_1796 74
21 3300037312 Ga0395899_0193979 Ga0395899_0193979_599_844 74
22 3300037312 Ga0395899_0216701 Ga0395899_0216701_129_371 74
23 3300037312 Ga0395899_0245336 Ga0395899_0245336_559_801 74
24 3300037312 Ga0395899_0337493 Ga0395899_0337493_731_973 74
25 3300037312 Ga0395899_0669683 Ga0395899_0669683_266_508 74
26 3300037418 Ga0395900_0001171 Ga0395900_0001171_31018_31251 74
27 3300037418 Ga0395900_0009006 Ga0395900_0009006_4561_4806 74
28 3300037418 Ga0395900_0027132 Ga0395900_0027132_5513_5755 74
29 3300037418 Ga0395900_0052179 Ga0395900_0052179_3692_3934 74
30 3300037418 Ga0395900_0065379 Ga0395900_0065379_1146_1388 74
31 3300037418 Ga0395900_0190670 Ga0395900_0190670_962_1204 74
32 3300037418 Ga0395900_0431266 Ga0395900_0431266_192_437 74
33 3300037418 Ga0395900_0533452 Ga0395900_0533452_488_724 74
34 3300037418 Ga0395900_0606174 Ga0395900_0606174_313_555 74
35 3300037418 Ga0395900_0685477 Ga0395900_0685477_374_616 74
36 3300037466 Ga0395898_0001741 Ga0395898_0001741_4349_4582 74
37 3300037466 Ga0395898_0177082 Ga0395898_0177082_192_434 74
38 3300037471 Ga0395905_0001079 Ga0395905_0001079_27653_27886 74
39 3300037471 Ga0395905_0010154 Ga0395905_0010154_2767_3009 74
40 3300037471 Ga0395905_0013100 Ga0395905_0013100_5186_5428 74
41 3300037471 Ga0395905_0016805 Ga0395905_0016805_133_378 74
42 3300037471 Ga0395905_0020072 Ga0395905_0020072_2727_2969 74
43 3300037471 Ga0395905_0022886 Ga0395905_0022886_285_527 74
44 3300037471 Ga0395905_0030876 Ga0395905_0030876_4068_4313 74
45 3300037471 Ga0395905_0104535 Ga0395905_0104535_2090_2335 74
46 3300037471 Ga0395905_0180626 Ga0395905_0180626_319_555 74
47 3300037471 Ga0395905_1311537 Ga0395905_1311537_269_520 74
48 3300038443 Ga0395901_0001340 Ga0395901_0001340_12600_12833 74
49 3300038443 Ga0395901_0002772 Ga0395901_0002772_14930_15172 74
50 3300038443 Ga0395901_0037956 Ga0395901_0037956_3780_4022 74
51 3300038443 Ga0395901_0082771 Ga0395901_0082771_2313_2558 74
52 3300038443 Ga0395901_0120754 Ga0395901_0120754_201_443 74
53 3300038443 Ga0395901_0152943 Ga0395901_0152943_18_260 74
54 3300038443 Ga0395901_1323834 Ga0395901_1323834_156_401 74
55 3300039453 Ga0436362_0013497 Ga0436362_0013497_291_524 74
56 3300042005 Ga0439448_0123401 Ga0439448_0123401_338_580 74
57 3300042118 Ga0450914_000284 Ga0450914_000284_980_1225 74
58 3300042127 Ga0450890_008119 Ga0450890_008119_570_815 74
59 3300042130 Ga0450892_009128 Ga0450892_009128_184_429 74
60 3300042138 Ga0450903_027394 Ga0450903_027394_331_576 74
61 3300042142 Ga0450905_000624 Ga0450905_000624_3315_3560 74
62 3300042144 Ga0450889_000401 Ga0450889_000401_611_856 74
63 3300042157 Ga0439458_0000872 Ga0439458_0000872_206_448 74
64 3300044656 Ga0466969_0311748 Ga0466969_0311748_431_667 74
65 3300044683 Ga0466965_0283629 Ga0466965_0283629_278_520 74
66 3300044683 Ga0466965_0379291 Ga0466965_0379291_139_381 74
67 3300044684 Ga0466966_0029734 Ga0466966_0029734_816_1052 74
68 3300044684 Ga0466966_0152890 Ga0466966_0152890_714_941 74
69 3300044684 Ga0466966_0437630 Ga0466966_0437630_430_666 74
70 3300044693 Ga0466961_0072117 Ga0466961_0072117_268_504 74
71 3300044693 Ga0466961_0407017 Ga0466961_0407017_162_407 74
72 3300044694 Ga0466963_0050663 Ga0466963_0050663_188_430 74
73 3300044694 Ga0466963_0319687 Ga0466963_0319687_622_864 74
74 3300044694 Ga0466963_0988452 Ga0466963_0988452_180_422 74
75 3300044706 Ga0466964_0646528 Ga0466964_0646528_24_248 74
76 3300044719 Ga0466971_0090696 Ga0466971_0090696_1140_1376 74
77 3300044765 Ga0466970_0094310 Ga0466970_0094310_1154_1381 74
78 3300044842 Ga0466957_0086010 Ga0466957_0086010_556_798 74
79 3300044842 Ga0466957_0589524 Ga0466957_0589524_431_673 74
80 3300044901 Ga0466960_0526951 Ga0466960_0526951_141_383 74
81 3300045049 Ga0466959_0026777 Ga0466959_0026777_1500_1736 74
82 3300045049 Ga0466959_0065062 Ga0466959_0065062_416_661 74
83 3300045049 Ga0466959_0415737 Ga0466959_0415737_435_677 74
84 3300045836 Ga0466958_0204037 Ga0466958_0204037_461_703 74
85 3300045836 Ga0466958_0205971 Ga0466958_0205971_870_1112 74
86 3300045976 Ga0466967_0099217 Ga0466967_0099217_485_727 74
87 3300045976 Ga0466967_0112196 Ga0466967_0112196_1513_1737 74
88 3300045976 Ga0466967_0141669 Ga0466967_0141669_1946_2191 74
89 3300045976 Ga0466967_0175489 Ga0466967_0175489_1558_1800 74
90 3300045976 Ga0466967_0737720 Ga0466967_0737720_179_421 74
91 3300045976 Ga0466967_0799488 Ga0466967_0799488_650_892 74
92 3300045976 Ga0466967_0947079 Ga0466967_0947079_185_427 74
93 3300046512 Ga0495610_0179669 Ga0495610_0179669_277_522 74
94 3300046513 Ga0495616_0447787 Ga0495616_0447787_172_417 74
95 3300046518 Ga0495631_0259100 Ga0495631_0259100_14_259 74
96 3300046530 Ga0495654_0412971 Ga0495654_0412971_43_288 74
97 3300046616 Ga0495668_0080229 Ga0495668_0080229_1197_1442 74
98 3300046616 Ga0495668_0613338 Ga0495668_0613338_34_288 74
99 3300046616 Ga0495668_0786234 Ga0495668_0786234_27_269 74
100 3300046684 Ga0495669_0000393 Ga0495669_0000393_229_474 74
101 3300046684 Ga0495669_0030586 Ga0495669_0030586_882_1127 74
102 3300046684 Ga0495669_0033908 Ga0495669_0033908_30_284 74
103 3300046691 Ga0495670_0156861 Ga0495670_0156861_421_666 74
104 3300047323 Ga0495683_0199262 Ga0495683_0199262_60_305 74
105 3300047445 Ga0495677_0263929 Ga0495677_0263929_378_623 74
106 3300048904 Ga0496101_0584746 Ga0496101_0584746_526_771 74
107 3300048904 Ga0496101_1466766 Ga0496101_1466766_26_268 74
108 3300048906 Ga0496103_0585493 Ga0496103_0585493_423_665 74
109 3300048906 Ga0496103_0606375 Ga0496103_0606375_119_352 74
110 3300048908 Ga0496105_1249292 Ga0496105_1249292_84_326 74
111 3300048911 Ga0496108_0570193 Ga0496108_0570193_422_664 74
112 3300048911 Ga0496108_0613460 Ga0496108_0613460_519_752 74
113 3300048912 Ga0496109_0009641 Ga0496109_0009641_718_951 74
114 3300048912 Ga0496109_0512533 Ga0496109_0512533_261_503 74
115 3300048913 Ga0496110_0074688 Ga0496110_0074688_2395_2628 74
116 3300048914 Ga0496111_0302908 Ga0496111_0302908_161_403 74
117 3300048914 Ga0496111_0374996 Ga0496111_0374996_177_410 74
118 3300048915 Ga0496112_0107967 Ga0496112_0107967_971_1204 74
119 3300048915 Ga0496112_0161406 Ga0496112_0161406_183_425 74
120 3300048915 Ga0496112_0979400 Ga0496112_0979400_485_727 74
121 3300048915 Ga0496112_1713334 Ga0496112_1713334_202_447 74
122 3300048916 Ga0496113_0957338 Ga0496113_0957338_225_458 74
123 3300049585 Ga0501069_0419726 Ga0501069_0419726_319_561 74
124 3300049586 Ga0501070_0079705 Ga0501070_0079705_1907_2149 74
125 3300049589 Ga0501073_0366769 Ga0501073_0366769_184_426 74
126 3300050511 nmdc:mga08y16_17079_c1 nmdc:mga08y16_17079_c1_6002_6247 74
127 3300053151 Ga0500604_0291253 Ga0500604_0291253_194_439 74
128 3300053158 Ga0500627_0170962 Ga0500627_0170962_597_842 74
129 3300061719 Ga0466962_0599542 Ga0466962_0599542_81_326 74
130 3300001915 JGI24741J21665_1000574 JGI24741J21665_10005746 76
131 3300001915 JGI24741J21665_1003070 JGI24741J21665_10030702 76
132 3300001915 JGI24741J21665_1024408 JGI24741J21665_10244082 76
133 3300001977 JGI24746J21847_1031500 JGI24746J21847_10315002 76
134 3300001979 JGI24740J21852_10003386 JGI24740J21852_100033865 76
135 3300001979 JGI24740J21852_10007509 JGI24740J21852_100075095 76
136 3300001979 JGI24740J21852_10016949 JGI24740J21852_100169493 76
137 3300001979 JGI24740J21852_10150693 JGI24740J21852_101506932 76
138 3300001989 JGI24739J22299_10003122 JGI24739J22299_100031227 76
139 3300001989 JGI24739J22299_10044098 JGI24739J22299_100440983 76
140 3300001990 JGI24737J22298_10009060 JGI24737J22298_100090602 76
141 3300001990 JGI24737J22298_10018116 JGI24737J22298_100181163 76
142 3300001991 JGI24743J22301_10032538 JGI24743J22301_100325382 76
143 3300002067 JGI24735J21928_10012457 JGI24735J21928_100124571 76
144 3300002067 JGI24735J21928_10022433 JGI24735J21928_100224335 76
145 3300002067 JGI24735J21928_10024923 JGI24735J21928_100249232 76
146 3300002067 JGI24735J21928_10144871 JGI24735J21928_101448712 76
147 3300002067 JGI24735J21928_10161405 JGI24735J21928_101614052 76
148 3300002075 JGI24738J21930_10004861 JGI24738J21930_100048614 76
149 3300002075 JGI24738J21930_10017021 JGI24738J21930_100170212 76
150 3300002075 JGI24738J21930_10063331 JGI24738J21930_100633312 76
151 3300002075 JGI24738J21930_10081562 JGI24738J21930_100815621 76
152 3300002244 JGI24742J22300_10040275 JGI24742J22300_100402753 76
153 3300002459 JGI24751J29686_10037870 JGI24751J29686_100378702 76
154 3300003215 JGI25153J46596_10000654 JGI25153J46596_1000065421 76
155 3300003759 Ga0055525_1000186 Ga0055525_100018669 76
156 3300003762 Ga0055542_1000025 Ga0055542_1000025171 76
157 3300003763 Ga0055529_1000014 Ga0055529_100001482 76
158 3300004799 Ga0058863_11548226 Ga0058863_115482262 76
159 3300004803 Ga0058862_12551368 Ga0058862_125513682 76
160 3300005288 Ga0065714_10192658 Ga0065714_101926582 76
161 3300005290 Ga0065712_10014525 Ga0065712_100145252 76
162 3300005290 Ga0065712_10290432 Ga0065712_102904322 76
163 3300005290 Ga0065712_10486333 Ga0065712_104863332 76
164 3300005293 Ga0065715_10044194 Ga0065715_100441942 76
165 3300005293 Ga0065715_10166649 Ga0065715_101666492 76
166 3300005293 Ga0065715_10344649 Ga0065715_103446492 76
167 3300005295 Ga0065707_10397432 Ga0065707_103974322 76
