F491906

General Info

Members Datasets Scaffolds Average Seq Length
1224 616 1025 322

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0000044|Ga0496104_0000044_128980_130065
Length 361
Sequence LKSNYSFDALAKWKTGGKRKACRGKLPVAAAQSEKIMSLKSFSELTQREILAIAIASEEEDNRIYSTFAEELADRYPATAKVFHEMAAEEDSHRRQLLEIYQARFGSNLPAIRREDVKGFYSRRPTWLVKNLPLETIRHQAEAMEVDSQRFYVQAASASQDVGVRKLLGDLAVVEKSHGEKANALAEAILTESARAAEGRTAHKFFVLQYVQPGLAGLMDGSVSTLAPLFAAAFATQNNWSTFLVGLAASLGAGISMAIAEALSDDGSITGRGAPFIRGAVCGLMTAAGGLGHSLPFLVPDSWPHAFWTATTIAGIVVFFELWAIAYIRARYMDTPFLKAVAQIVVGGAVVLAVGILIGGA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
12 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
15 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
20 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2643221651 Afipia sp. Root123D2 Isolate Unclassified
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
32 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
33 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
34 2791355199
35 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
36 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
37 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
38 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
39 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
40 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
41 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
42 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
43 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
44 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
45 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
46 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
47 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
48 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
49 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
50 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
51 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
52 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
53 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
54 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
55 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
56 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
57 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
58 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
59 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
60 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
61 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
62 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
63 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
64 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
65 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
66 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
67 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
68 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
69 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
70 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
71 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
72 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
73 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
74 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
75 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
76 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
77 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
78 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
79 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
80 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
81 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
82 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
83 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
84 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
85 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
86 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
87 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
88 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
89 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
90 2904699407
91 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
92 2906610324
93 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
94 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
95 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
96 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
97 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
98 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
99 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
100 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
101 2922368715
102 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
103 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
104 2922425934
105 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
106 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
107 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
108 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
109 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
110 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
111 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
112 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
113 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
114 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
115 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
116 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
117 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
118 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
119 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
120 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
121 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
122 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
123 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
124 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
125 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
126 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
127 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
128 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
129 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
130 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
131 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
132 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
133 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
134 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
135 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
136 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
137 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
138 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
139 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
140 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
141 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
142 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
143 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
144 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
145 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
146 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
147 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
148 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
149 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
150 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
151 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
152 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
153 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
154 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
155 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
156 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
157 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
158 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
159 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
160 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
161 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
162 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
163 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
164 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
165 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
166 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
167 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
168 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
169 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
170 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
171 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
172 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
173 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
174 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
175 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
176 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
177 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
178 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
179 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
180 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
181 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
182 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
183 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
184 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
185 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
186 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
187 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
188 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
189 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
190 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
191 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
192 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
193 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
194 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
195 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
196 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
197 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
198 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
199 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
200 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
201 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
202 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
203 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
204 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
205 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
206 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
207 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
208 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
209 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
210 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
211 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
212 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
213 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
214 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
215 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
216 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
217 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
218 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
219 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
220 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
221 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
222 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
223 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
224 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
225 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
226 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
227 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
228 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
229 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
230 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
231 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
232 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
233 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
234 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
235 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
236 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
237 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
238 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
239 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
240 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
241 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
242 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
243 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
244 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
245 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
246 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
247 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
248 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
249 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
250 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
251 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
252 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
253 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
254 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
255 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
256 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
257 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
258 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
259 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
260 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
261 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
262 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
263 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
264 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
265 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
266 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
267 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
268 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
269 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
270 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
271 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
272 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
273 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
274 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
275 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
276 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
277 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
278 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
279 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
280 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
281 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
282 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
283 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
284 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
286 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
287 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
288 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
289 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
290 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
291 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
348 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
349 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
350 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
351 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
356 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
357 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
358 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
359 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
360 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
361 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
362 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
363 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
364 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
365 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
366 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
367 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
368 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
369 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
370 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
371 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
372 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
373 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
374 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
375 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
376 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
377 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
378 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
379 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
380 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
381 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
382 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
383 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
384 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
385 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
386 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
387 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
388 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
389 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
390 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
391 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
392 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
393 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
394 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
395 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
396 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
397 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
398 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
399 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
400 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
401 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
402 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
403 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
404 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
405 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
406 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
407 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
408 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
409 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
410 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
411 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
412 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
413 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
414 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
