F491880

General Info

Members Datasets Scaffolds Average Seq Length
1223 371 2446 134

Family's Representative Sequence

Representative Sequence 3300004801|Ga0058860_11971705|Ga0058860_119717051
Length 146
Sequence MSMDLGGAKGGVKSDINVTPLVDVMAPMLEQGVQVKLPKASNASPKPQSQDQTIIAIGANRSMYINAKPVQEAELATKVSELLENKPGGEKIVIIRADEEVEYGAVMAAMDQLRQAGIEDIGLITQPTAQTGGAMSPAPAPAAGGR

Samples

Sample ID Description Type Environment
1 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
18 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
24 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
76 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
77 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
78 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
79 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
98 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
118 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
119 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
123 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
124 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
140 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
220 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
221 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
222 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
223 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
224 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
225 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
226 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
229 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
230 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
231 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
235 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
236 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
237 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
238 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
239 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
240 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
241 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
254 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
259 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
262 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
266 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
267 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
268 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
272 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
278 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
279 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
280 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
281 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
287 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
290 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
291 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
314 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
319 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
320 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
321 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
322 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
323 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
324 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
325 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
326 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.09
Metatranscriptomes 21.91
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.08
Nodule 0
Rhizoplane 4.17
Rhizosphere 93.38
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058860_11971705 3300004801 Bacteria 707
2 JGI24738J21930_10114224 3300002075 Unclassified 583
3 Ga0006778J45830_1030434 3300003162 Bacteria 1919
4 Ga0006759J45824_1018877 3300003163 Bacteria 1081
5 Ga0006759J45824_1018878 3300003163 Bacteria 1541
6 Ga0006759J45824_1034533 3300003163 Bacteria 1404
7 Ga0006759J45824_1059298 3300003163 Bacteria 694
8 Ga0006770J48903_1023257 3300003305 Bacteria 1015
9 Ga0006777J48905_1045790 3300003308 Bacteria 1300
10 Ga0006777J48905_1077046 3300003308 Bacteria 737
11 Ga0007417J51691_1016316 3300003544 Bacteria 948
12 Ga0007417J51691_1017946 3300003544 Bacteria 1687
13 Ga0007417J51691_1037647 3300003544 Bacteria 933
14 Ga0007417J51691_1055751 3300003544 Bacteria 1818
15 Ga0006781J51513_1024867 3300003568 Bacteria 1278
16 Ga0007410J51695_1022997 3300003574 Bacteria 1104
17 Ga0007410J51695_1034284 3300003574 Bacteria 773
18 Ga0007410J51695_1034286 3300003574 Bacteria 581
19 Ga0007410J51695_1036572 3300003574 Bacteria 1012
20 Ga0007410J51695_1039952 3300003574 Bacteria 1037
21 Ga0007410J51695_1040499 3300003574 Bacteria 818
22 Ga0007410J51695_1050590 3300003574 Bacteria 617
23 Ga0007409J51694_1014135 3300003575 Bacteria 1903
24 Ga0007409J51694_1017048 3300003575 Unclassified 1183
25 Ga0007409J51694_1034836 3300003575 Bacteria 1039
26 Ga0007409J51694_1038310 3300003575 Bacteria 687
27 Ga0007409J51694_1053687 3300003575 Bacteria 684
28 Ga0007409J51694_1054438 3300003575 Bacteria 623
29 Ga0007416J51690_1013238 3300003577 Bacteria 2000
30 Ga0007416J51690_1018448 3300003577 Bacteria 899
31 Ga0007416J51690_1034508 3300003577 Bacteria 924
32 Ga0007416J51690_1045110 3300003577 Bacteria 942
33 Ga0007416J51690_1045924 3300003577 Bacteria 952
34 Ga0007416J51690_1069212 3300003577 Bacteria 517
35 Ga0007429J51699_1027866 3300003579 Bacteria 1343
36 Ga0007429J51699_1045355 3300003579 Bacteria 1179
37 Ga0007429J51699_1049471 3300003579 Bacteria 921
38 Ga0007429J51699_1070095 3300003579 Bacteria 582
39 Ga0007415J51800_118343 3300003613 Bacteria 608
40 Ga0032354_1019356 3300003693 Bacteria 1959
41 Ga0032354_1029587 3300003693 Bacteria 1169
42 Ga0032354_1072768 3300003693 Bacteria 1203
43 Ga0006780_1030866 3300003735 Bacteria 1069
44 Ga0006780_1045787 3300003735 Bacteria 870
45 Ga0058858_1387962 3300004785 Bacteria 551
46 Ga0058858_1418458 3300004785 Bacteria 1145
47 Ga0058858_1420912 3300004785 Bacteria 882
48 Ga0058859_10012600 3300004798 Bacteria 1161
49 Ga0058859_10028325 3300004798 Bacteria 1160
50 Ga0058859_10034249 3300004798 Bacteria 1152
51 Ga0058859_11758045 3300004798 Bacteria 691
52 Ga0058859_11766987 3300004798 Bacteria 1256
53 Ga0058859_11770865 3300004798 Bacteria 1027
54 Ga0058859_11774989 3300004798 Bacteria 1127
55 Ga0058859_11790302 3300004798 Bacteria 804
56 Ga0058859_11820220 3300004798 Bacteria 1148
57 Ga0058863_10070689 3300004799 Bacteria 1483
58 Ga0058863_10081328 3300004799 Bacteria 2772
59 Ga0058863_11822787 3300004799 Bacteria 839
60 Ga0058863_11839074 3300004799 Bacteria 570
61 Ga0058863_11918591 3300004799 Bacteria 1145
62 Ga0058861_10028105 3300004800 Bacteria 1068
63 Ga0058861_10195728 3300004800 Bacteria 1458
64 Ga0058861_12070956 3300004800 Bacteria 1200
65 Ga0058860_10009161 3300004801 Bacteria 1839
66 Ga0058860_10015927 3300004801 Bacteria 824
67 Ga0058860_10023448 3300004801 Bacteria 1128
68 Ga0058860_10031814 3300004801 Bacteria 1308
69 Ga0058860_10048813 3300004801 Bacteria 1108
70 Ga0058860_10088307 3300004801 Bacteria 1060
71 Ga0058860_10137492 3300004801 Bacteria 1083
72 Ga0058860_10159832 3300004801 Bacteria 979
73 Ga0058860_12095346 3300004801 Bacteria 808
74 Ga0058860_12141545 3300004801 Bacteria 1157
75 Ga0058860_12160390 3300004801 Bacteria 1112
76 Ga0058860_12169525 3300004801 Bacteria 660
77 Ga0058860_12178039 3300004801 Bacteria 1047
78 Ga0058860_12180345 3300004801 Bacteria 612
79 Ga0058862_10197566 3300004803 Bacteria 1198
80 Ga0058862_12780275 3300004803 Bacteria 723
81 Ga0058862_12848465 3300004803 Bacteria 663
82 Ga0058862_12851153 3300004803 Bacteria 1095
83 Ga0065714_10119658 3300005288 Bacteria 1364
84 Ga0065704_10468849 3300005289 Bacteria 691
85 Ga0065704_10473311 3300005289 Bacteria 687
86 Ga0065712_10013945 3300005290 Bacteria 2491
87 Ga0065712_10101541 3300005290 Bacteria 2028
88 Ga0065712_10227925 3300005290 Bacteria 1008
89 Ga0065712_10505872 3300005290 Bacteria 637
90 Ga0065715_10064082 3300005293 Bacteria 725
91 Ga0065715_10309406 3300005293 Bacteria 999
92 Ga0065715_10509836 3300005293 Bacteria 772
93 Ga0065715_10696094 3300005293 Bacteria 649
94 Ga0065707_10043621 3300005295 Bacteria 1022
95 Ga0065707_10146777 3300005295 Bacteria 1683
96 Ga0065707_10456945 3300005295 Bacteria 795
97 Ga0070658_10884188 3300005327 Bacteria 777
98 Ga0070676_10013768 3300005328 Bacteria 4434
99 Ga0070676_10136905 3300005328 Bacteria 1555
100 Ga0070676_10137425 3300005328 Bacteria 1552
101 Ga0070676_10969671 3300005328 Bacteria 637
102 Ga0070676_11099119 3300005328 Bacteria 601
103 Ga0070683_100570240 3300005329 Bacteria 1083
104 Ga0070683_101722893 3300005329 Bacteria 603
105 Ga0070690_100037393 3300005330 Bacteria 3059
106 Ga0070690_100139612 3300005330 Bacteria 1644
107 Ga0070690_100177389 3300005330 Bacteria 1470
108 Ga0070670_100135630 3300005331 Bacteria 2127
109 Ga0070670_100280288 3300005331 Bacteria 1455
110 Ga0070670_100637179 3300005331 Bacteria 955
111 Ga0070677_10045567 3300005333 Bacteria 1750
112 Ga0070677_10733988 3300005333 Bacteria 559
113 Ga0068869_100040768 3300005334 Bacteria 3322
114 Ga0068869_100057218 3300005334 Bacteria 2846
115 Ga0068869_100410396 3300005334 Bacteria 1115
116 Ga0068869_100444482 3300005334 Bacteria 1074
117 Ga0070666_10075724 3300005335 Bacteria 2295
118 Ga0070666_10087294 3300005335 Bacteria 2138
119 Ga0070666_10097726 3300005335 Bacteria 2022