168 3300005327 Ga0070658_10003033 Ga0070658_100030339 76
169 3300005327 Ga0070658_10005053 Ga0070658_1000505312 76
170 3300005327 Ga0070658_10013956 Ga0070658_100139565 76
171 3300005327 Ga0070658_10023751 Ga0070658_100237514 76
172 3300005327 Ga0070658_10030122 Ga0070658_100301226 76
173 3300005327 Ga0070658_10047165 Ga0070658_100471654 76
174 3300005327 Ga0070658_10228097 Ga0070658_102280972 76
175 3300005327 Ga0070658_10401846 Ga0070658_104018463 76
176 3300005327 Ga0070658_10481176 Ga0070658_104811763 76
177 3300005327 Ga0070658_10626652 Ga0070658_106266522 76
178 3300005327 Ga0070658_10884413 Ga0070658_108844131 76
179 3300005327 Ga0070658_10886760 Ga0070658_108867601 76
180 3300005327 Ga0070658_10924530 Ga0070658_109245302 76
181 3300005327 Ga0070658_10992059 Ga0070658_109920592 76
182 3300005327 Ga0070658_10997067 Ga0070658_109970672 76
183 3300005327 Ga0070658_11170847 Ga0070658_111708472 76
184 3300005327 Ga0070658_11544463 Ga0070658_115444631 76
185 3300005327 Ga0070658_11767854 Ga0070658_117678542 76
186 3300005328 Ga0070676_10020664 Ga0070676_100206644 76
187 3300005328 Ga0070676_10023992 Ga0070676_100239924 76
188 3300005328 Ga0070676_10043678 Ga0070676_100436782 76
189 3300005328 Ga0070676_10627931 Ga0070676_106279313 76
190 3300005329 Ga0070683_100017485 Ga0070683_1000174857 76
191 3300005329 Ga0070683_100027613 Ga0070683_1000276132 76
192 3300005329 Ga0070683_100051173 Ga0070683_1000511733 76
193 3300005329 Ga0070683_100102513 Ga0070683_1001025134 76
194 3300005329 Ga0070683_100202665 Ga0070683_1002026652 76
195 3300005329 Ga0070683_100463365 Ga0070683_1004633653 76
196 3300005331 Ga0070670_100016670 Ga0070670_1000166708 76
197 3300005331 Ga0070670_100033067 Ga0070670_1000330675 76
198 3300005331 Ga0070670_100107868 Ga0070670_1001078682 76
199 3300005331 Ga0070670_100126346 Ga0070670_1001263464 76
200 3300005331 Ga0070670_100334854 Ga0070670_1003348543 76
201 3300005331 Ga0070670_100346935 Ga0070670_1003469352 76
202 3300005331 Ga0070670_100703483 Ga0070670_1007034833 76
203 3300005333 Ga0070677_10661119 Ga0070677_106611192 76
204 3300005334 Ga0068869_100015238 Ga0068869_1000152385 76
205 3300005334 Ga0068869_101840964 Ga0068869_1018409642 76
206 3300005335 Ga0070666_10047540 Ga0070666_100475403 76
207 3300005335 Ga0070666_10899016 Ga0070666_108990162 76
208 3300005336 Ga0070680_100007626 Ga0070680_1000076267 76
209 3300005336 Ga0070680_100090995 Ga0070680_1000909954 76
210 3300005336 Ga0070680_100097411 Ga0070680_1000974113 76
211 3300005336 Ga0070680_100185298 Ga0070680_1001852984 76
212 3300005336 Ga0070680_100307517 Ga0070680_1003075172 76
213 3300005336 Ga0070680_100466653 Ga0070680_1004666532 76
214 3300005336 Ga0070680_100657020 Ga0070680_1006570202 76
215 3300005336 Ga0070680_100698588 Ga0070680_1006985882 76
216 3300005337 Ga0070682_100047105 Ga0070682_1000471054 76
217 3300005337 Ga0070682_100231965 Ga0070682_1002319652 76
218 3300005337 Ga0070682_100271303 Ga0070682_1002713032 76
219 3300005337 Ga0070682_100299723 Ga0070682_1002997232 76
220 3300005337 Ga0070682_101308714 Ga0070682_1013087142 76
221 3300005338 Ga0068868_100373993 Ga0068868_1003739932 76
222 3300005338 Ga0068868_100882337 Ga0068868_1008823373 76
223 3300005339 Ga0070660_100004030 Ga0070660_1000040309 76
224 3300005339 Ga0070660_100106072 Ga0070660_1001060721 76
225 3300005339 Ga0070660_100122768 Ga0070660_1001227682 76
226 3300005339 Ga0070660_100141224 Ga0070660_1001412242 76
227 3300005339 Ga0070660_100214414 Ga0070660_1002144143 76
228 3300005339 Ga0070660_100246043 Ga0070660_1002460433 76
229 3300005339 Ga0070660_100286629 Ga0070660_1002866293 76
230 3300005339 Ga0070660_100437103 Ga0070660_1004371032 76
231 3300005339 Ga0070660_100526942 Ga0070660_1005269421 76
232 3300005339 Ga0070660_101306935 Ga0070660_1013069352 76
233 3300005339 Ga0070660_101863904 Ga0070660_1018639041 76
234 3300005340 Ga0070689_100331758 Ga0070689_1003317582 76
235 3300005340 Ga0070689_102187362 Ga0070689_1021873621 76
236 3300005341 Ga0070691_11055913 Ga0070691_110559132 76
237 3300005343 Ga0070687_100275385 Ga0070687_1002753852 76
238 3300005343 Ga0070687_100564088 Ga0070687_1005640882 76
239 3300005344 Ga0070661_100015195 Ga0070661_1000151953 76
240 3300005344 Ga0070661_100043876 Ga0070661_1000438763 76
241 3300005344 Ga0070661_100062023 Ga0070661_1000620232 76
242 3300005344 Ga0070661_100083218 Ga0070661_1000832183 76
243 3300005344 Ga0070661_100113377 Ga0070661_1001133774 76
244 3300005344 Ga0070661_100114134 Ga0070661_1001141343 76
245 3300005344 Ga0070661_100137487 Ga0070661_1001374873 76
246 3300005344 Ga0070661_100140734 Ga0070661_1001407344 76
247 3300005344 Ga0070661_100396394 Ga0070661_1003963943 76
248 3300005344 Ga0070661_100491291 Ga0070661_1004912913 76
249 3300005344 Ga0070661_100514397 Ga0070661_1005143973 76
250 3300005344 Ga0070661_100653206 Ga0070661_1006532062 76
251 3300005344 Ga0070661_100874413 Ga0070661_1008744131 76
252 3300005345 Ga0070692_10006719 Ga0070692_100067194 76
253 3300005345 Ga0070692_10095812 Ga0070692_100958122 76
254 3300005345 Ga0070692_10168401 Ga0070692_101684013 76
255 3300005345 Ga0070692_10516558 Ga0070692_105165582 76
256 3300005347 Ga0070668_100099808 Ga0070668_1000998083 76
257 3300005347 Ga0070668_100107128 Ga0070668_1001071283 76
258 3300005347 Ga0070668_100745715 Ga0070668_1007457153 76
259 3300005347 Ga0070668_101150317 Ga0070668_1011503172 76
260 3300005353 Ga0070669_100019184 Ga0070669_1000191846 76
261 3300005353 Ga0070669_100034144 Ga0070669_1000341445 76
262 3300005353 Ga0070669_100226259 Ga0070669_1002262591 76
263 3300005353 Ga0070669_100319810 Ga0070669_1003198101 76
264 3300005354 Ga0070675_100116015 Ga0070675_1001160154 76
265 3300005354 Ga0070675_100508948 Ga0070675_1005089482 76
266 3300005354 Ga0070675_101495551 Ga0070675_1014955512 76
267 3300005355 Ga0070671_100080797 Ga0070671_1000807974 76
268 3300005355 Ga0070671_100109435 Ga0070671_1001094353 76
269 3300005355 Ga0070671_101999777 Ga0070671_1019997772 76
270 3300005356 Ga0070674_100013554 Ga0070674_1000135545 76
271 3300005356 Ga0070674_100040032 Ga0070674_1000400322 76
272 3300005356 Ga0070674_100165147 Ga0070674_1001651474 76
273 3300005356 Ga0070674_100452126 Ga0070674_1004521262 76
274 3300005364 Ga0070673_100009087 Ga0070673_1000090874 76
275 3300005364 Ga0070673_100084413 Ga0070673_1000844132 76
276 3300005364 Ga0070673_100158336 Ga0070673_1001583361 76
277 3300005365 Ga0070688_101677261 Ga0070688_1016772612 76
278 3300005366 Ga0070659_100024161 Ga0070659_1000241613 76
279 3300005366 Ga0070659_100060497 Ga0070659_1000604977 76
280 3300005366 Ga0070659_100089448 Ga0070659_1000894483 76
281 3300005366 Ga0070659_100186354 Ga0070659_1001863543 76
282 3300005366 Ga0070659_100251977 Ga0070659_1002519772 76
283 3300005366 Ga0070659_100645242 Ga0070659_1006452423 76
284 3300005366 Ga0070659_100746368 Ga0070659_1007463682 76
285 3300005366 Ga0070659_100918432 Ga0070659_1009184322 76
286 3300005366 Ga0070659_101032815 Ga0070659_1010328152 76
287 3300005366 Ga0070659_101080407 Ga0070659_1010804072 76
288 3300005367 Ga0070667_100018909 Ga0070667_1000189095 76
289 3300005367 Ga0070667_100026863 Ga0070667_1000268636 76
290 3300005367 Ga0070667_100049910 Ga0070667_1000499104 76
291 3300005367 Ga0070667_100067671 Ga0070667_1000676713 76
292 3300005367 Ga0070667_100073243 Ga0070667_1000732432 76
293 3300005367 Ga0070667_100499694 Ga0070667_1004996942 76
294 3300005434 Ga0070709_11140387 Ga0070709_111403871 76
295 3300005435 Ga0070714_100062769 Ga0070714_1000627694 76
296 3300005435 Ga0070714_102024280 Ga0070714_1020242801 76
297 3300005436 Ga0070713_100254453 Ga0070713_1002544533 76
298 3300005455 Ga0070663_100017589 Ga0070663_1000175895 76
299 3300005455 Ga0070663_100027030 Ga0070663_1000270304 76
300 3300005455 Ga0070663_100068437 Ga0070663_1000684375 76
301 3300005455 Ga0070663_100086004 Ga0070663_1000860043 76
302 3300005455 Ga0070663_100097035 Ga0070663_1000970353 76
303 3300005455 Ga0070663_100418732 Ga0070663_1004187323 76
304 3300005455 Ga0070663_100478395 Ga0070663_1004783953 76
305 3300005456 Ga0070678_100001546 Ga0070678_1000015465 76
306 3300005456 Ga0070678_100493989 Ga0070678_1004939892 76
307 3300005457 Ga0070662_100019046 Ga0070662_1000190462 76
308 3300005457 Ga0070662_100022014 Ga0070662_1000220144 76
309 3300005457 Ga0070662_100048427 Ga0070662_1000484272 76
310 3300005457 Ga0070662_100157773 Ga0070662_1001577733 76
311 3300005457 Ga0070662_100567193 Ga0070662_1005671931 76
312 3300005457 Ga0070662_100641514 Ga0070662_1006415141 76
313 3300005457 Ga0070662_101131513 Ga0070662_1011315132 76
314 3300005457 Ga0070662_101494089 Ga0070662_1014940892 76
315 3300005457 Ga0070662_101534036 Ga0070662_1015340362 76
316 3300005457 Ga0070662_101582428 Ga0070662_1015824282 76
317 3300005458 Ga0070681_10042024 Ga0070681_100420245 76
318 3300005458 Ga0070681_10078833 Ga0070681_100788334 76
319 3300005458 Ga0070681_10290651 Ga0070681_102906513 76
320 3300005458 Ga0070681_10315092 Ga0070681_103150923 76
321 3300005458 Ga0070681_10615525 Ga0070681_106155252 76
322 3300005458 Ga0070681_10915582 Ga0070681_109155822 76