415 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
416 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
417 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
418 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
419 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
420 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
421 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
422 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
423 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
424 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
425 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
426 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
427 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
428 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
429 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
430 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
431 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
432 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
433 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
434 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
435 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
436 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
437 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
438 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
439 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
440 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
441 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
442 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
443 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
444 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
445 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
446 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
447 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
448 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
449 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
450 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
451 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
452 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
453 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
454 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
455 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
456 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
457 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
458 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
459 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
460 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
461 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
462 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
463 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
464 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
465 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
466 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
467 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
468 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
469 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
470 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
471 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
472 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
473 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
474 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
475 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
476 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
477 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
478 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
479 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
480 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
481 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
482 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
483 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
484 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
485 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
486 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
487 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
488 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
489 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
490 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
491 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
492 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
493 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
494 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
495 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
496 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
497 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
498 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
499 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
500 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
501 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
502 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
503 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
504 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
505 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
506 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
507 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
508 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
509 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
510 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
511 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
512 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
513 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
514 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
515 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
516 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
517 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
518 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
519 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
520 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
521 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
522 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
523 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
524 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
525 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
526 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
527 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
528 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
529 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
530 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
531 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
532 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
533 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
534 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
535 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
536 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
537 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
538 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
539 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
540 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
541 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
542 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
543 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
544 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
545 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
546 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
547 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
548 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
549 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
550 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
551 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
552 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
553 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
554 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
555 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
556 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
557 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
558 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
559 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
560 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
561 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
562 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
563 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
564 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
565 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
566 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
567 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
568 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
569 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
570 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
571 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
572 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
573 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
574 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
575 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
576 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
577 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
578 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
579 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
580 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
581 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
582 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
583 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
584 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
585 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
586 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
587 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
588 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
589 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
590 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
591 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
592 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
593 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
594 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
595 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
596 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
597 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
598 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
599 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
600 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
601 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
602 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
603 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
604 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
605 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
606 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
607 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
608 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
609 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
610 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
611 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
612 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
613 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
614 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
615 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
616 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.09
Metatranscriptomes 0
Isolates 15.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.64
Nodule 13.07
Rhizoplane 8.58
Rhizosphere 58.5
Stem 0
Stem Tuber 0
Unclassified 10.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005305 3300001979 Bacteria 5469
2 JGI24739J22299_10001354 3300001989 Bacteria 9192
3 JGI24737J22298_10006407 3300001990 Bacteria 4022
4 JGI24735J21928_10001477 3300002067 Bacteria 8310
5 JGI25406J46586_10003551 3300003203 Bacteria 7309
6 JGI25406J46586_10004678 3300003203 Bacteria 6373
7 JGI25406J46586_10005624 3300003203 Bacteria 5800
8 JGI25153J46596_10000683 3300003215 Bacteria 20724
9 JGI25153J46596_10004591 3300003215 Bacteria 7398
10 JGI25153J46596_10019116 3300003215 Bacteria 2633
11 JGI25153J46596_10040457 3300003215 Bacteria 1445
12 JGI25160J50197_1005256 3300003354 Bacteria 5418
13 Ga0055539_1004286 3300003752 Bacteria 1906
14 Ga0055531_10001777 3300003794 Bacteria 15317
15 JGI25405J52794_10013969 3300003911 Bacteria 1565
16 Ga0065165_1000346 3300005262 Bacteria 76065
17 Ga0065707_10213042 3300005295 Bacteria 1257
18 Ga0070658_10060745 3300005327 Bacteria 3079
19 Ga0070658_10134611 3300005327 Bacteria 2061
20 Ga0070658_10388491 3300005327 Bacteria 1198
21 Ga0070683_100042802 3300005329 Bacteria 4171
22 Ga0070683_100486866 3300005329 Bacteria 1178
23 Ga0070680_100031683 3300005336 Bacteria 4251
24 Ga0070680_100061315 3300005336 Bacteria 3079
25 Ga0070682_100025751 3300005337 Bacteria 3514
26 Ga0068868_100019606 3300005338 Bacteria 5069
27 Ga0068868_100025678 3300005338 Bacteria 4484
28 Ga0070660_100017224 3300005339 Bacteria 5264
29 Ga0070660_100091715 3300005339 Bacteria 2397
30 Ga0070660_100250247 3300005339 Bacteria 1445
31 Ga0070691_10043707 3300005341 Bacteria 2123
32 Ga0070661_100124878 3300005344 Bacteria 1930
33 Ga0070661_100194523 3300005344 Bacteria 1548
34 Ga0070668_100027108 3300005347 Bacteria 4348
35 Ga0070668_100107989 3300005347 Bacteria 2212
36 Ga0070668_100118533 3300005347 Bacteria 2113
37 Ga0070671_100016463 3300005355 Bacteria 5978
38 Ga0070671_100114977 3300005355 Bacteria 2262
39 Ga0070674_100039906 3300005356 Bacteria 3173
40 Ga0070673_100118128 3300005364 Bacteria 2208
41 Ga0070688_100036186 3300005365 Bacteria 3001
42 Ga0070659_100290374 3300005366 Bacteria 1362
43 Ga0070659_100328869 3300005366 Bacteria 1279
44 Ga0070667_100127770 3300005367 Bacteria 2216
45 Ga0070667_100141205 3300005367 Bacteria 2109
46 Ga0070667_100468143 3300005367 Bacteria 1153
47 Ga0070709_10003777 3300005434 Bacteria 8140
48 Ga0070709_10018724 3300005434 Bacteria 3995
49 Ga0070714_100002243 3300005435 Bacteria 14221
50 Ga0070714_100140963 3300005435 Bacteria 2164
51 Ga0070714_100434817 3300005435 Bacteria 1244
52 Ga0070713_100015248 3300005436 Bacteria 5734
53 Ga0070713_100036876 3300005436 Bacteria 3949
54 Ga0070713_100360446 3300005436 Bacteria 1351
55 Ga0070710_10001777 3300005437 Bacteria 10195
56 Ga0070710_10010746 3300005437 Bacteria 4501
57 Ga0070710_10018894 3300005437 Bacteria 3553
58 Ga0070710_10020491 3300005437 Bacteria 3431
59 Ga0070711_100000925 3300005439 Bacteria 15498
60 Ga0070711_100003897 3300005439 Bacteria 8762
61 Ga0070711_100004173 3300005439 Bacteria 8490
62 Ga0070711_100032022 3300005439 Bacteria 3493
63 Ga0070694_100180322 3300005444 Bacteria 1562
64 Ga0070694_100273431 3300005444 Bacteria 1285
65 Ga0070663_100022852 3300005455 Bacteria 4185
66 Ga0070663_100049790 3300005455 Bacteria 2977
67 Ga0070663_100052579 3300005455 Bacteria 2905
68 Ga0070663_100087817 3300005455 Bacteria 2299
69 Ga0070663_100118555 3300005455 Bacteria 1997
70 Ga0070663_100123980 3300005455 Bacteria 1955
71 Ga0070663_100149569 3300005455 Bacteria 1789
72 Ga0070678_100004019 3300005456 Bacteria 8277
73 Ga0070678_100135891 3300005456 Bacteria 1960
74 Ga0070662_100042188 3300005457 Bacteria 3258
75 Ga0070662_100328464 3300005457 Bacteria 1249
76 Ga0070681_10055590 3300005458 Bacteria 3940
77 Ga0070681_10061821 3300005458 Bacteria 3719
78 Ga0070681_10077122 3300005458 Bacteria 3290
79 Ga0070706_100139283 3300005467 Bacteria 2265
80 Ga0070707_100105819 3300005468 Bacteria 2728
81 Ga0070698_100032926 3300005471 Bacteria 5369
82 Ga0070698_100077304 3300005471 Bacteria 3328
83 Ga0070679_100012161 3300005530 Bacteria 8222
84 Ga0070679_100033412 3300005530 Bacteria 5093
85 Ga0070679_100067578 3300005530 Bacteria 3564
86 Ga0070679_100163108 3300005530 Bacteria 2202
87 Ga0070684_100005499 3300005535 Bacteria 9713
88 Ga0070684_100015667 3300005535 Bacteria 6183
89 Ga0070684_100187485 3300005535 Bacteria 1881
90 Ga0070697_100088757 3300005536 Bacteria 2554
91 Ga0068853_100005555 3300005539 Bacteria 9894
92 Ga0068853_100029210 3300005539 Bacteria 4645
93 Ga0068853_100045658 3300005539 Bacteria 3753
94 Ga0070695_100276247 3300005545 Bacteria 1232
95 Ga0070696_100295768 3300005546 Bacteria 1238
96 Ga0070665_100051314 3300005548 Bacteria 4137
97 Ga0070665_100074805 3300005548 Bacteria 3393
98 Ga0068855_100177099 3300005563 Bacteria 2412
99 Ga0068855_100186425 3300005563 Bacteria 2343
100 Ga0068855_100223347 3300005563 Bacteria 2111
101 Ga0068855_100290959 3300005563 Bacteria 1811
102 Ga0070664_100060470 3300005564 Bacteria 3226
103 Ga0070664_100123842 3300005564 Bacteria 2266
104 Ga0068857_100003636 3300005577 Bacteria 12924
105 Ga0068857_100033843 3300005577 Bacteria 4520
106 Ga0068857_100129044 3300005577 Bacteria 2279
107 Ga0068854_100001467 3300005578 Bacteria 14286
108 Ga0068854_100052337 3300005578 Bacteria 2928
109 Ga0068854_100264450 3300005578 Bacteria 1378
110 Ga0068856_100001216 3300005614 Bacteria 26989
111 Ga0068856_100005462 3300005614 Bacteria 12520
112 Ga0068856_100064877 3300005614 Bacteria 3608
113 Ga0068856_100196464 3300005614 Bacteria 2031
114 Ga0070702_100058847 3300005615 Bacteria 2228
115 Ga0070702_100073873 3300005615 Bacteria 2021
116 Ga0068852_100079490 3300005616 Bacteria 2905
117 Ga0068852_100093541 3300005616 Bacteria 2695
118 Ga0068852_100120527 3300005616 Bacteria 2400
119 Ga0068859_100067989 3300005617 Bacteria 3598
120 Ga0068864_100064197 3300005618 Bacteria 3184
121 Ga0068864_100160162 3300005618 Bacteria 2045
122 Ga0068864_100231287 3300005618 Bacteria 1710
123 Ga0068861_100024838 3300005719 Bacteria 4338
124 Ga0068861_100072147 3300005719 Bacteria 2678
125 Ga0068851_10081615 3300005834 Bacteria 1689
126 Ga0068863_100060745 3300005841 Bacteria 3574
127 Ga0068858_100031611 3300005842 Bacteria 4917
128 Ga0068860_100000313 3300005843 Bacteria 66545
129 Ga0068860_100061820 3300005843 Bacteria 3558
130 Ga0068860_100275665 3300005843 Bacteria 1642
131 Ga0081455_10017005 3300005937 Bacteria 6991
132 Ga0081455_10033425 3300005937 Bacteria 4622
133 Ga0081455_10044893 3300005937 Bacteria 3850
134 Ga0081540_1001554 3300005983 Bacteria 19673
135 Ga0081540_1002392 3300005983 Bacteria 15309
136 Ga0081540_1002941 3300005983 Bacteria 13703
137 Ga0081540_1003116 3300005983 Bacteria 13276
138 Ga0081540_1007937 3300005983 Bacteria 7490
139 Ga0081540_1028608 3300005983 Bacteria 3126
140 Ga0081540_1040551 3300005983 Bacteria 2426
141 Ga0081540_1044814 3300005983 Bacteria 2254
142 Ga0081540_1054809 3300005983 Bacteria 1945
143 Ga0081539_10000157 3300005985 Bacteria 158278
144 Ga0081539_10000269 3300005985 Bacteria 119082
145 Ga0081539_10089794 3300005985 Bacteria 1591
146 Ga0070717_10003038 3300006028 Bacteria 11966
147 Ga0070717_10025148 3300006028 Bacteria 4731
148 Ga0070717_10056384 3300006028 Bacteria 3246
149 Ga0070717_10289786 3300006028 Bacteria 1453
150 Ga0070717_10398573 3300006028 Bacteria 1236
151 Ga0075365_10016284 3300006038 Bacteria 4518
152 Ga0075365_10065239 3300006038 Bacteria 2440
153 Ga0075365_10092701 3300006038 Bacteria 2059