120 Ga0070666_10151304 3300005335 Bacteria 1619
121 Ga0070666_10187504 3300005335 Bacteria 1452
122 Ga0070666_10211254 3300005335 Bacteria 1367
123 Ga0070666_10839649 3300005335 Bacteria 678
124 Ga0070680_100344858 3300005336 Bacteria 1266
125 Ga0070680_101510665 3300005336 Bacteria 582
126 Ga0070682_101417005 3300005337 Bacteria 595
127 Ga0068868_100113892 3300005338 Bacteria 2200
128 Ga0068868_100923237 3300005338 Bacteria 794
129 Ga0070660_100000836 3300005339 Bacteria 20489
130 Ga0070660_101285784 3300005339 Bacteria 621
131 Ga0070689_100130558 3300005340 Bacteria 2014
132 Ga0070689_100296667 3300005340 Bacteria 1345
133 Ga0070691_10001161 3300005341 Bacteria 10983
134 Ga0070687_100023353 3300005343 Bacteria 2938
135 Ga0070687_100422493 3300005343 Bacteria 880
136 Ga0070687_100677536 3300005343 Bacteria 718
137 Ga0070692_10060111 3300005345 Bacteria 1999
138 Ga0070692_11129544 3300005345 Bacteria 555
139 Ga0070668_100005545 3300005347 Bacteria 9365
140 Ga0070669_100002989 3300005353 Bacteria 12187
141 Ga0070669_100049679 3300005353 Bacteria 3062
142 Ga0070669_101587132 3300005353 Bacteria 569
143 Ga0070675_100100692 3300005354 Bacteria 2433
144 Ga0070675_100594086 3300005354 Bacteria 1004
145 Ga0070675_101055632 3300005354 Bacteria 746
146 Ga0070675_101190136 3300005354 Bacteria 701
147 Ga0070675_101250526 3300005354 Bacteria 684
148 Ga0070675_101261462 3300005354 Bacteria 681
149 Ga0070671_100059879 3300005355 Bacteria 3169
150 Ga0070671_100505558 3300005355 Bacteria 1040
151 Ga0070671_100553974 3300005355 Unclassified 992
152 Ga0070671_100871937 3300005355 Bacteria 786
153 Ga0070674_100134805 3300005356 Bacteria 1846
154 Ga0070674_100151538 3300005356 Bacteria 1750
155 Ga0070674_100287860 3300005356 Bacteria 1305
156 Ga0070674_100479984 3300005356 Bacteria 1031
157 Ga0070674_101211439 3300005356 Bacteria 670
158 Ga0070673_100196965 3300005364 Bacteria 1733
159 Ga0070673_100234065 3300005364 Bacteria 1594
160 Ga0070673_100346356 3300005364 Bacteria 1318
161 Ga0070673_101034427 3300005364 Bacteria 765
162 Ga0070673_101093310 3300005364 Bacteria 745
163 Ga0070688_100009090 3300005365 Bacteria 5419
164 Ga0070659_100443220 3300005366 Bacteria 1100
165 Ga0070659_101182913 3300005366 Bacteria 676
166 Ga0070667_100069513 3300005367 Bacteria 2997
167 Ga0070667_100208445 3300005367 Bacteria 1737
168 Ga0070667_100296183 3300005367 Bacteria 1456
169 Ga0070667_101120937 3300005367 Bacteria 736
170 Ga0070709_10177843 3300005434 Bacteria 1492
171 Ga0070714_100001653 3300005435 Bacteria 16226
172 Ga0070701_10050773 3300005438 Bacteria 2149
173 Ga0070701_10877571 3300005438 Bacteria 618
174 Ga0070711_100528673 3300005439 Bacteria 976
175 Ga0070711_100818268 3300005439 Bacteria 791
176 Ga0070705_100032997 3300005440 Bacteria 2882
177 Ga0070705_100308616 3300005440 Bacteria 1137
178 Ga0070705_101201753 3300005440 Bacteria 625
179 Ga0070700_100002448 3300005441 Bacteria 9444
180 Ga0070700_100176651 3300005441 Bacteria 1483
181 Ga0070694_100027813 3300005444 Bacteria 3675
182 Ga0070694_100258703 3300005444 Bacteria 1319
183 Ga0070694_100262094 3300005444 Bacteria 1311
184 Ga0070694_100356548 3300005444 Bacteria 1134
185 Ga0070694_100755189 3300005444 Bacteria 794
186 Ga0070708_100480281 3300005445 Bacteria 1172
187 Ga0070678_100046207 3300005456 Bacteria 3120
188 Ga0070678_100239487 3300005456 Bacteria 1516
189 Ga0070678_100314355 3300005456 Bacteria 1336
190 Ga0070678_102096218 3300005456 Bacteria 536
191 Ga0070662_100089053 3300005457 Bacteria 2314
192 Ga0070662_100108497 3300005457 Bacteria 2111
193 Ga0070662_100276906 3300005457 Bacteria 1357
194 Ga0070681_10007994 3300005458 Bacteria 10352
195 Ga0070681_10032094 3300005458 Bacteria 5270
196 Ga0070681_10808537 3300005458 Bacteria 855
197 Ga0068867_100035037 3300005459 Bacteria 3639
198 Ga0068867_100070165 3300005459 Bacteria 2619
199 Ga0068867_100109245 3300005459 Bacteria 2123
200 Ga0068867_100122705 3300005459 Bacteria 2010
201 Ga0068867_100130175 3300005459 Bacteria 1954
202 Ga0070685_10337383 3300005466 Bacteria 1027
203 Ga0070685_10661972 3300005466 Bacteria 758
204 Ga0070685_11222026 3300005466 Bacteria 572
205 Ga0070707_100555178 3300005468 Bacteria 1111
206 Ga0070707_100795200 3300005468 Bacteria 910
207 Ga0070707_100982333 3300005468 Bacteria 810
208 Ga0070707_101222612 3300005468 Bacteria 717
209 Ga0070707_101527923 3300005468 Bacteria 634
210 Ga0070698_100036863 3300005471 Bacteria 5046
211 Ga0070698_100448508 3300005471 Bacteria 1226
212 Ga0070698_100448608 3300005471 Bacteria 1225
213 Ga0070698_101030235 3300005471 Bacteria 771
214 Ga0070698_101052003 3300005471 Bacteria 762
215 Ga0070699_100102708 3300005518 Bacteria 2507
216 Ga0070699_100349593 3300005518 Bacteria 1332
217 Ga0070699_100719177 3300005518 Bacteria 913
218 Ga0070679_100037523 3300005530 Bacteria 4815
219 Ga0070684_101008080 3300005535 Bacteria 782
220 Ga0070697_100261836 3300005536 Bacteria 1481
221 Ga0070697_100429005 3300005536 Bacteria 1149
222 Ga0070697_101004219 3300005536 Bacteria 742
223 Ga0070697_101084871 3300005536 Bacteria 712
224 Ga0070697_101130158 3300005536 Bacteria 697
225 Ga0070697_101255643 3300005536 Unclassified 660
226 Ga0068853_100190938 3300005539 Bacteria 1861
227 Ga0068853_100464462 3300005539 Bacteria 1192
228 Ga0070672_100104669 3300005543 Bacteria 2299
229 Ga0070672_100226932 3300005543 Bacteria 1568
230 Ga0070672_100753670 3300005543 Bacteria 855
231 Ga0070672_100909384 3300005543 Bacteria 777
232 Ga0070672_101226119 3300005543 Bacteria 669
233 Ga0070686_100012299 3300005544 Bacteria 4869
234 Ga0070686_100158777 3300005544 Bacteria 1590
235 Ga0070686_100212740 3300005544 Bacteria 1393
236 Ga0070686_100828974 3300005544 Bacteria 747
237 Ga0070695_100002218 3300005545 Bacteria 11131
238 Ga0070695_100066638 3300005545 Bacteria 2347
239 Ga0070695_100111603 3300005545 Bacteria 1856
240 Ga0070695_100285841 3300005545 Bacteria 1214
241 Ga0070695_100331417 3300005545 Bacteria 1135
242 Ga0070695_100370163 3300005545 Bacteria 1079
243 Ga0070695_100905560 3300005545 Bacteria 713
244 Ga0070696_100007825 3300005546 Bacteria 7135
245 Ga0070696_100184973 3300005546 Bacteria 1547
246 Ga0070696_100204202 3300005546 Bacteria 1476
247 Ga0070696_100517445 3300005546 Bacteria 952
248 Ga0070665_100007928 3300005548 Bacteria 10765
249 Ga0070665_100012708 3300005548 Bacteria 8479
250 Ga0070665_100013730 3300005548 Bacteria 8152
251 Ga0070665_100074367 3300005548 Bacteria 3403
252 Ga0070665_100139417 3300005548 Bacteria 2429
253 Ga0070665_100464555 3300005548 Bacteria 1276
254 Ga0070665_100543529 3300005548 Bacteria 1174
255 Ga0070704_100003047 3300005549 Bacteria 9536
256 Ga0070704_100045815 3300005549 Bacteria 3045
257 Ga0070704_100914918 3300005549 Bacteria 790
258 Ga0068855_100031256 3300005563 Bacteria 6359
259 Ga0068855_100197523 3300005563 Bacteria 2266
260 Ga0068855_100511517 3300005563 Bacteria 1304
261 Ga0070664_100100511 3300005564 Bacteria 2514
262 Ga0070664_100388134 3300005564 Bacteria 1275
263 Ga0068857_100018182 3300005577 Bacteria 6166
264 Ga0068857_100176840 3300005577 Bacteria 1942
265 Ga0068857_102143477 3300005577 Bacteria 549
266 Ga0068854_100029698 3300005578 Bacteria 3786
267 Ga0068854_100033337 3300005578 Bacteria 3590
268 Ga0068854_100089426 3300005578 Bacteria 2288
269 Ga0068854_101138432 3300005578 Bacteria 697
270 Ga0070702_100167942 3300005615 Bacteria 1424
271 Ga0070702_100763966 3300005615 Bacteria 744
272 Ga0068852_100608404 3300005616 Bacteria 1098
273 Ga0068852_101556192 3300005616 Bacteria 684
274 Ga0068859_100026299 3300005617 Bacteria 5834
275 Ga0068859_100027234 3300005617 Bacteria 5734
276 Ga0068859_100449082 3300005617 Bacteria 1385
277 Ga0068859_100614700 3300005617 Bacteria 1179
278 Ga0068859_100885786 3300005617 Bacteria 978
279 Ga0068859_101200368 3300005617 Bacteria 836
280 Ga0068864_100012674 3300005618 Bacteria 6969
281 Ga0068864_100014594 3300005618 Bacteria 6525
282 Ga0068864_100261595 3300005618 Bacteria 1610
283 Ga0068864_100492726 3300005618 Bacteria 1178
284 Ga0068866_10022595 3300005718 Bacteria 2913
285 Ga0068866_10077708 3300005718 Bacteria 1773
286 Ga0068866_10133412 3300005718 Bacteria 1416
287 Ga0068866_10364883 3300005718 Bacteria 922
288 Ga0068861_100006774 3300005719 Bacteria 7825
289 Ga0068861_100152993 3300005719 Bacteria 1895
290 Ga0068861_100440295 3300005719 Bacteria 1165
291 Ga0068861_100786791 3300005719 Bacteria 892
292 Ga0068861_101175238 3300005719 Bacteria 741
293 Ga0068851_10092221 3300005834 Bacteria 1596
294 Ga0068851_10290262 3300005834 Bacteria 938
295 Ga0068870_10022372 3300005840 Bacteria 3106
296 Ga0068870_10368305 3300005840 Bacteria 927
297 Ga0068870_10512242 3300005840 Bacteria 801
298 Ga0068870_10563531 3300005840 Bacteria 769
299 Ga0068863_100016899 3300005841 Bacteria 6998
300 Ga0068863_100098158 3300005841 Bacteria 2782
301 Ga0068863_100804299 3300005841 Bacteria 938
302 Ga0068863_101244386 3300005841 Bacteria 751
303 Ga0068858_100014306 3300005842 Bacteria 7482
304 Ga0068858_100030415 3300005842 Bacteria 5013
305 Ga0068858_100062432 3300005842 Bacteria 3445
306 Ga0068858_100065796 3300005842 Bacteria 3355
307 Ga0068858_100194660 3300005842 Bacteria 1916
308 Ga0068858_100453116 3300005842 Bacteria 1236
309 Ga0068858_101028565 3300005842 Bacteria 808
310 Ga0068858_101836636 3300005842 Bacteria 599
311 Ga0068860_100068273 3300005843 Bacteria 3377
312 Ga0068860_100105308 3300005843 Bacteria 2694
313 Ga0068860_100223748 3300005843 Bacteria 1827