323 3300005458 Ga0070681_11130400 Ga0070681_111304002 76
324 3300005459 Ga0068867_100007054 Ga0068867_1000070547 76
325 3300005459 Ga0068867_100243056 Ga0068867_1002430562 76
326 3300005467 Ga0070706_100210185 Ga0070706_1002101853 76
327 3300005530 Ga0070679_100003115 Ga0070679_1000031154 76
328 3300005530 Ga0070679_100179972 Ga0070679_1001799723 76
329 3300005530 Ga0070679_100297099 Ga0070679_1002970991 76
330 3300005530 Ga0070679_100552228 Ga0070679_1005522282 76
331 3300005530 Ga0070679_101274320 Ga0070679_1012743202 76
332 3300005530 Ga0070679_101550212 Ga0070679_1015502122 76
333 3300005535 Ga0070684_100081437 Ga0070684_1000814374 76
334 3300005535 Ga0070684_100113302 Ga0070684_1001133021 76
335 3300005535 Ga0070684_100461227 Ga0070684_1004612274 76
336 3300005535 Ga0070684_102297183 Ga0070684_1022971832 76
337 3300005539 Ga0068853_100009859 Ga0068853_1000098593 76
338 3300005539 Ga0068853_100087735 Ga0068853_1000877354 76
339 3300005539 Ga0068853_100149046 Ga0068853_1001490462 76
340 3300005539 Ga0068853_100181686 Ga0068853_1001816863 76
341 3300005539 Ga0068853_100223803 Ga0068853_1002238032 76
342 3300005539 Ga0068853_100346853 Ga0068853_1003468532 76
343 3300005539 Ga0068853_101107910 Ga0068853_1011079101 76
344 3300005539 Ga0068853_101947438 Ga0068853_1019474381 76
345 3300005539 Ga0068853_102109450 Ga0068853_1021094501 76
346 3300005539 Ga0068853_102255729 Ga0068853_1022557292 76
347 3300005543 Ga0070672_100011421 Ga0070672_1000114213 76
348 3300005543 Ga0070672_100040262 Ga0070672_1000402621 76
349 3300005543 Ga0070672_100210427 Ga0070672_1002104273 76
350 3300005543 Ga0070672_100398175 Ga0070672_1003981752 76
351 3300005543 Ga0070672_100832824 Ga0070672_1008328242 76
352 3300005545 Ga0070695_100120838 Ga0070695_1001208384 76
353 3300005545 Ga0070695_100182023 Ga0070695_1001820233 76
354 3300005545 Ga0070695_100741494 Ga0070695_1007414942 76
355 3300005546 Ga0070696_100022927 Ga0070696_1000229272 76
356 3300005546 Ga0070696_101012197 Ga0070696_1010121972 76
357 3300005547 Ga0070693_100065915 Ga0070693_1000659152 76
358 3300005547 Ga0070693_100171300 Ga0070693_1001713002 76
359 3300005547 Ga0070693_100613832 Ga0070693_1006138322 76
360 3300005547 Ga0070693_100683202 Ga0070693_1006832022 76
361 3300005547 Ga0070693_100708773 Ga0070693_1007087731 76
362 3300005547 Ga0070693_101137890 Ga0070693_1011378902 76
363 3300005548 Ga0070665_100000323 Ga0070665_10000032358 76
364 3300005548 Ga0070665_100001399 Ga0070665_10000139913 76
365 3300005548 Ga0070665_100005110 Ga0070665_10000511014 76
366 3300005548 Ga0070665_100070713 Ga0070665_1000707135 76
367 3300005548 Ga0070665_100367729 Ga0070665_1003677292 76
368 3300005548 Ga0070665_101352964 Ga0070665_1013529642 76
369 3300005548 Ga0070665_101386589 Ga0070665_1013865892 76
370 3300005549 Ga0070704_100073619 Ga0070704_1000736192 76
371 3300005549 Ga0070704_100432263 Ga0070704_1004322633 76
372 3300005563 Ga0068855_100046390 Ga0068855_1000463904 76
373 3300005563 Ga0068855_100054251 Ga0068855_1000542516 76
374 3300005563 Ga0068855_100220101 Ga0068855_1002201014 76
375 3300005563 Ga0068855_100371225 Ga0068855_1003712252 76
376 3300005563 Ga0068855_100441424 Ga0068855_1004414242 76
377 3300005563 Ga0068855_100903744 Ga0068855_1009037442 76
378 3300005563 Ga0068855_101144702 Ga0068855_1011447022 76
379 3300005563 Ga0068855_101380706 Ga0068855_1013807062 76
380 3300005563 Ga0068855_101483741 Ga0068855_1014837412 76
381 3300005563 Ga0068855_101659796 Ga0068855_1016597962 76
382 3300005564 Ga0070664_100015524 Ga0070664_1000155245 76
383 3300005564 Ga0070664_100049987 Ga0070664_1000499874 76
384 3300005564 Ga0070664_100082530 Ga0070664_1000825304 76
385 3300005564 Ga0070664_100589262 Ga0070664_1005892621 76
386 3300005564 Ga0070664_100621887 Ga0070664_1006218872 76
387 3300005564 Ga0070664_100738338 Ga0070664_1007383382 76
388 3300005577 Ga0068857_100004600 Ga0068857_10000460013 76
389 3300005577 Ga0068857_100349189 Ga0068857_1003491892 76
390 3300005577 Ga0068857_100352778 Ga0068857_1003527782 76
391 3300005577 Ga0068857_100380079 Ga0068857_1003800793 76
392 3300005577 Ga0068857_100394755 Ga0068857_1003947553 76
393 3300005577 Ga0068857_101250903 Ga0068857_1012509032 76
394 3300005577 Ga0068857_101847367 Ga0068857_1018473672 76
395 3300005578 Ga0068854_100015755 Ga0068854_1000157553 76
396 3300005578 Ga0068854_100026943 Ga0068854_1000269434 76
397 3300005578 Ga0068854_100034678 Ga0068854_1000346783 76
398 3300005578 Ga0068854_100054916 Ga0068854_1000549163 76
399 3300005578 Ga0068854_100077177 Ga0068854_1000771774 76
400 3300005578 Ga0068854_100193471 Ga0068854_1001934713 76
401 3300005578 Ga0068854_100216388 Ga0068854_1002163882 76
402 3300005578 Ga0068854_100313653 Ga0068854_1003136533 76
403 3300005578 Ga0068854_100399554 Ga0068854_1003995543 76
404 3300005578 Ga0068854_100506449 Ga0068854_1005064492 76
405 3300005578 Ga0068854_100579257 Ga0068854_1005792572 76
406 3300005578 Ga0068854_101745151 Ga0068854_1017451512 76
407 3300005614 Ga0068856_100009109 Ga0068856_1000091099 76
408 3300005614 Ga0068856_100033877 Ga0068856_1000338774 76
409 3300005614 Ga0068856_100055001 Ga0068856_1000550014 76
410 3300005614 Ga0068856_100230040 Ga0068856_1002300403 76
411 3300005614 Ga0068856_100478875 Ga0068856_1004788752 76
412 3300005614 Ga0068856_100574550 Ga0068856_1005745502 76
413 3300005614 Ga0068856_100585036 Ga0068856_1005850361 76
414 3300005614 Ga0068856_101683563 Ga0068856_1016835632 76
415 3300005615 Ga0070702_100516805 Ga0070702_1005168052 76
416 3300005616 Ga0068852_100006017 Ga0068852_1000060175 76
417 3300005616 Ga0068852_100021463 Ga0068852_1000214633 76
418 3300005616 Ga0068852_100055591 Ga0068852_1000555913 76
419 3300005616 Ga0068852_100116320 Ga0068852_1001163205 76
420 3300005616 Ga0068852_100157469 Ga0068852_1001574693 76
421 3300005616 Ga0068852_100231454 Ga0068852_1002314542 76
422 3300005616 Ga0068852_100318011 Ga0068852_1003180114 76
423 3300005616 Ga0068852_100695289 Ga0068852_1006952892 76
424 3300005616 Ga0068852_101225811 Ga0068852_1012258112 76
425 3300005616 Ga0068852_101639316 Ga0068852_1016393162 76
426 3300005617 Ga0068859_100102736 Ga0068859_1001027363 76
427 3300005617 Ga0068859_100885891 Ga0068859_1008858912 76
428 3300005618 Ga0068864_100147193 Ga0068864_1001471932 76
429 3300005718 Ga0068866_10932671 Ga0068866_109326712 76
430 3300005719 Ga0068861_100165393 Ga0068861_1001653933 76
431 3300005719 Ga0068861_101325370 Ga0068861_1013253702 76
432 3300005834 Ga0068851_10012530 Ga0068851_100125302 76
433 3300005834 Ga0068851_10255874 Ga0068851_102558742 76
434 3300005834 Ga0068851_10719625 Ga0068851_107196252 76
435 3300005840 Ga0068870_10006029 Ga0068870_100060295 76
436 3300005841 Ga0068863_100010125 Ga0068863_10001012515 76
437 3300005841 Ga0068863_100464881 Ga0068863_1004648812 76
438 3300005841 Ga0068863_100650857 Ga0068863_1006508573 76
439 3300005842 Ga0068858_100029611 Ga0068858_1000296115 76
440 3300005843 Ga0068860_100004967 Ga0068860_10000496711 76
441 3300005843 Ga0068860_100005579 Ga0068860_1000055797 76
442 3300005843 Ga0068860_100024695 Ga0068860_1000246957 76
443 3300005844 Ga0068862_100007377 Ga0068862_1000073772 76
444 3300005844 Ga0068862_100019573 Ga0068862_1000195737 76
445 3300005844 Ga0068862_100041542 Ga0068862_1000415423 76
446 3300005844 Ga0068862_100054847 Ga0068862_1000548475 76
447 3300005844 Ga0068862_100562290 Ga0068862_1005622902 76
448 3300005844 Ga0068862_100798091 Ga0068862_1007980912 76
449 3300005844 Ga0068862_101789094 Ga0068862_1017890942 76
450 3300005985 Ga0081539_10016201 Ga0081539_100162014 76
451 3300006175 Ga0070712_101260551 Ga0070712_1012605512 76
452 3300006195 Ga0075366_10032304 Ga0075366_100323043 76
453 3300006237 Ga0097621_100002273 Ga0097621_10000227310 76
454 3300006237 Ga0097621_100237316 Ga0097621_1002373163 76
455 3300006237 Ga0097621_100510476 Ga0097621_1005104762 76
456 3300006358 Ga0068871_100021080 Ga0068871_1000210803 76
457 3300006358 Ga0068871_100077978 Ga0068871_1000779783 76
458 3300006881 Ga0068865_100175505 Ga0068865_1001755053 76
459 3300006881 Ga0068865_100805880 Ga0068865_1008058801 76
460 3300006881 Ga0068865_101023437 Ga0068865_1010234372 76
461 3300006931 Ga0097620_100102727 Ga0097620_1001027273 76
462 3300006931 Ga0097620_100885961 Ga0097620_1008859612 76
463 3300009093 Ga0105240_10286632 Ga0105240_102866322 76
464 3300009093 Ga0105240_10357548 Ga0105240_103575483 76
465 3300009094 Ga0111539_10133352 Ga0111539_101333523 76
466 3300009148 Ga0105243_10000033 Ga0105243_10000033162 76
467 3300009148 Ga0105243_11499179 Ga0105243_114991792 76
468 3300009174 Ga0105241_10001031 Ga0105241_100010318 76
469 3300009174 Ga0105241_10071745 Ga0105241_100717454 76
470 3300009174 Ga0105241_10357331 Ga0105241_103573312 76
471 3300009176 Ga0105242_11049311 Ga0105242_110493112 76
472 3300009177 Ga0105248_10141793 Ga0105248_101417933 76
473 3300009545 Ga0105237_10234305 Ga0105237_102343052 76
474 3300009545 Ga0105237_11848810 Ga0105237_118488102 76
475 3300009551 Ga0105238_10232397 Ga0105238_102323973 76
476 3300009551 Ga0105238_11426341 Ga0105238_114263412 76
477 3300009553 Ga0105249_10035144 Ga0105249_100351444 76
478 3300009553 Ga0105249_10278186 Ga0105249_102781864 76