154 Ga0075368_10094488 3300006042 Bacteria 1224
155 Ga0075363_100008111 3300006048 Bacteria 4873
156 Ga0075363_100027242 3300006048 Bacteria 2928
157 Ga0070715_10005356 3300006163 Bacteria 4273
158 Ga0070716_100001830 3300006173 Bacteria 9631
159 Ga0070716_100001976 3300006173 Bacteria 9334
160 Ga0070716_100092010 3300006173 Bacteria 1838
161 Ga0070716_100193525 3300006173 Bacteria 1346
162 Ga0070712_100015066 3300006175 Bacteria 4971
163 Ga0070712_100057656 3300006175 Bacteria 2729
164 Ga0070712_100075500 3300006175 Bacteria 2424
165 Ga0075367_10036832 3300006178 Bacteria 2839
166 Ga0075369_10110837 3300006186 Bacteria 1237
167 Ga0075370_10003655 3300006353 Bacteria 7363
168 Ga0075370_10128865 3300006353 Bacteria 1476
169 Ga0068871_100085036 3300006358 Bacteria 2626
170 Ga0075434_100017125 3300006871 Bacteria 6974
171 Ga0075434_100117389 3300006871 Bacteria 2674
172 Ga0075434_100200196 3300006871 Bacteria 2017
173 Ga0075434_100353289 3300006871 Bacteria 1491
174 Ga0068865_100196177 3300006881 Bacteria 1565
175 Ga0097620_100067989 3300006931 Bacteria 3598
176 Ga0099825_1030002 3300006941 Bacteria 2456
177 Ga0099824_1003568 3300006942 Bacteria 22720
178 Ga0099824_1020150 3300006942 Bacteria 4991
179 Ga0099822_1020142 3300006943 Bacteria 6673
180 Ga0099823_1022771 3300006944 Bacteria 5781
181 Ga0099795_10015685 3300007788 Bacteria 2380
182 Ga0099795_10039119 3300007788 Bacteria 1677
183 Ga0099795_10068911 3300007788 Bacteria 1330
184 Ga0105250_10025569 3300009092 Bacteria 2378
185 Ga0105240_10002788 3300009093 Bacteria 27630
186 Ga0105240_10036732 3300009093 Bacteria 6299
187 Ga0105240_10040279 3300009093 Bacteria 5977
188 Ga0105240_10070783 3300009093 Bacteria 4314
189 Ga0105240_10087986 3300009093 Bacteria 3802
190 Ga0105240_10140606 3300009093 Bacteria 2886
191 Ga0105240_10174617 3300009093 Bacteria 2541
192 Ga0111539_10217448 3300009094 Bacteria 2225
193 Ga0105245_10036585 3300009098 Bacteria 4361
194 Ga0105245_10446810 3300009098 Bacteria 1300
195 Ga0105247_10012446 3300009101 Bacteria 5109
196 Ga0105247_10060715 3300009101 Bacteria 2343
197 Ga0105247_10104186 3300009101 Bacteria 1817
198 Ga0105243_10267669 3300009148 Bacteria 1533
199 Ga0105241_10001292 3300009174 Bacteria 19082
200 Ga0105241_10013611 3300009174 Bacteria 5962
201 Ga0105241_10015930 3300009174 Bacteria 5508
202 Ga0105241_10026423 3300009174 Bacteria 4319
203 Ga0105241_10447899 3300009174 Bacteria 1141
204 Ga0105242_10453123 3300009176 Bacteria 1210
205 Ga0105248_10027010 3300009177 Bacteria 6386
206 Ga0105248_10084197 3300009177 Bacteria 3577
207 Ga0105248_10220761 3300009177 Bacteria 2134
208 Ga0105237_10009221 3300009545 Bacteria 10589
209 Ga0105237_10036983 3300009545 Bacteria 4936
210 Ga0105237_10046660 3300009545 Bacteria 4357
211 Ga0105237_10060489 3300009545 Bacteria 3789
212 Ga0105237_10078985 3300009545 Bacteria 3280
213 Ga0105237_10184537 3300009545 Bacteria 2086
214 Ga0105237_10223199 3300009545 Bacteria 1884
215 Ga0105237_10301554 3300009545 Bacteria 1605
216 Ga0105238_10002650 3300009551 Bacteria 17821
217 Ga0105238_10009622 3300009551 Bacteria 9670
218 Ga0105238_10107061 3300009551 Bacteria 2777
219 Ga0105238_10128992 3300009551 Bacteria 2507
220 Ga0105238_10206349 3300009551 Bacteria 1941
221 Ga0105238_10617163 3300009551 Bacteria 1093
222 Ga0105249_10062340 3300009553 Bacteria 3423
223 Ga0105239_10002167 3300010375 Bacteria 25250
224 Ga0105239_10069537 3300010375 Bacteria 3868
225 Ga0105239_10174916 3300010375 Bacteria 2401
226 Ga0105239_10213351 3300010375 Bacteria 2164
227 Ga0105239_10265546 3300010375 Bacteria 1930
228 Ga0105246_10012832 3300011119 Bacteria 5239
229 Ga0105246_10029670 3300011119 Bacteria 3604
230 Ga0105246_10085430 3300011119 Bacteria 2260
231 Ga0105246_10266420 3300011119 Bacteria 1367
232 Ga0157370_10053798 3300013104 Bacteria 3838
233 Ga0157370_10076043 3300013104 Bacteria 3164
234 Ga0157370_10168341 3300013104 Bacteria 2037
235 Ga0157370_10197802 3300013104 Bacteria 1865
236 Ga0157369_10018355 3300013105 Bacteria 7842
237 Ga0157369_10207224 3300013105 Bacteria 2056
238 Ga0157369_10309753 3300013105 Bacteria 1642
239 Ga0157374_10051253 3300013296 Bacteria 3840
240 Ga0157378_10105505 3300013297 Bacteria 2577
241 Ga0157378_10116406 3300013297 Bacteria 2458
242 Ga0163162_10024637 3300013306 Bacteria 5942
243 Ga0163162_10244216 3300013306 Bacteria 1927
244 Ga0163162_10284952 3300013306 Bacteria 1784
245 Ga0163162_10505994 3300013306 Bacteria 1338
246 Ga0157375_10074172 3300013308 Bacteria 3423
247 Ga0157375_10162998 3300013308 Bacteria 2373
248 Ga0157375_10231205 3300013308 Bacteria 2008
249 Ga0163163_10006627 3300014325 Bacteria 10142
250 Ga0163163_10042699 3300014325 Bacteria 4442
251 Ga0163163_10057594 3300014325 Bacteria 3843
252 Ga0163163_10083753 3300014325 Bacteria 3195
253 Ga0157380_10011431 3300014326 Bacteria 6415
254 Ga0157377_10012950 3300014745 Bacteria 4208
255 Ga0157379_10059456 3300014968 Bacteria 3417
256 Ga0157379_10119130 3300014968 Bacteria 2374
257 Ga0163161_10116334 3300017792 Bacteria 2004
258 Ga0213874_10011052 3300021377 Bacteria 2276
259 Ga0213876_10004666 3300021384 Bacteria 7633
260 Ga0213876_10031289 3300021384 Bacteria 2808
261 Ga0213876_10081273 3300021384 Bacteria 1714
262 Ga0213876_10098820 3300021384 Bacteria 1547
263 Ga0207425_1023647 3300025245 Bacteria 1284
264 Ga0209677_105501 3300025253 Bacteria 3283
265 Ga0209233_1002653 3300025261 Bacteria 6482
266 Ga0209233_1006085 3300025261 Bacteria 3926
267 Ga0209455_1001457 3300025272 Bacteria 10642
268 Ga0209564_1010921 3300025295 Bacteria 4127
269 Ga0209564_1028283 3300025295 Bacteria 1797
270 Ga0209758_1000015 3300025297 Bacteria 851943
271 Ga0209758_1000306 3300025297 Bacteria 95362
272 Ga0209758_1001762 3300025297 Bacteria 24014
273 Ga0209758_1005473 3300025297 Bacteria 9757
274 Ga0209758_1006330 3300025297 Bacteria 8580
275 Ga0209758_1014947 3300025297 Bacteria 4067
276 Ga0209758_1020436 3300025297 Bacteria 3132
277 Ga0209256_1001762 3300025299 Bacteria 20594
278 Ga0209256_1022067 3300025299 Bacteria 1937
279 Ga0207426_1001146 3300025302 Bacteria 23889
280 Ga0207426_1009602 3300025302 Bacteria 3814
281 Ga0207426_1052349 3300025302 Bacteria 1209
282 Ga0209257_1001620 3300025304 Bacteria 25806
283 Ga0209257_1010293 3300025304 Bacteria 4767
284 Ga0207656_10024518 3300025321 Bacteria 2440
285 Ga0207656_10037089 3300025321 Bacteria 2049
286 Ga0207692_10001222 3300025898 Bacteria 9523
287 Ga0207692_10001328 3300025898 Bacteria 9210
288 Ga0207692_10021787 3300025898 Bacteria 2938
289 Ga0207710_10016733 3300025900 Bacteria 3104
290 Ga0207710_10025237 3300025900 Bacteria 2564
291 Ga0207710_10152423 3300025900 Bacteria 1122
292 Ga0207688_10053788 3300025901 Bacteria 2258
293 Ga0207680_10142253 3300025903 Bacteria 1591
294 Ga0207647_10000121 3300025904 Bacteria 61311
295 Ga0207647_10011601 3300025904 Bacteria 6171
296 Ga0207685_10005021 3300025905 Bacteria 3442
297 Ga0207699_10000616 3300025906 Bacteria 17322
298 Ga0207699_10023472 3300025906 Bacteria 3357
299 Ga0207699_10024839 3300025906 Bacteria 3282
300 Ga0207699_10143998 3300025906 Bacteria 1569
301 Ga0207699_10267164 3300025906 Bacteria 1184
302 Ga0207645_10036827 3300025907 Bacteria 3141
303 Ga0207705_10050706 3300025909 Bacteria 2988
304 Ga0207705_10054801 3300025909 Bacteria 2874
305 Ga0207705_10088213 3300025909 Bacteria 2269
306 Ga0207705_10229709 3300025909 Bacteria 1411
307 Ga0207705_10273600 3300025909 Bacteria 1292
308 Ga0207654_10004165 3300025911 Bacteria 7294
309 Ga0207654_10070397 3300025911 Bacteria 2076
310 Ga0207707_10000143 3300025912 Bacteria 74226
311 Ga0207707_10001842 3300025912 Bacteria 19423
312 Ga0207707_10011276 3300025912 Bacteria 7779
313 Ga0207707_10212392 3300025912 Bacteria 1685
314 Ga0207707_10414567 3300025912 Bacteria 1155
315 Ga0207695_10000059 3300025913 Bacteria 363920
316 Ga0207695_10001028 3300025913 Bacteria 49101
317 Ga0207695_10010833 3300025913 Bacteria 11109
318 Ga0207695_10076241 3300025913 Bacteria 3409
319 Ga0207695_10316594 3300025913 Bacteria 1450
320 Ga0207671_10006959 3300025914 Bacteria 9946
321 Ga0207671_10103796 3300025914 Bacteria 2156
322 Ga0207671_10127285 3300025914 Bacteria 1952
323 Ga0207671_10130192 3300025914 Bacteria 1931
324 Ga0207693_10005104 3300025915 Bacteria 11006
325 Ga0207693_10039800 3300025915 Bacteria 3701
326 Ga0207663_10002795 3300025916 Bacteria 8410
327 Ga0207663_10013988 3300025916 Bacteria 4380
328 Ga0207660_10005467 3300025917 Bacteria 8248
329 Ga0207660_10026046 3300025917 Bacteria 3978
330 Ga0207660_10044519 3300025917 Bacteria 3123
331 Ga0207657_10018743 3300025919 Bacteria 6593
332 Ga0207657_10198445 3300025919 Bacteria 1615
333 Ga0207649_10084450 3300025920 Bacteria 2064
334 Ga0207652_10002421 3300025921 Bacteria 15748
335 Ga0207652_10042999 3300025921 Bacteria 3847
336 Ga0207652_10097592 3300025921 Bacteria 2590
337 Ga0207646_10062089 3300025922 Bacteria 3335
338 Ga0207681_10107063 3300025923 Bacteria 2027
339 Ga0207681_10201884 3300025923 Bacteria 1527
340 Ga0207694_10000186 3300025924 Bacteria 63372
341 Ga0207694_10017755 3300025924 Bacteria 5376
342 Ga0207694_10058931 3300025924 Bacteria 2986
343 Ga0207694_10095241 3300025924 Bacteria 2353
344 Ga0207694_10167381 3300025924 Bacteria 1778
345 Ga0207659_10241801 3300025926 Bacteria 1461
346 Ga0207659_10314668 3300025926 Bacteria 1290
347 Ga0207687_10082632 3300025927 Bacteria 2324
348 Ga0207687_10212858 3300025927 Bacteria 1517
349 Ga0207687_10360207 3300025927 Bacteria 1187
350 Ga0207700_10006776 3300025928 Bacteria 6961
351 Ga0207700_10041762 3300025928 Bacteria 3358
352 Ga0207700_10065823 3300025928 Bacteria 2767
353 Ga0207700_10184427 3300025928 Bacteria 1749
354 Ga0207700_10417169 3300025928 Bacteria 1178
355 Ga0207664_10085288 3300025929 Bacteria 2577
356 Ga0207664_10199475 3300025929 Bacteria 1726
357 Ga0207644_10078014 3300025931 Bacteria 2441
358 Ga0207644_10324503 3300025931 Bacteria 1245
359 Ga0207690_10350870 3300025932 Bacteria 1167
360 Ga0207706_10037004 3300025933 Bacteria 4334
361 Ga0207706_10071644 3300025933 Bacteria 3048
362 Ga0207706_10230840 3300025933 Bacteria 1619
363 Ga0207686_10203872 3300025934 Bacteria 1418
364 Ga0207709_10382163 3300025935 Bacteria 1072
365 Ga0207669_10033427 3300025937 Bacteria 2902
366 Ga0207704_10208521 3300025938 Bacteria 1436
367 Ga0207665_10000986 3300025939 Bacteria 19251
368 Ga0207665_10004249 3300025939 Bacteria 9521
369 Ga0207665_10170076 3300025939 Bacteria 1573
370 Ga0207665_10335502 3300025939 Bacteria 1138
371 Ga0207691_10089800 3300025940 Bacteria 2755
372 Ga0207691_10130785 3300025940 Bacteria 2218
373 Ga0207711_10050991 3300025941 Bacteria 3543
374 Ga0207711_10140438 3300025941 Bacteria 2173
375 Ga0207689_10031598 3300025942 Bacteria 4406
376 Ga0207661_10015591 3300025944 Bacteria 5597
377 Ga0207661_10058395 3300025944 Bacteria 3105
378 Ga0207661_10123192 3300025944 Bacteria 2210
379 Ga0207679_10081504 3300025945 Bacteria 2474
380 Ga0207667_10025336 3300025949 Bacteria 6494
381 Ga0207667_10030933 3300025949 Bacteria 5784
382 Ga0207667_10058055 3300025949 Bacteria 4060
383 Ga0207667_10215480 3300025949 Bacteria 1968
384 Ga0207667_10435085 3300025949 Bacteria 1334
385 Ga0207712_10361120 3300025961 Bacteria 1210
386 Ga0207668_10020091 3300025972 Bacteria 4236
387 Ga0207668_10049153 3300025972 Bacteria 2897
388 Ga0207668_10066907 3300025972 Bacteria 2548
389 Ga0207668_10107364 3300025972 Bacteria 2087
390 Ga0207640_10006494 3300025981 Bacteria 6422
391 Ga0207640_10016970 3300025981 Bacteria 4249
392 Ga0207640_10071674 3300025981 Bacteria 2335
393 Ga0207658_10115565 3300025986 Bacteria 2130
394 Ga0207677_10028693 3300026023 Bacteria 3525
395 Ga0207639_10218125 3300026041 Bacteria 1646
396 Ga0207639_10446504 3300026041 Bacteria 1173
397 Ga0207678_10013578 3300026067 Bacteria 7152
398 Ga0207678_10043427 3300026067 Bacteria 3890
399 Ga0207678_10049123 3300026067 Bacteria 3646
400 Ga0207678_10051858 3300026067 Bacteria 3540
401 Ga0207678_10055568 3300026067 Bacteria 3410
402 Ga0207678_10071365 3300026067 Bacteria 2978
403 Ga0207678_10079603 3300026067 Bacteria 2805
404 Ga0207678_10089104 3300026067 Bacteria 2637
405 Ga0207702_10000064 3300026078 Bacteria 120869
406 Ga0207702_10001100 3300026078 Bacteria 27642
407 Ga0207702_10275186 3300026078 Bacteria 1589
408 Ga0207702_10646922 3300026078 Bacteria 1040
409 Ga0207641_10050308 3300026088 Bacteria 3525
410 Ga0207676_10020142 3300026095 Bacteria 4876
411 Ga0207676_10383390 3300026095 Bacteria 1309
412 Ga0207674_10000946 3300026116 Bacteria 37958
413 Ga0207674_10003365 3300026116 Bacteria 19630
414 Ga0207674_10030029 3300026116 Bacteria 5718
415 Ga0207675_100126901 3300026118 Bacteria 2417
416 Ga0207675_100144614 3300026118 Bacteria 2260
417 Ga0207675_100445446 3300026118 Bacteria 1282
418 Ga0207683_10009120 3300026121 Bacteria 8454
419 Ga0207683_10026713 3300026121 Bacteria 4986
420 Ga0207698_10078750 3300026142 Bacteria 2648
421 Ga0207698_10384535 3300026142 Bacteria 1336
422 Ga0207698_10391533 3300026142 Bacteria 1325
423 Ga0207698_10426378 3300026142 Bacteria 1274
424 Ga0209389_1000012 3300027296 Bacteria 213243
425 Ga0209389_1000052 3300027296 Bacteria 109624
426 Ga0209589_1000015 3300027357 Bacteria 225913
427 Ga0209589_1000058 3300027357 Bacteria 109624
428 Ga0209489_100015 3300027361 Bacteria 225913
429 Ga0209489_100019 3300027361 Bacteria 213243
430 Ga0209489_100020 3300027361 Bacteria 207541
431 Ga0209700_100018 3300027363 Bacteria 238200
432 Ga0209700_100025 3300027363 Bacteria 225913
433 Ga0209179_1004942 3300027512 Bacteria 2051
434 Ga0268266_10009025 3300028379 Bacteria 8814
435 Ga0268266_10032599 3300028379 Bacteria 4426
436 Ga0268266_10118485 3300028379 Bacteria 2354
437 Ga0268266_10134419 3300028379 Bacteria 2214
438 Ga0268266_10183462 3300028379 Bacteria 1907
439 Ga0268266_10412343 3300028379 Bacteria 1279
440 Ga0268265_10006752 3300028380 Bacteria 7764
441 Ga0268265_10079575 3300028380 Bacteria 2581
442 Ga0268265_10386996 3300028380 Bacteria 1288
443 Ga0268264_10000356 3300028381 Bacteria 68810
444 Ga0265326_10016053 3300028558 Bacteria 2166
445 Ga0265334_10004606 3300028573 Bacteria 6097
446 Ga0265318_10013883 3300028577 Bacteria 3391
447 Ga0265323_10005398 3300028653 Bacteria 5432
448 Ga0265336_10000394 3300028666 Bacteria 27433
449 Ga0307517_10000476 3300028786 Bacteria 68696
450 Ga0307517_10048541 3300028786 Bacteria 4365
451 Ga0307517_10235724 3300028786 Bacteria 1092
452 Ga0265338_10001172 3300028800 Bacteria 43270
453 Ga0307511_10094360 3300030521 Bacteria 2005
454 Ga0265330_10029159 3300031235 Bacteria 2483
455 Ga0265328_10000080 3300031239 Bacteria 49890
456 Ga0265328_10000281 3300031239 Bacteria 23769
457 Ga0265328_10001707 3300031239 Bacteria 10051
458 Ga0265328_10005769 3300031239 Bacteria 5284
459 Ga0265339_10005531 3300031249 Bacteria 8403
460 Ga0265339_10096742 3300031249 Bacteria 1541
461 Ga0265331_10002562 3300031250 Bacteria 12218
462 Ga0265331_10004877 3300031250 Bacteria 8254
463 Ga0265327_10054415 3300031251 Bacteria 2072
464 Ga0265327_10084304 3300031251 Bacteria 1562
465 Ga0265316_10005062 3300031344 Bacteria 12934
466 Ga0265316_10094446 3300031344 Bacteria 2278
467 Ga0307509_10103050 3300031507 Bacteria 2883
468 Ga0307508_10000715 3300031616 Bacteria 39415
469 Ga0307508_10080513 3300031616 Bacteria 2838
470 Ga0265314_10005216 3300031711 Bacteria 11788
471 Ga0265314_10014299 3300031711 Bacteria 6361
472 Ga0265314_10041855 3300031711 Bacteria 3274
473 Ga0265314_10048926 3300031711 Bacteria 2963
474 Ga0265342_10008957 3300031712 Bacteria 7109
475 Ga0265342_10187919 3300031712 Bacteria 1128
476 Ga0307516_10035080 3300031730 Bacteria 5036
477 Ga0307405_10056632 3300031731 Bacteria 2460
478 Ga0307407_10283914 3300031903 Bacteria 1148
479 Ga0307412_10130410 3300031911 Bacteria 1825
480 Ga0307409_100197155 3300031995 Bacteria 1798
481 Ga0307416_100232352 3300032002 Bacteria 1779
482 Ga0307415_100055386 3300032126 Bacteria 2713
483 Ga0307510_10004729 3300033180 Bacteria 16101
484 Ga0307510_10074620 3300033180 Bacteria 3349
485 Ga0307510_10097798 3300033180 Bacteria 2742
486 Ga0307510_10139643 3300033180 Bacteria 2070
487 Ga0315911_1000021 3300033442 Bacteria 124874
488 Ga0373926_0022234 3300035083 Bacteria 2200
489 Ga0373926_0101304 3300035083 Bacteria 1077
490 Ga0373934_0001987 3300035086 Bacteria 7506
491 Ga0373952_0008126 3300035092 Bacteria 1984
492 Ga0373923_0034028 3300035111 Bacteria 2066
493 Ga0373936_0012672 3300035113 Bacteria 3209
494 Ga0373936_0107583 3300035113 Bacteria 1181
495 Ga0373945_0004593 3300035116 Bacteria 4392
496 Ga0373953_0001676 3300035117 Bacteria 6515
497 Ga0373953_0003868 3300035117 Bacteria 4714
498 Ga0373954_0000227 3300035118 Bacteria 20422
499 Ga0373954_0025227 3300035118 Bacteria 2716
500 Ga0373954_0183241 3300035118 Bacteria 1027
501 Ga0373956_0020477 3300035119 Bacteria 2815
502 Ga0373956_0079606 3300035119 Bacteria 1502
503 Ga0373957_0009828 3300035120 Bacteria 3141
504 Ga0373943_0010076 3300035170 Bacteria 4238
505 Ga0373943_0019622 3300035170 Bacteria 3110
506 Ga0373943_0023685 3300035170 Bacteria 2856
507 Ga0373946_0009651 3300035171 Bacteria 3561
508 Ga0373946_0010087 3300035171 Bacteria 3493
509 Ga0373946_0165990 3300035171 Bacteria 1039
510 Ga0373955_0000497 3300035172 Bacteria 16690
511 Ga0373955_0013295 3300035172 Bacteria 3977
512 Ga0373955_0046008 3300035172 Bacteria 2357
513 Ga0373924_0004075 3300035410 Bacteria 5080
514 Ga0373924_0014704 3300035410 Bacteria 2960
515 Ga0373931_0034070 3300035691 Bacteria 2641
516 Ga0373935_0000583 3300035692 Bacteria 19030
517 Ga0373935_0102075 3300035692 Bacteria 1892
518 Ga0373927_0000464 3300035695 Bacteria 30987
519 Ga0373927_0003335 3300035695 Bacteria 11554
520 Ga0373927_0006414 3300035695 Bacteria 8017
521 Ga0373927_0015524 3300035695 Bacteria 5031
522 Ga0373927_0022947 3300035695 Bacteria 4088
523 Ga0373927_0029862 3300035695 Bacteria 3555
524 Ga0373927_0035964 3300035695 Bacteria 3222
525 Ga0373927_0155470 3300035695 Bacteria 1497
526 Ga0373933_0000108 3300035724 Bacteria 53024
527 Ga0373933_0008543 3300035724 Bacteria 5585
528 Ga0373947_0004527 3300035725 Bacteria 8151
529 Ga0373947_0044546 3300035725 Bacteria 2653
530 Ga0373947_0046969 3300035725 Bacteria 2587
531 Ga0373947_0091578 3300035725 Bacteria 1897
532 Ga0373937_0004852 3300036401 Bacteria 11429
533 Ga0373937_0014146 3300036401 Bacteria 7038
534 Ga0373937_0027435 3300036401 Bacteria 5149
535 Ga0373937_0187904 3300036401 Bacteria 1940
536 Ga0373925_0001896 3300037068 Bacteria 17364
537 Ga0373925_0014012 3300037068 Bacteria 5803
538 Ga0373925_0029117 3300037068 Bacteria 4051
539 Ga0373925_0232117 3300037068 Bacteria 1476
540 Ga0395899_0272173 3300037312 Bacteria 1155
541 Ga0395900_0013869 3300037418 Bacteria 8223
542 Ga0395900_0042572 3300037418 Bacteria 4680
543 Ga0395900_0198942 3300037418 Bacteria 2029
544 Ga0395905_0271159 3300037471 Bacteria 1583
545 Ga0395901_0023149 3300038443 Bacteria 6369
546 Ga0436365_0058492 3300039437 Bacteria 2044
547 Ga0436365_0174179 3300039437 Bacteria 3613
548 Ga0436365_0498686 3300039437 Bacteria 17846
549 Ga0436365_0553539 3300039437 Bacteria 1206
550 Ga0436365_0685508 3300039437 Bacteria 1791
551 Ga0436365_1483980 3300039437 Bacteria 4371
552 Ga0436361_1162611 3300039447 Bacteria 5088
553 Ga0436363_0152105 3300039450 Bacteria 7630
554 Ga0436363_0665614 3300039450 Bacteria 1592
555 Ga0436362_0604315 3300039453 Bacteria 3141