314 Ga0068860_100242444 3300005843 Bacteria 1753
315 Ga0068860_100739917 3300005843 Bacteria 995
316 Ga0068862_100011268 3300005844 Bacteria 7382
317 Ga0068862_100236380 3300005844 Bacteria 1659
318 Ga0068862_100329873 3300005844 Bacteria 1411
319 Ga0068862_100555445 3300005844 Bacteria 1097
320 Ga0068862_100648020 3300005844 Bacteria 1019
321 Ga0081455_10325541 3300005937 Bacteria 1093
322 Ga0081455_11020447 3300005937 Bacteria 512
323 Ga0081539_10032974 3300005985 Bacteria 3162
324 Ga0070716_100259779 3300006173 Bacteria 1188
325 Ga0097621_100008334 3300006237 Bacteria 7460
326 Ga0097621_100017544 3300006237 Bacteria 5438
327 Ga0097621_100023295 3300006237 Bacteria 4819
328 Ga0097621_100029261 3300006237 Bacteria 4349
329 Ga0097621_100166922 3300006237 Bacteria 1895
330 Ga0097621_100193907 3300006237 Bacteria 1761
331 Ga0097621_100285541 3300006237 Bacteria 1454
332 Ga0097621_100365075 3300006237 Bacteria 1287
333 Ga0097621_100369918 3300006237 Bacteria 1278
334 Ga0068871_100013241 3300006358 Bacteria 6117
335 Ga0068871_100019001 3300006358 Bacteria 5238
336 Ga0068871_100096303 3300006358 Bacteria 2472
337 Ga0068871_100207272 3300006358 Bacteria 1695
338 Ga0068871_100384226 3300006358 Bacteria 1248
339 Ga0068871_100630863 3300006358 Bacteria 977
340 Ga0075428_100305044 3300006844 Bacteria 1712
341 Ga0075428_100375919 3300006844 Bacteria 1523
342 Ga0075428_100480767 3300006844 Bacteria 1329
343 Ga0075428_101106899 3300006844 Bacteria 836
344 Ga0075428_101614753 3300006844 Bacteria 678
345 Ga0075431_101180148 3300006847 Bacteria 729
346 Ga0075431_101243050 3300006847 Bacteria 707
347 Ga0075433_10082878 3300006852 Bacteria 2829
348 Ga0075433_10102024 3300006852 Bacteria 2540
349 Ga0075433_10105195 3300006852 Bacteria 2500
350 Ga0075433_10257762 3300006852 Bacteria 1547
351 Ga0075433_10269006 3300006852 Bacteria 1510
352 Ga0075433_10321220 3300006852 Bacteria 1370
353 Ga0075433_10459178 3300006852 Bacteria 1122
354 Ga0075433_10581570 3300006852 Bacteria 984
355 Ga0075434_100001358 3300006871 Bacteria 20536
356 Ga0075434_100032496 3300006871 Bacteria 5145
357 Ga0075434_100126849 3300006871 Bacteria 2569
358 Ga0075434_100181207 3300006871 Bacteria 2126
359 Ga0075434_100441350 3300006871 Bacteria 1323
360 Ga0075434_100464561 3300006871 Bacteria 1287
361 Ga0075434_100526286 3300006871 Bacteria 1203
362 Ga0075434_100730066 3300006871 Bacteria 1008
363 Ga0075434_101197668 3300006871 Bacteria 772
364 Ga0075434_101536605 3300006871 Bacteria 674
365 Ga0075434_102264213 3300006871 Bacteria 547
366 Ga0075429_100601238 3300006880 Bacteria 964
367 Ga0075429_100745879 3300006880 Bacteria 858
368 Ga0068865_100001357 3300006881 Bacteria 14249
369 Ga0068865_100058080 3300006881 Bacteria 2701
370 Ga0068865_100318813 3300006881 Bacteria 1249
371 Ga0068865_100368272 3300006881 Bacteria 1169
372 Ga0068865_100538864 3300006881 Bacteria 979
373 Ga0068865_101338951 3300006881 Bacteria 638
374 Ga0075436_100007215 3300006914 Bacteria 7604
375 Ga0075436_100016853 3300006914 Bacteria 5000
376 Ga0075436_100068008 3300006914 Bacteria 2461
377 Ga0075436_100269086 3300006914 Bacteria 1216
378 Ga0075436_100316664 3300006914 Bacteria 1120
379 Ga0097620_100026299 3300006931 Bacteria 5834
380 Ga0097620_100027234 3300006931 Bacteria 5734
381 Ga0097620_100449067 3300006931 Bacteria 1385
382 Ga0097620_100614686 3300006931 Bacteria 1179
383 Ga0097620_100885833 3300006931 Bacteria 978
384 Ga0097620_101133611 3300006931 Bacteria 861
385 Ga0097620_101200344 3300006931 Bacteria 836
386 Ga0075435_100001736 3300007076 Bacteria 14173
387 Ga0075435_100002501 3300007076 Bacteria 12223
388 Ga0075435_100015933 3300007076 Bacteria 5660
389 Ga0075435_100026242 3300007076 Bacteria 4543
390 Ga0075435_100053956 3300007076 Bacteria 3243
391 Ga0075435_100223443 3300007076 Bacteria 1599
392 Ga0075435_100317409 3300007076 Bacteria 1333
393 Ga0105250_10368979 3300009092 Bacteria 631
394 Ga0105250_10486197 3300009092 Bacteria 558
395 Ga0105240_10030262 3300009093 Bacteria 7037
396 Ga0105240_10101147 3300009093 Bacteria 3507
397 Ga0105240_10336827 3300009093 Bacteria 1715
398 Ga0105240_10687025 3300009093 Bacteria 1118
399 Ga0105240_11650427 3300009093 Bacteria 670
400 Ga0111539_10000755 3300009094 Bacteria 42078
401 Ga0111539_10008909 3300009094 Bacteria 12703
402 Ga0111539_10026986 3300009094 Bacteria 7014
403 Ga0111539_10092467 3300009094 Bacteria 3555
404 Ga0111539_10478172 3300009094 Bacteria 1451
405 Ga0111539_11568418 3300009094 Bacteria 764
406 Ga0105245_10028601 3300009098 Bacteria 4919
407 Ga0105245_10034825 3300009098 Bacteria 4467
408 Ga0105245_10293636 3300009098 Bacteria 1593
409 Ga0105245_10533940 3300009098 Bacteria 1193
410 Ga0105245_11213277 3300009098 Bacteria 802
411 Ga0105245_12161364 3300009098 Bacteria 610
412 Ga0105247_10007823 3300009101 Bacteria 6542
413 Ga0105247_10016909 3300009101 Bacteria 4374
414 Ga0105247_10340481 3300009101 Bacteria 1052
415 Ga0105247_10823511 3300009101 Bacteria 710
416 Ga0105247_11273173 3300009101 Bacteria 589
417 Ga0114129_10004994 3300009147 Bacteria 18697
418 Ga0114129_10011461 3300009147 Bacteria 12623
419 Ga0114129_10034467 3300009147 Bacteria 7150
420 Ga0114129_10078908 3300009147 Bacteria 4578
421 Ga0114129_10091983 3300009147 Bacteria 4202
422 Ga0114129_10274169 3300009147 Bacteria 2256
423 Ga0114129_10282899 3300009147 Bacteria 2216
424 Ga0114129_10342488 3300009147 Bacteria 1982
425 Ga0114129_11812518 3300009147 Bacteria 742
426 Ga0114129_11975388 3300009147 Bacteria 706
427 Ga0114129_12096429 3300009147 Bacteria 682
428 Ga0114129_12433262 3300009147 Bacteria 627
429 Ga0105243_10056836 3300009148 Bacteria 3114
430 Ga0105243_10070818 3300009148 Bacteria 2817
431 Ga0105243_10642734 3300009148 Bacteria 1027
432 Ga0105243_10662488 3300009148 Bacteria 1013
433 Ga0105243_10895235 3300009148 Bacteria 882
434 Ga0105243_11232034 3300009148 Bacteria 763
435 Ga0105243_11465710 3300009148 Bacteria 705
436 Ga0105241_10208504 3300009174 Bacteria 1636
437 Ga0105241_12221683 3300009174 Bacteria 545
438 Ga0105242_10060524 3300009176 Bacteria 3112
439 Ga0105242_10063550 3300009176 Bacteria 3040
440 Ga0105242_10067088 3300009176 Bacteria 2965
441 Ga0105242_10471347 3300009176 Bacteria 1188
442 Ga0105242_11034974 3300009176 Bacteria 831
443 Ga0105242_11097137 3300009176 Bacteria 810
444 Ga0105242_11688917 3300009176 Bacteria 669
445 Ga0105242_12233543 3300009176 Bacteria 593
446 Ga0105248_10005069 3300009177 Bacteria 14544
447 Ga0105248_10078441 3300009177 Bacteria 3712
448 Ga0105248_10170465 3300009177 Bacteria 2453
449 Ga0105248_10240558 3300009177 Bacteria 2038
450 Ga0105248_10266037 3300009177 Bacteria 1930
451 Ga0105248_10338953 3300009177 Bacteria 1693
452 Ga0105248_10602238 3300009177 Bacteria 1240
453 Ga0105248_10797157 3300009177 Bacteria 1066
454 Ga0105248_10833247 3300009177 Bacteria 1041
455 Ga0105248_10956448 3300009177 Bacteria 967
456 Ga0105248_11202665 3300009177 Bacteria 857
457 Ga0105248_11203136 3300009177 Bacteria 857
458 Ga0105248_11347482 3300009177 Bacteria 807
459 Ga0105248_11797417 3300009177 Bacteria 695
460 Ga0105237_11704815 3300009545 Bacteria 637
461 Ga0105237_12352532 3300009545 Bacteria 543
462 Ga0105238_11032309 3300009551 Bacteria 844
463 Ga0105238_11389999 3300009551 Bacteria 729
464 Ga0105249_10335134 3300009553 Bacteria 1528
465 Ga0105249_10654729 3300009553 Bacteria 1108
466 Ga0105249_10869200 3300009553 Bacteria 968
467 Ga0105249_10894950 3300009553 Bacteria 954
468 Ga0105249_11796163 3300009553 Bacteria 686
469 Ga0105249_11889577 3300009553 Bacteria 670
470 Ga0105249_12176167 3300009553 Bacteria 627
471 Ga0105249_12271678 3300009553 Bacteria 615
472 Ga0105239_10162711 3300010375 Bacteria 2494
473 Ga0105239_10614280 3300010375 Bacteria 1240
474 Ga0105246_10508458 3300011119 Bacteria 1024
475 Ga0105246_10880543 3300011119 Bacteria 801
476 Ga0105246_11587835 3300011119 Bacteria 618
477 Ga0157339_1028622 3300012505 Bacteria 639
478 Ga0157324_1005689 3300012506 Bacteria 911
479 Ga0157371_10167789 3300013102 Bacteria 1568
480 Ga0157370_10468623 3300013104 Bacteria 1158
481 Ga0157374_10069753 3300013296 Bacteria 3310
482 Ga0157374_11021152 3300013296 Bacteria 846
483 Ga0157378_10242241 3300013297 Bacteria 1723
484 Ga0157378_10284204 3300013297 Bacteria 1596
485 Ga0157378_10375819 3300013297 Bacteria 1394
486 Ga0157378_10720645 3300013297 Bacteria 1018
487 Ga0157378_11039572 3300013297 Unclassified 854
488 Ga0157378_11241888 3300013297 Bacteria 785
489 Ga0157378_11302408 3300013297 Bacteria 768
490 Ga0157378_11396065 3300013297 Unclassified 743
491 Ga0157378_12062813 3300013297 Bacteria 621
492 Ga0163162_10099679 3300013306 Bacteria 2996
493 Ga0163162_10432928 3300013306 Bacteria 1447
494 Ga0163162_10887544 3300013306 Bacteria 1005
495 Ga0163162_10993190 3300013306 Bacteria 949
496 Ga0163162_11347172 3300013306 Bacteria 811
497 Ga0163162_11617505 3300013306 Bacteria 739
498 Ga0163162_11929880 3300013306 Bacteria 676
499 Ga0157372_10365312 3300013307 Bacteria 1682
500 Ga0157375_10036094 3300013308 Bacteria 4725
501 Ga0157375_10410957 3300013308 Bacteria 1519
502 Ga0157375_10434007 3300013308 Bacteria 1479
503 Ga0157375_10797944 3300013308 Bacteria 1093
504 Ga0157375_11706882 3300013308 Bacteria 746
505 Ga0157375_12331122 3300013308 Bacteria 638
506 Ga0163163_10042536 3300014325 Bacteria 4450
507 Ga0163163_10231581 3300014325 Bacteria 1897
508 Ga0163163_10242531 3300014325 Bacteria 1852
509 Ga0163163_10399302 3300014325 Bacteria 1433