479 3300010375 Ga0105239_10639586 Ga0105239_106395862 76
480 3300010375 Ga0105239_13264315 Ga0105239_132643152 76
481 3300011119 Ga0105246_10131530 Ga0105246_101315303 76
482 3300011119 Ga0105246_10137348 Ga0105246_101373483 76
483 3300011119 Ga0105246_11079740 Ga0105246_110797402 76
484 3300012475 Ga0157317_1002353 Ga0157317_10023532 76
485 3300012500 Ga0157314_1022480 Ga0157314_10224802 76
486 3300012506 Ga0157324_1015623 Ga0157324_10156232 76
487 3300012512 Ga0157327_1031939 Ga0157327_10319392 76
488 3300012513 Ga0157326_1004163 Ga0157326_10041633 76
489 3300013100 Ga0157373_10028852 Ga0157373_100288524 76
490 3300013100 Ga0157373_10039547 Ga0157373_100395475 76
491 3300013100 Ga0157373_10058470 Ga0157373_100584703 76
492 3300013100 Ga0157373_10080646 Ga0157373_100806463 76
493 3300013100 Ga0157373_10169664 Ga0157373_101696642 76
494 3300013100 Ga0157373_10260483 Ga0157373_102604833 76
495 3300013100 Ga0157373_10296946 Ga0157373_102969463 76
496 3300013100 Ga0157373_10497764 Ga0157373_104977642 76
497 3300013100 Ga0157373_10654490 Ga0157373_106544902 76
498 3300013100 Ga0157373_10955889 Ga0157373_109558892 76
499 3300013100 Ga0157373_11040336 Ga0157373_110403362 76
500 3300013102 Ga0157371_10000059 Ga0157371_10000059112 76
501 3300013102 Ga0157371_10043673 Ga0157371_100436733 76
502 3300013102 Ga0157371_10069985 Ga0157371_100699853 76
503 3300013102 Ga0157371_10106041 Ga0157371_101060413 76
504 3300013102 Ga0157371_10108598 Ga0157371_101085984 76
505 3300013102 Ga0157371_10115756 Ga0157371_101157562 76
506 3300013102 Ga0157371_10169813 Ga0157371_101698132 76
507 3300013102 Ga0157371_10179348 Ga0157371_101793483 76
508 3300013102 Ga0157371_10285046 Ga0157371_102850462 76
509 3300013102 Ga0157371_10309676 Ga0157371_103096762 76
510 3300013102 Ga0157371_10647490 Ga0157371_106474902 76
511 3300013102 Ga0157371_10890708 Ga0157371_108907082 76
512 3300013104 Ga0157370_10013215 Ga0157370_100132157 76
513 3300013104 Ga0157370_10019603 Ga0157370_100196038 76
514 3300013104 Ga0157370_10067434 Ga0157370_100674344 76
515 3300013104 Ga0157370_10102536 Ga0157370_101025363 76
516 3300013104 Ga0157370_10422400 Ga0157370_104224004 76
517 3300013104 Ga0157370_10648743 Ga0157370_106487432 76
518 3300013104 Ga0157370_11854381 Ga0157370_118543812 76
519 3300013105 Ga0157369_10033065 Ga0157369_100330655 76
520 3300013105 Ga0157369_10063471 Ga0157369_100634714 76
521 3300013105 Ga0157369_10069759 Ga0157369_100697594 76
522 3300013105 Ga0157369_10137983 Ga0157369_101379834 76
523 3300013105 Ga0157369_10481979 Ga0157369_104819794 76
524 3300013105 Ga0157369_10756850 Ga0157369_107568503 76
525 3300013105 Ga0157369_10819940 Ga0157369_108199402 76
526 3300013105 Ga0157369_12270758 Ga0157369_122707582 76
527 3300013296 Ga0157374_10896058 Ga0157374_108960582 76
528 3300013296 Ga0157374_11476392 Ga0157374_114763922 76
529 3300013296 Ga0157374_12327861 Ga0157374_123278612 76
530 3300013306 Ga0163162_10503383 Ga0163162_105033832 76
531 3300013306 Ga0163162_12901193 Ga0163162_129011931 76
532 3300013307 Ga0157372_10006811 Ga0157372_100068116 76
533 3300013307 Ga0157372_10112553 Ga0157372_101125533 76
534 3300013307 Ga0157372_10407227 Ga0157372_104072274 76
535 3300013307 Ga0157372_11028217 Ga0157372_110282172 76
536 3300013307 Ga0157372_11506807 Ga0157372_115068072 76
537 3300013307 Ga0157372_11972427 Ga0157372_119724272 76
538 3300013307 Ga0157372_13314890 Ga0157372_133148901 76
539 3300013308 Ga0157375_10897230 Ga0157375_108972302 76
540 3300013308 Ga0157375_12809219 Ga0157375_128092191 76
541 3300014326 Ga0157380_13287948 Ga0157380_132879482 76
542 3300014497 Ga0182008_10439260 Ga0182008_104392602 76
543 3300014497 Ga0182008_10766435 Ga0182008_107664352 76
544 3300014745 Ga0157377_10076128 Ga0157377_100761283 76
545 3300014745 Ga0157377_10408223 Ga0157377_104082232 76
546 3300014745 Ga0157377_10644846 Ga0157377_106448462 76
547 3300014745 Ga0157377_10843626 Ga0157377_108436262 76
548 3300014968 Ga0157379_11026788 Ga0157379_110267882 76
549 3300014969 Ga0157376_10416101 Ga0157376_104161013 76
550 3300017792 Ga0163161_10951971 Ga0163161_109519712 76
551 3300020069 Ga0197907_11013996 Ga0197907_110139962 76
552 3300020070 Ga0206356_10386422 Ga0206356_103864222 76
553 3300020070 Ga0206356_11392800 Ga0206356_113928001 76
554 3300020076 Ga0206355_1505226 Ga0206355_15052263 76
555 3300020077 Ga0206351_10293905 Ga0206351_102939052 76
556 3300020077 Ga0206351_10865377 Ga0206351_108653772 76
557 3300020078 Ga0206352_10134520 Ga0206352_101345202 76
558 3300020078 Ga0206352_10816031 Ga0206352_108160312 76
559 3300020080 Ga0206350_10874698 Ga0206350_108746982 76
560 3300020080 Ga0206350_11230029 Ga0206350_112300291 76
561 3300020081 Ga0206354_10606539 Ga0206354_106065392 76
562 3300020081 Ga0206354_11398537 Ga0206354_113985373 76
563 3300020082 Ga0206353_10737954 Ga0206353_107379543 76
564 3300020610 Ga0154015_1709903 Ga0154015_17099032 76
565 3300021388 Ga0213875_10013137 Ga0213875_100131373 76
566 3300022467 Ga0224712_10078172 Ga0224712_100781723 76
567 3300022467 Ga0224712_10282104 Ga0224712_102821042 76
568 3300025230 Ga0209563_100145 Ga0209563_10014516 76
569 3300025233 Ga0209437_125768 Ga0209437_1257682 76
570 3300025246 Ga0209646_1019071 Ga0209646_10190712 76
571 3300025250 Ga0209026_1016930 Ga0209026_10169302 76
572 3300025253 Ga0209677_104936 Ga0209677_1049366 76
573 3300025254 Ga0209148_1000011 Ga0209148_100001184 76
574 3300025261 Ga0209233_1019338 Ga0209233_10193383 76
575 3300025272 Ga0209455_1000006 Ga0209455_10000061110 76
576 3300025297 Ga0209758_1000001 Ga0209758_1000001734 76
577 3300025315 Ga0207697_10004884 Ga0207697_100048846 76
578 3300025315 Ga0207697_10019628 Ga0207697_100196283 76
579 3300025315 Ga0207697_10021840 Ga0207697_100218403 76
580 3300025321 Ga0207656_10024814 Ga0207656_100248143 76
581 3300025321 Ga0207656_10061171 Ga0207656_100611712 76
582 3300025321 Ga0207656_10146452 Ga0207656_101464522 76
583 3300025321 Ga0207656_10404315 Ga0207656_104043152 76
584 3300025893 Ga0207682_10230202 Ga0207682_102302022 76
585 3300025898 Ga0207692_10714320 Ga0207692_107143202 76
586 3300025899 Ga0207642_10158786 Ga0207642_101587862 76
587 3300025901 Ga0207688_10004546 Ga0207688_1000454610 76
588 3300025901 Ga0207688_10377762 Ga0207688_103777622 76
589 3300025903 Ga0207680_10024970 Ga0207680_100249704 76
590 3300025903 Ga0207680_10226005 Ga0207680_102260052 76
591 3300025903 Ga0207680_10882236 Ga0207680_108822362 76
592 3300025903 Ga0207680_10927382 Ga0207680_109273822 76
593 3300025904 Ga0207647_10003878 Ga0207647_1000387812 76
594 3300025904 Ga0207647_10011023 Ga0207647_100110234 76
595 3300025904 Ga0207647_10020394 Ga0207647_100203943 76
596 3300025904 Ga0207647_10064754 Ga0207647_100647542 76
597 3300025904 Ga0207647_10082181 Ga0207647_100821812 76
598 3300025904 Ga0207647_10082408 Ga0207647_100824084 76
599 3300025904 Ga0207647_10219410 Ga0207647_102194102 76
600 3300025904 Ga0207647_10419453 Ga0207647_104194532 76
601 3300025904 Ga0207647_10580543 Ga0207647_105805431 76
602 3300025907 Ga0207645_10026662 Ga0207645_100266625 76
603 3300025907 Ga0207645_10027083 Ga0207645_100270832 76
604 3300025907 Ga0207645_10100575 Ga0207645_101005753 76
605 3300025907 Ga0207645_10112424 Ga0207645_101124242 76
606 3300025907 Ga0207645_10121377 Ga0207645_101213773 76
607 3300025907 Ga0207645_10629415 Ga0207645_106294152 76
608 3300025908 Ga0207643_10009827 Ga0207643_100098274 76
609 3300025909 Ga0207705_10000203 Ga0207705_1000020367 76
610 3300025909 Ga0207705_10001816 Ga0207705_100018163 76
611 3300025909 Ga0207705_10032460 Ga0207705_100324603 76
612 3300025909 Ga0207705_10084985 Ga0207705_100849853 76
613 3300025909 Ga0207705_10125340 Ga0207705_101253403 76
614 3300025909 Ga0207705_10128666 Ga0207705_101286662 76
615 3300025909 Ga0207705_10139066 Ga0207705_101390663 76
616 3300025909 Ga0207705_10142518 Ga0207705_101425183 76
617 3300025909 Ga0207705_10156441 Ga0207705_101564412 76
618 3300025909 Ga0207705_10221090 Ga0207705_102210903 76
619 3300025909 Ga0207705_10503984 Ga0207705_105039842 76
620 3300025909 Ga0207705_10729054 Ga0207705_107290542 76
621 3300025909 Ga0207705_10765177 Ga0207705_107651772 76
622 3300025909 Ga0207705_10797086 Ga0207705_107970862 76
623 3300025909 Ga0207705_11117309 Ga0207705_111173092 76
624 3300025909 Ga0207705_11406050 Ga0207705_114060501 76
625 3300025910 Ga0207684_10177253 Ga0207684_101772531 76
626 3300025911 Ga0207654_10000897 Ga0207654_1000089719 76
627 3300025912 Ga0207707_10058038 Ga0207707_100580384 76
628 3300025912 Ga0207707_10131196 Ga0207707_101311962 76
629 3300025912 Ga0207707_10146939 Ga0207707_101469392 76
630 3300025912 Ga0207707_10231331 Ga0207707_102313311 76
631 3300025912 Ga0207707_10755014 Ga0207707_107550142 76
632 3300025912 Ga0207707_11243609 Ga0207707_112436092 76
633 3300025913 Ga0207695_10020907 Ga0207695_100209078 76
634 3300025913 Ga0207695_10294250 Ga0207695_102942503 76
635 3300025913 Ga0207695_11148807 Ga0207695_111488072 76
636 3300025914 Ga0207671_10042103 Ga0207671_100421035 76
637 3300025914 Ga0207671_10075279 Ga0207671_100752795 76
638 3300025915 Ga0207693_10653858 Ga0207693_106538582 76