556 Ga0436362_0640009 3300039453 Bacteria 7758
557 Ga0451853_0598542 3300041512 Bacteria 1417
558 Ga0466969_0016700 3300044656 Bacteria 3839
559 Ga0466972_0037585 3300044658 Bacteria 2366
560 Ga0466966_0000563 3300044684 Bacteria 23663
561 Ga0466966_0029768 3300044684 Bacteria 3550
562 Ga0466966_0057322 3300044684 Bacteria 2463
563 Ga0466966_0080631 3300044684 Bacteria 2027
564 Ga0466966_0209486 3300044684 Bacteria 1178
565 Ga0466961_0000087 3300044693 Bacteria 58547
566 Ga0466963_0004010 3300044694 Bacteria 8511
567 Ga0466963_0028391 3300044694 Bacteria 3592
568 Ga0466971_0044425 3300044719 Bacteria 1995
569 Ga0466957_0053685 3300044842 Bacteria 2458
570 Ga0466957_0094220 3300044842 Bacteria 1880
571 Ga0466959_0000716 3300045049 Bacteria 19360
572 Ga0466959_0050922 3300045049 Bacteria 3039
573 Ga0466959_0080529 3300045049 Bacteria 2347
574 Ga0466959_0122851 3300045049 Bacteria 1844
575 Ga0466967_0039316 3300045976 Bacteria 4066
576 Ga0466967_0046551 3300045976 Bacteria 3777
577 Ga0466967_0127683 3300045976 Bacteria 2357
578 Ga0466967_0389879 3300045976 Bacteria 1354
579 Ga0495617_002878 3300046452 Bacteria 6629
580 Ga0495592_0010442 3300046454 Bacteria 7003
581 Ga0495592_0017029 3300046454 Bacteria 5517
582 Ga0495592_0087540 3300046454 Bacteria 2240
583 Ga0495592_0183608 3300046454 Bacteria 1423
584 Ga0495603_0000029 3300046455 Bacteria 60872
585 Ga0495603_0004050 3300046455 Bacteria 8723
586 Ga0495603_0019984 3300046455 Bacteria 4058
587 Ga0495603_0092616 3300046455 Bacteria 1766
588 Ga0495603_0142961 3300046455 Bacteria 1391
589 Ga0495603_0231704 3300046455 Bacteria 1065
590 Ga0495629_0000029 3300046459 Bacteria 127000
591 Ga0495629_0000419 3300046459 Bacteria 35618
592 Ga0495629_0053710 3300046459 Bacteria 2818
593 Ga0495629_0066247 3300046459 Bacteria 2521
594 Ga0495638_0043887 3300046460 Bacteria 2818
595 Ga0495638_0128455 3300046460 Bacteria 1491
596 Ga0495638_0157738 3300046460 Bacteria 1311
597 Ga0495638_0184880 3300046460 Bacteria 1186
598 Ga0495641_0001748 3300046461 Bacteria 18118
599 Ga0495641_0128780 3300046461 Bacteria 1130
600 Ga0495651_0015916 3300046462 Bacteria 5824
601 Ga0495651_0032987 3300046462 Bacteria 4039
602 Ga0495653_0006942 3300046463 Bacteria 9296
603 Ga0495653_0032349 3300046463 Bacteria 4154
604 Ga0495653_0072968 3300046463 Bacteria 2562
605 Ga0495653_0126486 3300046463 Bacteria 1814
606 Ga0495580_0000321 3300046472 Bacteria 39093
607 Ga0495580_0034834 3300046472 Bacteria 3623
608 Ga0495582_0000024 3300046473 Bacteria 82444
609 Ga0495582_0012091 3300046473 Bacteria 4756
610 Ga0495605_0140247 3300046474 Bacteria 1085
611 Ga0495639_0000006 3300046475 Bacteria 100361
612 Ga0495639_0028163 3300046475 Bacteria 2489
613 Ga0495662_0000068 3300046476 Bacteria 36559
614 Ga0495664_0003213 3300046477 Bacteria 8868
615 Ga0495664_0003926 3300046477 Bacteria 8113
616 Ga0495664_0017604 3300046477 Bacteria 4087
617 Ga0495585_0072552 3300046492 Bacteria 1875
618 Ga0495585_0087703 3300046492 Bacteria 1679
619 Ga0495594_0000806 3300046499 Bacteria 16204
620 Ga0495607_0101410 3300046501 Bacteria 1541
621 Ga0495606_0098254 3300046507 Bacteria 1787
622 Ga0495608_0022618 3300046511 Bacteria 4311
623 Ga0495608_0025045 3300046511 Bacteria 4075
624 Ga0495608_0045766 3300046511 Bacteria 2914
625 Ga0495610_0017519 3300046512 Bacteria 4081
626 Ga0495610_0044990 3300046512 Bacteria 2187
627 Ga0495610_0139623 3300046512 Bacteria 1044
628 Ga0495616_0011962 3300046513 Bacteria 4941
629 Ga0495618_0009920 3300046514 Bacteria 5762
630 Ga0495618_0032596 3300046514 Bacteria 3263
631 Ga0495618_0042853 3300046514 Bacteria 2854
632 Ga0495628_0004480 3300046516 Bacteria 12377
633 Ga0495628_0039169 3300046516 Bacteria 3791
634 Ga0495628_0086452 3300046516 Bacteria 2431
635 Ga0495628_0230245 3300046516 Bacteria 1389
636 Ga0495630_0000497 3300046517 Bacteria 29123
637 Ga0495630_0049525 3300046517 Bacteria 3144
638 Ga0495630_0067113 3300046517 Bacteria 2696
639 Ga0495630_0085892 3300046517 Bacteria 2376
640 Ga0495630_0213722 3300046517 Bacteria 1472
641 Ga0495632_0103314 3300046519 Bacteria 1342
642 Ga0495643_0025483 3300046522 Bacteria 3345
643 Ga0495644_0030105 3300046523 Bacteria 2050
644 Ga0495648_0005939 3300046524 Bacteria 10048
645 Ga0495648_0008777 3300046524 Bacteria 7910
646 Ga0495648_0116607 3300046524 Bacteria 1443
647 Ga0495666_0024658 3300046526 Bacteria 2971
648 Ga0495666_0102467 3300046526 Bacteria 1348
649 Ga0495652_0014184 3300046529 Bacteria 7158
650 Ga0495652_0022028 3300046529 Bacteria 5659
651 Ga0495652_0104584 3300046529 Bacteria 2289
652 Ga0495654_0014286 3300046530 Bacteria 4229
653 Ga0495665_0000158 3300046531 Bacteria 33789
654 Ga0495665_0056887 3300046531 Bacteria 2064
655 Ga0495640_0007422 3300046533 Bacteria 8623
656 Ga0495640_0009201 3300046533 Bacteria 7708
657 Ga0495640_0034183 3300046533 Bacteria 3608
658 Ga0495640_0047483 3300046533 Bacteria 2971
659 Ga0495640_0170126 3300046533 Bacteria 1392
660 Ga0495586_0282853 3300046535 Bacteria 949
661 Ga0495587_0014907 3300046536 Bacteria 4861
662 Ga0495587_0025421 3300046536 Bacteria 3618
663 Ga0495609_0075412 3300046538 Bacteria 1478
664 Ga0495597_0030621 3300046542 Bacteria 2452
665 Ga0495645_0038952 3300046543 Bacteria 3467
666 Ga0495645_0074772 3300046543 Bacteria 2439
667 Ga0495645_0095874 3300046543 Bacteria 2114
668 Ga0495645_0208920 3300046543 Bacteria 1319
669 Ga0495622_0001732 3300046557 Bacteria 10795
670 Ga0495622_0006022 3300046557 Bacteria 5635
671 Ga0495622_0017869 3300046557 Bacteria 3303
672 Ga0495622_0037526 3300046557 Bacteria 2257
673 Ga0495667_0002287 3300046559 Bacteria 12842
674 Ga0495667_0025100 3300046559 Bacteria 4018
675 Ga0495667_0030068 3300046559 Bacteria 3652
676 Ga0495656_0025807 3300046615 Bacteria 2333
677 Ga0495656_0039831 3300046615 Bacteria 1955
678 Ga0495668_0115320 3300046616 Bacteria 1469
679 Ga0495668_0227418 3300046616 Bacteria 1021
680 Ga0495634_0000354 3300046642 Bacteria 44714
681 Ga0495634_0007448 3300046642 Bacteria 8222
682 Ga0495634_0074062 3300046642 Bacteria 2238
683 Ga0495634_0123288 3300046642 Bacteria 1658
684 Ga0495611_0116942 3300046648 Bacteria 1243
685 Ga0495625_0126175 3300046660 Bacteria 1737
686 Ga0495635_0000179 3300046663 Bacteria 40014
687 Ga0495635_0005499 3300046663 Bacteria 8810
688 Ga0495635_0019804 3300046663 Bacteria 4688
689 Ga0495635_0024056 3300046663 Bacteria 4246
690 Ga0495635_0030019 3300046663 Bacteria 3779
691 Ga0495635_0137317 3300046663 Bacteria 1666
692 Ga0495659_0008329 3300046664 Bacteria 3300
693 Ga0495588_0016066 3300046674 Bacteria 3612
694 Ga0495588_0071654 3300046674 Bacteria 1802
695 Ga0495588_0116537 3300046674 Bacteria 1408
696 Ga0495657_0001266 3300046675 Bacteria 21999
697 Ga0495657_0014769 3300046675 Bacteria 5730
698 Ga0495657_0056764 3300046675 Bacteria 2606
699 Ga0495599_0000703 3300046678 Bacteria 18899
700 Ga0495599_0019821 3300046678 Bacteria 4189
701 Ga0495599_0076447 3300046678 Bacteria 2091
702 Ga0495623_0001494 3300046679 Bacteria 15865
703 Ga0495623_0057795 3300046679 Bacteria 2439
704 Ga0495646_0020437 3300046680 Bacteria 4190
705 Ga0495646_0025607 3300046680 Bacteria 3711
706 Ga0495647_0052186 3300046681 Bacteria 1591
707 Ga0495647_0074995 3300046681 Bacteria 1361
708 Ga0495658_0000736 3300046683 Bacteria 17637
709 Ga0495658_0092649 3300046683 Bacteria 1792
710 Ga0495669_0006708 3300046684 Bacteria 4818
711 Ga0495669_0099561 3300046684 Bacteria 1349
712 Ga0495613_0009354 3300046689 Bacteria 7270
713 Ga0495613_0040515 3300046689 Bacteria 3451
714 Ga0495613_0047124 3300046689 Bacteria 3184
715 Ga0495613_0106414 3300046689 Bacteria 2024
716 Ga0495613_0182529 3300046689 Bacteria 1486
717 Ga0495624_0000698 3300046690 Bacteria 26344
718 Ga0495624_0056795 3300046690 Bacteria 2462
719 Ga0495624_0145449 3300046690 Bacteria 1451
720 Ga0495670_0006475 3300046691 Bacteria 5754
721 Ga0495670_0037201 3300046691 Bacteria 2426
722 Ga0495589_0046416 3300046794 Bacteria 2156
723 Ga0495600_0020632 3300046809 Bacteria 4213
724 Ga0495600_0035688 3300046809 Bacteria 3231
725 Ga0495600_0081579 3300046809 Bacteria 2111
726 Ga0495600_0133412 3300046809 Bacteria 1613
727 Ga0495660_0135185 3300046810 Bacteria 1233
728 Ga0495581_0000004 3300047315 Bacteria 84424
729 Ga0495581_0018159 3300047315 Bacteria 4086
730 Ga0495581_0136859 3300047315 Bacteria 1428
731 Ga0495604_0000470 3300047317 Bacteria 35601
732 Ga0495604_0018741 3300047317 Bacteria 5540
733 Ga0495604_0075744 3300047317 Bacteria 2532
734 Ga0495604_0099527 3300047317 Bacteria 2139
735 Ga0495604_0102836 3300047317 Bacteria 2097
736 Ga0495674_0005737 3300047319 Bacteria 11900
737 Ga0495674_0037584 3300047319 Bacteria 4351
738 Ga0495674_0070045 3300047319 Bacteria 3031
739 Ga0495672_0006040 3300047320 Bacteria 9462
740 Ga0495676_0039914 3300047321 Bacteria 3881
741 Ga0495676_0128364 3300047321 Bacteria 1834
742 Ga0495680_0000546 3300047322 Bacteria 42342
743 Ga0495680_0096376 3300047322 Bacteria 2209
744 Ga0495687_015633 3300047443 Bacteria 3852
745 Ga0495675_0015041 3300047444 Bacteria 4893
746 Ga0495675_0124852 3300047444 Bacteria 1602
747 Ga0495677_0036264 3300047445 Bacteria 1801
748 Ga0495673_0049113 3300047469 Bacteria 1858
749 Ga0495673_0114797 3300047469 Bacteria 1073
750 Ga0495684_0000032 3300047471 Bacteria 113195
751 Ga0495684_0035426 3300047471 Bacteria 3828
752 Ga0495684_0049744 3300047471 Bacteria 3202
753 Ga0495684_0217174 3300047471 Bacteria 1403
754 Ga0495686_0038985 3300047472 Bacteria 3037
755 Ga0495686_0147616 3300047472 Bacteria 1383
756 Ga0495593_0000278 3300047673 Bacteria 27906
757 Ga0495593_0002026 3300047673 Bacteria 12083
758 Ga0495593_0029272 3300047673 Bacteria 3021
759 Ga0495593_0045073 3300047673 Bacteria 2355
760 Ga0495602_0006281 3300048088 Bacteria 12466
761 Ga0495602_0053243 3300048088 Bacteria 3586
762 Ga0495602_0151958 3300048088 Bacteria 1818
763 Ga0495615_0015597 3300048090 Bacteria 1626
764 Ga0496100_0014565 3300048903 Bacteria 4569
765 Ga0496100_0029356 3300048903 Bacteria 3401
766 Ga0496100_0029494 3300048903 Bacteria 3394
767 Ga0496100_0050828 3300048903 Bacteria 2688
768 Ga0496100_0053911 3300048903 Bacteria 2621
769 Ga0496100_0241713 3300048903 Bacteria 1332
770 Ga0496101_0005277 3300048904 Bacteria 8228
771 Ga0496101_0107419 3300048904 Bacteria 2097
772 Ga0496101_0117427 3300048904 Bacteria 2008
773 Ga0496101_0211771 3300048904 Bacteria 1501
774 Ga0496102_0007529 3300048905 Bacteria 9308
775 Ga0496102_0013319 3300048905 Bacteria 7123
776 Ga0496102_0034440 3300048905 Bacteria 4554
777 Ga0496102_0045498 3300048905 Bacteria 3985
778 Ga0496102_0059994 3300048905 Bacteria 3480
779 Ga0496102_0115276 3300048905 Bacteria 2507
780 Ga0496102_0496680 3300048905 Bacteria 1142
781 Ga0496103_0001777 3300048906 Bacteria 14064
782 Ga0496103_0011075 3300048906 Bacteria 5341
783 Ga0496103_0057649 3300048906 Bacteria 2412
784 Ga0496103_0127160 3300048906 Bacteria 1626
785 Ga0496103_0144937 3300048906 Bacteria 1520
786 Ga0496104_0000044 3300048907 Bacteria 153699
787 Ga0496104_0013573 3300048907 Bacteria 7342
788 Ga0496104_0049572 3300048907 Bacteria 3959
789 Ga0496104_0119084 3300048907 Bacteria 2535
790 Ga0496104_0157748 3300048907 Bacteria 2177
791 Ga0496104_0227000 3300048907 Bacteria 1779
792 Ga0496104_0422170 3300048907 Bacteria 1246
793 Ga0496104_0444489 3300048907 Bacteria 1208
794 Ga0496105_0000017 3300048908 Bacteria 210323
795 Ga0496105_0001074 3300048908 Bacteria 18936
796 Ga0496105_0005035 3300048908 Bacteria 10006
797 Ga0496105_0047822 3300048908 Bacteria 3530
798 Ga0496105_0082882 3300048908 Bacteria 2649
799 Ga0496105_0090637 3300048908 Bacteria 2525
800 Ga0496105_0092553 3300048908 Bacteria 2496
801 Ga0496105_0141294 3300048908 Bacteria 1982
802 Ga0496105_0268776 3300048908 Bacteria 1377
803 Ga0496106_0001945 3300048909 Bacteria 15500
804 Ga0496106_0003717 3300048909 Bacteria 11385
805 Ga0496106_0084039 3300048909 Bacteria 2449
806 Ga0496106_0090019 3300048909 Bacteria 2367
807 Ga0496106_0156931 3300048909 Bacteria 1797
808 Ga0496106_0240683 3300048909 Bacteria 1446
809 Ga0496106_0285199 3300048909 Bacteria 1323
810 Ga0496107_0014874 3300048910 Bacteria 5449
811 Ga0496107_0019218 3300048910 Bacteria 4821
812 Ga0496107_0024078 3300048910 Bacteria 4305
813 Ga0496107_0097593 3300048910 Bacteria 2151
814 Ga0496107_0209328 3300048910 Bacteria 1450
815 Ga0496108_0003699 3300048911 Bacteria 12269
816 Ga0496108_0004933 3300048911 Bacteria 10778
817 Ga0496108_0016433 3300048911 Bacteria 6036
818 Ga0496108_0058750 3300048911 Bacteria 3233
819 Ga0496108_0072233 3300048911 Bacteria 2912
820 Ga0496108_0100177 3300048911 Bacteria 2471
821 Ga0496108_0341489 3300048911 Bacteria 1306
822 Ga0496109_0000609 3300048912 Bacteria 29900
823 Ga0496109_0010467 3300048912 Bacteria 7924
824 Ga0496109_0054587 3300048912 Bacteria 3645
825 Ga0496109_0105472 3300048912 Bacteria 2617
826 Ga0496109_0145972 3300048912 Bacteria 2213
827 Ga0496109_0209210 3300048912 Bacteria 1834
828 Ga0496110_0010579 3300048913 Bacteria 7511
829 Ga0496110_0012558 3300048913 Bacteria 6967
830 Ga0496110_0109014 3300048913 Bacteria 2486
831 Ga0496110_0110671 3300048913 Bacteria 2468
832 Ga0496110_0161957 3300048913 Bacteria 2028
833 Ga0496111_0017716 3300048914 Bacteria 4926
834 Ga0496112_0000079 3300048915 Bacteria 64101
835 Ga0496112_0006493 3300048915 Bacteria 10277
836 Ga0496112_0013257 3300048915 Bacteria 7608
837 Ga0496112_0025627 3300048915 Bacteria 5664
838 Ga0496112_0071027 3300048915 Bacteria 3441
839 Ga0496112_0101522 3300048915 Bacteria 2846
840 Ga0496112_0221797 3300048915 Bacteria 1846
841 Ga0496112_0224503 3300048915 Bacteria 1834
842 Ga0496112_0236460 3300048915 Bacteria 1780
843 Ga0496112_0343625 3300048915 Bacteria 1435
844 Ga0496113_0003535 3300048916 Bacteria 9377
845 Ga0496113_0011006 3300048916 Bacteria 6012
846 Ga0496113_0013879 3300048916 Bacteria 5476
847 Ga0496113_0023194 3300048916 Bacteria 4400
848 Ga0496113_0031129 3300048916 Bacteria 3869
849 Ga0496113_0066218 3300048916 Bacteria 2735
850 Ga0496113_0141618 3300048916 Bacteria 1892
851 Ga0496114_0062945 3300048917 Bacteria 3106
852 Ga0496114_0089987 3300048917 Bacteria 2605
853 Ga0496114_0167307 3300048917 Bacteria 1915
854 Ga0496114_0168238 3300048917 Bacteria 1909
855 Ga0496114_0333080 3300048917 Bacteria 1342
856 Ga0496115_0022958 3300048918 Bacteria 4838
857 Ga0496115_0025598 3300048918 Bacteria 4596
858 Ga0496115_0028712 3300048918 Bacteria 4362
859 Ga0496115_0049167 3300048918 Bacteria 3374
860 Ga0496115_0054956 3300048918 Bacteria 3198
861 Ga0496115_0072104 3300048918 Bacteria 2802
862 Ga0496115_0109044 3300048918 Bacteria 2273
863 Ga0496115_0114315 3300048918 Bacteria 2218
864 Ga0496115_0114580 3300048918 Bacteria 2216
865 Ga0496115_0143379 3300048918 Bacteria 1971
866 Ga0496115_0225955 3300048918 Bacteria 1544
867 Ga0496116_0045530 3300048919 Bacteria 2969
868 Ga0496117_0076422 3300048920 Bacteria 2220
869 Ga0496118_0003943 3300048921 Bacteria 18147
870 Ga0496118_0031182 3300048921 Bacteria 4427
871 Ga0496118_0078330 3300048921 Bacteria 2339
872 Ga0496118_0086417 3300048921 Bacteria 2179
873 Ga0496118_0127630 3300048921 Bacteria 1641
874 Ga0496119_0000308 3300048922 Bacteria 68303
875 Ga0496119_0004369 3300048922 Bacteria 14109
876 Ga0496119_0021850 3300048922 Bacteria 4606
877 Ga0496119_0052425 3300048922 Bacteria 2498
878 Ga0496119_0065309 3300048922 Bacteria 2156
879 Ga0496119_0103201 3300048922 Bacteria 1597
880 Ga0496119_0117195 3300048922 Bacteria 1469
881 Ga0496120_0011626 3300048923 Bacteria 6040
882 Ga0496120_0027326 3300048923 Bacteria 3512
883 Ga0496120_0039904 3300048923 Bacteria 2765
884 Ga0496121_0001623 3300048924 Bacteria 37277
885 Ga0496121_0003178 3300048924 Bacteria 23674
886 Ga0496121_0005022 3300048924 Bacteria 17298
887 Ga0496121_0029702 3300048924 Bacteria 5043
888 Ga0496121_0037412 3300048924 Bacteria 4311
889 Ga0496121_0081787 3300048924 Bacteria 2555
890 Ga0496121_0113996 3300048924 Bacteria 2055
891 Ga0496121_0191201 3300048924 Bacteria 1467
892 Ga0496123_0000663 3300048926 Bacteria 56880
893 Ga0496124_0002348 3300048927 Bacteria 24978
894 Ga0496124_0044249 3300048927 Bacteria 3821
895 Ga0496124_0236163 3300048927 Bacteria 1363
896 Ga0496125_0000158 3300048928 Bacteria 151273
897 Ga0496125_0001404 3300048928 Bacteria 35155
898 Ga0496125_0028745 3300048928 Bacteria 5012
899 Ga0496125_0032273 3300048928 Bacteria 4653
900 Ga0496125_0041231 3300048928 Bacteria 3950
901 Ga0496125_0062583 3300048928 Bacteria 2974
902 Ga0496125_0069666 3300048928 Bacteria 2758
903 Ga0496125_0179748 3300048928 Bacteria 1411
904 Ga0496126_0004256 3300048929 Bacteria 17223
905 Ga0496126_0008099 3300048929 Bacteria 11382
906 Ga0496126_0010132 3300048929 Bacteria 9927
907 Ga0496126_0013275 3300048929 Bacteria 8394
908 Ga0496126_0017275 3300048929 Bacteria 7189
909 Ga0496126_0022316 3300048929 Bacteria 6162
910 Ga0496126_0027029 3300048929 Bacteria 5491
911 Ga0496126_0053217 3300048929 Bacteria 3674
912 Ga0496126_0067179 3300048929 Bacteria 3204
913 Ga0496126_0125274 3300048929 Bacteria 2224
914 Ga0496126_0165516 3300048929 Bacteria 1887
915 Ga0496126_0208924 3300048929 Bacteria 1644
916 Ga0501032_0002419 3300049569 Bacteria 14568
917 Ga0501033_0182710 3300049570 Bacteria 1503
918 Ga0501038_0000519 3300049574 Bacteria 33842
919 Ga0501039_0017792 3300049575 Bacteria 5452
920 Ga0501041_0223876 3300049577 Bacteria 1181
921 Ga0501043_0012980 3300049579 Bacteria 6511
922 Ga0501046_0032898 3300049580 Bacteria 4196
923 Ga0501047_0022591 3300049581 Bacteria 6040
924 Ga0501047_0486124 3300049581 Bacteria 1062
925 Ga0501070_0152952 3300049586 Bacteria 1903
926 Ga0501074_0033966 3300049590 Bacteria 3698
927 Ga0501076_0031503 3300049592 Bacteria 4136
928 Ga0501080_0064261 3300049742 Bacteria 3414
929 Ga0501035_0172446 3300049822 Bacteria 1868
930 Ga0501044_0047933 3300049823 Bacteria 4418
931 Ga0501044_0057044 3300049823 Bacteria 4008
932 nmdc:mga03683_100025_c1 3300050489 Bacteria 1273
933 nmdc:mga03n38_5033_c1 3300050490 Bacteria 4455
934 nmdc:mga00v17_138411_c1 3300050491 Bacteria 1560
935 nmdc:mga00v17_222933_c1 3300050491 Bacteria 1221
936 nmdc:mga00v17_275578_c1 3300050491 Bacteria 1092
937 nmdc:mga00v17_58356_c1 3300050491 Bacteria 2364
938 nmdc:mga0yw44_135815_c1 3300050492 Bacteria 1596
939 nmdc:mga0yw44_138845_c1 3300050492 Bacteria 1578
940 nmdc:mga0yw44_71325_c1 3300050492 Bacteria 2156
941 nmdc:mga0k408_96676_c1 3300050493 Bacteria 1739
942 nmdc:mga07m45_5079_c1 3300050496 Bacteria 6511
943 nmdc:mga05p37_405022_c1 3300050507 Bacteria 1592
944 nmdc:mga08y16_406229_c1 3300050511 Bacteria 1393
945 nmdc:mga0n895_118051_c1 3300050512 Bacteria 2672
946 nmdc:mga0n895_15102_c1 3300050512 Bacteria 7036
947 nmdc:mga0n895_75921_c1 3300050512 Bacteria 3342
948 nmdc:mga0a205_526376_c1 3300050515 Bacteria 1038
949 nmdc:mga0sz30_122328_c1 3300050516 Bacteria 1144
950 nmdc:mga0sz30_82662_c1 3300050516 Bacteria 1391
951 Ga0495601_0075792 3300053077 Bacteria 2153
952 Ga0495601_0163484 3300053077 Bacteria 1455
953 Ga0495612_0092336 3300053078 Bacteria 1283
954 Ga0495595_0000660 3300053084 Bacteria 13133
955 Ga0495595_0037409 3300053084 Bacteria 2206
956 Ga0495595_0088697 3300053084 Bacteria 1482
957 Ga0495619_0004289 3300053085 Bacteria 9089
958 Ga0495619_0092103 3300053085 Bacteria 2053
959 Ga0495619_0108248 3300053085 Bacteria 1897
960 Ga0500643_000048 3300053087 Bacteria 147879
961 Ga0500643_013788 3300053087 Bacteria 2837
962 Ga0500643_027307 3300053087 Bacteria 1775