510 Ga0157380_10198086 3300014326 Bacteria 1779
511 Ga0157380_10518045 3300014326 Bacteria 1162
512 Ga0157380_11014654 3300014326 Bacteria 864
513 Ga0157380_11647126 3300014326 Bacteria 698
514 Ga0157380_12509316 3300014326 Bacteria 581
515 Ga0157380_12936189 3300014326 Bacteria 543
516 Ga0157380_13211936 3300014326 Bacteria 522
517 Ga0157377_10117283 3300014745 Bacteria 1609
518 Ga0157377_10298849 3300014745 Bacteria 1062
519 Ga0157377_10906674 3300014745 Bacteria 659
520 Ga0157379_10003064 3300014968 Bacteria 14133
521 Ga0157379_10005965 3300014968 Bacteria 10501
522 Ga0157379_10063891 3300014968 Bacteria 3290
523 Ga0157379_10104398 3300014968 Bacteria 2543
524 Ga0157379_10202330 3300014968 Bacteria 1796
525 Ga0157379_10391762 3300014968 Bacteria 1276
526 Ga0157379_10395638 3300014968 Bacteria 1269
527 Ga0157379_10779698 3300014968 Bacteria 901
528 Ga0157379_11430726 3300014968 Bacteria 671
529 Ga0157379_11431866 3300014968 Bacteria 670
530 Ga0157376_10011929 3300014969 Bacteria 6427
531 Ga0157376_10307270 3300014969 Bacteria 1503
532 Ga0157376_10446644 3300014969 Bacteria 1260
533 Ga0157376_10566754 3300014969 Bacteria 1126
534 Ga0157376_11270112 3300014969 Bacteria 766
535 Ga0157376_11867499 3300014969 Bacteria 637
536 Ga0157376_11978697 3300014969 Bacteria 620
537 Ga0163161_10474974 3300017792 Bacteria 1014
538 Ga0163161_10607261 3300017792 Bacteria 902
539 Ga0197907_10887154 3300020069 Bacteria 2658
540 Ga0206356_11432270 3300020070 Bacteria 1063
541 Ga0206356_11624237 3300020070 Bacteria 1204
542 Ga0206356_11860972 3300020070 Bacteria 1096
543 Ga0206355_1495824 3300020076 Bacteria 941
544 Ga0206351_10784960 3300020077 Bacteria 969
545 Ga0206352_10542231 3300020078 Bacteria 906
546 Ga0206352_11109900 3300020078 Bacteria 1044
547 Ga0206354_10453284 3300020081 Bacteria 1013
548 Ga0224712_10047956 3300022467 Bacteria 1646
549 Ga0207697_10093685 3300025315 Bacteria 1274
550 Ga0207697_10381675 3300025315 Bacteria 626
551 Ga0207656_10032234 3300025321 Bacteria 2176
552 Ga0207696_1144202 3300025711 Bacteria 637
553 Ga0207682_10012771 3300025893 Bacteria 3276
554 Ga0207682_10063274 3300025893 Bacteria 1553
555 Ga0207692_11025832 3300025898 Bacteria 545
556 Ga0207642_10216397 3300025899 Bacteria 1068
557 Ga0207642_10581545 3300025899 Bacteria 695
558 Ga0207710_10008385 3300025900 Bacteria 4359
559 Ga0207710_10138900 3300025900 Bacteria 1172
560 Ga0207710_10164671 3300025900 Bacteria 1082
561 Ga0207710_10204618 3300025900 Bacteria 976
562 Ga0207710_10236266 3300025900 Bacteria 911
563 Ga0207688_10297517 3300025901 Bacteria 986
564 Ga0207680_10025132 3300025903 Bacteria 3282
565 Ga0207680_10172827 3300025903 Bacteria 1456
566 Ga0207680_10511148 3300025903 Bacteria 856
567 Ga0207680_10659128 3300025903 Bacteria 749
568 Ga0207685_10183868 3300025905 Bacteria 971
569 Ga0207685_10498023 3300025905 Bacteria 641
570 Ga0207685_10754441 3300025905 Bacteria 533
571 Ga0207699_10066470 3300025906 Bacteria 2189
572 Ga0207699_10655174 3300025906 Bacteria 767
573 Ga0207645_10001211 3300025907 Bacteria 21295
574 Ga0207645_10050366 3300025907 Bacteria 2659
575 Ga0207645_10073597 3300025907 Bacteria 2187
576 Ga0207645_10135616 3300025907 Bacteria 1603
577 Ga0207643_10027534 3300025908 Bacteria 3151
578 Ga0207643_10399155 3300025908 Bacteria 869
579 Ga0207643_10679300 3300025908 Bacteria 665
580 Ga0207705_11002030 3300025909 Bacteria 645
581 Ga0207684_10340941 3300025910 Bacteria 1291
582 Ga0207684_11148446 3300025910 Bacteria 645
583 Ga0207707_10024560 3300025912 Bacteria 5275
584 Ga0207707_10072855 3300025912 Bacteria 2994
585 Ga0207707_10129630 3300025912 Bacteria 2206
586 Ga0207695_10433116 3300025913 Bacteria 1199
587 Ga0207695_10542603 3300025913 Bacteria 1044
588 Ga0207695_10638451 3300025913 Bacteria 946
589 Ga0207671_10516880 3300025914 Bacteria 952
590 Ga0207663_10284281 3300025916 Bacteria 1230
591 Ga0207663_10380405 3300025916 Bacteria 1075
592 Ga0207660_10243424 3300025917 Bacteria 1418
593 Ga0207660_10360092 3300025917 Bacteria 1167
594 Ga0207662_10011646 3300025918 Bacteria 4885
595 Ga0207662_10172047 3300025918 Bacteria 1389
596 Ga0207662_10313673 3300025918 Bacteria 1045
597 Ga0207662_10343990 3300025918 Bacteria 1000
598 Ga0207662_10459508 3300025918 Bacteria 872
599 Ga0207657_10002850 3300025919 Bacteria 18583
600 Ga0207657_10734604 3300025919 Bacteria 765
601 Ga0207652_10051931 3300025921 Bacteria 3517
602 Ga0207652_10815665 3300025921 Bacteria 828
603 Ga0207646_10059862 3300025922 Bacteria 3401
604 Ga0207646_10720154 3300025922 Bacteria 891
605 Ga0207646_10818770 3300025922 Bacteria 829
606 Ga0207646_11279588 3300025922 Bacteria 641
607 Ga0207646_11597452 3300025922 Bacteria 562
608 Ga0207681_10015878 3300025923 Bacteria 4700
609 Ga0207681_10020093 3300025923 Bacteria 4228
610 Ga0207681_10045177 3300025923 Bacteria 2956
611 Ga0207681_10201307 3300025923 Bacteria 1529
612 Ga0207694_10104022 3300025924 Bacteria 2252
613 Ga0207694_10228140 3300025924 Bacteria 1520
614 Ga0207694_10246893 3300025924 Bacteria 1460
615 Ga0207694_11248729 3300025924 Bacteria 628
616 Ga0207650_10107865 3300025925 Bacteria 2152
617 Ga0207650_11033185 3300025925 Bacteria 699
618 Ga0207659_10106102 3300025926 Bacteria 2127
619 Ga0207659_10494902 3300025926 Bacteria 1034
620 Ga0207659_10737203 3300025926 Bacteria 845
621 Ga0207687_10026017 3300025927 Bacteria 3917
622 Ga0207687_10060805 3300025927 Bacteria 2666
623 Ga0207687_10176697 3300025927 Bacteria 1651
624 Ga0207687_10374322 3300025927 Bacteria 1165
625 Ga0207687_10525910 3300025927 Bacteria 990
626 Ga0207687_10806032 3300025927 Bacteria 801
627 Ga0207687_10813285 3300025927 Bacteria 797
628 Ga0207644_10004183 3300025931 Bacteria 9365
629 Ga0207644_10389396 3300025931 Bacteria 1138
630 Ga0207644_10633506 3300025931 Bacteria 889
631 Ga0207644_10649360 3300025931 Bacteria 878
632 Ga0207644_11215884 3300025931 Bacteria 633
633 Ga0207690_10276906 3300025932 Bacteria 1306
634 Ga0207706_10135407 3300025933 Bacteria 2167
635 Ga0207706_10280677 3300025933 Bacteria 1453
636 Ga0207706_10485721 3300025933 Bacteria 1067
637 Ga0207686_10004178 3300025934 Bacteria 7746
638 Ga0207686_10040300 3300025934 Bacteria 2839
639 Ga0207686_10044062 3300025934 Bacteria 2737
640 Ga0207709_10056123 3300025935 Bacteria 2436
641 Ga0207709_10437882 3300025935 Bacteria 1007
642 Ga0207709_11196114 3300025935 Bacteria 626
643 Ga0207670_10020704 3300025936 Bacteria 4046
644 Ga0207670_10553551 3300025936 Bacteria 940
645 Ga0207669_10364858 3300025937 Bacteria 1120
646 Ga0207669_10427583 3300025937 Bacteria 1044
647 Ga0207669_10628088 3300025937 Bacteria 876
648 Ga0207704_10008908 3300025938 Bacteria 4819
649 Ga0207704_10061112 3300025938 Bacteria 2335
650 Ga0207704_10399726 3300025938 Bacteria 1084
651 Ga0207704_10754120 3300025938 Bacteria 810
652 Ga0207665_10292699 3300025939 Bacteria 1215
653 Ga0207665_10364524 3300025939 Bacteria 1093
654 Ga0207691_10092084 3300025940 Bacteria 2715
655 Ga0207691_10108559 3300025940 Bacteria 2469
656 Ga0207691_10220844 3300025940 Bacteria 1643
657 Ga0207691_10941864 3300025940 Bacteria 722
658 Ga0207711_10006661 3300025941 Bacteria 9723
659 Ga0207711_10011869 3300025941 Bacteria 7241
660 Ga0207711_10019410 3300025941 Bacteria 5661
661 Ga0207711_10069291 3300025941 Bacteria 3057
662 Ga0207711_10093774 3300025941 Bacteria 2645
663 Ga0207711_10218026 3300025941 Bacteria 1744
664 Ga0207711_10231152 3300025941 Bacteria 1694
665 Ga0207711_10235445 3300025941 Bacteria 1678
666 Ga0207711_10388703 3300025941 Bacteria 1295
667 Ga0207689_10106820 3300025942 Bacteria 2300
668 Ga0207689_10409050 3300025942 Bacteria 1131
669 Ga0207689_10427463 3300025942 Bacteria 1106
670 Ga0207661_10165249 3300025944 Bacteria 1923
671 Ga0207661_11338024 3300025944 Bacteria 658
672 Ga0207679_10180980 3300025945 Bacteria 1744
673 Ga0207679_11006799 3300025945 Bacteria 764
674 Ga0207667_10225136 3300025949 Bacteria 1921
675 Ga0207667_10260915 3300025949 Bacteria 1772
676 Ga0207667_10378297 3300025949 Bacteria 1443
677 Ga0207667_10585597 3300025949 Bacteria 1126
678 Ga0207651_10024523 3300025960 Bacteria 3733
679 Ga0207651_10153392 3300025960 Bacteria 1796
680 Ga0207651_10538928 3300025960 Bacteria 1013
681 Ga0207651_11192943 3300025960 Bacteria 683
682 Ga0207651_11217175 3300025960 Bacteria 676
683 Ga0207651_11357787 3300025960 Bacteria 639
684 Ga0207651_11866872 3300025960 Bacteria 540
685 Ga0207712_10048619 3300025961 Bacteria 2951
686 Ga0207712_10562738 3300025961 Bacteria 982
687 Ga0207712_10757180 3300025961 Bacteria 851
688 Ga0207712_11311303 3300025961 Bacteria 647
689 Ga0207668_10162758 3300025972 Bacteria 1740
690 Ga0207668_10809865 3300025972 Bacteria 829
691 Ga0207668_11621341 3300025972 Bacteria 584
692 Ga0207640_10012925 3300025981 Bacteria 4770
693 Ga0207640_10053128 3300025981 Bacteria 2643
694 Ga0207640_10251062 3300025981 Bacteria 1373
695 Ga0207640_10264992 3300025981 Bacteria 1341
696 Ga0207640_11487673 3300025981 Bacteria 608
697 Ga0207658_10204844 3300025986 Bacteria 1649
698 Ga0207658_10627332 3300025986 Bacteria 967
699 Ga0207658_11067029 3300025986 Bacteria 738
700 Ga0207658_11105351 3300025986 Bacteria 724
701 Ga0207677_10103051 3300026023 Bacteria 2105
702 Ga0207677_10234913 3300026023 Bacteria 1479
703 Ga0207677_10885670 3300026023 Bacteria 804
704 Ga0207703_10001811 3300026035 Bacteria 19051
705 Ga0207703_10012192 3300026035 Bacteria 6702
706 Ga0207703_10273955 3300026035 Bacteria 1530
707 Ga0207703_10326502 3300026035 Bacteria 1406