639 3300025917 Ga0207660_10069557 Ga0207660_100695574 76
640 3300025917 Ga0207660_10083256 Ga0207660_100832563 76
641 3300025917 Ga0207660_10195455 Ga0207660_101954554 76
642 3300025917 Ga0207660_10388479 Ga0207660_103884792 76
643 3300025917 Ga0207660_10934203 Ga0207660_109342032 76
644 3300025917 Ga0207660_11072497 Ga0207660_110724972 76
645 3300025917 Ga0207660_11744975 Ga0207660_117449752 76
646 3300025918 Ga0207662_10013077 Ga0207662_100130775 76
647 3300025919 Ga0207657_10000468 Ga0207657_100004684 76
648 3300025919 Ga0207657_10000856 Ga0207657_1000085617 76
649 3300025919 Ga0207657_10021935 Ga0207657_100219357 76
650 3300025919 Ga0207657_10026345 Ga0207657_100263453 76
651 3300025919 Ga0207657_10037144 Ga0207657_100371444 76
652 3300025919 Ga0207657_10040078 Ga0207657_100400785 76
653 3300025919 Ga0207657_10057510 Ga0207657_100575103 76
654 3300025919 Ga0207657_10103051 Ga0207657_101030515 76
655 3300025919 Ga0207657_10156752 Ga0207657_101567523 76
656 3300025919 Ga0207657_10236181 Ga0207657_102361814 76
657 3300025919 Ga0207657_10326539 Ga0207657_103265393 76
658 3300025919 Ga0207657_10480893 Ga0207657_104808932 76
659 3300025919 Ga0207657_10563326 Ga0207657_105633261 76
660 3300025920 Ga0207649_10000319 Ga0207649_1000031935 76
661 3300025920 Ga0207649_10008668 Ga0207649_100086684 76
662 3300025920 Ga0207649_10041457 Ga0207649_100414574 76
663 3300025920 Ga0207649_10158574 Ga0207649_101585743 76
664 3300025920 Ga0207649_10192175 Ga0207649_101921754 76
665 3300025920 Ga0207649_10290875 Ga0207649_102908752 76
666 3300025920 Ga0207649_10356968 Ga0207649_103569683 76
667 3300025920 Ga0207649_11619387 Ga0207649_116193872 76
668 3300025921 Ga0207652_10047862 Ga0207652_100478624 76
669 3300025921 Ga0207652_10153364 Ga0207652_101533643 76
670 3300025921 Ga0207652_10272982 Ga0207652_102729824 76
671 3300025921 Ga0207652_10642473 Ga0207652_106424732 76
672 3300025921 Ga0207652_10710235 Ga0207652_107102352 76
673 3300025921 Ga0207652_10858948 Ga0207652_108589482 76
674 3300025921 Ga0207652_11349090 Ga0207652_113490902 76
675 3300025923 Ga0207681_10009916 Ga0207681_100099164 76
676 3300025923 Ga0207681_10013371 Ga0207681_100133715 76
677 3300025923 Ga0207681_10034526 Ga0207681_100345262 76
678 3300025923 Ga0207681_11282484 Ga0207681_112824842 76
679 3300025924 Ga0207694_10006961 Ga0207694_100069615 76
680 3300025924 Ga0207694_10129875 Ga0207694_101298752 76
681 3300025925 Ga0207650_10018685 Ga0207650_100186852 76
682 3300025925 Ga0207650_10042250 Ga0207650_100422505 76
683 3300025925 Ga0207650_10080011 Ga0207650_100800114 76
684 3300025925 Ga0207650_10151016 Ga0207650_101510163 76
685 3300025925 Ga0207650_10213373 Ga0207650_102133732 76
686 3300025925 Ga0207650_10301013 Ga0207650_103010134 76
687 3300025925 Ga0207650_10393373 Ga0207650_103933733 76
688 3300025925 Ga0207650_10615646 Ga0207650_106156462 76
689 3300025925 Ga0207650_11478776 Ga0207650_114787762 76
690 3300025928 Ga0207700_10211441 Ga0207700_102114413 76
691 3300025929 Ga0207664_10094182 Ga0207664_100941823 76
692 3300025931 Ga0207644_10471624 Ga0207644_104716243 76
693 3300025931 Ga0207644_10963850 Ga0207644_109638502 76
694 3300025932 Ga0207690_10006519 Ga0207690_100065193 76
695 3300025932 Ga0207690_10025795 Ga0207690_100257953 76
696 3300025932 Ga0207690_10114217 Ga0207690_101142171 76
697 3300025932 Ga0207690_10159055 Ga0207690_101590553 76
698 3300025932 Ga0207690_10292828 Ga0207690_102928282 76
699 3300025932 Ga0207690_10346174 Ga0207690_103461742 76
700 3300025932 Ga0207690_10384574 Ga0207690_103845743 76
701 3300025932 Ga0207690_10453076 Ga0207690_104530761 76
702 3300025932 Ga0207690_10551989 Ga0207690_105519892 76
703 3300025932 Ga0207690_10814121 Ga0207690_108141211 76
704 3300025932 Ga0207690_10988548 Ga0207690_109885482 76
705 3300025932 Ga0207690_10992681 Ga0207690_109926812 76
706 3300025932 Ga0207690_11758884 Ga0207690_117588842 76
707 3300025933 Ga0207706_10008360 Ga0207706_100083605 76
708 3300025933 Ga0207706_10037355 Ga0207706_100373555 76
709 3300025933 Ga0207706_10053750 Ga0207706_100537505 76
710 3300025933 Ga0207706_10304811 Ga0207706_103048113 76
711 3300025933 Ga0207706_10332790 Ga0207706_103327904 76
712 3300025933 Ga0207706_10398949 Ga0207706_103989493 76
713 3300025933 Ga0207706_10469612 Ga0207706_104696122 76
714 3300025933 Ga0207706_10490465 Ga0207706_104904653 76
715 3300025933 Ga0207706_10773848 Ga0207706_107738482 76
716 3300025933 Ga0207706_10890494 Ga0207706_108904942 76
717 3300025933 Ga0207706_10892739 Ga0207706_108927392 76
718 3300025935 Ga0207709_10000059 Ga0207709_1000005992 76
719 3300025935 Ga0207709_11220527 Ga0207709_112205272 76
720 3300025936 Ga0207670_10367260 Ga0207670_103672602 76
721 3300025936 Ga0207670_10369019 Ga0207670_103690192 76
722 3300025936 Ga0207670_10397087 Ga0207670_103970873 76
723 3300025937 Ga0207669_10000341 Ga0207669_100003415 76
724 3300025937 Ga0207669_10011156 Ga0207669_100111563 76
725 3300025937 Ga0207669_10023707 Ga0207669_100237074 76
726 3300025937 Ga0207669_10607785 Ga0207669_106077853 76
727 3300025938 Ga0207704_10248674 Ga0207704_102486743 76
728 3300025938 Ga0207704_10594665 Ga0207704_105946653 76
729 3300025938 Ga0207704_11964545 Ga0207704_119645452 76
730 3300025940 Ga0207691_10044806 Ga0207691_100448066 76
731 3300025940 Ga0207691_10150303 Ga0207691_101503033 76
732 3300025940 Ga0207691_10538601 Ga0207691_105386012 76
733 3300025940 Ga0207691_10600742 Ga0207691_106007422 76
734 3300025940 Ga0207691_10791987 Ga0207691_107919873 76
735 3300025941 Ga0207711_10559919 Ga0207711_105599193 76
736 3300025942 Ga0207689_10017112 Ga0207689_100171126 76
737 3300025944 Ga0207661_10218362 Ga0207661_102183623 76
738 3300025944 Ga0207661_10245895 Ga0207661_102458952 76
739 3300025944 Ga0207661_10412577 Ga0207661_104125773 76
740 3300025944 Ga0207661_11041549 Ga0207661_110415492 76
741 3300025944 Ga0207661_11318040 Ga0207661_113180402 76
742 3300025944 Ga0207661_11335906 Ga0207661_113359062 76
743 3300025945 Ga0207679_10096623 Ga0207679_100966235 76
744 3300025945 Ga0207679_10174394 Ga0207679_101743944 76
745 3300025945 Ga0207679_10185811 Ga0207679_101858113 76
746 3300025945 Ga0207679_10255223 Ga0207679_102552232 76
747 3300025945 Ga0207679_10340230 Ga0207679_103402304 76
748 3300025945 Ga0207679_10522605 Ga0207679_105226052 76
749 3300025945 Ga0207679_10720233 Ga0207679_107202332 76
750 3300025945 Ga0207679_10930405 Ga0207679_109304052 76
751 3300025945 Ga0207679_11365553 Ga0207679_113655532 76
752 3300025945 Ga0207679_11385712 Ga0207679_113857122 76
753 3300025949 Ga0207667_10000002 Ga0207667_1000000248 76
754 3300025949 Ga0207667_10016335 Ga0207667_100163358 76
755 3300025949 Ga0207667_10149462 Ga0207667_101494625 76
756 3300025949 Ga0207667_10346521 Ga0207667_103465214 76
757 3300025949 Ga0207667_10354441 Ga0207667_103544412 76
758 3300025949 Ga0207667_10925505 Ga0207667_109255052 76
759 3300025949 Ga0207667_11289242 Ga0207667_112892422 76
760 3300025949 Ga0207667_11502804 Ga0207667_115028042 76
761 3300025949 Ga0207667_12262479 Ga0207667_122624791 76
762 3300025960 Ga0207651_10643480 Ga0207651_106434803 76
763 3300025960 Ga0207651_10692172 Ga0207651_106921723 76
764 3300025960 Ga0207651_10815909 Ga0207651_108159092 76
765 3300025960 Ga0207651_10885611 Ga0207651_108856112 76
766 3300025960 Ga0207651_11092042 Ga0207651_110920422 76
767 3300025961 Ga0207712_10005915 Ga0207712_1000591511 76
768 3300025961 Ga0207712_10979462 Ga0207712_109794622 76
769 3300025972 Ga0207668_10012882 Ga0207668_100128825 76
770 3300025972 Ga0207668_10094827 Ga0207668_100948273 76
771 3300025972 Ga0207668_10578373 Ga0207668_105783732 76
772 3300025972 Ga0207668_10989196 Ga0207668_109891962 76
773 3300025972 Ga0207668_11886448 Ga0207668_118864481 76
774 3300025981 Ga0207640_10000689 Ga0207640_1000068922 76
775 3300025981 Ga0207640_10064801 Ga0207640_100648013 76
776 3300025981 Ga0207640_10083870 Ga0207640_100838704 76
777 3300025981 Ga0207640_10410551 Ga0207640_104105513 76
778 3300025981 Ga0207640_10490626 Ga0207640_104906263 76
779 3300025981 Ga0207640_10636788 Ga0207640_106367883 76
780 3300025981 Ga0207640_10653722 Ga0207640_106537222 76
781 3300025981 Ga0207640_10693270 Ga0207640_106932702 76
782 3300025981 Ga0207640_10721009 Ga0207640_107210092 76
783 3300025981 Ga0207640_10991592 Ga0207640_109915922 76
784 3300025981 Ga0207640_11009206 Ga0207640_110092061 76
785 3300025981 Ga0207640_11020046 Ga0207640_110200461 76
786 3300025981 Ga0207640_11244582 Ga0207640_112445822 76
787 3300025986 Ga0207658_10026701 Ga0207658_100267012 76
788 3300025986 Ga0207658_10037213 Ga0207658_100372131 76
789 3300025986 Ga0207658_10071364 Ga0207658_100713643 76
790 3300025986 Ga0207658_10591532 Ga0207658_105915323 76
791 3300025986 Ga0207658_10766616 Ga0207658_107666162 76
792 3300026023 Ga0207677_10509819 Ga0207677_105098192 76
793 3300026023 Ga0207677_10697188 Ga0207677_106971882 76
794 3300026023 Ga0207677_10927892 Ga0207677_109278922 76
795 3300026035 Ga0207703_10025125 Ga0207703_100251256 76
796 3300026041 Ga0207639_10000124 Ga0207639_1000012447 76
797 3300026041 Ga0207639_10030851 Ga0207639_100308513 76
798 3300026041 Ga0207639_10044664 Ga0207639_100446643 76