963 Ga0500581_065905 3300053089 Bacteria 1828
964 Ga0500647_0083144 3300053091 Bacteria 1535
965 Ga0500583_0125955 3300053092 Bacteria 1269
966 Ga0500651_0115649 3300053093 Bacteria 1633
967 Ga0500566_0000126 3300053094 Bacteria 39286
968 Ga0500566_0016744 3300053094 Bacteria 4303
969 Ga0500566_0059192 3300053094 Bacteria 2173
970 Ga0500640_000682 3300053095 Bacteria 9002
971 Ga0500641_0026941 3300053096 Bacteria 2236
972 Ga0500650_0114635 3300053098 Bacteria 1258
973 Ga0500554_001101 3300053102 Bacteria 5241
974 Ga0500555_008526 3300053103 Bacteria 2924
975 Ga0500556_0000029 3300053104 Bacteria 165326
976 Ga0500556_0000113 3300053104 Bacteria 70501
977 Ga0500557_000097 3300053105 Bacteria 28812
978 Ga0500562_033317 3300053108 Bacteria 1361
979 Ga0500572_000110 3300053111 Bacteria 27192
980 Ga0500572_000976 3300053111 Bacteria 8666
981 Ga0500572_042610 3300053111 Bacteria 1323
982 Ga0500594_0002516 3300053118 Bacteria 3985
983 Ga0500595_000813 3300053119 Bacteria 18027
984 Ga0500595_005181 3300053119 Bacteria 5718
985 Ga0500595_021173 3300053119 Bacteria 2325
986 Ga0500595_054028 3300053119 Bacteria 1234
987 Ga0500608_010946 3300053122 Bacteria 3917
988 Ga0500614_000373 3300053123 Bacteria 11676
989 Ga0500642_0000020 3300053130 Bacteria 159498
990 Ga0500642_0000100 3300053130 Bacteria 41454
991 Ga0500642_0061546 3300053130 Bacteria 1687
992 Ga0500652_000903 3300053131 Bacteria 9783
993 Ga0500559_0000230 3300053136 Bacteria 44504
994 Ga0500559_0002208 3300053136 Bacteria 10284
995 Ga0500559_0015782 3300053136 Bacteria 3190
996 Ga0500559_0019948 3300053136 Bacteria 2833
997 Ga0500568_0016791 3300053139 Bacteria 3244
998 Ga0500568_0022002 3300053139 Bacteria 2735
999 Ga0500573_0018252 3300053140 Bacteria 3997
1000 Ga0500590_043159 3300053148 Bacteria 2314
1001 Ga0500590_088974 3300053148 Bacteria 1503
1002 Ga0500603_001499 3300053150 Bacteria 5325
1003 Ga0500603_003864 3300053150 Bacteria 3205
1004 Ga0500604_0002146 3300053151 Bacteria 5425
1005 Ga0500604_0016932 3300053151 Bacteria 2011
1006 Ga0500616_0000112 3300053153 Bacteria 151210
1007 Ga0500622_0000717 3300053156 Bacteria 28993
1008 Ga0500633_0008264 3300053160 Bacteria 2673
1009 Ga0500634_0020923 3300053161 Bacteria 3542
1010 Ga0500638_004443 3300053162 Bacteria 5402
1011 Ga0500638_018163 3300053162 Bacteria 3278
1012 Ga0500638_042664 3300053162 Bacteria 2203
1013 Ga0500638_079155 3300053162 Bacteria 1563
1014 Ga0500639_000039 3300053163 Bacteria 65182
1015 Ga0500639_003558 3300053163 Bacteria 7864
1016 Ga0500636_0000016 3300053177 Bacteria 123469
1017 Ga0500636_0019099 3300053177 Bacteria 4056
1018 Ga0500637_0000336 3300053178 Bacteria 17738
1019 Ga0500637_0020933 3300053178 Bacteria 3548
1020 Ga0500637_0032525 3300053178 Bacteria 2908
1021 Ga0500645_007056 3300053730 Bacteria 3946
1022 Ga0500552_002242 3300053733 Bacteria 1872
1023 Ga0500596_001190 3300053735 Bacteria 5254
1024 Ga0500596_002651 3300053735 Bacteria 3509
1025 Ga0500601_000237 3300053737 Bacteria 10803

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100060470 Ga0070664_1000604703 296
2 3300037312 Ga0395899_0272173 Ga0395899_0272173_250_1140 296
3 3300046512 Ga0495610_0139623 Ga0495610_0139623_144_1034 296
4 3300046535 Ga0495586_0282853 Ga0495586_0282853_38_928 296
5 3300048911 Ga0496108_0341489 Ga0496108_0341489_39_929 296
6 3300048921 Ga0496118_0086417 Ga0496118_0086417_1139_2029 296
7 3300050516 nmdc:mga0sz30_122328_c1 nmdc:mga0sz30_122328_c1_26_916 296
8 3300025272 Ga0209455_1001457 Ga0209455_10014576 299
9 3300037418 Ga0395900_0042572 Ga0395900_0042572_1577_2548 299
10 3300033180 Ga0307510_10004729 Ga0307510_1000472913 300
11 3300047472 Ga0495686_0147616 Ga0495686_0147616_69_1040 300
12 3300049822 Ga0501035_0172446 Ga0501035_0172446_655_1632 304
13 iso_pu_bacteria 2791355196 2793061618 306
14 3300007788 Ga0099795_10068911 Ga0099795_100689112 312
15 3300028558 Ga0265326_10016053 Ga0265326_100160532 312
16 3300006871 Ga0075434_100017125 Ga0075434_1000171252 313
17 3300050512 nmdc:mga0n895_15102_c1 nmdc:mga0n895_15102_c1_1145_2116 313
18 iso_pu_bacteria 2881665667 2881672335 313
19 3300031239 Ga0265328_10000281 Ga0265328_100002814 314
20 3300031250 Ga0265331_10002562 Ga0265331_100025624 314
21 3300031251 Ga0265327_10084304 Ga0265327_100843042 314
22 3300031344 Ga0265316_10005062 Ga0265316_1000506210 314
23 3300031711 Ga0265314_10041855 Ga0265314_100418552 317
24 3300028379 Ga0268266_10412343 Ga0268266_104123431 318
25 3300035695 Ga0373927_0155470 Ga0373927_0155470_280_1239 318
26 3300035725 Ga0373947_0046969 Ga0373947_0046969_424_1383 318
27 3300046472 Ga0495580_0034834 Ga0495580_0034834_2112_3071 318
28 3300046517 Ga0495630_0213722 Ga0495630_0213722_113_1072 318
29 3300048922 Ga0496119_0000308 Ga0496119_0000308_368_1324 318
30 3300048926 Ga0496123_0000663 Ga0496123_0000663_22087_23043 318
31 3300053104 Ga0500556_0000113 Ga0500556_0000113_13998_14954 318
32 iso_pu_bacteria 2643221651 2644291676 318
33 iso_pu_bacteria 2507262055 2507505849 319
34 iso_pu_bacteria 2508501009 2508540040 319
35 iso_pu_bacteria 2508501042 2508696115 319
36 iso_pu_bacteria 2508501128 2509151588 319
37 iso_pu_bacteria 2511231028 2511397181 319
38 iso_pu_bacteria 2513237092 2513626462 319
39 iso_pu_bacteria 2513237094 2513638848 319
40 iso_pu_bacteria 2513237095 2513649815 319
41 iso_pu_bacteria 2513237096 2513659825 319
42 iso_pu_bacteria 2513237098 2513679780 319
43 iso_pu_bacteria 2513237102 2513704303 319
44 iso_pu_bacteria 2513237104 2513715442 319
45 iso_pu_bacteria 2513237137 2513857286 319
46 iso_pu_bacteria 2513237139 2513875430 319
47 iso_pu_bacteria 2513237141 2513891678 319
48 iso_pu_bacteria 2513237145 2513918901 319
49 iso_pu_bacteria 2513237161 2514011192 319
50 iso_pu_bacteria 2515154112 2515630802 319
51 iso_pu_bacteria 2517093001 2517105740 319
52 iso_pu_bacteria 2517572143 2517888228 319
53 iso_pu_bacteria 2524023205 2524435468 319
54 iso_pu_bacteria 2524023210 2524468675 319
55 iso_pu_bacteria 2524023228 2524533406 319
56 iso_pu_bacteria 2528768022 2528851805 319
57 iso_pu_bacteria 2602042107 2603857281 319
58 iso_pu_bacteria 2617270735 2617347733 319
59 iso_pu_bacteria 2667528175 2671119316 319
60 iso_pu_bacteria 2721755755 2723842225 319
61 iso_pu_bacteria 2728368998 2728753885 319
62 iso_pu_bacteria 2744054633 2745081368 319
63 iso_pu_bacteria 2791355197 2793073929 319
64 iso_pu_bacteria 2791355199 2793078008 319
65 iso_pu_bacteria 2802429603 2805921655 319
66 iso_pu_bacteria 2816332527 2818240815 319
67 iso_pu_bacteria 2824617872 2824619403 319
68 iso_pu_bacteria 2824626560 2824627858 319
69 iso_pu_bacteria 2824635225 2824640323 319
70 iso_pu_bacteria 2824644064 2824647194 319
71 iso_pu_bacteria 2824661429 2824663659 319
72 iso_pu_bacteria 2824671348 2824674970 319
73 iso_pu_bacteria 2824679649 2824680272 319
74 iso_pu_bacteria 2824687955 2824691390 319
75 iso_pu_bacteria 2824696289 2824701464 319
76 iso_pu_bacteria 2824714736 2824720785 319
77 iso_pu_bacteria 2824723954 2824729339 319
78 iso_pu_bacteria 2824773399 2824775793 319
79 iso_pu_bacteria 2838122688 2838125164 319
80 iso_pu_bacteria 2841941048 2841945905 319
81 iso_pu_bacteria 2841949485 2841956771 319
82 iso_pu_bacteria 2841957949 2841965254 319
83 iso_pu_bacteria 2841966195 2841973288 319
84 iso_pu_bacteria 2841974524 2841979553 319
85 iso_pu_bacteria 2841983080 2841989326 319
86 iso_pu_bacteria 2842038055 2842044317 319
87 iso_pu_bacteria 2842045827 2842051694 319
88 iso_pu_bacteria 2844315083 2844321552 319
89 iso_pu_bacteria 2847930680 2847939523 319
90 iso_pu_bacteria 2847939898 2847941330 319
91 iso_pu_bacteria 2849076700 2849082257 319
92 iso_pu_bacteria 2857524615 2857526656 319
93 iso_pu_bacteria 2874590934 2874596415 319
94 iso_pu_bacteria 2874612657 2874620175 319
95 iso_pu_bacteria 2874620515 2874622388 319
96 iso_pu_bacteria 2874645413 2874650402 319
97 iso_pu_bacteria 2876771140 2876776880 319
98 iso_pu_bacteria 2876808645 2876814015 319
99 iso_pu_bacteria 2876818435 2876824670 319
100 iso_pu_bacteria 2879074833 2879081017 319
101 iso_pu_bacteria 2879083081 2879083202 319
102 iso_pu_bacteria 2879099564 2879106538 319
103 iso_pu_bacteria 2879110137 2879112452 319
104 iso_pu_bacteria 2879127579 2879130360 319
105 iso_pu_bacteria 2879142872 2879147220 319
106 iso_pu_bacteria 2881364244 2881369671 319
107 iso_pu_bacteria 2881665667 2881670225 319
108 iso_pu_bacteria 2885366525 2885367674 319
109 iso_pu_bacteria 2885374607 2885377136 319
110 iso_pu_bacteria 2885383462 2885391260 319
111 iso_pu_bacteria 2888378607 2888378697 319
112 iso_pu_bacteria 2888388044 2888390016 319
113 iso_pu_bacteria 2889033259 2889036336 319
114 iso_pu_bacteria 2891088606 2891091662 319
115 iso_pu_bacteria 2903727486 2903727874 319
116 iso_pu_bacteria 2903748898 2903757656 319
117 iso_pu_bacteria 2903768456 2903771261 319
118 iso_pu_bacteria 2904666416 2904671605 319
119 iso_pu_bacteria 2904690495 2904692335 319
120 iso_pu_bacteria 2904699407 2904709846 319
121 iso_pu_bacteria 2906602504 2906602642 319
122 iso_pu_bacteria 2906610324 2906614414 319
123 iso_pu_bacteria 2906626472 2906631953 319
124 iso_pu_bacteria 2906635258 2906643672 319
125 iso_pu_bacteria 2906643746 2906648619 319
126 iso_pu_bacteria 2906660503 2906666653 319
127 iso_pu_bacteria 2908739725 2908746759 319
128 iso_pu_bacteria 2908756301 2908764329 319
129 iso_pu_bacteria 2919073203 2919077835 319
130 iso_pu_bacteria 2922361189 2922366780 319
131 iso_pu_bacteria 2922368715 2922377568 319
132 iso_pu_bacteria 2922386360 2922389317 319
133 iso_pu_bacteria 2922393267 2922393331 319
134 iso_pu_bacteria 2922425934 2922426244 319
135 iso_pu_bacteria 2929615660 2929622347 319
136 iso_pu_bacteria 2929624759 2929630007 319
137 iso_pu_bacteria 2932784394 2932788064 319
138 iso_pu_bacteria 2932794094 2932794957 319
139 iso_pu_bacteria 2932809354 2932813440 319
140 iso_pu_bacteria 2932818245 2932820137 319
141 iso_pu_bacteria 2932828146 2932832800 319
142 iso_pu_bacteria 2933577622 2933584039 319
143 iso_pu_bacteria 2935608549 2935613024 319
144 iso_pu_bacteria 2935616580 2935620285 319
145 iso_pu_bacteria 2935630451 2935632637 319
146 iso_pu_bacteria 2935638405 2935640610 319
147 iso_pu_bacteria 2935648319 2935649303 319
148 iso_pu_bacteria 2935656913 2935657925 319
149 iso_pu_bacteria 2935665750 2935668802 319
150 iso_pu_bacteria 2935675223 2935681471 319
151 iso_pu_bacteria 2935684952 2935687109 319
152 iso_pu_bacteria 2935694250 2935696919 319
153 iso_pu_bacteria 2935703347 2935708989 319
154 iso_pu_bacteria 2935713505 2935716797 319
155 iso_pu_bacteria 2935722832 2935723078 319
156 iso_pu_bacteria 2935732158 2935734635 319
157 iso_pu_bacteria 2935741537 2935744574 319
158 iso_pu_bacteria 2935750917 2935753075 319
159 iso_pu_bacteria 2935760218 2935766970 319
160 iso_pu_bacteria 2935769743 2935777345 319
161 iso_pu_bacteria 2935785616 2935793337 319
162 iso_pu_bacteria 2935793552 2935801370 319
163 iso_pu_bacteria 2935801545 2935804719 319
164 iso_pu_bacteria 2935810662 2935815869 319
165 iso_pu_bacteria 2935819856 2935825124 319
166 iso_pu_bacteria 2935827899 2935832116 319
167 iso_pu_bacteria 2935837841 2935841053 319
168 iso_pu_bacteria 2935847175 2935852343 319
169 iso_pu_bacteria 2935855204 2935859171 319
170 iso_pu_bacteria 2935864058 2935864355 319
171 iso_pu_bacteria 2935873716 2935875293 319
172 iso_pu_bacteria 2935908558 2935910778 319
173 iso_pu_bacteria 2935916978 2935921960 319
174 iso_pu_bacteria 2935926038 2935929903 319
175 iso_pu_bacteria 2935934488 2935937571 319
176 iso_pu_bacteria 2935942939 2935948030 319
177 iso_pu_bacteria 2935951376 2935956771 319
178 iso_pu_bacteria 2935959822 2935963961 319
179 iso_pu_bacteria 2935967501 2935970972 319
180 iso_pu_bacteria 2935975950 2935978295 319
181 iso_pu_bacteria 2935984226 2935985581 319
182 iso_pu_bacteria 2935992306 2935995732 319
183 iso_pu_bacteria 2936002035 2936005643 319
184 iso_pu_bacteria 2936011229 2936012144 319
185 iso_pu_bacteria 2936019824 2936020775 319
186 iso_pu_bacteria 2936028420 2936029437 319
187 iso_pu_bacteria 2936037263 2936041772 319
188 iso_pu_bacteria 2936046547 2936048239 319
189 iso_pu_bacteria 2936055302 2936056649 319
190 iso_pu_bacteria 2940556831 2940558988 319
191 iso_pu_bacteria 2941507105 2941508699 319
192 iso_pu_bacteria 2941515067 2941516529 319
193 iso_pu_bacteria 2941523033 2941524455 319
194 iso_pu_bacteria 2941538514 2941541684 319
195 iso_pu_bacteria 3005474847 3005475613 319
196 iso_pu_bacteria 3005483717 3005485783 319
197 iso_pu_bacteria 3005587118 3005588776 319
198 iso_pu_bacteria 3005594810 3005601914 319
199 iso_pu_bacteria 3005710791 3005717643 319
200 iso_pu_bacteria 8006926726 8006931621 319
201 iso_pu_bacteria 8006933436 8006936944 319
202 iso_pu_bacteria 8006973647 8006976909 319
203 iso_pu_bacteria 8006984368 8006987310 319
204 iso_pu_bacteria 8016511872 8016517419 319
205 iso_pu_bacteria 8016583857 8016585501 319
206 iso_pu_bacteria 8016630954 8016634970 319
207 iso_pu_bacteria 8017057580 8017059193 319
208 iso_pu_bacteria 8019555841 8019561731 319
209 iso_pu_bacteria 8019565922 8019571801 319
210 iso_pu_bacteria 8019576017 8019576440 319
211 iso_pu_bacteria 8019586578 8019594314 319
212 iso_pu_bacteria 8019597564 8019607250 319
213 iso_pu_bacteria 8019608314 8019611268 319
214 iso_pu_bacteria 8019619141 8019622046 319
215 iso_pu_bacteria 8019629233 8019631277 319
216 iso_pu_bacteria 8019638758 8019639348 319
217 iso_pu_bacteria 8019659431 8019668084 319
218 iso_pu_bacteria 8019668869 8019677497 319
219 iso_pu_bacteria 8019678201 8019687453 319
220 iso_pu_bacteria 8019687851 8019695549 319
221 iso_pu_bacteria 8055742211 8055743403 319
222 iso_pu_bacteria 8056673599 8056678230 319
223 iso_pu_bacteria 8056681323 8056683479 319
224 iso_pu_bacteria 8056967851 8056975425 319
225 3300049569 Ga0501032_0002419 Ga0501032_0002419_8040_9008 322
226 3300049570 Ga0501033_0182710 Ga0501033_0182710_101_1069 322
227 3300049574 Ga0501038_0000519 Ga0501038_0000519_29655_30623 322
228 3300049575 Ga0501039_0017792 Ga0501039_0017792_808_1776 322
229 3300049579 Ga0501043_0012980 Ga0501043_0012980_566_1534 322
230 3300049823 Ga0501044_0047933 Ga0501044_0047933_2800_3768 322
231 3300001979 JGI24740J21852_10005305 JGI24740J21852_100053052 323
232 3300001989 JGI24739J22299_10001354 JGI24739J22299_100013548 323
233 3300001990 JGI24737J22298_10006407 JGI24737J22298_100064072 323
234 3300002067 JGI24735J21928_10001477 JGI24735J21928_100014773 323
235 3300003203 JGI25406J46586_10003551 JGI25406J46586_100035512 323
236 3300003203 JGI25406J46586_10004678 JGI25406J46586_100046785 323
237 3300003203 JGI25406J46586_10005624 JGI25406J46586_100056247 323
238 3300003215 JGI25153J46596_10000683 JGI25153J46596_100006835 323
239 3300003215 JGI25153J46596_10004591 JGI25153J46596_100045916 323
240 3300003215 JGI25153J46596_10019116 JGI25153J46596_100191162 323
241 3300003215 JGI25153J46596_10040457 JGI25153J46596_100404571 323
242 3300003354 JGI25160J50197_1005256 JGI25160J50197_10052563 323
243 3300003752 Ga0055539_1004286 Ga0055539_10042861 323
244 3300003794 Ga0055531_10001777 Ga0055531_1000177712 323
245 3300003911 JGI25405J52794_10013969 JGI25405J52794_100139692 323
246 3300005262 Ga0065165_1000346 Ga0065165_100034653 323
247 3300005295 Ga0065707_10213042 Ga0065707_102130421 323
248 3300005327 Ga0070658_10060745 Ga0070658_100607452 323
249 3300005327 Ga0070658_10134611 Ga0070658_101346112 323
250 3300005327 Ga0070658_10388491 Ga0070658_103884911 323
251 3300005329 Ga0070683_100042802 Ga0070683_1000428023 323
252 3300005329 Ga0070683_100486866 Ga0070683_1004868661 323
253 3300005336 Ga0070680_100031683 Ga0070680_1000316834 323
254 3300005336 Ga0070680_100061315 Ga0070680_1000613152 323
255 3300005337 Ga0070682_100025751 Ga0070682_1000257512 323
256 3300005338 Ga0068868_100019606 Ga0068868_1000196062 323
257 3300005338 Ga0068868_100025678 Ga0068868_1000256782 323
258 3300005339 Ga0070660_100017224 Ga0070660_1000172242 323
259 3300005339 Ga0070660_100091715 Ga0070660_1000917152 323
260 3300005339 Ga0070660_100250247 Ga0070660_1002502471 323
261 3300005341 Ga0070691_10043707 Ga0070691_100437073 323
262 3300005344 Ga0070661_100124878 Ga0070661_1001248782 323
263 3300005344 Ga0070661_100194523 Ga0070661_1001945232 323
264 3300005347 Ga0070668_100027108 Ga0070668_1000271083 323
265 3300005347 Ga0070668_100107989 Ga0070668_1001079892 323
266 3300005347 Ga0070668_100118533 Ga0070668_1001185332 323
267 3300005355 Ga0070671_100016463 Ga0070671_1000164635 323
268 3300005355 Ga0070671_100114977 Ga0070671_1001149771 323
269 3300005356 Ga0070674_100039906 Ga0070674_1000399062 323
270 3300005364 Ga0070673_100118128 Ga0070673_1001181282 323
271 3300005365 Ga0070688_100036186 Ga0070688_1000361861 323
272 3300005366 Ga0070659_100290374 Ga0070659_1002903741 323
273 3300005366 Ga0070659_100328869 Ga0070659_1003288692 323
274 3300005367 Ga0070667_100127770 Ga0070667_1001277702 323
275 3300005367 Ga0070667_100141205 Ga0070667_1001412051 323
276 3300005367 Ga0070667_100468143 Ga0070667_1004681431 323
277 3300005434 Ga0070709_10003777 Ga0070709_100037772 323
278 3300005434 Ga0070709_10018724 Ga0070709_100187242 323
279 3300005435 Ga0070714_100002243 Ga0070714_1000022439 323
280 3300005435 Ga0070714_100140963 Ga0070714_1001409632 323
281 3300005435 Ga0070714_100434817 Ga0070714_1004348171 323
282 3300005436 Ga0070713_100015248 Ga0070713_1000152484 323
283 3300005436 Ga0070713_100036876 Ga0070713_1000368762 323
284 3300005436 Ga0070713_100360446 Ga0070713_1003604461 323
285 3300005437 Ga0070710_10001777 Ga0070710_1000177712 323
286 3300005437 Ga0070710_10010746 Ga0070710_100107464 323
287 3300005437 Ga0070710_10018894 Ga0070710_100188942 323
288 3300005437 Ga0070710_10020491 Ga0070710_100204912 323
289 3300005439 Ga0070711_100000925 Ga0070711_1000009253 323
290 3300005439 Ga0070711_100003897 Ga0070711_1000038978 323
291 3300005439 Ga0070711_100004173 Ga0070711_1000041735 323
292 3300005439 Ga0070711_100032022 Ga0070711_1000320222 323
293 3300005444 Ga0070694_100180322 Ga0070694_1001803222 323
294 3300005444 Ga0070694_100273431 Ga0070694_1002734312 323
295 3300005455 Ga0070663_100022852 Ga0070663_1000228521 323
296 3300005455 Ga0070663_100049790 Ga0070663_1000497902 323
297 3300005455 Ga0070663_100052579 Ga0070663_1000525792 323
298 3300005455 Ga0070663_100087817 Ga0070663_1000878172 323
299 3300005455 Ga0070663_100118555 Ga0070663_1001185551 323
300 3300005455 Ga0070663_100123980 Ga0070663_1001239802 323
301 3300005455 Ga0070663_100149569 Ga0070663_1001495691 323
302 3300005456 Ga0070678_100004019 Ga0070678_1000040196 323
303 3300005456 Ga0070678_100135891 Ga0070678_1001358912 323
304 3300005457 Ga0070662_100042188 Ga0070662_1000421882 323
305 3300005457 Ga0070662_100328464 Ga0070662_1003284641 323
306 3300005458 Ga0070681_10055590 Ga0070681_100555904 323
307 3300005458 Ga0070681_10061821 Ga0070681_100618212 323
308 3300005458 Ga0070681_10077122 Ga0070681_100771221 323
309 3300005467 Ga0070706_100139283 Ga0070706_1001392833 323
310 3300005468 Ga0070707_100105819 Ga0070707_1001058192 323
311 3300005471 Ga0070698_100032926 Ga0070698_1000329264 323
312 3300005471 Ga0070698_100077304 Ga0070698_1000773043 323
313 3300005530 Ga0070679_100012161 Ga0070679_1000121616 323
314 3300005530 Ga0070679_100033412 Ga0070679_1000334124 323
315 3300005530 Ga0070679_100067578 Ga0070679_1000675782 323
316 3300005530 Ga0070679_100163108 Ga0070679_1001631082 323