708 Ga0207703_10367984 3300026035 Bacteria 1327
709 Ga0207703_10607797 3300026035 Bacteria 1035
710 Ga0207703_12142001 3300026035 Bacteria 535
711 Ga0207639_10143192 3300026041 Bacteria 1994
712 Ga0207639_11392720 3300026041 Bacteria 658
713 Ga0207678_10608489 3300026067 Bacteria 958
714 Ga0207708_10027766 3300026075 Bacteria 4286
715 Ga0207708_10032297 3300026075 Bacteria 3976
716 Ga0207708_10169752 3300026075 Bacteria 1727
717 Ga0207708_11317551 3300026075 Bacteria 633
718 Ga0207641_10002105 3300026088 Bacteria 18816
719 Ga0207641_10327978 3300026088 Bacteria 1453
720 Ga0207641_10785253 3300026088 Bacteria 941
721 Ga0207641_10802377 3300026088 Bacteria 931
722 Ga0207648_10024373 3300026089 Bacteria 5401
723 Ga0207648_10045780 3300026089 Bacteria 3836
724 Ga0207648_10133044 3300026089 Bacteria 2189
725 Ga0207648_10166543 3300026089 Bacteria 1948
726 Ga0207648_10361086 3300026089 Bacteria 1310
727 Ga0207676_10039689 3300026095 Bacteria 3602
728 Ga0207676_10042982 3300026095 Bacteria 3476
729 Ga0207676_10093973 3300026095 Bacteria 2470
730 Ga0207676_10810560 3300026095 Bacteria 914
731 Ga0207676_10965976 3300026095 Bacteria 838
732 Ga0207676_10994175 3300026095 Bacteria 826
733 Ga0207674_10013671 3300026116 Bacteria 8991
734 Ga0207674_10058289 3300026116 Bacteria 3912
735 Ga0207674_11452602 3300026116 Bacteria 655
736 Ga0207675_100034095 3300026118 Bacteria 4744
737 Ga0207675_100065358 3300026118 Bacteria 3400
738 Ga0207675_100082114 3300026118 Bacteria 3022
739 Ga0207675_100184209 3300026118 Bacteria 2001
740 Ga0207675_100519391 3300026118 Bacteria 1187
741 Ga0207675_100711170 3300026118 Bacteria 1014
742 Ga0207675_100766054 3300026118 Bacteria 977
743 Ga0207675_101423666 3300026118 Bacteria 714
744 Ga0207683_10015366 3300026121 Bacteria 6518
745 Ga0207683_10113553 3300026121 Bacteria 2426
746 Ga0207683_10123395 3300026121 Bacteria 2327
747 Ga0207683_10632864 3300026121 Bacteria 991
748 Ga0207683_11355464 3300026121 Bacteria 658
749 Ga0207698_10369945 3300026142 Bacteria 1360
750 Ga0209999_1082553 3300027543 Bacteria 620
751 Ga0209998_10008773 3300027717 Bacteria 2094
752 Ga0209974_10044580 3300027876 Bacteria 1480
753 Ga0207428_10006364 3300027907 Bacteria 10922
754 Ga0207428_10008027 3300027907 Bacteria 9579
755 Ga0207428_10169775 3300027907 Bacteria 1652
756 Ga0207428_10463511 3300027907 Bacteria 923
757 Ga0268266_10013912 3300028379 Bacteria 6928
758 Ga0268266_10072243 3300028379 Bacteria 2992
759 Ga0268266_10079309 3300028379 Bacteria 2858
760 Ga0268266_10370467 3300028379 Bacteria 1349
761 Ga0268266_10657866 3300028379 Bacteria 1008
762 Ga0268266_11011693 3300028379 Unclassified 804
763 Ga0268265_10004086 3300028380 Bacteria 10255
764 Ga0268265_10108325 3300028380 Bacteria 2262
765 Ga0268265_10223626 3300028380 Bacteria 1649
766 Ga0268265_10783475 3300028380 Bacteria 928
767 Ga0268265_10853444 3300028380 Bacteria 891
768 Ga0268265_12444238 3300028380 Bacteria 529
769 Ga0268264_10142502 3300028381 Bacteria 2139
770 Ga0268264_10698346 3300028381 Bacteria 1007
771 Ga0268264_10716213 3300028381 Bacteria 995
772 Ga0268264_10758201 3300028381 Bacteria 967
773 Ga0268264_11422049 3300028381 Bacteria 704
774 Ga0268264_11804252 3300028381 Bacteria 622
775 Ga0268264_12110816 3300028381 Bacteria 572
776 Ga0307408_100244483 3300031548 Bacteria 1477
777 Ga0307408_100273024 3300031548 Bacteria 1405
778 Ga0265314_10106006 3300031711 Bacteria 1796
779 Ga0307413_11521900 3300031824 Bacteria 592
780 Ga0307410_10113237 3300031852 Bacteria 1966
781 Ga0307412_10155537 3300031911 Bacteria 1692
782 Ga0307412_11906985 3300031911 Bacteria 548
783 Ga0307411_10715933 3300032005 Bacteria 873
784 Ga0307415_100039893 3300032126 Bacteria 3107
785 Ga0307415_101404808 3300032126 Bacteria 665
786 Ga0373930_0014282 3300034816 Bacteria 1476
787 Ga0373948_0001910 3300034817 Bacteria 2988
788 Ga0373950_0011871 3300034818 Bacteria 1430
789 Ga0373958_0002174 3300034819 Bacteria 2718
790 Ga0373958_0045682 3300034819 Bacteria 911
791 Ga0373958_0048041 3300034819 Bacteria 894
792 Ga0373959_0002901 3300034820 Bacteria 2719
793 Ga0373938_0023726 3300034957 Bacteria 1263
794 Ga0373928_0001584 3300035084 Bacteria 4410
795 Ga0373928_0056678 3300035084 Bacteria 938
796 Ga0373929_0001310 3300035085 Bacteria 4796
797 Ga0373929_0083664 3300035085 Bacteria 782
798 Ga0373934_0397742 3300035086 Bacteria 575
799 Ga0373940_0004300 3300035088 Bacteria 3001
800 Ga0373949_0004565 3300035090 Bacteria 3158
801 Ga0373951_0009649 3300035091 Bacteria 2169
802 Ga0373952_0003164 3300035092 Bacteria 2963
803 Ga0373952_0092644 3300035092 Bacteria 787
804 Ga0373932_0001227 3300035112 Bacteria 7276
805 Ga0373932_0172272 3300035112 Bacteria 755
806 Ga0373936_0143794 3300035113 Bacteria 1031
807 Ga0373939_0000417 3300035114 Bacteria 10668
808 Ga0373939_0139925 3300035114 Bacteria 872
809 Ga0373939_0191461 3300035114 Bacteria 768
810 Ga0373941_0001684 3300035115 Bacteria 4734
811 Ga0373941_0043809 3300035115 Bacteria 1394
812 Ga0373945_0303319 3300035116 Bacteria 684
813 Ga0373953_0079484 3300035117 Bacteria 1362
814 Ga0373953_0089294 3300035117 Bacteria 1288
815 Ga0373953_0093027 3300035117 Bacteria 1263
816 Ga0373957_0271812 3300035120 Bacteria 716
817 Ga0373960_0000383 3300035121 Bacteria 8599
818 Ga0373960_0402306 3300035121 Bacteria 528
819 Ga0373943_0096711 3300035170 Bacteria 1538
820 Ga0373943_0174539 3300035170 Bacteria 1178
821 Ga0373946_0029613 3300035171 Bacteria 2181
822 Ga0373946_0496437 3300035171 Bacteria 626
823 Ga0373955_0588197 3300035172 Bacteria 681
824 Ga0373942_0000206 3300035207 Bacteria 15248
825 Ga0373942_0069474 3300035207 Bacteria 1026
826 Ga0373961_0000423 3300035241 Bacteria 17501
827 Ga0373961_0064331 3300035241 Bacteria 1121
828 Ga0373961_0381492 3300035241 Bacteria 537
829 Ga0373962_0002541 3300035242 Bacteria 4327
830 Ga0373962_0062658 3300035242 Bacteria 1095
831 Ga0373931_0002559 3300035691 Bacteria 8092
832 Ga0373931_0956720 3300035691 Bacteria 578
833 Ga0373927_0461142 3300035695 Bacteria 839
834 Ga0373927_0705189 3300035695 Bacteria 667
835 Ga0373933_0808964 3300035724 Bacteria 617
836 Ga0373947_0118463 3300035725 Bacteria 1680
837 Ga0373947_1142262 3300035725 Bacteria 531
838 Ga0373937_0018583 3300036401 Bacteria 6210
839 Ga0373937_0066960 3300036401 Bacteria 3309
840 Ga0373937_0074440 3300036401 Bacteria 3134
841 Ga0373937_0383329 3300036401 Bacteria 1333
842 Ga0373937_0514887 3300036401 Bacteria 1137
843 Ga0373937_0538121 3300036401 Bacteria 1110
844 Ga0373937_0772770 3300036401 Bacteria 908
845 Ga0373925_0119813 3300037068 Bacteria 2042
846 Ga0373925_0366733 3300037068 Bacteria 1171
847 Ga0373925_0618990 3300037068 Bacteria 892
848 Ga0373925_1491515 3300037068 Bacteria 553
849 Ga0395898_0851901 3300037466 Bacteria 851
850 Ga0436365_1564356 3300039437 Bacteria 899
851 Ga0451804_1053224 3300041463 Bacteria 886
852 Ga0451853_2421316 3300041512 Bacteria 543
853 Ga0439431_0200712 3300041997 Bacteria 581
854 Ga0453683_0521581 3300044673 Bacteria 772
855 Ga0466963_0022955 3300044694 Bacteria 3957
856 Ga0466964_0267614 3300044706 Unclassified 849
857 Ga0466957_0465128 3300044842 Bacteria 873
858 Ga0466957_1195512 3300044842 Bacteria 550
859 Ga0451576_0039489 3300045051 Bacteria 4995
860 Ga0451576_0123050 3300045051 Bacteria 2702
861 Ga0451576_0310851 3300045051 Bacteria 1649
862 Ga0451576_1165140 3300045051 Bacteria 805
863 Ga0466967_0381804 3300045976 Bacteria 1368
864 Ga0466967_0488346 3300045976 Bacteria 1207
865 Ga0466967_0693527 3300045976 Bacteria 1008
866 Ga0466967_0735542 3300045976 Bacteria 978
867 Ga0466967_1212865 3300045976 Bacteria 752
868 Ga0495603_0139429 3300046455 Bacteria 1411
869 Ga0495603_0359822 3300046455 Bacteria 835
870 Ga0495629_0260600 3300046459 Bacteria 1192
871 Ga0495629_0769683 3300046459 Bacteria 636
872 Ga0495629_1145709 3300046459 Bacteria 501
873 Ga0495582_0218983 3300046473 Bacteria 1089
874 Ga0495582_0471581 3300046473 Bacteria 725
875 Ga0495639_0585397 3300046475 Bacteria 573
876 Ga0495662_0449126 3300046476 Bacteria 633
877 Ga0495664_0493332 3300046477 Bacteria 732
878 Ga0495628_0343585 3300046516 Bacteria 1098
879 Ga0495630_0622722 3300046517 Bacteria 827
880 Ga0495630_0708402 3300046517 Bacteria 770
881 Ga0495666_0467059 3300046526 Bacteria 565
882 Ga0495642_0233952 3300046528 Bacteria 803
883 Ga0495652_0292822 3300046529 Bacteria 1187
884 Ga0495640_0014890 3300046533 Bacteria 5866
885 Ga0495586_0149511 3300046535 Bacteria 1314
886 Ga0495586_0212397 3300046535 Bacteria 1098
887 Ga0495621_0079804 3300046539 Bacteria 1219
888 Ga0495645_0000509 3300046543 Bacteria 26861
889 Ga0495635_0098051 3300046663 Bacteria 2004
890 Ga0495635_0287767 3300046663 Bacteria 1103
891 Ga0495647_0297526 3300046681 Bacteria 727
892 Ga0495658_0136510 3300046683 Bacteria 1497
893 Ga0495658_0193547 3300046683 Bacteria 1265
894 Ga0495658_0243186 3300046683 Bacteria 1130
895 Ga0495658_0310097 3300046683 Bacteria 999
896 Ga0495669_0503056 3300046684 Bacteria 589
897 Ga0495613_0229851 3300046689 Bacteria 1300
898 Ga0495613_0488936 3300046689 Bacteria 830
899 Ga0495624_0315593 3300046690 Bacteria 942
900 Ga0495600_0238311 3300046809 Bacteria 1160
901 Ga0495581_0240843 3300047315 Bacteria 1058
902 Ga0495604_0442036 3300047317 Bacteria 851
903 Ga0495636_0133591 3300047318 Bacteria 1105
904 Ga0495674_0219274 3300047319 Bacteria 1573
905 Ga0495674_0858680 3300047319 Bacteria 703
906 Ga0495672_0139808 3300047320 Bacteria 1266
907 Ga0495676_0541743 3300047321 Bacteria 761