799 3300026041 Ga0207639_10273101 Ga0207639_102731013 76
800 3300026041 Ga0207639_10395352 Ga0207639_103953523 76
801 3300026041 Ga0207639_10568920 Ga0207639_105689202 76
802 3300026041 Ga0207639_10661373 Ga0207639_106613731 76
803 3300026041 Ga0207639_10914052 Ga0207639_109140522 76
804 3300026067 Ga0207678_10000357 Ga0207678_100003574 76
805 3300026067 Ga0207678_10001147 Ga0207678_1000114719 76
806 3300026067 Ga0207678_10004733 Ga0207678_100047338 76
807 3300026067 Ga0207678_10018816 Ga0207678_100188162 76
808 3300026067 Ga0207678_10026062 Ga0207678_100260623 76
809 3300026067 Ga0207678_10029003 Ga0207678_100290036 76
810 3300026067 Ga0207678_10100933 Ga0207678_101009333 76
811 3300026067 Ga0207678_10106755 Ga0207678_101067553 76
812 3300026067 Ga0207678_10142732 Ga0207678_101427323 76
813 3300026067 Ga0207678_10236935 Ga0207678_102369352 76
814 3300026067 Ga0207678_10321921 Ga0207678_103219214 76
815 3300026067 Ga0207678_10530845 Ga0207678_105308451 76
816 3300026067 Ga0207678_11815540 Ga0207678_118155402 76
817 3300026078 Ga0207702_10003062 Ga0207702_1000306216 76
818 3300026078 Ga0207702_10004365 Ga0207702_100043659 76
819 3300026078 Ga0207702_10119256 Ga0207702_101192563 76
820 3300026078 Ga0207702_10175180 Ga0207702_101751804 76
821 3300026078 Ga0207702_10329577 Ga0207702_103295773 76
822 3300026088 Ga0207641_10068185 Ga0207641_100681854 76
823 3300026088 Ga0207641_10368135 Ga0207641_103681353 76
824 3300026088 Ga0207641_10521756 Ga0207641_105217563 76
825 3300026089 Ga0207648_10009350 Ga0207648_100093507 76
826 3300026089 Ga0207648_10273954 Ga0207648_102739543 76
827 3300026089 Ga0207648_10706118 Ga0207648_107061182 76
828 3300026095 Ga0207676_10028583 Ga0207676_100285834 76
829 3300026095 Ga0207676_11923638 Ga0207676_119236381 76
830 3300026116 Ga0207674_10000730 Ga0207674_1000073038 76
831 3300026116 Ga0207674_10005891 Ga0207674_1000589114 76
832 3300026116 Ga0207674_10013176 Ga0207674_100131769 76
833 3300026116 Ga0207674_10013965 Ga0207674_1001396512 76
834 3300026116 Ga0207674_10018179 Ga0207674_100181796 76
835 3300026116 Ga0207674_10233515 Ga0207674_102335153 76
836 3300026116 Ga0207674_10261486 Ga0207674_102614862 76
837 3300026116 Ga0207674_10425602 Ga0207674_104256024 76
838 3300026116 Ga0207674_10566208 Ga0207674_105662083 76
839 3300026118 Ga0207675_100512725 Ga0207675_1005127253 76
840 3300026118 Ga0207675_100549609 Ga0207675_1005496092 76
841 3300026118 Ga0207675_102321509 Ga0207675_1023215092 76
842 3300026121 Ga0207683_10014396 Ga0207683_100143965 76
843 3300026121 Ga0207683_10029198 Ga0207683_100291983 76
844 3300026142 Ga0207698_10011565 Ga0207698_100115657 76
845 3300026142 Ga0207698_10013806 Ga0207698_100138065 76
846 3300026142 Ga0207698_10092159 Ga0207698_100921593 76
847 3300026142 Ga0207698_10135776 Ga0207698_101357763 76
848 3300026142 Ga0207698_10307539 Ga0207698_103075392 76
849 3300026142 Ga0207698_10327727 Ga0207698_103277273 76
850 3300026142 Ga0207698_10367687 Ga0207698_103676872 76
851 3300026142 Ga0207698_10681423 Ga0207698_106814233 76
852 3300026142 Ga0207698_10846002 Ga0207698_108460022 76
853 3300027364 Ga0209967_1011483 Ga0209967_10114833 76
854 3300028379 Ga0268266_10000002 Ga0268266_100000022964 76
855 3300028379 Ga0268266_10000452 Ga0268266_1000045214 76
856 3300028379 Ga0268266_10007592 Ga0268266_100075929 76
857 3300028379 Ga0268266_10076162 Ga0268266_100761622 76
858 3300028379 Ga0268266_10438357 Ga0268266_104383573 76
859 3300028379 Ga0268266_10479174 Ga0268266_104791742 76
860 3300028380 Ga0268265_10003010 Ga0268265_1000301011 76
861 3300028380 Ga0268265_10011047 Ga0268265_100110473 76
862 3300028380 Ga0268265_10013924 Ga0268265_100139243 76
863 3300028380 Ga0268265_10061170 Ga0268265_100611704 76
864 3300028380 Ga0268265_10242497 Ga0268265_102424972 76
865 3300028380 Ga0268265_11855722 Ga0268265_118557222 76
866 3300028381 Ga0268264_10004146 Ga0268264_1000414610 76
867 3300028381 Ga0268264_10011541 Ga0268264_1001154111 76
868 3300028381 Ga0268264_10082954 Ga0268264_100829542 76
869 3300031548 Ga0307408_100036575 Ga0307408_1000365754 76
870 3300031548 Ga0307408_100189378 Ga0307408_1001893782 76
871 3300031548 Ga0307408_100266195 Ga0307408_1002661952 76
872 3300031548 Ga0307408_100326406 Ga0307408_1003264061 76
873 3300031548 Ga0307408_100524900 Ga0307408_1005249003 76
874 3300031548 Ga0307408_100579931 Ga0307408_1005799312 76
875 3300031548 Ga0307408_100631195 Ga0307408_1006311952 76
876 3300031548 Ga0307408_101090399 Ga0307408_1010903992 76
877 3300031548 Ga0307408_101124381 Ga0307408_1011243812 76
878 3300031548 Ga0307408_101930741 Ga0307408_1019307412 76
879 3300031731 Ga0307405_10021558 Ga0307405_100215587 76
880 3300031731 Ga0307405_10111192 Ga0307405_101111922 76
881 3300031731 Ga0307405_10165710 Ga0307405_101657102 76
882 3300031731 Ga0307405_10179072 Ga0307405_101790722 76
883 3300031731 Ga0307405_10214362 Ga0307405_102143623 76
884 3300031731 Ga0307405_10260187 Ga0307405_102601872 76
885 3300031731 Ga0307405_10316370 Ga0307405_103163703 76
886 3300031731 Ga0307405_10328893 Ga0307405_103288933 76
887 3300031731 Ga0307405_10371429 Ga0307405_103714293 76
888 3300031731 Ga0307405_10420225 Ga0307405_104202252 76
889 3300031824 Ga0307413_10008092 Ga0307413_100080928 76
890 3300031824 Ga0307413_10013850 Ga0307413_100138507 76
891 3300031824 Ga0307413_10072035 Ga0307413_100720352 76
892 3300031824 Ga0307413_10209531 Ga0307413_102095313 76
893 3300031824 Ga0307413_10236039 Ga0307413_102360393 76
894 3300031824 Ga0307413_10426032 Ga0307413_104260323 76
895 3300031824 Ga0307413_10603871 Ga0307413_106038712 76
896 3300031824 Ga0307413_10719061 Ga0307413_107190613 76
897 3300031824 Ga0307413_10872911 Ga0307413_108729112 76
898 3300031824 Ga0307413_11119742 Ga0307413_111197422 76
899 3300031824 Ga0307413_11569605 Ga0307413_115696051 76
900 3300031824 Ga0307413_12040744 Ga0307413_120407441 76
901 3300031852 Ga0307410_10052601 Ga0307410_100526013 76
902 3300031852 Ga0307410_10189933 Ga0307410_101899333 76
903 3300031852 Ga0307410_10192471 Ga0307410_101924713 76
904 3300031852 Ga0307410_10192558 Ga0307410_101925583 76
905 3300031852 Ga0307410_10274331 Ga0307410_102743313 76
906 3300031852 Ga0307410_10294036 Ga0307410_102940363 76
907 3300031852 Ga0307410_10407750 Ga0307410_104077502 76
908 3300031852 Ga0307410_11293709 Ga0307410_112937092 76
909 3300031852 Ga0307410_11461625 Ga0307410_114616252 76
910 3300031901 Ga0307406_10069949 Ga0307406_100699492 76
911 3300031901 Ga0307406_10091044 Ga0307406_100910443 76
912 3300031901 Ga0307406_10114532 Ga0307406_101145323 76
913 3300031901 Ga0307406_10220604 Ga0307406_102206043 76
914 3300031901 Ga0307406_10271518 Ga0307406_102715182 76
915 3300031901 Ga0307406_10564930 Ga0307406_105649302 76
916 3300031901 Ga0307406_10669233 Ga0307406_106692332 76
917 3300031901 Ga0307406_11571410 Ga0307406_115714102 76
918 3300031903 Ga0307407_10030985 Ga0307407_100309853 76
919 3300031903 Ga0307407_10250636 Ga0307407_102506363 76
920 3300031903 Ga0307407_10298090 Ga0307407_102980903 76
921 3300031903 Ga0307407_10354072 Ga0307407_103540721 76
922 3300031903 Ga0307407_10518154 Ga0307407_105181542 76
923 3300031903 Ga0307407_10734114 Ga0307407_107341142 76
924 3300031903 Ga0307407_11384569 Ga0307407_113845692 76
925 3300031903 Ga0307407_11517923 Ga0307407_115179232 76
926 3300031903 Ga0307407_11685321 Ga0307407_116853212 76
927 3300031911 Ga0307412_10001165 Ga0307412_1000116514 76
928 3300031911 Ga0307412_10052332 Ga0307412_100523325 76
929 3300031911 Ga0307412_10153714 Ga0307412_101537143 76
930 3300031911 Ga0307412_10160694 Ga0307412_101606942 76
931 3300031911 Ga0307412_10257505 Ga0307412_102575052 76
932 3300031911 Ga0307412_10337741 Ga0307412_103377412 76
933 3300031911 Ga0307412_10408633 Ga0307412_104086332 76
934 3300031911 Ga0307412_10468554 Ga0307412_104685542 76
935 3300031911 Ga0307412_10537412 Ga0307412_105374122 76
936 3300031911 Ga0307412_10606907 Ga0307412_106069073 76
937 3300031911 Ga0307412_10955735 Ga0307412_109557351 76
938 3300031911 Ga0307412_11095365 Ga0307412_110953652 76
939 3300031911 Ga0307412_11661736 Ga0307412_116617362 76
940 3300031911 Ga0307412_11793072 Ga0307412_117930722 76
941 3300031995 Ga0307409_100074131 Ga0307409_1000741312 76
942 3300031995 Ga0307409_100353795 Ga0307409_1003537951 76
943 3300031995 Ga0307409_100549682 Ga0307409_1005496823 76
944 3300031995 Ga0307409_100594830 Ga0307409_1005948302 76
945 3300031995 Ga0307409_100711804 Ga0307409_1007118042 76
946 3300031995 Ga0307409_100754675 Ga0307409_1007546752 76
947 3300031995 Ga0307409_101733238 Ga0307409_1017332382 76
948 3300031995 Ga0307409_101741075 Ga0307409_1017410752 76
949 3300031995 Ga0307409_102093789 Ga0307409_1020937891 76
950 3300031995 Ga0307409_102948260 Ga0307409_1029482602 76
951 3300032002 Ga0307416_100152722 Ga0307416_1001527223 76
952 3300032002 Ga0307416_100153329 Ga0307416_1001533293 76
953 3300032002 Ga0307416_100206250 Ga0307416_1002062503 76
954 3300032002 Ga0307416_100376208 Ga0307416_1003762082 76
955 3300032002 Ga0307416_100546686 Ga0307416_1005466862 76
956 3300032002 Ga0307416_100704033 Ga0307416_1007040333 76
957 3300032002 Ga0307416_100990144 Ga0307416_1009901443 76