317 3300005535 Ga0070684_100005499 Ga0070684_1000054995 323
318 3300005535 Ga0070684_100015667 Ga0070684_1000156672 323
319 3300005535 Ga0070684_100187485 Ga0070684_1001874851 323
320 3300005536 Ga0070697_100088757 Ga0070697_1000887572 323
321 3300005539 Ga0068853_100005555 Ga0068853_1000055558 323
322 3300005539 Ga0068853_100029210 Ga0068853_1000292102 323
323 3300005539 Ga0068853_100045658 Ga0068853_1000456581 323
324 3300005545 Ga0070695_100276247 Ga0070695_1002762471 323
325 3300005546 Ga0070696_100295768 Ga0070696_1002957681 323
326 3300005548 Ga0070665_100051314 Ga0070665_1000513143 323
327 3300005548 Ga0070665_100074805 Ga0070665_1000748052 323
328 3300005563 Ga0068855_100177099 Ga0068855_1001770992 323
329 3300005563 Ga0068855_100186425 Ga0068855_1001864252 323
330 3300005563 Ga0068855_100223347 Ga0068855_1002233472 323
331 3300005563 Ga0068855_100290959 Ga0068855_1002909592 323
332 3300005564 Ga0070664_100123842 Ga0070664_1001238422 323
333 3300005577 Ga0068857_100003636 Ga0068857_1000036363 323
334 3300005577 Ga0068857_100033843 Ga0068857_1000338434 323
335 3300005577 Ga0068857_100129044 Ga0068857_1001290441 323
336 3300005578 Ga0068854_100001467 Ga0068854_1000014675 323
337 3300005578 Ga0068854_100052337 Ga0068854_1000523372 323
338 3300005578 Ga0068854_100264450 Ga0068854_1002644502 323
339 3300005614 Ga0068856_100001216 Ga0068856_10000121619 323
340 3300005614 Ga0068856_100005462 Ga0068856_1000054629 323
341 3300005614 Ga0068856_100064877 Ga0068856_1000648772 323
342 3300005614 Ga0068856_100196464 Ga0068856_1001964643 323
343 3300005615 Ga0070702_100058847 Ga0070702_1000588472 323
344 3300005615 Ga0070702_100073873 Ga0070702_1000738732 323
345 3300005616 Ga0068852_100079490 Ga0068852_1000794902 323
346 3300005616 Ga0068852_100093541 Ga0068852_1000935412 323
347 3300005616 Ga0068852_100120527 Ga0068852_1001205272 323
348 3300005617 Ga0068859_100067989 Ga0068859_1000679893 323
349 3300005618 Ga0068864_100064197 Ga0068864_1000641972 323
350 3300005618 Ga0068864_100160162 Ga0068864_1001601623 323
351 3300005618 Ga0068864_100231287 Ga0068864_1002312872 323
352 3300005719 Ga0068861_100024838 Ga0068861_1000248384 323
353 3300005719 Ga0068861_100072147 Ga0068861_1000721472 323
354 3300005834 Ga0068851_10081615 Ga0068851_100816152 323
355 3300005841 Ga0068863_100060745 Ga0068863_1000607452 323
356 3300005842 Ga0068858_100031611 Ga0068858_1000316112 323
357 3300005843 Ga0068860_100000313 Ga0068860_10000031320 323
358 3300005843 Ga0068860_100061820 Ga0068860_1000618202 323
359 3300005843 Ga0068860_100275665 Ga0068860_1002756652 323
360 3300005937 Ga0081455_10017005 Ga0081455_100170054 323
361 3300005937 Ga0081455_10033425 Ga0081455_100334253 323
362 3300005937 Ga0081455_10044893 Ga0081455_100448934 323
363 3300005983 Ga0081540_1001554 Ga0081540_10015549 323
364 3300005983 Ga0081540_1002392 Ga0081540_10023926 323
365 3300005983 Ga0081540_1002941 Ga0081540_10029417 323
366 3300005983 Ga0081540_1003116 Ga0081540_10031164 323
367 3300005983 Ga0081540_1007937 Ga0081540_10079372 323
368 3300005983 Ga0081540_1028608 Ga0081540_10286082 323
369 3300005983 Ga0081540_1040551 Ga0081540_10405511 323
370 3300005983 Ga0081540_1044814 Ga0081540_10448142 323
371 3300005983 Ga0081540_1054809 Ga0081540_10548091 323
372 3300005985 Ga0081539_10000157 Ga0081539_1000015792 323
373 3300005985 Ga0081539_10000269 Ga0081539_1000026917 323
374 3300005985 Ga0081539_10089794 Ga0081539_100897942 323
375 3300006028 Ga0070717_10003038 Ga0070717_1000303810 323
376 3300006028 Ga0070717_10025148 Ga0070717_100251485 323
377 3300006028 Ga0070717_10056384 Ga0070717_100563843 323
378 3300006028 Ga0070717_10289786 Ga0070717_102897862 323
379 3300006028 Ga0070717_10398573 Ga0070717_103985731 323
380 3300006038 Ga0075365_10016284 Ga0075365_100162843 323
381 3300006038 Ga0075365_10065239 Ga0075365_100652392 323
382 3300006038 Ga0075365_10092701 Ga0075365_100927011 323
383 3300006042 Ga0075368_10094488 Ga0075368_100944881 323
384 3300006048 Ga0075363_100008111 Ga0075363_1000081112 323
385 3300006048 Ga0075363_100027242 Ga0075363_1000272422 323
386 3300006163 Ga0070715_10005356 Ga0070715_100053563 323
387 3300006173 Ga0070716_100001830 Ga0070716_1000018306 323
388 3300006173 Ga0070716_100001976 Ga0070716_1000019766 323
389 3300006173 Ga0070716_100092010 Ga0070716_1000920102 323
390 3300006173 Ga0070716_100193525 Ga0070716_1001935252 323
391 3300006175 Ga0070712_100015066 Ga0070712_1000150662 323
392 3300006175 Ga0070712_100057656 Ga0070712_1000576562 323
393 3300006175 Ga0070712_100075500 Ga0070712_1000755002 323
394 3300006178 Ga0075367_10036832 Ga0075367_100368321 323
395 3300006186 Ga0075369_10110837 Ga0075369_101108372 323
396 3300006353 Ga0075370_10003655 Ga0075370_100036552 323
397 3300006353 Ga0075370_10128865 Ga0075370_101288652 323
398 3300006358 Ga0068871_100085036 Ga0068871_1000850361 323
399 3300006871 Ga0075434_100117389 Ga0075434_1001173892 323
400 3300006871 Ga0075434_100200196 Ga0075434_1002001962 323
401 3300006871 Ga0075434_100353289 Ga0075434_1003532891 323
402 3300006881 Ga0068865_100196177 Ga0068865_1001961772 323
403 3300006931 Ga0097620_100067989 Ga0097620_1000679893 323
404 3300006941 Ga0099825_1030002 Ga0099825_10300022 323
405 3300006942 Ga0099824_1003568 Ga0099824_10035685 323
406 3300006942 Ga0099824_1020150 Ga0099824_10201504 323
407 3300006943 Ga0099822_1020142 Ga0099822_10201424 323
408 3300006944 Ga0099823_1022771 Ga0099823_10227715 323
409 3300007788 Ga0099795_10015685 Ga0099795_100156852 323
410 3300007788 Ga0099795_10039119 Ga0099795_100391192 323
411 3300009092 Ga0105250_10025569 Ga0105250_100255693 323
412 3300009093 Ga0105240_10002788 Ga0105240_100027888 323
413 3300009093 Ga0105240_10036732 Ga0105240_100367325 323
414 3300009093 Ga0105240_10040279 Ga0105240_100402794 323
415 3300009093 Ga0105240_10070783 Ga0105240_100707833 323
416 3300009093 Ga0105240_10087986 Ga0105240_100879863 323
417 3300009093 Ga0105240_10140606 Ga0105240_101406063 323
418 3300009093 Ga0105240_10174617 Ga0105240_101746172 323
419 3300009094 Ga0111539_10217448 Ga0111539_102174482 323
420 3300009098 Ga0105245_10036585 Ga0105245_100365853 323
421 3300009098 Ga0105245_10446810 Ga0105245_104468101 323
422 3300009101 Ga0105247_10012446 Ga0105247_100124465 323
423 3300009101 Ga0105247_10060715 Ga0105247_100607153 323
424 3300009101 Ga0105247_10104186 Ga0105247_101041861 323
425 3300009148 Ga0105243_10267669 Ga0105243_102676692 323
426 3300009174 Ga0105241_10001292 Ga0105241_100012928 323
427 3300009174 Ga0105241_10013611 Ga0105241_100136116 323
428 3300009174 Ga0105241_10015930 Ga0105241_100159302 323
429 3300009174 Ga0105241_10026423 Ga0105241_100264233 323
430 3300009174 Ga0105241_10447899 Ga0105241_104478991 323
431 3300009176 Ga0105242_10453123 Ga0105242_104531231 323
432 3300009177 Ga0105248_10027010 Ga0105248_100270103 323
433 3300009177 Ga0105248_10084197 Ga0105248_100841972 323
434 3300009177 Ga0105248_10220761 Ga0105248_102207612 323
435 3300009545 Ga0105237_10009221 Ga0105237_100092217 323
436 3300009545 Ga0105237_10036983 Ga0105237_100369833 323
437 3300009545 Ga0105237_10046660 Ga0105237_100466606 323
438 3300009545 Ga0105237_10060489 Ga0105237_100604893 323
439 3300009545 Ga0105237_10078985 Ga0105237_100789852 323
440 3300009545 Ga0105237_10184537 Ga0105237_101845372 323
441 3300009545 Ga0105237_10223199 Ga0105237_102231992 323
442 3300009545 Ga0105237_10301554 Ga0105237_103015542 323
443 3300009551 Ga0105238_10002650 Ga0105238_100026507 323
444 3300009551 Ga0105238_10009622 Ga0105238_100096227 323
445 3300009551 Ga0105238_10107061 Ga0105238_101070612 323
446 3300009551 Ga0105238_10128992 Ga0105238_101289922 323
447 3300009551 Ga0105238_10206349 Ga0105238_102063491 323
448 3300009551 Ga0105238_10617163 Ga0105238_106171631 323
449 3300009553 Ga0105249_10062340 Ga0105249_100623401 323
450 3300010375 Ga0105239_10002167 Ga0105239_100021674 323
451 3300010375 Ga0105239_10069537 Ga0105239_100695372 323
452 3300010375 Ga0105239_10174916 Ga0105239_101749162 323
453 3300010375 Ga0105239_10213351 Ga0105239_102133512 323
454 3300010375 Ga0105239_10265546 Ga0105239_102655461 323
455 3300011119 Ga0105246_10012832 Ga0105246_100128325 323
456 3300011119 Ga0105246_10029670 Ga0105246_100296704 323
457 3300011119 Ga0105246_10085430 Ga0105246_100854302 323
458 3300011119 Ga0105246_10266420 Ga0105246_102664202 323
459 3300013104 Ga0157370_10053798 Ga0157370_100537983 323
460 3300013104 Ga0157370_10076043 Ga0157370_100760433 323
461 3300013104 Ga0157370_10168341 Ga0157370_101683412 323
462 3300013104 Ga0157370_10197802 Ga0157370_101978022 323
463 3300013105 Ga0157369_10018355 Ga0157369_100183553 323
464 3300013105 Ga0157369_10207224 Ga0157369_102072242 323
465 3300013105 Ga0157369_10309753 Ga0157369_103097531 323
466 3300013296 Ga0157374_10051253 Ga0157374_100512533 323
467 3300013297 Ga0157378_10105505 Ga0157378_101055052 323
468 3300013297 Ga0157378_10116406 Ga0157378_101164063 323
469 3300013306 Ga0163162_10024637 Ga0163162_100246374 323
470 3300013306 Ga0163162_10244216 Ga0163162_102442162 323
471 3300013306 Ga0163162_10284952 Ga0163162_102849522 323
472 3300013306 Ga0163162_10505994 Ga0163162_105059941 323
473 3300013308 Ga0157375_10074172 Ga0157375_100741722 323
474 3300013308 Ga0157375_10162998 Ga0157375_101629983 323
475 3300013308 Ga0157375_10231205 Ga0157375_102312052 323
476 3300014325 Ga0163163_10006627 Ga0163163_100066277 323
477 3300014325 Ga0163163_10042699 Ga0163163_100426992 323
478 3300014325 Ga0163163_10057594 Ga0163163_100575944 323
479 3300014325 Ga0163163_10083753 Ga0163163_100837532 323
480 3300014326 Ga0157380_10011431 Ga0157380_100114314 323
481 3300014745 Ga0157377_10012950 Ga0157377_100129502 323
482 3300014968 Ga0157379_10059456 Ga0157379_100594562 323
483 3300014968 Ga0157379_10119130 Ga0157379_101191302 323
484 3300017792 Ga0163161_10116334 Ga0163161_101163342 323
485 3300021377 Ga0213874_10011052 Ga0213874_100110522 323
486 3300021384 Ga0213876_10004666 Ga0213876_100046668 323
487 3300021384 Ga0213876_10031289 Ga0213876_100312893 323
488 3300021384 Ga0213876_10081273 Ga0213876_100812731 323
489 3300021384 Ga0213876_10098820 Ga0213876_100988201 323
490 3300025245 Ga0207425_1023647 Ga0207425_10236471 323
491 3300025253 Ga0209677_105501 Ga0209677_1055012 323
492 3300025261 Ga0209233_1002653 Ga0209233_10026536 323
493 3300025261 Ga0209233_1006085 Ga0209233_10060853 323
494 3300025295 Ga0209564_1010921 Ga0209564_10109213 323
495 3300025295 Ga0209564_1028283 Ga0209564_10282833 323
496 3300025297 Ga0209758_1000015 Ga0209758_1000015750 323
497 3300025297 Ga0209758_1000306 Ga0209758_100030678 323
498 3300025297 Ga0209758_1001762 Ga0209758_100176220 323
499 3300025297 Ga0209758_1005473 Ga0209758_10054736 323
500 3300025297 Ga0209758_1006330 Ga0209758_10063306 323
501 3300025297 Ga0209758_1014947 Ga0209758_10149474 323
502 3300025297 Ga0209758_1020436 Ga0209758_10204363 323
503 3300025299 Ga0209256_1001762 Ga0209256_10017623 323
504 3300025299 Ga0209256_1022067 Ga0209256_10220672 323
505 3300025302 Ga0207426_1001146 Ga0207426_100114612 323
506 3300025302 Ga0207426_1009602 Ga0207426_10096022 323
507 3300025302 Ga0207426_1052349 Ga0207426_10523491 323
508 3300025304 Ga0209257_1001620 Ga0209257_100162010 323
509 3300025304 Ga0209257_1010293 Ga0209257_10102932 323
510 3300025321 Ga0207656_10024518 Ga0207656_100245181 323
511 3300025321 Ga0207656_10037089 Ga0207656_100370891 323
512 3300025898 Ga0207692_10001222 Ga0207692_100012226 323
513 3300025898 Ga0207692_10001328 Ga0207692_100013282 323
514 3300025898 Ga0207692_10021787 Ga0207692_100217872 323
515 3300025900 Ga0207710_10016733 Ga0207710_100167332 323
516 3300025900 Ga0207710_10025237 Ga0207710_100252373 323
517 3300025900 Ga0207710_10152423 Ga0207710_101524231 323
518 3300025901 Ga0207688_10053788 Ga0207688_100537882 323
519 3300025903 Ga0207680_10142253 Ga0207680_101422532 323
520 3300025904 Ga0207647_10000121 Ga0207647_1000012137 323
521 3300025904 Ga0207647_10011601 Ga0207647_100116016 323
522 3300025905 Ga0207685_10005021 Ga0207685_100050213 323
523 3300025906 Ga0207699_10000616 Ga0207699_1000061614 323
524 3300025906 Ga0207699_10023472 Ga0207699_100234722 323
525 3300025906 Ga0207699_10024839 Ga0207699_100248391 323
526 3300025906 Ga0207699_10143998 Ga0207699_101439982 323
527 3300025906 Ga0207699_10267164 Ga0207699_102671642 323
528 3300025907 Ga0207645_10036827 Ga0207645_100368271 323
529 3300025909 Ga0207705_10050706 Ga0207705_100507063 323
530 3300025909 Ga0207705_10054801 Ga0207705_100548012 323
531 3300025909 Ga0207705_10088213 Ga0207705_100882132 323
532 3300025909 Ga0207705_10229709 Ga0207705_102297092 323
533 3300025909 Ga0207705_10273600 Ga0207705_102736002 323
534 3300025911 Ga0207654_10004165 Ga0207654_100041658 323
535 3300025911 Ga0207654_10070397 Ga0207654_100703971 323
536 3300025912 Ga0207707_10000143 Ga0207707_1000014358 323
537 3300025912 Ga0207707_10001842 Ga0207707_1000184217 323
538 3300025912 Ga0207707_10011276 Ga0207707_100112767 323
539 3300025912 Ga0207707_10212392 Ga0207707_102123922 323
540 3300025912 Ga0207707_10414567 Ga0207707_104145672 323
541 3300025913 Ga0207695_10000059 Ga0207695_10000059123 323
542 3300025913 Ga0207695_10001028 Ga0207695_100010281 323
543 3300025913 Ga0207695_10010833 Ga0207695_1001083314 323
544 3300025913 Ga0207695_10076241 Ga0207695_100762413 323
545 3300025913 Ga0207695_10316594 Ga0207695_103165942 323
546 3300025914 Ga0207671_10006959 Ga0207671_100069594 323
547 3300025914 Ga0207671_10103796 Ga0207671_101037962 323
548 3300025914 Ga0207671_10127285 Ga0207671_101272852 323
549 3300025914 Ga0207671_10130192 Ga0207671_101301922 323
550 3300025915 Ga0207693_10005104 Ga0207693_100051043 323
551 3300025915 Ga0207693_10039800 Ga0207693_100398004 323
552 3300025916 Ga0207663_10002795 Ga0207663_100027953 323
553 3300025916 Ga0207663_10013988 Ga0207663_100139882 323
554 3300025917 Ga0207660_10005467 Ga0207660_100054677 323
555 3300025917 Ga0207660_10026046 Ga0207660_100260464 323
556 3300025917 Ga0207660_10044519 Ga0207660_100445192 323
557 3300025919 Ga0207657_10018743 Ga0207657_100187432 323
558 3300025919 Ga0207657_10198445 Ga0207657_101984452 323
559 3300025920 Ga0207649_10084450 Ga0207649_100844502 323
560 3300025921 Ga0207652_10002421 Ga0207652_1000242113 323
561 3300025921 Ga0207652_10042999 Ga0207652_100429992 323
562 3300025921 Ga0207652_10097592 Ga0207652_100975922 323
563 3300025922 Ga0207646_10062089 Ga0207646_100620893 323
564 3300025923 Ga0207681_10107063 Ga0207681_101070632 323
565 3300025923 Ga0207681_10201884 Ga0207681_102018841 323
566 3300025924 Ga0207694_10000186 Ga0207694_1000018645 323
567 3300025924 Ga0207694_10017755 Ga0207694_100177555 323
568 3300025924 Ga0207694_10058931 Ga0207694_100589313 323
569 3300025924 Ga0207694_10095241 Ga0207694_100952413 323
570 3300025924 Ga0207694_10167381 Ga0207694_101673812 323
571 3300025926 Ga0207659_10241801 Ga0207659_102418011 323
572 3300025926 Ga0207659_10314668 Ga0207659_103146682 323
573 3300025927 Ga0207687_10082632 Ga0207687_100826322 323
574 3300025927 Ga0207687_10212858 Ga0207687_102128582 323
575 3300025927 Ga0207687_10360207 Ga0207687_103602071 323
576 3300025928 Ga0207700_10006776 Ga0207700_100067765 323
577 3300025928 Ga0207700_10041762 Ga0207700_100417624 323
578 3300025928 Ga0207700_10065823 Ga0207700_100658232 323
579 3300025928 Ga0207700_10184427 Ga0207700_101844272 323
580 3300025928 Ga0207700_10417169 Ga0207700_104171691 323
581 3300025929 Ga0207664_10085288 Ga0207664_100852882 323
582 3300025929 Ga0207664_10199475 Ga0207664_101994752 323
583 3300025931 Ga0207644_10078014 Ga0207644_100780142 323
584 3300025931 Ga0207644_10324503 Ga0207644_103245031 323
585 3300025932 Ga0207690_10350870 Ga0207690_103508701 323
586 3300025933 Ga0207706_10037004 Ga0207706_100370045 323
587 3300025933 Ga0207706_10071644 Ga0207706_100716443 323
588 3300025933 Ga0207706_10230840 Ga0207706_102308402 323
589 3300025934 Ga0207686_10203872 Ga0207686_102038722 323
590 3300025935 Ga0207709_10382163 Ga0207709_103821631 323
591 3300025937 Ga0207669_10033427 Ga0207669_100334272 323
592 3300025938 Ga0207704_10208521 Ga0207704_102085211 323
593 3300025939 Ga0207665_10000986 Ga0207665_100009867 323
594 3300025939 Ga0207665_10004249 Ga0207665_100042495 323
595 3300025939 Ga0207665_10170076 Ga0207665_101700762 323
596 3300025939 Ga0207665_10335502 Ga0207665_103355021 323
597 3300025940 Ga0207691_10089800 Ga0207691_100898003 323
598 3300025940 Ga0207691_10130785 Ga0207691_101307852 323
599 3300025941 Ga0207711_10050991 Ga0207711_100509913 323
600 3300025941 Ga0207711_10140438 Ga0207711_101404382 323
601 3300025942 Ga0207689_10031598 Ga0207689_100315983 323
602 3300025944 Ga0207661_10015591 Ga0207661_100155914 323
603 3300025944 Ga0207661_10058395 Ga0207661_100583953 323
604 3300025944 Ga0207661_10123192 Ga0207661_101231922 323
605 3300025945 Ga0207679_10081504 Ga0207679_100815042 323
606 3300025949 Ga0207667_10025336 Ga0207667_100253363 323
607 3300025949 Ga0207667_10030933 Ga0207667_100309332 323
608 3300025949 Ga0207667_10058055 Ga0207667_100580553 323
609 3300025949 Ga0207667_10215480 Ga0207667_102154802 323
610 3300025949 Ga0207667_10435085 Ga0207667_104350852 323
611 3300025961 Ga0207712_10361120 Ga0207712_103611202 323
612 3300025972 Ga0207668_10020091 Ga0207668_100200912 323
613 3300025972 Ga0207668_10049153 Ga0207668_100491533 323
614 3300025972 Ga0207668_10066907 Ga0207668_100669072 323
615 3300025972 Ga0207668_10107364 Ga0207668_101073642 323
616 3300025981 Ga0207640_10006494 Ga0207640_100064943 323
617 3300025981 Ga0207640_10016970 Ga0207640_100169702 323
618 3300025981 Ga0207640_10071674 Ga0207640_100716742 323
619 3300025986 Ga0207658_10115565 Ga0207658_101155651 323
620 3300026023 Ga0207677_10028693 Ga0207677_100286933 323
621 3300026041 Ga0207639_10218125 Ga0207639_102181252 323
622 3300026041 Ga0207639_10446504 Ga0207639_104465041 323
623 3300026067 Ga0207678_10013578 Ga0207678_100135785 323
624 3300026067 Ga0207678_10043427 Ga0207678_100434272 323
625 3300026067 Ga0207678_10049123 Ga0207678_100491232 323
626 3300026067 Ga0207678_10051858 Ga0207678_100518583 323
627 3300026067 Ga0207678_10055568 Ga0207678_100555682 323
628 3300026067 Ga0207678_10071365 Ga0207678_100713652 323
629 3300026067 Ga0207678_10079603 Ga0207678_100796032 323
630 3300026067 Ga0207678_10089104 Ga0207678_100891042 323
631 3300026078 Ga0207702_10000064 Ga0207702_10000064106 323
632 3300026078 Ga0207702_10001100 Ga0207702_1000110021 323
633 3300026078 Ga0207702_10275186 Ga0207702_102751861 323
634 3300026078 Ga0207702_10646922 Ga0207702_106469221 323
635 3300026088 Ga0207641_10050308 Ga0207641_100503083 323
636 3300026095 Ga0207676_10020142 Ga0207676_100201423 323
637 3300026095 Ga0207676_10383390 Ga0207676_103833901 323
638 3300026116 Ga0207674_10000946 Ga0207674_1000094611 323
639 3300026116 Ga0207674_10003365 Ga0207674_100033656 323
640 3300026116 Ga0207674_10030029 Ga0207674_100300293 323
641 3300026118 Ga0207675_100126901 Ga0207675_1001269012 323
642 3300026118 Ga0207675_100144614 Ga0207675_1001446142 323
643 3300026118 Ga0207675_100445446 Ga0207675_1004454462 323
644 3300026121 Ga0207683_10009120 Ga0207683_100091206 323
645 3300026121 Ga0207683_10026713 Ga0207683_100267132 323
646 3300026142 Ga0207698_10078750 Ga0207698_100787502 323
647 3300026142 Ga0207698_10384535 Ga0207698_103845352 323
648 3300026142 Ga0207698_10391533 Ga0207698_103915332 323