908 Ga0495676_0782385 3300047321 Bacteria 615
909 Ga0495684_0613201 3300047471 Bacteria 733
910 Ga0495602_0413191 3300048088 Bacteria 960
911 Ga0495602_0948454 3300048088 Bacteria 570
912 Ga0496100_0023442 3300048903 Bacteria 3750
913 Ga0496100_0711774 3300048903 Bacteria 784
914 Ga0496100_1193621 3300048903 Bacteria 600
915 Ga0496101_0008263 3300048904 Bacteria 6799
916 Ga0496102_0039911 3300048905 Bacteria 4244
917 Ga0496102_0183611 3300048905 Bacteria 1971
918 Ga0496102_0904808 3300048905 Bacteria 804
919 Ga0496102_0995975 3300048905 Bacteria 759
920 Ga0496103_0679340 3300048906 Bacteria 653
921 Ga0496104_0008370 3300048907 Bacteria 9192
922 Ga0496104_0092666 3300048907 Bacteria 2889
923 Ga0496104_0238629 3300048907 Bacteria 1730
924 Ga0496104_0629219 3300048907 Bacteria 982
925 Ga0496104_1051985 3300048907 Unclassified 718
926 Ga0496105_0131253 3300048908 Bacteria 2065
927 Ga0496105_0363852 3300048908 Bacteria 1153
928 Ga0496105_0547653 3300048908 Bacteria 903
929 Ga0496105_0574366 3300048908 Bacteria 878
930 Ga0496105_1129144 3300048908 Bacteria 580
931 Ga0496106_0170424 3300048909 Bacteria 1725
932 Ga0496106_0192956 3300048909 Bacteria 1620
933 Ga0496106_0242937 3300048909 Bacteria 1439
934 Ga0496106_0319117 3300048909 Bacteria 1247
935 Ga0496107_0168851 3300048910 Bacteria 1623
936 Ga0496107_0324419 3300048910 Bacteria 1146
937 Ga0496108_0086890 3300048911 Bacteria 2655
938 Ga0496108_0720306 3300048911 Bacteria 864
939 Ga0496109_0257859 3300048912 Bacteria 1642
940 Ga0496109_0445836 3300048912 Bacteria 1223
941 Ga0496109_1197699 3300048912 Bacteria 696
942 Ga0496110_0417846 3300048913 Bacteria 1223
943 Ga0496110_1021062 3300048913 Bacteria 735
944 Ga0496111_0387003 3300048914 Bacteria 1034
945 Ga0496111_0774448 3300048914 Bacteria 695
946 Ga0496112_0030063 3300048915 Bacteria 5256
947 Ga0496112_0171416 3300048915 Bacteria 2135
948 Ga0496112_0216455 3300048915 Bacteria 1872
949 Ga0496112_0373552 3300048915 Bacteria 1367
950 Ga0496112_0502510 3300048915 Bacteria 1148
951 Ga0496112_0617987 3300048915 Bacteria 1015
952 Ga0496112_0764269 3300048915 Bacteria 892
953 Ga0496113_0011324 3300048916 Bacteria 5944
954 Ga0496113_1329950 3300048916 Bacteria 558
955 Ga0496113_1363503 3300048916 Bacteria 550
956 Ga0496114_0079280 3300048917 Bacteria 2771
957 Ga0496114_0193587 3300048917 Bacteria 1779
958 Ga0496114_0381888 3300048917 Bacteria 1247
959 Ga0496114_0828104 3300048917 Bacteria 805
960 Ga0496114_1223030 3300048917 Bacteria 637
961 Ga0496115_0378383 3300048918 Bacteria 1152
962 Ga0501047_0258794 3300049581 Bacteria 1588
963 Ga0501068_0209778 3300049584 Bacteria 1237
964 Ga0501069_0455299 3300049585 Bacteria 761
965 Ga0501070_0719052 3300049586 Bacteria 789
966 Ga0501270_028914 3300049767 Bacteria 901
967 Ga0501035_1120856 3300049822 Bacteria 614
968 Ga0501044_0005972 3300049823 Bacteria 13466
969 nmdc:mga05p37_106008_c1 3300050507 Bacteria 3457
970 nmdc:mga05p37_109188_c1 3300050507 Bacteria 3403
971 nmdc:mga05p37_11450_c1 3300050507 Bacteria 10562
972 nmdc:mga05p37_13045_c1 3300050507 Bacteria 9944
973 nmdc:mga05p37_1346817_c1 3300050507 Bacteria 723
974 nmdc:mga05p37_1551_c1 3300050507 Bacteria 26706
975 nmdc:mga05p37_1667387_c1 3300050507 Bacteria 624
976 nmdc:mga05p37_1788810_c1 3300050507 Bacteria 594
977 nmdc:mga05p37_19613_c1 3300050507 Bacteria 8178
978 nmdc:mga05p37_283727_c1 3300050507 Bacteria 1974
979 nmdc:mga05p37_31436_c1 3300050507 Bacteria 4281
980 nmdc:mga05p37_33089_c1 3300050507 Bacteria 6332
981 nmdc:mga05p37_446635_c1 3300050507 Bacteria 1498
982 nmdc:mga05p37_58340_c1 3300050507 Bacteria 4754
983 nmdc:mga05p37_645204_c1 3300050507 Bacteria 1187
984 nmdc:mga05p37_778591_c1 3300050507 Bacteria 1050
985 nmdc:mga09592_341929_c1 3300050508 Bacteria 1295
986 nmdc:mga06r32_53617_c1 3300050510 Bacteria 3863
987 nmdc:mga06r32_669353_c1 3300050510 Bacteria 1005
988 nmdc:mga08y16_1054093_c1 3300050511 Bacteria 790
989 nmdc:mga08y16_2433_c2 3300050511 Bacteria 16697
990 nmdc:mga08y16_36565_c1 3300050511 Bacteria 5157
991 nmdc:mga08y16_44512_c1 3300050511 Bacteria 4650
992 nmdc:mga08y16_97676_c1 3300050511 Bacteria 3059
993 nmdc:mga0n895_1298300_c1 3300050512 Bacteria 699
994 nmdc:mga0n895_133675_c1 3300050512 Bacteria 2507
995 nmdc:mga0n895_1436720_c1 3300050512 Bacteria 657
996 nmdc:mga0n895_1771086_c1 3300050512 Bacteria 579
997 nmdc:mga0n895_2345_c1 3300050512 Bacteria 14753
998 nmdc:mga0n895_235457_c1 3300050512 Bacteria 1858
999 nmdc:mga0n895_287218_c1 3300050512 Bacteria 1668
1000 nmdc:mga0n895_29627_c1 3300050512 Bacteria 5224
1001 nmdc:mga0n895_360872_c1 3300050512 Bacteria 1471
1002 nmdc:mga0n895_416433_c1 3300050512 Bacteria 1358
1003 nmdc:mga0n895_457357_c1 3300050512 Bacteria 1288
1004 nmdc:mga0n895_60819_c1 3300050512 Bacteria 3728
1005 nmdc:mga0n895_634453_c1 3300050512 Bacteria 1068
1006 nmdc:mga0n895_725055_c1 3300050512 Bacteria 989
1007 nmdc:mga0n895_8_c1 3300050512 Bacteria 121439
1008 nmdc:mga0n895_96669_c1 3300050512 Bacteria 2958
1009 nmdc:mga0rr50_109364_c1 3300050513 Bacteria 2185
1010 nmdc:mga0rr50_119_c1 3300050513 Bacteria 43382
1011 nmdc:mga0rr50_24324_c1 3300050513 Bacteria 4194
1012 nmdc:mga0rr50_31102_c1 3300050513 Bacteria 3787
1013 nmdc:mga0rr50_69851_c1 3300050513 Bacteria 2675
1014 nmdc:mga0rr50_932546_c1 3300050513 Bacteria 740
1015 nmdc:mga08x19_127741_c1 3300050514 Bacteria 1708
1016 nmdc:mga08x19_1319323_c1 3300050514 Bacteria 511
1017 nmdc:mga08x19_1669_c1 3300050514 Bacteria 13674
1018 nmdc:mga08x19_180602_c1 3300050514 Bacteria 1441
1019 nmdc:mga08x19_20081_c1 3300050514 Bacteria 4112
1020 nmdc:mga08x19_382707_c1 3300050514 Bacteria 985
1021 nmdc:mga08x19_384138_c1 3300050514 Bacteria 984
1022 nmdc:mga08x19_591038_c1 3300050514 Bacteria 786
1023 nmdc:mga08x19_631219_c1 3300050514 Bacteria 760
1024 nmdc:mga08x19_92990_c1 3300050514 Bacteria 1993
1025 nmdc:mga0a205_126843_c1 3300050515 Bacteria 2452
1026 nmdc:mga0a205_206601_c1 3300050515 Bacteria 1853
1027 nmdc:mga0a205_222919_c1 3300050515 Bacteria 1771
1028 nmdc:mga0a205_350700_c1 3300050515 Bacteria 1343
1029 nmdc:mga0a205_366472_c1 3300050515 Bacteria 1307
1030 nmdc:mga0a205_43427_c1 3300050515 Bacteria 4334
1031 nmdc:mga0a205_6877_c1 3300050515 Bacteria 10288
1032 nmdc:mga0a205_877439_c1 3300050515 Bacteria 744
1033 Ga0495601_0209514 3300053077 Bacteria 1273
1034 Ga0495601_0328461 3300053077 Bacteria 996
1035 Ga0495601_0394612 3300053077 Bacteria 897
1036 Ga0495601_0544816 3300053077 Bacteria 747
1037 Ga0495595_0060856 3300053084 Bacteria 1768
1038 Ga0495595_0167947 3300053084 Bacteria 1085
1039 Ga0495619_0022737 3300053085 Bacteria 4015
1040 Ga0495619_0062975 3300053085 Bacteria 2470
1041 Ga0495619_0288181 3300053085 Bacteria 1137
1042 Ga0495619_0376053 3300053085 Bacteria 982
1043 Ga0495619_0625344 3300053085 Bacteria 736
1044 Ga0495619_0642449 3300053085 Bacteria 724
1045 Ga0500658_0125370 3300053134 Bacteria 1141
1046 Ga0587084_006303 3300059477 Bacteria 1436
1047 Ga0587084_016774 3300059477 Bacteria 1050
1048 Ga0587084_017196 3300059477 Bacteria 1041
1049 Ga0587084_018734 3300059477 Bacteria 1013
1050 Ga0587084_022635 3300059477 Bacteria 953
1051 Ga0587084_030517 3300059477 Bacteria 865
1052 Ga0587084_032188 3300059477 Bacteria 850
1053 Ga0587084_037250 3300059477 Bacteria 811
1054 Ga0587093_004941 3300059478 Bacteria 1384
1055 Ga0587093_018471 3300059478 Bacteria 909
1056 Ga0587093_043131 3300059478 Bacteria 691
1057 Ga0587066_001392 3300059490 Bacteria 2405
1058 Ga0587066_014432 3300059490 Bacteria 1214
1059 Ga0587066_016790 3300059490 Bacteria 1158
1060 Ga0587066_022279 3300059490 Bacteria 1058
1061 Ga0587066_028222 3300059490 Bacteria 981
1062 Ga0587066_061140 3300059490 Bacteria 769
1063 Ga0587070_013731 3300059491 Bacteria 1254
1064 Ga0587070_015134 3300059491 Bacteria 1218
1065 Ga0587070_027229 3300059491 Bacteria 1011
1066 Ga0587070_087995 3300059491 Bacteria 694
1067 Ga0587073_0025332 3300059492 Bacteria 1179
1068 Ga0587073_0057681 3300059492 Bacteria 901
1069 Ga0587073_0112429 3300059492 Bacteria 724
1070 Ga0587073_0205093 3300059492 Bacteria 593
1071 Ga0587077_004110 3300059493 Bacteria 1887
1072 Ga0587077_005878 3300059493 Bacteria 1706
1073 Ga0587077_016404 3300059493 Bacteria 1247
1074 Ga0587077_019964 3300059493 Bacteria 1172
1075 Ga0587077_037380 3300059493 Bacteria 958
1076 Ga0587077_039283 3300059493 Bacteria 942
1077 Ga0587077_069874 3300059493 Bacteria 782
1078 Ga0587077_102717 3300059493 Bacteria 689
1079 Ga0587077_112178 3300059493 Bacteria 669
1080 Ga0587077_149036 3300059493 Bacteria 610
1081 Ga0587077_157051 3300059493 Bacteria 599
1082 Ga0587080_011059 3300059503 Bacteria 1342
1083 Ga0587080_027804 3300059503 Bacteria 968
1084 Ga0587082_009184 3300059504 Bacteria 1396
1085 Ga0587082_028990 3300059504 Bacteria 953
1086 Ga0587082_033926 3300059504 Bacteria 904
1087 Ga0587082_041800 3300059504 Bacteria 843
1088 Ga0587082_050497 3300059504 Bacteria 792
1089 Ga0587082_052644 3300059504 Bacteria 781
1090 Ga0587082_067377 3300059504 Bacteria 720
1091 Ga0587082_074571 3300059504 Bacteria 696
1092 Ga0587082_088296 3300059504 Bacteria 657
1093 Ga0587083_0007085 3300059505 Bacteria 1701
1094 Ga0587083_0028038 3300059505 Bacteria 1099
1095 Ga0587083_0040957 3300059505 Bacteria 970
1096 Ga0587083_0081933 3300059505 Bacteria 770
1097 Ga0587083_0106193 3300059505 Bacteria 707
1098 Ga0587083_0166458 3300059505 Bacteria 607
1099 Ga0587083_0219178 3300059505 Bacteria 552
1100 Ga0587085_021598 3300059506 Bacteria 985