958 3300032002 Ga0307416_101023308 Ga0307416_1010233082 76
959 3300032002 Ga0307416_101163215 Ga0307416_1011632151 76
960 3300032002 Ga0307416_101372708 Ga0307416_1013727082 76
961 3300032002 Ga0307416_101514386 Ga0307416_1015143862 76
962 3300032002 Ga0307416_101816699 Ga0307416_1018166992 76
963 3300032002 Ga0307416_102727023 Ga0307416_1027270232 76
964 3300032002 Ga0307416_102952341 Ga0307416_1029523412 76
965 3300032002 Ga0307416_103008986 Ga0307416_1030089862 76
966 3300032002 Ga0307416_103096295 Ga0307416_1030962952 76
967 3300032004 Ga0307414_10000343 Ga0307414_1000034327 76
968 3300032004 Ga0307414_10021194 Ga0307414_100211942 76
969 3300032004 Ga0307414_10041633 Ga0307414_100416336 76
970 3300032004 Ga0307414_10154867 Ga0307414_101548673 76
971 3300032004 Ga0307414_10392121 Ga0307414_103921213 76
972 3300032004 Ga0307414_10479898 Ga0307414_104798983 76
973 3300032004 Ga0307414_10783771 Ga0307414_107837712 76
974 3300032004 Ga0307414_10978705 Ga0307414_109787052 76
975 3300032004 Ga0307414_11163553 Ga0307414_111635531 76
976 3300032004 Ga0307414_11331702 Ga0307414_113317022 76
977 3300032005 Ga0307411_10102213 Ga0307411_101022133 76
978 3300032005 Ga0307411_10149026 Ga0307411_101490263 76
979 3300032005 Ga0307411_10164328 Ga0307411_101643282 76
980 3300032005 Ga0307411_10180607 Ga0307411_101806073 76
981 3300032005 Ga0307411_10270793 Ga0307411_102707932 76
982 3300032005 Ga0307411_10559042 Ga0307411_105590422 76
983 3300032005 Ga0307411_10633902 Ga0307411_106339022 76
984 3300032005 Ga0307411_11032611 Ga0307411_110326112 76
985 3300032005 Ga0307411_11603045 Ga0307411_116030452 76
986 3300032126 Ga0307415_100045833 Ga0307415_1000458333 76
987 3300032126 Ga0307415_100134218 Ga0307415_1001342183 76
988 3300032126 Ga0307415_100164695 Ga0307415_1001646953 76
989 3300032126 Ga0307415_100251349 Ga0307415_1002513493 76
990 3300032126 Ga0307415_100308804 Ga0307415_1003088042 76
991 3300032126 Ga0307415_100434342 Ga0307415_1004343421 76
992 3300032126 Ga0307415_100441682 Ga0307415_1004416822 76
993 3300032126 Ga0307415_100446001 Ga0307415_1004460013 76
994 3300032126 Ga0307415_100479183 Ga0307415_1004791833 76
995 3300032126 Ga0307415_100805508 Ga0307415_1008055082 76
996 3300032126 Ga0307415_101181059 Ga0307415_1011810592 76
997 3300032126 Ga0307415_101682620 Ga0307415_1016826202 76
998 3300032126 Ga0307415_101692456 Ga0307415_1016924562 76
999 3300032126 Ga0307415_101807011 Ga0307415_1018070112 76
1000 3300032126 Ga0307415_102353342 Ga0307415_1023533422 76
1001 3300035092 Ga0373952_0191951 Ga0373952_0191951_104_352 76
1002 3300035116 Ga0373945_0446294 Ga0373945_0446294_183_434 76
1003 3300035171 Ga0373946_0710935 Ga0373946_0710935_124_369 76
1004 3300035692 Ga0373935_0525575 Ga0373935_0525575_69_317 76
1005 3300037312 Ga0395899_0000103 Ga0395899_0000103_133505_133756 76
1006 3300037312 Ga0395899_0044654 Ga0395899_0044654_665_913 76
1007 3300037312 Ga0395899_0050965 Ga0395899_0050965_1031_1279 76
1008 3300037312 Ga0395899_0156292 Ga0395899_0156292_760_1008 76
1009 3300037312 Ga0395899_0193247 Ga0395899_0193247_430_660 76
1010 3300037312 Ga0395899_0217347 Ga0395899_0217347_67_318 76
1011 3300037312 Ga0395899_0416617 Ga0395899_0416617_436_687 76
1012 3300037312 Ga0395899_0529614 Ga0395899_0529614_341_589 76
1013 3300037312 Ga0395899_0779728 Ga0395899_0779728_161_406 76
1014 3300037418 Ga0395900_0014276 Ga0395900_0014276_1468_1719 76
1015 3300037418 Ga0395900_0018553 Ga0395900_0018553_3516_3761 76
1016 3300037418 Ga0395900_0080027 Ga0395900_0080027_2809_3057 76
1017 3300037418 Ga0395900_0092958 Ga0395900_0092958_217_465 76
1018 3300037418 Ga0395900_0108414 Ga0395900_0108414_1877_2128 76
1019 3300037418 Ga0395900_0144204 Ga0395900_0144204_1090_1341 76
1020 3300037418 Ga0395900_0265260 Ga0395900_0265260_1378_1626 76
1021 3300037418 Ga0395900_0318708 Ga0395900_0318708_730_978 76
1022 3300037418 Ga0395900_0340724 Ga0395900_0340724_289_537 76
1023 3300037418 Ga0395900_0368354 Ga0395900_0368354_1115_1366 76
1024 3300037418 Ga0395900_1036317 Ga0395900_1036317_393_644 76
1025 3300037418 Ga0395900_1374095 Ga0395900_1374095_67_318 76
1026 3300037418 Ga0395900_1650602 Ga0395900_1650602_131_376 76
1027 3300037418 Ga0395900_1736782 Ga0395900_1736782_95_343 76
1028 3300037466 Ga0395898_0000053 Ga0395898_0000053_188106_188357 76
1029 3300037466 Ga0395898_0059944 Ga0395898_0059944_284_532 76
1030 3300037466 Ga0395898_0104192 Ga0395898_0104192_1202_1447 76
1031 3300037466 Ga0395898_0174873 Ga0395898_0174873_1290_1538 76
1032 3300037466 Ga0395898_0739086 Ga0395898_0739086_435_686 76
1033 3300037466 Ga0395898_1051845 Ga0395898_1051845_284_532 76
1034 3300037471 Ga0395905_0000031 Ga0395905_0000031_98401_98652 76
1035 3300037471 Ga0395905_0010668 Ga0395905_0010668_570_815 76
1036 3300037471 Ga0395905_0049853 Ga0395905_0049853_3111_3356 76
1037 3300037471 Ga0395905_0127455 Ga0395905_0127455_233_481 76
1038 3300037471 Ga0395905_0158570 Ga0395905_0158570_1620_1868 76
1039 3300037471 Ga0395905_0243444 Ga0395905_0243444_1281_1529 76
1040 3300037471 Ga0395905_0277537 Ga0395905_0277537_345_596 76
1041 3300037471 Ga0395905_0301969 Ga0395905_0301969_345_593 76
1042 3300037471 Ga0395905_0317740 Ga0395905_0317740_1095_1343 76
1043 3300037471 Ga0395905_0432860 Ga0395905_0432860_787_1038 76
1044 3300037471 Ga0395905_0489681 Ga0395905_0489681_400_645 76
1045 3300037471 Ga0395905_0670974 Ga0395905_0670974_146_376 76
1046 3300037471 Ga0395905_0809719 Ga0395905_0809719_458_706 76
1047 3300037471 Ga0395905_1115582 Ga0395905_1115582_378_626 76
1048 3300037853 Ga0436364_0831628 Ga0436364_0831628_195_434 76
1049 3300037853 Ga0436364_1360610 Ga0436364_1360610_3720_3974 76
1050 3300038443 Ga0395901_0000140 Ga0395901_0000140_93317_93568 76
1051 3300038443 Ga0395901_0000163 Ga0395901_0000163_59217_59468 76
1052 3300038443 Ga0395901_0019566 Ga0395901_0019566_217_465 76
1053 3300038443 Ga0395901_0048374 Ga0395901_0048374_3917_4162 76
1054 3300038443 Ga0395901_0132520 Ga0395901_0132520_144_395 76
1055 3300038443 Ga0395901_0306549 Ga0395901_0306549_694_942 76
1056 3300038443 Ga0395901_0373498 Ga0395901_0373498_1163_1411 76
1057 3300038443 Ga0395901_0950586 Ga0395901_0950586_165_395 76
1058 3300038443 Ga0395901_1045016 Ga0395901_1045016_462_707 76
1059 3300039450 Ga0436363_1532858 Ga0436363_1532858_87_317 76
1060 3300041443 Ga0451789_0444458 Ga0451789_0444458_161_391 76
1061 3300041459 Ga0451800_0026858 Ga0451800_0026858_135_386 76
1062 3300041459 Ga0451800_1450778 Ga0451800_1450778_165_395 76
1063 3300041460 Ga0451802_1464898 Ga0451802_1464898_334_564 76
1064 3300041491 Ga0451833_0589453 Ga0451833_0589453_62_292 76
1065 3300041491 Ga0451833_0716403 Ga0451833_0716403_239_469 76
1066 3300041498 Ga0451841_0430204 Ga0451841_0430204_230_460 76
1067 3300042005 Ga0439448_0099506 Ga0439448_0099506_99_329 76
1068 3300042532 Ga0450893_0107181 Ga0450893_0107181_53_286 76
1069 3300044694 Ga0466963_0014100 Ga0466963_0014100_4212_4460 76
1070 3300044706 Ga0466964_0155458 Ga0466964_0155458_497_745 76
1071 3300044719 Ga0466971_0159112 Ga0466971_0159112_321_569 76
1072 3300044842 Ga0466957_0199266 Ga0466957_0199266_472_720 76
1073 3300044842 Ga0466957_0242823 Ga0466957_0242823_581_823 76
1074 3300044901 Ga0466960_0060197 Ga0466960_0060197_956_1204 76
1075 3300045836 Ga0466958_0579658 Ga0466958_0579658_386_628 76
1076 3300045976 Ga0466967_0015683 Ga0466967_0015683_4323_4571 76
1077 3300045976 Ga0466967_0242317 Ga0466967_0242317_1048_1296 76
1078 3300045976 Ga0466967_0406998 Ga0466967_0406998_320_568 76
1079 3300045976 Ga0466967_0794470 Ga0466967_0794470_351_602 76
1080 3300045976 Ga0466967_0799106 Ga0466967_0799106_75_326 76
1081 3300045976 Ga0466967_1069857 Ga0466967_1069857_118_369 76
1082 3300046452 Ga0495617_235760 Ga0495617_235760_124_357 76
1083 3300046460 Ga0495638_0000051 Ga0495638_0000051_44115_44348 76
1084 3300046492 Ga0495585_0066796 Ga0495585_0066796_132_362 76
1085 3300046492 Ga0495585_0292015 Ga0495585_0292015_19_249 76
1086 3300046492 Ga0495585_0319097 Ga0495585_0319097_288_518 76
1087 3300046500 Ga0495596_0011244 Ga0495596_0011244_2425_2655 76
1088 3300046501 Ga0495607_0258104 Ga0495607_0258104_563_793 76
1089 3300046506 Ga0495583_0000498 Ga0495583_0000498_43770_44003 76
1090 3300046506 Ga0495583_0013060 Ga0495583_0013060_1187_1417 76
1091 3300046507 Ga0495606_0009337 Ga0495606_0009337_6947_7177 76
1092 3300046507 Ga0495606_0083378 Ga0495606_0083378_1267_1497 76
1093 3300046512 Ga0495610_0089165 Ga0495610_0089165_815_1045 76
1094 3300046513 Ga0495616_0040154 Ga0495616_0040154_264_494 76
1095 3300046518 Ga0495631_0125497 Ga0495631_0125497_122_352 76
1096 3300046519 Ga0495632_0000511 Ga0495632_0000511_12883_13116 76
1097 3300046520 Ga0495637_0006994 Ga0495637_0006994_1627_1857 76
1098 3300046520 Ga0495637_0299266 Ga0495637_0299266_186_419 76
1099 3300046522 Ga0495643_0001726 Ga0495643_0001726_9799_10029 76
1100 3300046522 Ga0495643_0003070 Ga0495643_0003070_1969_2199 76
1101 3300046522 Ga0495643_0144798 Ga0495643_0144798_188_418 76
1102 3300046524 Ga0495648_0000032 Ga0495648_0000032_161636_161869 76
1103 3300046524 Ga0495648_0000459 Ga0495648_0000459_30778_31008 76
1104 3300046525 Ga0495663_0046415 Ga0495663_0046415_486_716 76