649 3300026142 Ga0207698_10426378 Ga0207698_104263781 323
650 3300027296 Ga0209389_1000012 Ga0209389_1000012105 323
651 3300027296 Ga0209389_1000052 Ga0209389_100005213 323
652 3300027357 Ga0209589_1000015 Ga0209589_1000015103 323
653 3300027357 Ga0209589_1000058 Ga0209589_100005813 323
654 3300027361 Ga0209489_100015 Ga0209489_100015103 323
655 3300027361 Ga0209489_100019 Ga0209489_100019105 323
656 3300027361 Ga0209489_100020 Ga0209489_10002090 323
657 3300027363 Ga0209700_100018 Ga0209700_100018125 323
658 3300027363 Ga0209700_100025 Ga0209700_100025103 323
659 3300027512 Ga0209179_1004942 Ga0209179_10049422 323
660 3300028379 Ga0268266_10009025 Ga0268266_100090252 323
661 3300028379 Ga0268266_10032599 Ga0268266_100325993 323
662 3300028379 Ga0268266_10118485 Ga0268266_101184852 323
663 3300028379 Ga0268266_10134419 Ga0268266_101344192 323
664 3300028379 Ga0268266_10183462 Ga0268266_101834622 323
665 3300028380 Ga0268265_10006752 Ga0268265_100067523 323
666 3300028380 Ga0268265_10079575 Ga0268265_100795753 323
667 3300028380 Ga0268265_10386996 Ga0268265_103869961 323
668 3300028381 Ga0268264_10000356 Ga0268264_1000035648 323
669 3300028573 Ga0265334_10004606 Ga0265334_100046064 323
670 3300028577 Ga0265318_10013883 Ga0265318_100138832 323
671 3300028653 Ga0265323_10005398 Ga0265323_100053982 323
672 3300028666 Ga0265336_10000394 Ga0265336_100003947 323
673 3300028786 Ga0307517_10000476 Ga0307517_1000047620 323
674 3300028786 Ga0307517_10048541 Ga0307517_100485412 323
675 3300028786 Ga0307517_10235724 Ga0307517_102357241 323
676 3300028800 Ga0265338_10001172 Ga0265338_1000117217 323
677 3300030521 Ga0307511_10094360 Ga0307511_100943602 323
678 3300031235 Ga0265330_10029159 Ga0265330_100291591 323
679 3300031239 Ga0265328_10000080 Ga0265328_100000806 323
680 3300031239 Ga0265328_10001707 Ga0265328_100017076 323
681 3300031239 Ga0265328_10005769 Ga0265328_100057693 323
682 3300031249 Ga0265339_10005531 Ga0265339_100055313 323
683 3300031249 Ga0265339_10096742 Ga0265339_100967422 323
684 3300031250 Ga0265331_10004877 Ga0265331_100048775 323
685 3300031251 Ga0265327_10054415 Ga0265327_100544152 323
686 3300031344 Ga0265316_10094446 Ga0265316_100944463 323
687 3300031507 Ga0307509_10103050 Ga0307509_101030502 323
688 3300031616 Ga0307508_10000715 Ga0307508_100007157 323
689 3300031616 Ga0307508_10080513 Ga0307508_100805132 323
690 3300031711 Ga0265314_10005216 Ga0265314_100052165 323
691 3300031711 Ga0265314_10014299 Ga0265314_100142994 323
692 3300031711 Ga0265314_10048926 Ga0265314_100489261 323
693 3300031712 Ga0265342_10008957 Ga0265342_100089578 323
694 3300031712 Ga0265342_10187919 Ga0265342_101879191 323
695 3300031730 Ga0307516_10035080 Ga0307516_100350802 323
696 3300031731 Ga0307405_10056632 Ga0307405_100566323 323
697 3300031903 Ga0307407_10283914 Ga0307407_102839141 323
698 3300031911 Ga0307412_10130410 Ga0307412_101304102 323
699 3300031995 Ga0307409_100197155 Ga0307409_1001971552 323
700 3300032002 Ga0307416_100232352 Ga0307416_1002323522 323
701 3300032126 Ga0307415_100055386 Ga0307415_1000553862 323
702 3300033180 Ga0307510_10074620 Ga0307510_100746202 323
703 3300033180 Ga0307510_10097798 Ga0307510_100977982 323
704 3300033180 Ga0307510_10139643 Ga0307510_101396432 323
705 3300033442 Ga0315911_1000021 Ga0315911_100002183 323
706 3300035083 Ga0373926_0022234 Ga0373926_0022234_955_1926 323
707 3300035083 Ga0373926_0101304 Ga0373926_0101304_35_1006 323
708 3300035086 Ga0373934_0001987 Ga0373934_0001987_3283_4254 323
709 3300035092 Ga0373952_0008126 Ga0373952_0008126_478_1449 323
710 3300035111 Ga0373923_0034028 Ga0373923_0034028_708_1679 323
711 3300035113 Ga0373936_0012672 Ga0373936_0012672_83_1054 323
712 3300035113 Ga0373936_0107583 Ga0373936_0107583_21_992 323
713 3300035116 Ga0373945_0004593 Ga0373945_0004593_944_1915 323
714 3300035117 Ga0373953_0001676 Ga0373953_0001676_5417_6388 323
715 3300035117 Ga0373953_0003868 Ga0373953_0003868_463_1434 323
716 3300035118 Ga0373954_0000227 Ga0373954_0000227_16553_17524 323
717 3300035118 Ga0373954_0025227 Ga0373954_0025227_1507_2478 323
718 3300035118 Ga0373954_0183241 Ga0373954_0183241_16_987 323
719 3300035119 Ga0373956_0020477 Ga0373956_0020477_291_1262 323
720 3300035119 Ga0373956_0079606 Ga0373956_0079606_277_1248 323
721 3300035120 Ga0373957_0009828 Ga0373957_0009828_974_1945 323
722 3300035170 Ga0373943_0010076 Ga0373943_0010076_543_1514 323
723 3300035170 Ga0373943_0019622 Ga0373943_0019622_1206_2177 323
724 3300035170 Ga0373943_0023685 Ga0373943_0023685_403_1374 323
725 3300035171 Ga0373946_0009651 Ga0373946_0009651_671_1642 323
726 3300035171 Ga0373946_0010087 Ga0373946_0010087_1482_2453 323
727 3300035171 Ga0373946_0165990 Ga0373946_0165990_58_1029 323
728 3300035172 Ga0373955_0000497 Ga0373955_0000497_5872_6843 323
729 3300035172 Ga0373955_0013295 Ga0373955_0013295_487_1458 323
730 3300035172 Ga0373955_0046008 Ga0373955_0046008_863_1834 323
731 3300035410 Ga0373924_0004075 Ga0373924_0004075_4046_5017 323
732 3300035410 Ga0373924_0014704 Ga0373924_0014704_479_1450 323
733 3300035691 Ga0373931_0034070 Ga0373931_0034070_1648_2619 323
734 3300035692 Ga0373935_0000583 Ga0373935_0000583_8499_9470 323
735 3300035692 Ga0373935_0102075 Ga0373935_0102075_766_1737 323
736 3300035695 Ga0373927_0000464 Ga0373927_0000464_6054_7025 323
737 3300035695 Ga0373927_0003335 Ga0373927_0003335_9003_9974 323
738 3300035695 Ga0373927_0006414 Ga0373927_0006414_4037_5008 323
739 3300035695 Ga0373927_0015524 Ga0373927_0015524_2205_3176 323
740 3300035695 Ga0373927_0022947 Ga0373927_0022947_2069_3040 323
741 3300035695 Ga0373927_0029862 Ga0373927_0029862_1600_2571 323
742 3300035695 Ga0373927_0035964 Ga0373927_0035964_1163_2134 323
743 3300035724 Ga0373933_0000108 Ga0373933_0000108_43776_44747 323
744 3300035724 Ga0373933_0008543 Ga0373933_0008543_3707_4678 323
745 3300035725 Ga0373947_0004527 Ga0373947_0004527_6710_7681 323
746 3300035725 Ga0373947_0044546 Ga0373947_0044546_1345_2316 323
747 3300035725 Ga0373947_0091578 Ga0373947_0091578_202_1173 323
748 3300036401 Ga0373937_0004852 Ga0373937_0004852_641_1612 323
749 3300036401 Ga0373937_0014146 Ga0373937_0014146_3931_4902 323
750 3300036401 Ga0373937_0027435 Ga0373937_0027435_1212_2183 323
751 3300036401 Ga0373937_0187904 Ga0373937_0187904_746_1717 323
752 3300037068 Ga0373925_0001896 Ga0373925_0001896_3440_4411 323
753 3300037068 Ga0373925_0014012 Ga0373925_0014012_3377_4348 323
754 3300037068 Ga0373925_0029117 Ga0373925_0029117_1302_2273 323
755 3300037068 Ga0373925_0232117 Ga0373925_0232117_203_1174 323
756 3300037418 Ga0395900_0013869 Ga0395900_0013869_4079_5050 323
757 3300037418 Ga0395900_0198942 Ga0395900_0198942_403_1374 323
758 3300037471 Ga0395905_0271159 Ga0395905_0271159_400_1371 323
759 3300038443 Ga0395901_0023149 Ga0395901_0023149_2886_3857 323
760 3300039437 Ga0436365_0058492 Ga0436365_0058492_312_1283 323
761 3300039437 Ga0436365_0174179 Ga0436365_0174179_1696_2667 323
762 3300039437 Ga0436365_0498686 Ga0436365_0498686_8476_9447 323
763 3300039437 Ga0436365_0553539 Ga0436365_0553539_24_995 323
764 3300039437 Ga0436365_0685508 Ga0436365_0685508_800_1771 323
765 3300039437 Ga0436365_1483980 Ga0436365_1483980_2203_3174 323
766 3300039447 Ga0436361_1162611 Ga0436361_1162611_833_1804 323
767 3300039450 Ga0436363_0152105 Ga0436363_0152105_5189_6160 323
768 3300039450 Ga0436363_0665614 Ga0436363_0665614_543_1514 323
769 3300039453 Ga0436362_0604315 Ga0436362_0604315_349_1320 323
770 3300039453 Ga0436362_0640009 Ga0436362_0640009_1222_2193 323
771 3300041512 Ga0451853_0598542 Ga0451853_0598542_329_1300 323
772 3300044656 Ga0466969_0016700 Ga0466969_0016700_2166_3137 323
773 3300044658 Ga0466972_0037585 Ga0466972_0037585_242_1213 323
774 3300044684 Ga0466966_0000563 Ga0466966_0000563_15657_16628 323
775 3300044684 Ga0466966_0029768 Ga0466966_0029768_171_1142 323
776 3300044684 Ga0466966_0057322 Ga0466966_0057322_690_1661 323
777 3300044684 Ga0466966_0080631 Ga0466966_0080631_30_1001 323
778 3300044684 Ga0466966_0209486 Ga0466966_0209486_113_1084 323
779 3300044693 Ga0466961_0000087 Ga0466961_0000087_44308_45279 323
780 3300044694 Ga0466963_0004010 Ga0466963_0004010_638_1609 323
781 3300044694 Ga0466963_0028391 Ga0466963_0028391_988_1959 323
782 3300044719 Ga0466971_0044425 Ga0466971_0044425_202_1173 323
783 3300044842 Ga0466957_0053685 Ga0466957_0053685_643_1614 323
784 3300044842 Ga0466957_0094220 Ga0466957_0094220_537_1508 323
785 3300045049 Ga0466959_0000716 Ga0466959_0000716_10095_11066 323
786 3300045049 Ga0466959_0050922 Ga0466959_0050922_1926_2897 323
787 3300045049 Ga0466959_0080529 Ga0466959_0080529_934_1905 323
788 3300045049 Ga0466959_0122851 Ga0466959_0122851_450_1421 323
789 3300045976 Ga0466967_0039316 Ga0466967_0039316_2996_3967 323
790 3300045976 Ga0466967_0046551 Ga0466967_0046551_30_1001 323
791 3300045976 Ga0466967_0127683 Ga0466967_0127683_563_1534 323
792 3300045976 Ga0466967_0389879 Ga0466967_0389879_159_1130 323
793 3300046452 Ga0495617_002878 Ga0495617_002878_1205_2176 323
794 3300046454 Ga0495592_0010442 Ga0495592_0010442_2320_3291 323
795 3300046454 Ga0495592_0017029 Ga0495592_0017029_2995_3966 323
796 3300046454 Ga0495592_0087540 Ga0495592_0087540_70_1041 323
797 3300046454 Ga0495592_0183608 Ga0495592_0183608_396_1367 323
798 3300046455 Ga0495603_0000029 Ga0495603_0000029_33258_34229 323
799 3300046455 Ga0495603_0004050 Ga0495603_0004050_1289_2260 323
800 3300046455 Ga0495603_0019984 Ga0495603_0019984_2169_3140 323
801 3300046455 Ga0495603_0092616 Ga0495603_0092616_764_1735 323
802 3300046455 Ga0495603_0142961 Ga0495603_0142961_386_1357 323
803 3300046455 Ga0495603_0231704 Ga0495603_0231704_64_1035 323
804 3300046459 Ga0495629_0000029 Ga0495629_0000029_62568_63539 323
805 3300046459 Ga0495629_0000419 Ga0495629_0000419_7208_8179 323
806 3300046459 Ga0495629_0053710 Ga0495629_0053710_160_1131 323
807 3300046459 Ga0495629_0066247 Ga0495629_0066247_35_1006 323
808 3300046460 Ga0495638_0043887 Ga0495638_0043887_1075_2046 323
809 3300046460 Ga0495638_0128455 Ga0495638_0128455_485_1456 323
810 3300046460 Ga0495638_0157738 Ga0495638_0157738_39_1010 323
811 3300046460 Ga0495638_0184880 Ga0495638_0184880_36_1007 323
812 3300046461 Ga0495641_0001748 Ga0495641_0001748_9641_10612 323
813 3300046461 Ga0495641_0128780 Ga0495641_0128780_20_991 323
814 3300046462 Ga0495651_0015916 Ga0495651_0015916_1205_2176 323
815 3300046462 Ga0495651_0032987 Ga0495651_0032987_1246_2217 323
816 3300046463 Ga0495653_0006942 Ga0495653_0006942_4741_5712 323
817 3300046463 Ga0495653_0032349 Ga0495653_0032349_2583_3554 323
818 3300046463 Ga0495653_0072968 Ga0495653_0072968_176_1147 323
819 3300046463 Ga0495653_0126486 Ga0495653_0126486_143_1114 323
820 3300046472 Ga0495580_0000321 Ga0495580_0000321_31180_32151 323
821 3300046473 Ga0495582_0000024 Ga0495582_0000024_62546_63517 323
822 3300046473 Ga0495582_0012091 Ga0495582_0012091_3525_4496 323
823 3300046474 Ga0495605_0140247 Ga0495605_0140247_42_1013 323
824 3300046475 Ga0495639_0000006 Ga0495639_0000006_41307_42278 323
825 3300046475 Ga0495639_0028163 Ga0495639_0028163_967_1938 323
826 3300046476 Ga0495662_0000068 Ga0495662_0000068_8570_9541 323
827 3300046477 Ga0495664_0003213 Ga0495664_0003213_1942_2913 323
828 3300046477 Ga0495664_0003926 Ga0495664_0003926_3219_4190 323
829 3300046477 Ga0495664_0017604 Ga0495664_0017604_1846_2817 323
830 3300046492 Ga0495585_0072552 Ga0495585_0072552_285_1256 323
831 3300046492 Ga0495585_0087703 Ga0495585_0087703_335_1306 323
832 3300046499 Ga0495594_0000806 Ga0495594_0000806_12053_13024 323
833 3300046501 Ga0495607_0101410 Ga0495607_0101410_46_1017 323
834 3300046507 Ga0495606_0098254 Ga0495606_0098254_640_1611 323
835 3300046511 Ga0495608_0022618 Ga0495608_0022618_741_1712 323
836 3300046511 Ga0495608_0025045 Ga0495608_0025045_1236_2207 323
837 3300046511 Ga0495608_0045766 Ga0495608_0045766_904_1875 323
838 3300046512 Ga0495610_0017519 Ga0495610_0017519_1498_2469 323
839 3300046512 Ga0495610_0044990 Ga0495610_0044990_458_1429 323
840 3300046513 Ga0495616_0011962 Ga0495616_0011962_2397_3368 323
841 3300046514 Ga0495618_0009920 Ga0495618_0009920_3965_4936 323
842 3300046514 Ga0495618_0032596 Ga0495618_0032596_2217_3188 323
843 3300046514 Ga0495618_0042853 Ga0495618_0042853_390_1361 323
844 3300046516 Ga0495628_0004480 Ga0495628_0004480_7401_8372 323
845 3300046516 Ga0495628_0039169 Ga0495628_0039169_1721_2692 323
846 3300046516 Ga0495628_0086452 Ga0495628_0086452_372_1343 323
847 3300046516 Ga0495628_0230245 Ga0495628_0230245_185_1156 323
848 3300046517 Ga0495630_0000497 Ga0495630_0000497_7161_8132 323
849 3300046517 Ga0495630_0049525 Ga0495630_0049525_636_1607 323
850 3300046517 Ga0495630_0067113 Ga0495630_0067113_1260_2231 323
851 3300046517 Ga0495630_0085892 Ga0495630_0085892_1243_2214 323
852 3300046519 Ga0495632_0103314 Ga0495632_0103314_349_1320 323
853 3300046522 Ga0495643_0025483 Ga0495643_0025483_2355_3326 323
854 3300046523 Ga0495644_0030105 Ga0495644_0030105_783_1754 323
855 3300046524 Ga0495648_0005939 Ga0495648_0005939_827_1798 323
856 3300046524 Ga0495648_0008777 Ga0495648_0008777_3212_4183 323
857 3300046524 Ga0495648_0116607 Ga0495648_0116607_122_1093 323
858 3300046526 Ga0495666_0024658 Ga0495666_0024658_875_1846 323
859 3300046526 Ga0495666_0102467 Ga0495666_0102467_201_1172 323
860 3300046529 Ga0495652_0014184 Ga0495652_0014184_3683_4654 323
861 3300046529 Ga0495652_0022028 Ga0495652_0022028_3534_4505 323
862 3300046529 Ga0495652_0104584 Ga0495652_0104584_1057_2028 323
863 3300046530 Ga0495654_0014286 Ga0495654_0014286_552_1523 323
864 3300046531 Ga0495665_0000158 Ga0495665_0000158_30451_31422 323
865 3300046531 Ga0495665_0056887 Ga0495665_0056887_502_1473 323
866 3300046533 Ga0495640_0007422 Ga0495640_0007422_6266_7237 323
867 3300046533 Ga0495640_0009201 Ga0495640_0009201_2438_3409 323
868 3300046533 Ga0495640_0034183 Ga0495640_0034183_597_1568 323
869 3300046533 Ga0495640_0047483 Ga0495640_0047483_235_1206 323
870 3300046533 Ga0495640_0170126 Ga0495640_0170126_16_987 323
871 3300046536 Ga0495587_0014907 Ga0495587_0014907_312_1283 323
872 3300046536 Ga0495587_0025421 Ga0495587_0025421_1024_1995 323
873 3300046538 Ga0495609_0075412 Ga0495609_0075412_473_1444 323
874 3300046542 Ga0495597_0030621 Ga0495597_0030621_981_1952 323
875 3300046543 Ga0495645_0038952 Ga0495645_0038952_895_1866 323
876 3300046543 Ga0495645_0074772 Ga0495645_0074772_387_1358 323
877 3300046543 Ga0495645_0095874 Ga0495645_0095874_183_1154 323
878 3300046543 Ga0495645_0208920 Ga0495645_0208920_16_987 323
879 3300046557 Ga0495622_0001732 Ga0495622_0001732_3842_4813 323
880 3300046557 Ga0495622_0006022 Ga0495622_0006022_2083_3054 323
881 3300046557 Ga0495622_0017869 Ga0495622_0017869_698_1669 323
882 3300046557 Ga0495622_0037526 Ga0495622_0037526_731_1702 323
883 3300046559 Ga0495667_0002287 Ga0495667_0002287_3579_4550 323
884 3300046559 Ga0495667_0025100 Ga0495667_0025100_123_1094 323
885 3300046559 Ga0495667_0030068 Ga0495667_0030068_1611_2582 323
886 3300046615 Ga0495656_0025807 Ga0495656_0025807_418_1389 323
887 3300046615 Ga0495656_0039831 Ga0495656_0039831_486_1457 323
888 3300046616 Ga0495668_0115320 Ga0495668_0115320_423_1394 323
889 3300046616 Ga0495668_0227418 Ga0495668_0227418_20_991 323
890 3300046642 Ga0495634_0000354 Ga0495634_0000354_387_1358 323
891 3300046642 Ga0495634_0007448 Ga0495634_0007448_3197_4168 323
892 3300046642 Ga0495634_0074062 Ga0495634_0074062_1060_2031 323
893 3300046642 Ga0495634_0123288 Ga0495634_0123288_377_1348 323
894 3300046648 Ga0495611_0116942 Ga0495611_0116942_114_1085 323
895 3300046660 Ga0495625_0126175 Ga0495625_0126175_404_1375 323
896 3300046663 Ga0495635_0000179 Ga0495635_0000179_6271_7242 323
897 3300046663 Ga0495635_0005499 Ga0495635_0005499_4127_5098 323
898 3300046663 Ga0495635_0019804 Ga0495635_0019804_1095_2066 323
899 3300046663 Ga0495635_0024056 Ga0495635_0024056_1221_2192 323
900 3300046663 Ga0495635_0030019 Ga0495635_0030019_1983_2954 323
901 3300046663 Ga0495635_0137317 Ga0495635_0137317_57_1028 323
902 3300046664 Ga0495659_0008329 Ga0495659_0008329_520_1491 323
903 3300046674 Ga0495588_0016066 Ga0495588_0016066_2607_3578 323
904 3300046674 Ga0495588_0071654 Ga0495588_0071654_50_1021 323
905 3300046674 Ga0495588_0116537 Ga0495588_0116537_426_1397 323
906 3300046675 Ga0495657_0001266 Ga0495657_0001266_19160_20131 323
907 3300046675 Ga0495657_0014769 Ga0495657_0014769_1174_2145 323
908 3300046675 Ga0495657_0056764 Ga0495657_0056764_53_1024 323
909 3300046678 Ga0495599_0000703 Ga0495599_0000703_11832_12803 323
910 3300046678 Ga0495599_0019821 Ga0495599_0019821_1214_2185 323
911 3300046678 Ga0495599_0076447 Ga0495599_0076447_1064_2035 323
912 3300046679 Ga0495623_0001494 Ga0495623_0001494_4059_5030 323
913 3300046679 Ga0495623_0057795 Ga0495623_0057795_1082_2053 323
914 3300046680 Ga0495646_0020437 Ga0495646_0020437_2890_3861 323
915 3300046680 Ga0495646_0025607 Ga0495646_0025607_176_1147 323
916 3300046681 Ga0495647_0052186 Ga0495647_0052186_510_1481 323
917 3300046681 Ga0495647_0074995 Ga0495647_0074995_304_1275 323
918 3300046683 Ga0495658_0000736 Ga0495658_0000736_10164_11135 323
919 3300046683 Ga0495658_0092649 Ga0495658_0092649_302_1273 323
920 3300046684 Ga0495669_0006708 Ga0495669_0006708_1225_2196 323
921 3300046684 Ga0495669_0099561 Ga0495669_0099561_337_1308 323
922 3300046689 Ga0495613_0009354 Ga0495613_0009354_1782_2753 323
923 3300046689 Ga0495613_0040515 Ga0495613_0040515_32_1003 323
924 3300046689 Ga0495613_0047124 Ga0495613_0047124_1943_2914 323
925 3300046689 Ga0495613_0106414 Ga0495613_0106414_368_1339 323
926 3300046689 Ga0495613_0182529 Ga0495613_0182529_128_1099 323
927 3300046690 Ga0495624_0000698 Ga0495624_0000698_21447_22418 323
928 3300046690 Ga0495624_0056795 Ga0495624_0056795_737_1708 323
929 3300046690 Ga0495624_0145449 Ga0495624_0145449_461_1432 323
930 3300046691 Ga0495670_0006475 Ga0495670_0006475_1752_2723 323
931 3300046691 Ga0495670_0037201 Ga0495670_0037201_707_1678 323
932 3300046794 Ga0495589_0046416 Ga0495589_0046416_652_1623 323
933 3300046809 Ga0495600_0020632 Ga0495600_0020632_388_1359 323
934 3300046809 Ga0495600_0035688 Ga0495600_0035688_1342_2313 323
935 3300046809 Ga0495600_0081579 Ga0495600_0081579_766_1743 323
936 3300046809 Ga0495600_0133412 Ga0495600_0133412_312_1283 323
937 3300046810 Ga0495660_0135185 Ga0495660_0135185_39_1010 323
938 3300047315 Ga0495581_0000004 Ga0495581_0000004_21900_22871 323
939 3300047315 Ga0495581_0018159 Ga0495581_0018159_111_1082 323
940 3300047315 Ga0495581_0136859 Ga0495581_0136859_424_1395 323
941 3300047317 Ga0495604_0000470 Ga0495604_0000470_17832_18803 323
942 3300047317 Ga0495604_0018741 Ga0495604_0018741_1156_2127 323
943 3300047317 Ga0495604_0075744 Ga0495604_0075744_999_1970 323
944 3300047317 Ga0495604_0099527 Ga0495604_0099527_765_1736 323
945 3300047317 Ga0495604_0102836 Ga0495604_0102836_63_1034 323
946 3300047319 Ga0495674_0005737 Ga0495674_0005737_4230_5201 323
947 3300047319 Ga0495674_0037584 Ga0495674_0037584_3008_3979 323
948 3300047319 Ga0495674_0070045 Ga0495674_0070045_1078_2049 323
949 3300047320 Ga0495672_0006040 Ga0495672_0006040_6979_7950 323
950 3300047321 Ga0495676_0039914 Ga0495676_0039914_1762_2733 323
951 3300047321 Ga0495676_0128364 Ga0495676_0128364_211_1182 323
952 3300047322 Ga0495680_0000546 Ga0495680_0000546_9420_10391 323
953 3300047322 Ga0495680_0096376 Ga0495680_0096376_331_1302 323