1101 Ga0587085_021850 3300059506 Bacteria 981
1102 Ga0587085_028226 3300059506 Bacteria 905
1103 Ga0587085_029602 3300059506 Bacteria 892
1104 Ga0587085_040529 3300059506 Bacteria 809
1105 Ga0587085_044924 3300059506 Bacteria 784
1106 Ga0587085_080341 3300059506 Bacteria 655
1107 Ga0587086_010264 3300059507 Bacteria 1130
1108 Ga0587086_026789 3300059507 Bacteria 824
1109 Ga0587088_011543 3300059508 Bacteria 1318
1110 Ga0587089_006225 3300059509 Bacteria 1380
1111 Ga0587089_048596 3300059509 Bacteria 675
1112 Ga0587090_010749 3300059510 Bacteria 1274
1113 Ga0587090_011436 3300059510 Bacteria 1248
1114 Ga0587090_019028 3300059510 Bacteria 1055
1115 Ga0587090_019336 3300059510 Bacteria 1050
1116 Ga0587091_009707 3300059511 Bacteria 1457
1117 Ga0587091_024301 3300059511 Bacteria 1086
1118 Ga0587091_045302 3300059511 Bacteria 883
1119 Ga0587091_070679 3300059511 Bacteria 763
1120 Ga0587091_079602 3300059511 Bacteria 733
1121 Ga0587092_007759 3300059512 Bacteria 1401
1122 Ga0587092_011506 3300059512 Bacteria 1232
1123 Ga0587092_015242 3300059512 Bacteria 1123
1124 Ga0587092_060089 3300059512 Bacteria 709
1125 Ga0587094_005397 3300059513 Bacteria 1491
1126 Ga0587094_008518 3300059513 Bacteria 1286
1127 Ga0587094_073577 3300059513 Bacteria 620
1128 Ga0587106_076202 3300059605 Bacteria 645
1129 Ga0587106_149788 3300059605 Bacteria 518
1130 Ga0587125_011387 3300059607 Bacteria 933
1131 Ga0587131_002258 3300059609 Bacteria 1032
1132 Ga0587099_017036 3300059622 Bacteria 791
1133 Ga0587101_011037 3300059623 Bacteria 1147
1134 Ga0587101_013466 3300059623 Bacteria 1078
1135 Ga0587101_014970 3300059623 Bacteria 1043
1136 Ga0587101_032478 3300059623 Bacteria 822
1137 Ga0587101_036179 3300059623 Bacteria 794
1138 Ga0587101_068754 3300059623 Bacteria 648
1139 Ga0587101_101852 3300059623 Bacteria 572
1140 Ga0587109_023275 3300059624 Bacteria 1122
1141 Ga0587109_037244 3300059624 Bacteria 950
1142 Ga0587109_039128 3300059624 Bacteria 933
1143 Ga0587109_042157 3300059624 Bacteria 909
1144 Ga0587109_135511 3300059624 Bacteria 597
1145 Ga0587115_001579 3300059626 Bacteria 2121
1146 Ga0587115_021733 3300059626 Bacteria 899
1147 Ga0587115_021765 3300059626 Bacteria 899
1148 Ga0587115_052268 3300059626 Bacteria 666
1149 Ga0587117_012894 3300059627 Bacteria 1061
1150 Ga0587117_020630 3300059627 Bacteria 916
1151 Ga0587128_048879 3300059630 Bacteria 766
1152 Ga0587062_006883 3300059639 Bacteria 1307
1153 Ga0587062_024422 3300059639 Bacteria 883
1154 Ga0587062_024839 3300059639 Bacteria 878
1155 Ga0587062_035873 3300059639 Bacteria 783
1156 Ga0587067_010641 3300059640 Bacteria 1399
1157 Ga0587067_014669 3300059640 Bacteria 1260
1158 Ga0587067_023463 3300059640 Bacteria 1082
1159 Ga0587067_030081 3300059640 Bacteria 996
1160 Ga0587067_090350 3300059640 Unclassified 693
1161 Ga0587068_009216 3300059641 Bacteria 1448
1162 Ga0587068_010717 3300059641 Bacteria 1372
1163 Ga0587068_021773 3300059641 Bacteria 1057
1164 Ga0587068_028906 3300059641 Bacteria 951
1165 Ga0587068_033650 3300059641 Bacteria 900
1166 Ga0587068_077516 3300059641 Bacteria 666
1167 Ga0587069_002652 3300059642 Bacteria 1834
1168 Ga0587069_028003 3300059642 Bacteria 893
1169 Ga0587069_028191 3300059642 Bacteria 891
1170 Ga0587069_100170 3300059642 Bacteria 591
1171 Ga0587072_013991 3300059643 Bacteria 1347
1172 Ga0587072_057849 3300059643 Bacteria 792
1173 Ga0587072_066457 3300059643 Bacteria 753
1174 Ga0587072_097957 3300059643 Bacteria 655
1175 Ga0587072_111112 3300059643 Bacteria 626
1176 Ga0587072_133491 3300059643 Bacteria 586
1177 Ga0587075_011165 3300059644 Bacteria 1201
1178 Ga0587075_117265 3300059644 Bacteria 548
1179 Ga0587076_007491 3300059645 Bacteria 1494
1180 Ga0587076_020875 3300059645 Bacteria 1079
1181 Ga0587076_048268 3300059645 Bacteria 821
1182 Ga0587076_065043 3300059645 Bacteria 744
1183 Ga0587079_015793 3300059647 Bacteria 1288
1184 Ga0587079_018920 3300059647 Bacteria 1214
1185 Ga0587079_022699 3300059647 Bacteria 1142
1186 Ga0587079_024716 3300059647 Bacteria 1110
1187 Ga0587079_035978 3300059647 Bacteria 977
1188 Ga0587079_042730 3300059647 Bacteria 922
1189 Ga0587079_056244 3300059647 Bacteria 840
1190 Ga0587079_064686 3300059647 Bacteria 801
1191 Ga0587079_077499 3300059647 Bacteria 754
1192 Ga0587079_095434 3300059647 Bacteria 702
1193 Ga0587079_098546 3300059647 Bacteria 695
1194 Ga0587079_110256 3300059647 Bacteria 668
1195 Ga0587079_149893 3300059647 Bacteria 602
1196 Ga0587100_022777 3300059648 Bacteria 622
1197 Ga0587100_027080 3300059648 Bacteria 591
1198 Ga0587102_023417 3300059649 Bacteria 713
1199 Ga0587107_024739 3300059652 Bacteria 868
1200 Ga0587107_081759 3300059652 Bacteria 608
1201 Ga0587110_026769 3300059654 Bacteria 684
1202 Ga0587114_003380 3300059655 Bacteria 1582
1203 Ga0587119_014099 3300059658 Bacteria 954
1204 Ga0587119_051833 3300059658 Bacteria 614
1205 Ga0587124_023402 3300059660 Bacteria 645
1206 Ga0587071_009087 3300060344 Bacteria 1626
1207 Ga0587071_012801 3300060344 Bacteria 1436
1208 Ga0587071_015453 3300060344 Bacteria 1339
1209 Ga0587071_024210 3300060344 Bacteria 1132
1210 Ga0587071_046564 3300060344 Bacteria 885
1211 Ga0587071_060504 3300060344 Bacteria 804
1212 Ga0587071_072294 3300060344 Bacteria 753
1213 Ga0587071_094392 3300060344 Bacteria 684
1214 Ga0587111_0001422 3300060346 Bacteria 2877
1215 Ga0587111_0023436 3300060346 Bacteria 1207
1216 Ga0587111_0030694 3300060346 Bacteria 1096
1217 Ga0587111_0031932 3300060346 Bacteria 1080
1218 Ga0587111_0034205 3300060346 Bacteria 1054
1219 Ga0587111_0038817 3300060346 Bacteria 1006
1220 Ga0587111_0047896 3300060346 Bacteria 934
1221 Ga0587111_0056409 3300060346 Bacteria 881
1222 Ga0587111_0227722 3300060346 Unclassified 541
1223 Ga0501082_0862075 3300060353 Bacteria 792
1224 Ga0058860_11971705
1225 JGI24738J21930_10114224
1226 Ga0006778J45830_1030434
1227 Ga0006759J45824_1018877
1228 Ga0006759J45824_1018878
1229 Ga0006759J45824_1034533
1230 Ga0006759J45824_1059298
1231 Ga0006770J48903_1023257
1232 Ga0006777J48905_1045790
1233 Ga0006777J48905_1077046
1234 Ga0007417J51691_1016316
1235 Ga0007417J51691_1017946
1236 Ga0007417J51691_1037647
1237 Ga0007417J51691_1055751
1238 Ga0006781J51513_1024867
1239 Ga0007410J51695_1022997
1240 Ga0007410J51695_1034284
1241 Ga0007410J51695_1034286
1242 Ga0007410J51695_1036572
1243 Ga0007410J51695_1039952
1244 Ga0007410J51695_1040499
1245 Ga0007410J51695_1050590
1246 Ga0007409J51694_1014135
1247 Ga0007409J51694_1017048
1248 Ga0007409J51694_1034836
1249 Ga0007409J51694_1038310
1250 Ga0007409J51694_1053687
1251 Ga0007409J51694_1054438
1252 Ga0007416J51690_1013238
1253 Ga0007416J51690_1018448
1254 Ga0007416J51690_1034508
1255 Ga0007416J51690_1045110
1256 Ga0007416J51690_1045924
1257 Ga0007416J51690_1069212
1258 Ga0007429J51699_1027866
1259 Ga0007429J51699_1045355
1260 Ga0007429J51699_1049471
1261 Ga0007429J51699_1070095
1262 Ga0007415J51800_118343
1263 Ga0032354_1019356
1264 Ga0032354_1029587
1265 Ga0032354_1072768
1266 Ga0006780_1030866
1267 Ga0006780_1045787
1268 Ga0058858_1387962
1269 Ga0058858_1418458
1270 Ga0058858_1420912
1271 Ga0058859_10012600
1272 Ga0058859_10028325
1273 Ga0058859_10034249
1274 Ga0058859_11758045
1275 Ga0058859_11766987
1276 Ga0058859_11770865
1277 Ga0058859_11774989
1278 Ga0058859_11790302
1279 Ga0058859_11820220
1280 Ga0058863_10070689
1281 Ga0058863_10081328
1282 Ga0058863_11822787
1283 Ga0058863_11839074
1284 Ga0058863_11918591
1285 Ga0058861_10028105
1286 Ga0058861_10195728
1287 Ga0058861_12070956
1288 Ga0058860_10009161
1289 Ga0058860_10015927
1290 Ga0058860_10023448
1291 Ga0058860_10031814
1292 Ga0058860_10048813
1293 Ga0058860_10088307
1294 Ga0058860_10137492
1295 Ga0058860_10159832
1296 Ga0058860_12095346
1297 Ga0058860_12141545
1298 Ga0058860_12160390
1299 Ga0058860_12169525
1300 Ga0058860_12178039
1301 Ga0058860_12180345
1302 Ga0058862_10197566
1303 Ga0058862_12780275
1304 Ga0058862_12848465
1305 Ga0058862_12851153
1306 Ga0065714_10119658
1307 Ga0065704_10468849
1308 Ga0065704_10473311
1309 Ga0065712_10013945
1310 Ga0065712_10101541
1311 Ga0065712_10227925
1312 Ga0065712_10505872
1313 Ga0065715_10064082
1314 Ga0065715_10309406
1315 Ga0065715_10509836
1316 Ga0065715_10696094
1317 Ga0065707_10043621
1318 Ga0065707_10146777
1319 Ga0065707_10456945
1320 Ga0070658_10884188
1321 Ga0070676_10013768
1322 Ga0070676_10136905
1323 Ga0070676_10137425
1324 Ga0070676_10969671
1325 Ga0070676_11099119
1326 Ga0070683_100570240
1327 Ga0070683_101722893
1328 Ga0070690_100037393
1329 Ga0070690_100139612
1330 Ga0070690_100177389
1331 Ga0070670_100135630
1332 Ga0070670_100280288
1333 Ga0070670_100637179
1334 Ga0070677_10045567
1335 Ga0070677_10733988
1336 Ga0068869_100040768
1337 Ga0068869_100057218
1338 Ga0068869_100410396
1339 Ga0068869_100444482
1340 Ga0070666_10075724
1341 Ga0070666_10087294
1342 Ga0070666_10097726
1343 Ga0070666_10151304
1344 Ga0070666_10187504
1345 Ga0070666_10211254
1346 Ga0070666_10839649
1347 Ga0070680_100344858
1348 Ga0070680_101510665
1349 Ga0070682_101417005
1350 Ga0068868_100113892
1351 Ga0068868_100923237
1352 Ga0070660_100000836
1353 Ga0070660_101285784
1354 Ga0070689_100130558
1355 Ga0070689_100296667
1356 Ga0070691_10001161
1357 Ga0070687_100023353
1358 Ga0070687_100422493
1359 Ga0070687_100677536
1360 Ga0070692_10060111
1361 Ga0070692_11129544
1362 Ga0070668_100005545
1363 Ga0070669_100002989
1364 Ga0070669_100049679
1365 Ga0070669_101587132
1366 Ga0070675_100100692
1367 Ga0070675_100594086
1368 Ga0070675_101055632