1105 3300046528 Ga0495642_0134621 Ga0495642_0134621_418_648 76
1106 3300046530 Ga0495654_0177303 Ga0495654_0177303_269_502 76
1107 3300046530 Ga0495654_0226710 Ga0495654_0226710_254_484 76
1108 3300046538 Ga0495609_0084505 Ga0495609_0084505_462_692 76
1109 3300046542 Ga0495597_0020763 Ga0495597_0020763_2193_2423 76
1110 3300046558 Ga0495633_0005764 Ga0495633_0005764_3668_3898 76
1111 3300046558 Ga0495633_0370354 Ga0495633_0370354_136_369 76
1112 3300046616 Ga0495668_0000072 Ga0495668_0000072_19304_19534 76
1113 3300046616 Ga0495668_0258468 Ga0495668_0258468_506_736 76
1114 3300046616 Ga0495668_0266233 Ga0495668_0266233_222_452 76
1115 3300046648 Ga0495611_0126392 Ga0495611_0126392_264_494 76
1116 3300046648 Ga0495611_0237986 Ga0495611_0237986_483_713 76
1117 3300046684 Ga0495669_0000148 Ga0495669_0000148_9724_9954 76
1118 3300046684 Ga0495669_0084230 Ga0495669_0084230_889_1137 76
1119 3300046691 Ga0495670_0233962 Ga0495670_0233962_504_737 76
1120 3300046691 Ga0495670_0446584 Ga0495670_0446584_382_612 76
1121 3300046692 Ga0495671_0000020 Ga0495671_0000020_43883_44116 76
1122 3300046692 Ga0495671_0233113 Ga0495671_0233113_120_350 76
1123 3300046694 Ga0495649_0065105 Ga0495649_0065105_1188_1418 76
1124 3300046694 Ga0495649_0147940 Ga0495649_0147940_849_1079 76
1125 3300046794 Ga0495589_0492604 Ga0495589_0492604_76_306 76
1126 3300046810 Ga0495660_0167317 Ga0495660_0167317_141_371 76
1127 3300047323 Ga0495683_0006914 Ga0495683_0006914_5305_5535 76
1128 3300047323 Ga0495683_0136688 Ga0495683_0136688_390_620 76
1129 3300047443 Ga0495687_000068 Ga0495687_000068_33522_33752 76
1130 3300047443 Ga0495687_000563 Ga0495687_000563_17213_17443 76
1131 3300047445 Ga0495677_0001813 Ga0495677_0001813_861_1091 76
1132 3300047445 Ga0495677_0040255 Ga0495677_0040255_263_493 76
1133 3300047469 Ga0495673_0000076 Ga0495673_0000076_161357_161590 76
1134 3300047469 Ga0495673_0069654 Ga0495673_0069654_402_632 76
1135 3300047470 Ga0495681_0026199 Ga0495681_0026199_1913_2143 76
1136 3300048904 Ga0496101_0064826 Ga0496101_0064826_1973_2203 76
1137 3300048905 Ga0496102_0002779 Ga0496102_0002779_8696_8926 76
1138 3300048906 Ga0496103_0000517 Ga0496103_0000517_29883_30113 76
1139 3300048906 Ga0496103_0518791 Ga0496103_0518791_354_602 76
1140 3300048907 Ga0496104_0087808 Ga0496104_0087808_2132_2362 76
1141 3300048908 Ga0496105_0009488 Ga0496105_0009488_694_924 76
1142 3300048910 Ga0496107_0030953 Ga0496107_0030953_956_1207 76
1143 3300048910 Ga0496107_0060972 Ga0496107_0060972_557_787 76
1144 3300048910 Ga0496107_0286217 Ga0496107_0286217_195_446 76
1145 3300048910 Ga0496107_0508859 Ga0496107_0508859_337_585 76
1146 3300048911 Ga0496108_0001668 Ga0496108_0001668_12791_13039 76
1147 3300048912 Ga0496109_0247125 Ga0496109_0247125_128_367 76
1148 3300048913 Ga0496110_0014892 Ga0496110_0014892_4730_4960 76
1149 3300048914 Ga0496111_0103646 Ga0496111_0103646_337_567 76
1150 3300048914 Ga0496111_0893601 Ga0496111_0893601_319_567 76
1151 3300048915 Ga0496112_1435847 Ga0496112_1435847_180_428 76
1152 3300048916 Ga0496113_0197489 Ga0496113_0197489_470_700 76
1153 3300048917 Ga0496114_0006445 Ga0496114_0006445_8770_9000 76
1154 3300048918 Ga0496115_0000269 Ga0496115_0000269_30277_30507 76
1155 3300048919 Ga0496116_0013371 Ga0496116_0013371_1265_1495 76
1156 3300048920 Ga0496117_0000887 Ga0496117_0000887_30508_30738 76
1157 3300048921 Ga0496118_0001717 Ga0496118_0001717_1559_1789 76
1158 3300048922 Ga0496119_0027215 Ga0496119_0027215_1536_1766 76
1159 3300048923 Ga0496120_0058805 Ga0496120_0058805_1429_1659 76
1160 3300048924 Ga0496121_0004850 Ga0496121_0004850_15348_15578 76
1161 3300048925 Ga0496122_0065656 Ga0496122_0065656_747_977 76
1162 3300048926 Ga0496123_0044148 Ga0496123_0044148_1879_2109 76
1163 3300048927 Ga0496124_0000960 Ga0496124_0000960_15361_15591 76
1164 3300048928 Ga0496125_0000956 Ga0496125_0000956_15285_15515 76
1165 3300048929 Ga0496126_0000321 Ga0496126_0000321_71780_72010 76
1166 3300049162 Ga0501307_089580 Ga0501307_089580_123_368 76
1167 3300049530 Ga0501314_003183 Ga0501314_003183_650_883 76
1168 3300049531 Ga0501315_051347 Ga0501315_051347_252_497 76
1169 3300049531 Ga0501315_103210 Ga0501315_103210_71_316 76
1170 3300049536 Ga0501320_051028 Ga0501320_051028_118_363 76
1171 3300049556 Ga0501340_024555 Ga0501340_024555_145_390 76
1172 3300049571 Ga0501034_0071253 Ga0501034_0071253_2702_2935 76
1173 3300049571 Ga0501034_1431488 Ga0501034_1431488_261_512 76
1174 3300049572 Ga0501036_1055510 Ga0501036_1055510_239_472 76
1175 3300049583 Ga0501067_0086541 Ga0501067_0086541_293_544 76
1176 3300049589 Ga0501073_0830577 Ga0501073_0830577_364_615 76
1177 3300049592 Ga0501076_1090308 Ga0501076_1090308_265_516 76
1178 3300049649 Ga0501198_035964 Ga0501198_035964_380_613 76
1179 3300049660 Ga0501216_052628 Ga0501216_052628_189_437 76
1180 3300049661 Ga0501217_205419 Ga0501217_205419_55_303 76
1181 3300049663 Ga0501223_000342 Ga0501223_000342_2851_3084 76
1182 3300049663 Ga0501223_039106 Ga0501223_039106_455_703 76
1183 3300049664 Ga0501224_000033 Ga0501224_000033_24576_24809 76
1184 3300049664 Ga0501224_019321 Ga0501224_019321_338_583 76
1185 3300049668 Ga0501233_000413 Ga0501233_000413_2666_2899 76
1186 3300049679 Ga0501249_102848 Ga0501249_102848_56_304 76
1187 3300049682 Ga0501252_053084 Ga0501252_053084_157_405 76
1188 3300049683 Ga0501253_023179 Ga0501253_023179_239_484 76
1189 3300049688 Ga0501259_181116 Ga0501259_181116_61_309 76
1190 3300049705 Ga0501225_0000097 Ga0501225_0000097_24514_24747 76
1191 3300049707 Ga0501234_002770 Ga0501234_002770_731_964 76
1192 3300049741 Ga0501079_0760038 Ga0501079_0760038_258_509 76
1193 3300049742 Ga0501080_0349068 Ga0501080_0349068_518_769 76
1194 3300049764 Ga0501267_041614 Ga0501267_041614_197_445 76
1195 3300049765 Ga0501268_079279 Ga0501268_079279_213_458 76
1196 3300049850 Ga0501204_073868 Ga0501204_073868_115_360 76
1197 3300049853 Ga0501226_000056 Ga0501226_000056_24530_24763 76
1198 3300050493 nmdc:mga0k408_33368_c1 nmdc:mga0k408_33368_c1_2041_2271 76
1199 3300050496 nmdc:mga07m45_700468_c1 nmdc:mga07m45_700468_c1_110_340 76
1200 3300050516 nmdc:mga0sz30_327691_c1 nmdc:mga0sz30_327691_c1_291_521 76
1201 3300053079 Ga0500610_0000607 Ga0500610_0000607_2558_2788 76
1202 3300053087 Ga0500643_000644 Ga0500643_000644_9703_9936 76
1203 3300053087 Ga0500643_050118 Ga0500643_050118_417_647 76
1204 3300053130 Ga0500642_0016417 Ga0500642_0016417_475_705 76
1205 3300053136 Ga0500559_0003794 Ga0500559_0003794_3573_3806 76
1206 3300053160 Ga0500633_0187874 Ga0500633_0187874_366_596 76
1207 3300053730 Ga0500645_000002 Ga0500645_000002_354077_354307 76
1208 3300053731 Ga0500609_037558 Ga0500609_037558_232_462 76
1209 3300055283 Ga0500661_000092 Ga0500661_000092_10495_10728 76
1210 3300059491 Ga0587070_152514 Ga0587070_152514_108_338 76
1211 3300059492 Ga0587073_0064600 Ga0587073_0064600_251_481 76
1212 3300059493 Ga0587077_172107 Ga0587077_172107_333_563 76
1213 3300059507 Ga0587086_101265 Ga0587086_101265_189_419 76
1214 3300059508 Ga0587088_003439 Ga0587088_003439_797_1027 76
1215 3300059509 Ga0587089_028254 Ga0587089_028254_250_480 76
1216 3300059510 Ga0587090_034627 Ga0587090_034627_500_730 76
1217 3300059511 Ga0587091_013659 Ga0587091_013659_259_489 76
1218 3300059513 Ga0587094_029529 Ga0587094_029529_68_298 76
1219 3300059630 Ga0587128_120699 Ga0587128_120699_250_480 76
1220 3300059640 Ga0587067_215998 Ga0587067_215998_250_480 76
1221 3300059642 Ga0587069_086497 Ga0587069_086497_65_295 76
1222 3300060344 Ga0587071_070236 Ga0587071_070236_196_426 76
1223 3300061719 Ga0466962_0094623 Ga0466962_0094623_1112_1360 76
1224 3300061719 Ga0466962_0264489 Ga0466962_0264489_252_500 76
1225 3300061734 Ga0530510_0906501 Ga0530510_0906501_151_402 76

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

13

78

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8944 4 76
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8721 4 76
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8578 3 73
3o2e-assembly1.cif.gz_A crystal structure of a bol-like protein from babesia bovis 0.8256 3 75
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.8248 3 73
ID Description Score Start End Superfamily
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8944 4 76 3.30.300.90
af_Q4CW19_9_87_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8778 3 76 3.30.300.90
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8721 4 76 3.30.300.90
af_O14280_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8665 3 75 3.30.300.90
af_P0A9W6_1_84_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8646 3 75 3.30.300.90
ID Description Score Start End GO Terms
AF-A0A5C8PQA4-F1-model_v4 BolA family transcriptional regulator 0.9912 1 75
AF-A0A0P7Y8L1-F1-model_v4 Transcriptional regulator, BolA protein family 0.9851 1 73
AF-A0A368E7T7-F1-model_v4 BolA family transcriptional regulator 0.9797 1 76
AF-A0A5S9P6V0-F1-model_v4 DNA-binding transcriptional regulator BolA 0.9793 1 76
AF-A0A2W2B5S8-F1-model_v4 BolA family transcriptional regulator 0.9789 1 76

Feature Viewer

pLDDT pTM Quality
84.98 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map