954 3300047443 Ga0495687_015633 Ga0495687_015633_582_1553 323
955 3300047444 Ga0495675_0015041 Ga0495675_0015041_3592_4563 323
956 3300047444 Ga0495675_0124852 Ga0495675_0124852_117_1094 323
957 3300047445 Ga0495677_0036264 Ga0495677_0036264_543_1514 323
958 3300047469 Ga0495673_0049113 Ga0495673_0049113_451_1422 323
959 3300047469 Ga0495673_0114797 Ga0495673_0114797_77_1048 323
960 3300047471 Ga0495684_0000032 Ga0495684_0000032_15862_16833 323
961 3300047471 Ga0495684_0035426 Ga0495684_0035426_929_1900 323
962 3300047471 Ga0495684_0049744 Ga0495684_0049744_1029_2000 323
963 3300047471 Ga0495684_0217174 Ga0495684_0217174_152_1123 323
964 3300047472 Ga0495686_0038985 Ga0495686_0038985_621_1592 323
965 3300047673 Ga0495593_0000278 Ga0495593_0000278_9327_10298 323
966 3300047673 Ga0495593_0002026 Ga0495593_0002026_3732_4703 323
967 3300047673 Ga0495593_0029272 Ga0495593_0029272_1376_2347 323
968 3300047673 Ga0495593_0045073 Ga0495593_0045073_1337_2308 323
969 3300048088 Ga0495602_0006281 Ga0495602_0006281_9194_10165 323
970 3300048088 Ga0495602_0053243 Ga0495602_0053243_495_1466 323
971 3300048088 Ga0495602_0151958 Ga0495602_0151958_681_1652 323
972 3300048090 Ga0495615_0015597 Ga0495615_0015597_428_1399 323
973 3300048903 Ga0496100_0014565 Ga0496100_0014565_2909_3880 323
974 3300048903 Ga0496100_0029356 Ga0496100_0029356_200_1171 323
975 3300048903 Ga0496100_0029494 Ga0496100_0029494_997_1968 323
976 3300048903 Ga0496100_0050828 Ga0496100_0050828_388_1359 323
977 3300048903 Ga0496100_0053911 Ga0496100_0053911_580_1557 323
978 3300048903 Ga0496100_0241713 Ga0496100_0241713_161_1132 323
979 3300048904 Ga0496101_0005277 Ga0496101_0005277_5986_6957 323
980 3300048904 Ga0496101_0107419 Ga0496101_0107419_200_1171 323
981 3300048904 Ga0496101_0117427 Ga0496101_0117427_543_1514 323
982 3300048904 Ga0496101_0211771 Ga0496101_0211771_82_1059 323
983 3300048905 Ga0496102_0007529 Ga0496102_0007529_4626_5597 323
984 3300048905 Ga0496102_0013319 Ga0496102_0013319_1694_2665 323
985 3300048905 Ga0496102_0034440 Ga0496102_0034440_3278_4249 323
986 3300048905 Ga0496102_0045498 Ga0496102_0045498_1369_2340 323
987 3300048905 Ga0496102_0059994 Ga0496102_0059994_112_1089 323
988 3300048905 Ga0496102_0115276 Ga0496102_0115276_211_1182 323
989 3300048905 Ga0496102_0496680 Ga0496102_0496680_150_1121 323
990 3300048906 Ga0496103_0001777 Ga0496103_0001777_9725_10696 323
991 3300048906 Ga0496103_0011075 Ga0496103_0011075_3281_4252 323
992 3300048906 Ga0496103_0057649 Ga0496103_0057649_1322_2293 323
993 3300048906 Ga0496103_0127160 Ga0496103_0127160_417_1388 323
994 3300048906 Ga0496103_0144937 Ga0496103_0144937_111_1082 323
995 3300048907 Ga0496104_0000044 Ga0496104_0000044_128980_130065 323
996 3300048907 Ga0496104_0013573 Ga0496104_0013573_3858_4829 323
997 3300048907 Ga0496104_0049572 Ga0496104_0049572_955_1926 323
998 3300048907 Ga0496104_0119084 Ga0496104_0119084_1291_2262 323
999 3300048907 Ga0496104_0157748 Ga0496104_0157748_199_1170 323
1000 3300048907 Ga0496104_0227000 Ga0496104_0227000_399_1370 323
1001 3300048907 Ga0496104_0422170 Ga0496104_0422170_46_1017 323
1002 3300048907 Ga0496104_0444489 Ga0496104_0444489_111_1088 323
1003 3300048908 Ga0496105_0000017 Ga0496105_0000017_8540_9625 323
1004 3300048908 Ga0496105_0001074 Ga0496105_0001074_9756_10805 323
1005 3300048908 Ga0496105_0005035 Ga0496105_0005035_7472_8443 323
1006 3300048908 Ga0496105_0047822 Ga0496105_0047822_2545_3516 323
1007 3300048908 Ga0496105_0082882 Ga0496105_0082882_273_1244 323
1008 3300048908 Ga0496105_0090637 Ga0496105_0090637_256_1227 323
1009 3300048908 Ga0496105_0092553 Ga0496105_0092553_1370_2341 323
1010 3300048908 Ga0496105_0141294 Ga0496105_0141294_425_1396 323
1011 3300048908 Ga0496105_0268776 Ga0496105_0268776_71_1042 323
1012 3300048909 Ga0496106_0001945 Ga0496106_0001945_6750_7721 323
1013 3300048909 Ga0496106_0003717 Ga0496106_0003717_3339_4310 323
1014 3300048909 Ga0496106_0084039 Ga0496106_0084039_395_1366 323
1015 3300048909 Ga0496106_0090019 Ga0496106_0090019_1311_2282 323
1016 3300048909 Ga0496106_0156931 Ga0496106_0156931_371_1342 323
1017 3300048909 Ga0496106_0240683 Ga0496106_0240683_378_1349 323
1018 3300048909 Ga0496106_0285199 Ga0496106_0285199_62_1033 323
1019 3300048910 Ga0496107_0014874 Ga0496107_0014874_3541_4512 323
1020 3300048910 Ga0496107_0019218 Ga0496107_0019218_54_1025 323
1021 3300048910 Ga0496107_0024078 Ga0496107_0024078_2165_3136 323
1022 3300048910 Ga0496107_0097593 Ga0496107_0097593_146_1117 323
1023 3300048910 Ga0496107_0209328 Ga0496107_0209328_65_1042 323
1024 3300048911 Ga0496108_0003699 Ga0496108_0003699_2029_3000 323
1025 3300048911 Ga0496108_0004933 Ga0496108_0004933_3824_4795 323
1026 3300048911 Ga0496108_0016433 Ga0496108_0016433_2533_3504 323
1027 3300048911 Ga0496108_0058750 Ga0496108_0058750_483_1454 323
1028 3300048911 Ga0496108_0072233 Ga0496108_0072233_1811_2782 323
1029 3300048911 Ga0496108_0100177 Ga0496108_0100177_610_1659 323
1030 3300048912 Ga0496109_0000609 Ga0496109_0000609_14946_15917 323
1031 3300048912 Ga0496109_0010467 Ga0496109_0010467_4738_5709 323
1032 3300048912 Ga0496109_0054587 Ga0496109_0054587_1999_2970 323
1033 3300048912 Ga0496109_0105472 Ga0496109_0105472_1028_1999 323
1034 3300048912 Ga0496109_0145972 Ga0496109_0145972_289_1266 323
1035 3300048912 Ga0496109_0209210 Ga0496109_0209210_597_1568 323
1036 3300048913 Ga0496110_0010579 Ga0496110_0010579_1843_2820 323
1037 3300048913 Ga0496110_0012558 Ga0496110_0012558_1418_2389 323
1038 3300048913 Ga0496110_0109014 Ga0496110_0109014_1008_1979 323
1039 3300048913 Ga0496110_0110671 Ga0496110_0110671_240_1289 323
1040 3300048913 Ga0496110_0161957 Ga0496110_0161957_953_1924 323
1041 3300048914 Ga0496111_0017716 Ga0496111_0017716_3511_4560 323
1042 3300048915 Ga0496112_0000079 Ga0496112_0000079_5040_6011 323
1043 3300048915 Ga0496112_0006493 Ga0496112_0006493_9140_10111 323
1044 3300048915 Ga0496112_0013257 Ga0496112_0013257_1078_2127 323
1045 3300048915 Ga0496112_0025627 Ga0496112_0025627_4304_5275 323
1046 3300048915 Ga0496112_0071027 Ga0496112_0071027_2237_3208 323
1047 3300048915 Ga0496112_0101522 Ga0496112_0101522_1242_2213 323
1048 3300048915 Ga0496112_0221797 Ga0496112_0221797_243_1214 323
1049 3300048915 Ga0496112_0224503 Ga0496112_0224503_573_1544 323
1050 3300048915 Ga0496112_0236460 Ga0496112_0236460_716_1687 323
1051 3300048915 Ga0496112_0343625 Ga0496112_0343625_28_999 323
1052 3300048916 Ga0496113_0003535 Ga0496113_0003535_7378_8427 323
1053 3300048916 Ga0496113_0011006 Ga0496113_0011006_958_1929 323
1054 3300048916 Ga0496113_0013879 Ga0496113_0013879_286_1263 323
1055 3300048916 Ga0496113_0023194 Ga0496113_0023194_3129_4100 323
1056 3300048916 Ga0496113_0031129 Ga0496113_0031129_431_1402 323
1057 3300048916 Ga0496113_0066218 Ga0496113_0066218_347_1318 323
1058 3300048916 Ga0496113_0141618 Ga0496113_0141618_492_1463 323
1059 3300048917 Ga0496114_0062945 Ga0496114_0062945_1236_2207 323
1060 3300048917 Ga0496114_0089987 Ga0496114_0089987_937_1908 323
1061 3300048917 Ga0496114_0167307 Ga0496114_0167307_14_985 323
1062 3300048917 Ga0496114_0168238 Ga0496114_0168238_898_1869 323
1063 3300048917 Ga0496114_0333080 Ga0496114_0333080_275_1246 323
1064 3300048918 Ga0496115_0022958 Ga0496115_0022958_410_1381 323
1065 3300048918 Ga0496115_0025598 Ga0496115_0025598_1357_2334 323
1066 3300048918 Ga0496115_0028712 Ga0496115_0028712_2668_3639 323
1067 3300048918 Ga0496115_0049167 Ga0496115_0049167_1501_2550 323
1068 3300048918 Ga0496115_0054956 Ga0496115_0054956_1027_1998 323
1069 3300048918 Ga0496115_0072104 Ga0496115_0072104_1311_2282 323
1070 3300048918 Ga0496115_0109044 Ga0496115_0109044_1102_2073 323
1071 3300048918 Ga0496115_0114315 Ga0496115_0114315_1197_2168 323
1072 3300048918 Ga0496115_0114580 Ga0496115_0114580_590_1561 323
1073 3300048918 Ga0496115_0143379 Ga0496115_0143379_48_1019 323
1074 3300048918 Ga0496115_0225955 Ga0496115_0225955_563_1534 323
1075 3300048919 Ga0496116_0045530 Ga0496116_0045530_10_981 323
1076 3300048920 Ga0496117_0076422 Ga0496117_0076422_861_1832 323
1077 3300048921 Ga0496118_0003943 Ga0496118_0003943_7358_8329 323
1078 3300048921 Ga0496118_0031182 Ga0496118_0031182_962_1933 323
1079 3300048921 Ga0496118_0078330 Ga0496118_0078330_33_1004 323
1080 3300048921 Ga0496118_0127630 Ga0496118_0127630_269_1240 323
1081 3300048922 Ga0496119_0004369 Ga0496119_0004369_5489_6538 323
1082 3300048922 Ga0496119_0021850 Ga0496119_0021850_1127_2176 323
1083 3300048922 Ga0496119_0052425 Ga0496119_0052425_530_1501 323
1084 3300048922 Ga0496119_0065309 Ga0496119_0065309_586_1557 323
1085 3300048922 Ga0496119_0103201 Ga0496119_0103201_169_1140 323
1086 3300048922 Ga0496119_0117195 Ga0496119_0117195_327_1298 323
1087 3300048923 Ga0496120_0011626 Ga0496120_0011626_3164_4135 323
1088 3300048923 Ga0496120_0027326 Ga0496120_0027326_1168_2139 323
1089 3300048923 Ga0496120_0039904 Ga0496120_0039904_24_995 323
1090 3300048924 Ga0496121_0001623 Ga0496121_0001623_17456_18427 323
1091 3300048924 Ga0496121_0003178 Ga0496121_0003178_9800_10771 323
1092 3300048924 Ga0496121_0005022 Ga0496121_0005022_6376_7347 323
1093 3300048924 Ga0496121_0029702 Ga0496121_0029702_1243_2214 323
1094 3300048924 Ga0496121_0037412 Ga0496121_0037412_845_1816 323
1095 3300048924 Ga0496121_0081787 Ga0496121_0081787_1543_2514 323
1096 3300048924 Ga0496121_0113996 Ga0496121_0113996_460_1431 323
1097 3300048924 Ga0496121_0191201 Ga0496121_0191201_117_1088 323
1098 3300048927 Ga0496124_0002348 Ga0496124_0002348_14212_15183 323
1099 3300048927 Ga0496124_0044249 Ga0496124_0044249_468_1439 323
1100 3300048927 Ga0496124_0236163 Ga0496124_0236163_74_1045 323
1101 3300048928 Ga0496125_0000158 Ga0496125_0000158_124068_125039 323
1102 3300048928 Ga0496125_0001404 Ga0496125_0001404_16471_17442 323
1103 3300048928 Ga0496125_0028745 Ga0496125_0028745_1874_2845 323
1104 3300048928 Ga0496125_0032273 Ga0496125_0032273_3547_4518 323
1105 3300048928 Ga0496125_0041231 Ga0496125_0041231_1639_2610 323
1106 3300048928 Ga0496125_0062583 Ga0496125_0062583_1197_2168 323
1107 3300048928 Ga0496125_0069666 Ga0496125_0069666_475_1446 323
1108 3300048928 Ga0496125_0179748 Ga0496125_0179748_412_1383 323
1109 3300048929 Ga0496126_0004256 Ga0496126_0004256_16067_17038 323
1110 3300048929 Ga0496126_0008099 Ga0496126_0008099_8830_9801 323
1111 3300048929 Ga0496126_0010132 Ga0496126_0010132_5222_6193 323
1112 3300048929 Ga0496126_0013275 Ga0496126_0013275_4858_5829 323
1113 3300048929 Ga0496126_0017275 Ga0496126_0017275_4134_5105 323
1114 3300048929 Ga0496126_0022316 Ga0496126_0022316_3927_4898 323
1115 3300048929 Ga0496126_0027029 Ga0496126_0027029_2560_3531 323
1116 3300048929 Ga0496126_0053217 Ga0496126_0053217_401_1372 323
1117 3300048929 Ga0496126_0067179 Ga0496126_0067179_223_1194 323
1118 3300048929 Ga0496126_0125274 Ga0496126_0125274_95_1066 323
1119 3300048929 Ga0496126_0165516 Ga0496126_0165516_59_1030 323
1120 3300048929 Ga0496126_0208924 Ga0496126_0208924_427_1398 323
1121 3300049577 Ga0501041_0223876 Ga0501041_0223876_57_1028 323
1122 3300049580 Ga0501046_0032898 Ga0501046_0032898_1799_2770 323
1123 3300049581 Ga0501047_0022591 Ga0501047_0022591_1605_2576 323
1124 3300049581 Ga0501047_0486124 Ga0501047_0486124_42_1013 323
1125 3300049586 Ga0501070_0152952 Ga0501070_0152952_544_1515 323
1126 3300049590 Ga0501074_0033966 Ga0501074_0033966_1572_2543 323
1127 3300049592 Ga0501076_0031503 Ga0501076_0031503_2035_3006 323
1128 3300049742 Ga0501080_0064261 Ga0501080_0064261_1081_2052 323
1129 3300049823 Ga0501044_0057044 Ga0501044_0057044_1410_2381 323
1130 3300050489 nmdc:mga03683_100025_c1 nmdc:mga03683_100025_c1_143_1114 323
1131 3300050490 nmdc:mga03n38_5033_c1 nmdc:mga03n38_5033_c1_2841_3812 323
1132 3300050491 nmdc:mga00v17_138411_c1 nmdc:mga00v17_138411_c1_275_1246 323
1133 3300050491 nmdc:mga00v17_222933_c1 nmdc:mga00v17_222933_c1_153_1124 323
1134 3300050491 nmdc:mga00v17_275578_c1 nmdc:mga00v17_275578_c1_94_1065 323
1135 3300050491 nmdc:mga00v17_58356_c1 nmdc:mga00v17_58356_c1_1177_2148 323
1136 3300050492 nmdc:mga0yw44_135815_c1 nmdc:mga0yw44_135815_c1_16_987 323
1137 3300050492 nmdc:mga0yw44_138845_c1 nmdc:mga0yw44_138845_c1_30_1001 323
1138 3300050492 nmdc:mga0yw44_71325_c1 nmdc:mga0yw44_71325_c1_277_1248 323
1139 3300050493 nmdc:mga0k408_96676_c1 nmdc:mga0k408_96676_c1_722_1693 323
1140 3300050496 nmdc:mga07m45_5079_c1 nmdc:mga07m45_5079_c1_4913_5884 323
1141 3300050507 nmdc:mga05p37_405022_c1 nmdc:mga05p37_405022_c1_167_1138 323
1142 3300050511 nmdc:mga08y16_406229_c1 nmdc:mga08y16_406229_c1_220_1191 323
1143 3300050512 nmdc:mga0n895_118051_c1 nmdc:mga0n895_118051_c1_366_1337 323
1144 3300050512 nmdc:mga0n895_75921_c1 nmdc:mga0n895_75921_c1_230_1201 323
1145 3300050515 nmdc:mga0a205_526376_c1 nmdc:mga0a205_526376_c1_42_1013 323
1146 3300050516 nmdc:mga0sz30_82662_c1 nmdc:mga0sz30_82662_c1_294_1265 323
1147 3300053077 Ga0495601_0075792 Ga0495601_0075792_642_1613 323
1148 3300053077 Ga0495601_0163484 Ga0495601_0163484_16_987 323
1149 3300053078 Ga0495612_0092336 Ga0495612_0092336_46_1017 323
1150 3300053084 Ga0495595_0000660 Ga0495595_0000660_3505_4476 323
1151 3300053084 Ga0495595_0037409 Ga0495595_0037409_664_1635 323
1152 3300053084 Ga0495595_0088697 Ga0495595_0088697_450_1421 323
1153 3300053085 Ga0495619_0004289 Ga0495619_0004289_7075_8046 323
1154 3300053085 Ga0495619_0092103 Ga0495619_0092103_48_1025 323
1155 3300053085 Ga0495619_0108248 Ga0495619_0108248_101_1072 323
1156 3300053087 Ga0500643_000048 Ga0500643_000048_52149_53120 323
1157 3300053087 Ga0500643_013788 Ga0500643_013788_1625_2596 323
1158 3300053087 Ga0500643_027307 Ga0500643_027307_155_1126 323
1159 3300053089 Ga0500581_065905 Ga0500581_065905_195_1166 323
1160 3300053091 Ga0500647_0083144 Ga0500647_0083144_363_1334 323
1161 3300053092 Ga0500583_0125955 Ga0500583_0125955_179_1150 323
1162 3300053093 Ga0500651_0115649 Ga0500651_0115649_432_1403 323
1163 3300053094 Ga0500566_0000126 Ga0500566_0000126_34050_35021 323
1164 3300053094 Ga0500566_0016744 Ga0500566_0016744_1950_2921 323
1165 3300053094 Ga0500566_0059192 Ga0500566_0059192_100_1071 323
1166 3300053095 Ga0500640_000682 Ga0500640_000682_74_1045 323
1167 3300053096 Ga0500641_0026941 Ga0500641_0026941_267_1238 323
1168 3300053098 Ga0500650_0114635 Ga0500650_0114635_271_1242 323
1169 3300053102 Ga0500554_001101 Ga0500554_001101_1104_2075 323
1170 3300053103 Ga0500555_008526 Ga0500555_008526_719_1690 323
1171 3300053104 Ga0500556_0000029 Ga0500556_0000029_96581_97552 323
1172 3300053105 Ga0500557_000097 Ga0500557_000097_10465_11436 323
1173 3300053108 Ga0500562_033317 Ga0500562_033317_234_1205 323
1174 3300053111 Ga0500572_000110 Ga0500572_000110_9996_10967 323
1175 3300053111 Ga0500572_000976 Ga0500572_000976_5603_6574 323
1176 3300053111 Ga0500572_042610 Ga0500572_042610_292_1263 323
1177 3300053118 Ga0500594_0002516 Ga0500594_0002516_2573_3544 323
1178 3300053119 Ga0500595_000813 Ga0500595_000813_7319_8290 323
1179 3300053119 Ga0500595_005181 Ga0500595_005181_3081_4052 323
1180 3300053119 Ga0500595_021173 Ga0500595_021173_438_1409 323
1181 3300053119 Ga0500595_054028 Ga0500595_054028_78_1049 323
1182 3300053122 Ga0500608_010946 Ga0500608_010946_2679_3650 323
1183 3300053123 Ga0500614_000373 Ga0500614_000373_8275_9246 323
1184 3300053130 Ga0500642_0000020 Ga0500642_0000020_99114_100085 323
1185 3300053130 Ga0500642_0000100 Ga0500642_0000100_30234_31205 323
1186 3300053130 Ga0500642_0061546 Ga0500642_0061546_638_1609 323
1187 3300053131 Ga0500652_000903 Ga0500652_000903_4877_5848 323
1188 3300053136 Ga0500559_0000230 Ga0500559_0000230_4234_5205 323
1189 3300053136 Ga0500559_0002208 Ga0500559_0002208_6230_7201 323
1190 3300053136 Ga0500559_0015782 Ga0500559_0015782_1583_2554 323
1191 3300053136 Ga0500559_0019948 Ga0500559_0019948_575_1546 323
1192 3300053139 Ga0500568_0016791 Ga0500568_0016791_1450_2421 323
1193 3300053139 Ga0500568_0022002 Ga0500568_0022002_951_1922 323
1194 3300053140 Ga0500573_0018252 Ga0500573_0018252_1616_2587 323
1195 3300053148 Ga0500590_043159 Ga0500590_043159_246_1217 323
1196 3300053148 Ga0500590_088974 Ga0500590_088974_171_1142 323
1197 3300053150 Ga0500603_001499 Ga0500603_001499_3274_4245 323
1198 3300053150 Ga0500603_003864 Ga0500603_003864_1388_2359 323
1199 3300053151 Ga0500604_0002146 Ga0500604_0002146_3081_4052 323
1200 3300053151 Ga0500604_0016932 Ga0500604_0016932_267_1238 323
1201 3300053153 Ga0500616_0000112 Ga0500616_0000112_100014_100985 323
1202 3300053156 Ga0500622_0000717 Ga0500622_0000717_24335_25306 323
1203 3300053160 Ga0500633_0008264 Ga0500633_0008264_1659_2630 323
1204 3300053161 Ga0500634_0020923 Ga0500634_0020923_91_1062 323
1205 3300053162 Ga0500638_004443 Ga0500638_004443_950_1921 323
1206 3300053162 Ga0500638_018163 Ga0500638_018163_1698_2669 323
1207 3300053162 Ga0500638_042664 Ga0500638_042664_310_1281 323
1208 3300053162 Ga0500638_079155 Ga0500638_079155_206_1177 323
1209 3300053163 Ga0500639_000039 Ga0500639_000039_34909_35880 323
1210 3300053163 Ga0500639_003558 Ga0500639_003558_1342_2313 323
1211 3300053177 Ga0500636_0000016 Ga0500636_0000016_12459_13430 323
1212 3300053177 Ga0500636_0019099 Ga0500636_0019099_1252_2223 323
1213 3300053178 Ga0500637_0000336 Ga0500637_0000336_7141_8112 323
1214 3300053178 Ga0500637_0020933 Ga0500637_0020933_71_1042 323
1215 3300053178 Ga0500637_0032525 Ga0500637_0032525_1167_2138 323
1216 3300053730 Ga0500645_007056 Ga0500645_007056_1795_2766 323
1217 3300053733 Ga0500552_002242 Ga0500552_002242_421_1392 323
1218 3300053735 Ga0500596_001190 Ga0500596_001190_1960_2931 323
1219 3300053735 Ga0500596_002651 Ga0500596_002651_1139_2110 323
1220 3300053737 Ga0500601_000237 Ga0500601_000237_2788_3759 323
1221 iso_pu_bacteria 2932801729 2932805252 323
1222 iso_pu_bacteria 2935883170 2935887660 323
1223 iso_pu_bacteria 3005718088 3005724702 323
1224 iso_pu_bacteria 8056689827 8056690866 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02915

Rubrerythrin

Rubrerythrin

49

186

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s5k-assembly1.cif.gz_B m. xanthus ferritin-like protein encb 0.9966 98 144
7s5c-assembly1.cif.gz_F m. xanthus ferritin-like protein encb 0.982 94 147
7s5c-assembly1.cif.gz_J m. xanthus ferritin-like protein encb 0.9819 94 147
7s5c-assembly1.cif.gz_G m. xanthus ferritin-like protein encb 0.9009 94 153
7s5c-assembly1.cif.gz_I m. xanthus ferritin-like protein encb 0.897 93 153
ID Description Score Start End Superfamily
af_A0A0R4IA57_86_156_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.9022 97 145 1.20.58.80
af_Q8IKQ5_5_77_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8608 97 147 1.20.58.80
af_Q9R1S8_86_155_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.859 97 148 1.20.58.80
4etrB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8567 9 147 1.20.1260.10
3k6cH00 Special;Helix non-globular;Helix Hairpins; 0.8522 93 147 6.10.140.1960
ID Description Score Start End GO Terms
AF-A0A7W0ML71-F1-model_v4 Rubrerythrin family protein 0.9916 2 142 GO:0016491
GO:0046872
AF-A0A529NKI1-F1-model_v4 Rubrerythrin family protein 0.9907 2 81 GO:0016491
GO:0046872
AF-A0A529U558-F1-model_v4 deleted 0.9902 2 106
AF-A0A2V9ZKR0-F1-model_v4 Rubrerythrin 0.9874 2 87 GO:0016491
GO:0046872
AF-X1CHA1-F1-model_v4 Rubrerythrin diiron-binding domain-containing protein 0.9862 2 87 GO:0016491
GO:0046872

Feature Viewer

pLDDT pTM Quality
82.96 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map