1369 Ga0070675_101190136
1370 Ga0070675_101250526
1371 Ga0070675_101261462
1372 Ga0070671_100059879
1373 Ga0070671_100505558
1374 Ga0070671_100553974
1375 Ga0070671_100871937
1376 Ga0070674_100134805
1377 Ga0070674_100151538
1378 Ga0070674_100287860
1379 Ga0070674_100479984
1380 Ga0070674_101211439
1381 Ga0070673_100196965
1382 Ga0070673_100234065
1383 Ga0070673_100346356
1384 Ga0070673_101034427
1385 Ga0070673_101093310
1386 Ga0070688_100009090
1387 Ga0070659_100443220
1388 Ga0070659_101182913
1389 Ga0070667_100069513
1390 Ga0070667_100208445
1391 Ga0070667_100296183
1392 Ga0070667_101120937
1393 Ga0070709_10177843
1394 Ga0070714_100001653
1395 Ga0070701_10050773
1396 Ga0070701_10877571
1397 Ga0070711_100528673
1398 Ga0070711_100818268
1399 Ga0070705_100032997
1400 Ga0070705_100308616
1401 Ga0070705_101201753
1402 Ga0070700_100002448
1403 Ga0070700_100176651
1404 Ga0070694_100027813
1405 Ga0070694_100258703
1406 Ga0070694_100262094
1407 Ga0070694_100356548
1408 Ga0070694_100755189
1409 Ga0070708_100480281
1410 Ga0070678_100046207
1411 Ga0070678_100239487
1412 Ga0070678_100314355
1413 Ga0070678_102096218
1414 Ga0070662_100089053
1415 Ga0070662_100108497
1416 Ga0070662_100276906
1417 Ga0070681_10007994
1418 Ga0070681_10032094
1419 Ga0070681_10808537
1420 Ga0068867_100035037
1421 Ga0068867_100070165
1422 Ga0068867_100109245
1423 Ga0068867_100122705
1424 Ga0068867_100130175
1425 Ga0070685_10337383
1426 Ga0070685_10661972
1427 Ga0070685_11222026
1428 Ga0070707_100555178
1429 Ga0070707_100795200
1430 Ga0070707_100982333
1431 Ga0070707_101222612
1432 Ga0070707_101527923
1433 Ga0070698_100036863
1434 Ga0070698_100448508
1435 Ga0070698_100448608
1436 Ga0070698_101030235
1437 Ga0070698_101052003
1438 Ga0070699_100102708
1439 Ga0070699_100349593
1440 Ga0070699_100719177
1441 Ga0070679_100037523
1442 Ga0070684_101008080
1443 Ga0070697_100261836
1444 Ga0070697_100429005
1445 Ga0070697_101004219
1446 Ga0070697_101084871
1447 Ga0070697_101130158
1448 Ga0070697_101255643
1449 Ga0068853_100190938
1450 Ga0068853_100464462
1451 Ga0070672_100104669
1452 Ga0070672_100226932
1453 Ga0070672_100753670
1454 Ga0070672_100909384
1455 Ga0070672_101226119
1456 Ga0070686_100012299
1457 Ga0070686_100158777
1458 Ga0070686_100212740
1459 Ga0070686_100828974
1460 Ga0070695_100002218
1461 Ga0070695_100066638
1462 Ga0070695_100111603
1463 Ga0070695_100285841
1464 Ga0070695_100331417
1465 Ga0070695_100370163
1466 Ga0070695_100905560
1467 Ga0070696_100007825
1468 Ga0070696_100184973
1469 Ga0070696_100204202
1470 Ga0070696_100517445
1471 Ga0070665_100007928
1472 Ga0070665_100012708
1473 Ga0070665_100013730
1474 Ga0070665_100074367
1475 Ga0070665_100139417
1476 Ga0070665_100464555
1477 Ga0070665_100543529
1478 Ga0070704_100003047
1479 Ga0070704_100045815
1480 Ga0070704_100914918
1481 Ga0068855_100031256
1482 Ga0068855_100197523
1483 Ga0068855_100511517
1484 Ga0070664_100100511
1485 Ga0070664_100388134
1486 Ga0068857_100018182
1487 Ga0068857_100176840
1488 Ga0068857_102143477
1489 Ga0068854_100029698
1490 Ga0068854_100033337
1491 Ga0068854_100089426
1492 Ga0068854_101138432
1493 Ga0070702_100167942
1494 Ga0070702_100763966
1495 Ga0068852_100608404
1496 Ga0068852_101556192
1497 Ga0068859_100026299
1498 Ga0068859_100027234
1499 Ga0068859_100449082
1500 Ga0068859_100614700
1501 Ga0068859_100885786
1502 Ga0068859_101200368
1503 Ga0068864_100012674
1504 Ga0068864_100014594
1505 Ga0068864_100261595
1506 Ga0068864_100492726
1507 Ga0068866_10022595
1508 Ga0068866_10077708
1509 Ga0068866_10133412
1510 Ga0068866_10364883
1511 Ga0068861_100006774
1512 Ga0068861_100152993
1513 Ga0068861_100440295
1514 Ga0068861_100786791
1515 Ga0068861_101175238
1516 Ga0068851_10092221
1517 Ga0068851_10290262
1518 Ga0068870_10022372
1519 Ga0068870_10368305
1520 Ga0068870_10512242
1521 Ga0068870_10563531
1522 Ga0068863_100016899
1523 Ga0068863_100098158
1524 Ga0068863_100804299
1525 Ga0068863_101244386
1526 Ga0068858_100014306
1527 Ga0068858_100030415
1528 Ga0068858_100062432
1529 Ga0068858_100065796
1530 Ga0068858_100194660
1531 Ga0068858_100453116
1532 Ga0068858_101028565
1533 Ga0068858_101836636
1534 Ga0068860_100068273
1535 Ga0068860_100105308
1536 Ga0068860_100223748
1537 Ga0068860_100242444
1538 Ga0068860_100739917
1539 Ga0068862_100011268
1540 Ga0068862_100236380
1541 Ga0068862_100329873
1542 Ga0068862_100555445
1543 Ga0068862_100648020
1544 Ga0081455_10325541
1545 Ga0081455_11020447
1546 Ga0081539_10032974
1547 Ga0070716_100259779
1548 Ga0097621_100008334
1549 Ga0097621_100017544
1550 Ga0097621_100023295
1551 Ga0097621_100029261
1552 Ga0097621_100166922
1553 Ga0097621_100193907
1554 Ga0097621_100285541
1555 Ga0097621_100365075
1556 Ga0097621_100369918
1557 Ga0068871_100013241
1558 Ga0068871_100019001
1559 Ga0068871_100096303
1560 Ga0068871_100207272
1561 Ga0068871_100384226
1562 Ga0068871_100630863
1563 Ga0075428_100305044
1564 Ga0075428_100375919
1565 Ga0075428_100480767
1566 Ga0075428_101106899
1567 Ga0075428_101614753
1568 Ga0075431_101180148
1569 Ga0075431_101243050
1570 Ga0075433_10082878
1571 Ga0075433_10102024
1572 Ga0075433_10105195
1573 Ga0075433_10257762
1574 Ga0075433_10269006
1575 Ga0075433_10321220
1576 Ga0075433_10459178
1577 Ga0075433_10581570
1578 Ga0075434_100001358
1579 Ga0075434_100032496
1580 Ga0075434_100126849
1581 Ga0075434_100181207
1582 Ga0075434_100441350
1583 Ga0075434_100464561
1584 Ga0075434_100526286
1585 Ga0075434_100730066
1586 Ga0075434_101197668
1587 Ga0075434_101536605
1588 Ga0075434_102264213
1589 Ga0075429_100601238
1590 Ga0075429_100745879
1591 Ga0068865_100001357
1592 Ga0068865_100058080
1593 Ga0068865_100318813
1594 Ga0068865_100368272
1595 Ga0068865_100538864
1596 Ga0068865_101338951
1597 Ga0075436_100007215
1598 Ga0075436_100016853
1599 Ga0075436_100068008
1600 Ga0075436_100269086
1601 Ga0075436_100316664
1602 Ga0097620_100026299
1603 Ga0097620_100027234
1604 Ga0097620_100449067
1605 Ga0097620_100614686
1606 Ga0097620_100885833
1607 Ga0097620_101133611
1608 Ga0097620_101200344
1609 Ga0075435_100001736
1610 Ga0075435_100002501
1611 Ga0075435_100015933
1612 Ga0075435_100026242
1613 Ga0075435_100053956
1614 Ga0075435_100223443
1615 Ga0075435_100317409
1616 Ga0105250_10368979
1617 Ga0105250_10486197
1618 Ga0105240_10030262
1619 Ga0105240_10101147
1620 Ga0105240_10336827
1621 Ga0105240_10687025
1622 Ga0105240_11650427
1623 Ga0111539_10000755
1624 Ga0111539_10008909
1625 Ga0111539_10026986
1626 Ga0111539_10092467
1627 Ga0111539_10478172
1628 Ga0111539_11568418
1629 Ga0105245_10028601
1630 Ga0105245_10034825
1631 Ga0105245_10293636
1632 Ga0105245_10533940
1633 Ga0105245_11213277
1634 Ga0105245_12161364
1635 Ga0105247_10007823
1636 Ga0105247_10016909
1637 Ga0105247_10340481
1638 Ga0105247_10823511
1639 Ga0105247_11273173
1640 Ga0114129_10004994
1641 Ga0114129_10011461
1642 Ga0114129_10034467
1643 Ga0114129_10078908
1644 Ga0114129_10091983
1645 Ga0114129_10274169
1646 Ga0114129_10282899
1647 Ga0114129_10342488
1648 Ga0114129_11812518
1649 Ga0114129_11975388
1650 Ga0114129_12096429
1651 Ga0114129_12433262
1652 Ga0105243_10056836
1653 Ga0105243_10070818
1654 Ga0105243_10642734
1655 Ga0105243_10662488
1656 Ga0105243_10895235
1657 Ga0105243_11232034
1658 Ga0105243_11465710
1659 Ga0105241_10208504
1660 Ga0105241_12221683
1661 Ga0105242_10060524
1662 Ga0105242_10063550
1663 Ga0105242_10067088
1664 Ga0105242_10471347
1665 Ga0105242_11034974
1666 Ga0105242_11097137
1667 Ga0105242_11688917
1668 Ga0105242_12233543
1669 Ga0105248_10005069
1670 Ga0105248_10078441
1671 Ga0105248_10170465
1672 Ga0105248_10240558
1673 Ga0105248_10266037
1674 Ga0105248_10338953
1675 Ga0105248_10602238
1676 Ga0105248_10797157
1677 Ga0105248_10833247
1678 Ga0105248_10956448
1679 Ga0105248_11202665
1680 Ga0105248_11203136
1681 Ga0105248_11347482
1682 Ga0105248_11797417
1683 Ga0105237_11704815
1684 Ga0105237_12352532
1685 Ga0105238_11032309
1686 Ga0105238_11389999
1687 Ga0105249_10335134
1688 Ga0105249_10654729
1689 Ga0105249_10869200
1690 Ga0105249_10894950
1691 Ga0105249_11796163
1692 Ga0105249_11889577
1693 Ga0105249_12176167
1694 Ga0105249_12271678
1695 Ga0105239_10162711
1696 Ga0105239_10614280
1697 Ga0105246_10508458
1698 Ga0105246_10880543
1699 Ga0105246_11587835
1700 Ga0157339_1028622
1701 Ga0157324_1005689
1702 Ga0157371_10167789
1703 Ga0157370_10468623
1704 Ga0157374_10069753
1705 Ga0157374_11021152
1706 Ga0157378_10242241
1707 Ga0157378_10284204
1708 Ga0157378_10375819
1709 Ga0157378_10720645
1710 Ga0157378_11039572
1711 Ga0157378_11241888
1712 Ga0157378_11302408
1713 Ga0157378_11396065
1714 Ga0157378_12062813
1715 Ga0163162_10099679
1716 Ga0163162_10432928
1717 Ga0163162_10887544
1718 Ga0163162_10993190
1719 Ga0163162_11347172
1720 Ga0163162_11617505
1721 Ga0163162_11929880
1722 Ga0157372_10365312
1723 Ga0157375_10036094
1724 Ga0157375_10410957
1725 Ga0157375_10434007
1726 Ga0157375_10797944
1727 Ga0157375_11706882
1728 Ga0157375_12331122
1729 Ga0163163_10042536
1730 Ga0163163_10231581
1731 Ga0163163_10242531
1732 Ga0163163_10399302
1733 Ga0157380_10198086
1734 Ga0157380_10518045
1735 Ga0157380_11014654
1736 Ga0157380_11647126
1737 Ga0157380_12509316
1738 Ga0157380_12936189
1739 Ga0157380_13211936
1740 Ga0157377_10117283
1741 Ga0157377_10298849
1742 Ga0157377_10906674
1743 Ga0157379_10003064
1744 Ga0157379_10005965
1745 Ga0157379_10063891
1746 Ga0157379_10104398
1747 Ga0157379_10202330
1748 Ga0157379_10391762
1749 Ga0157379_10395638
1750 Ga0157379_10779698
1751 Ga0157379_11430726
1752 Ga0157379_11431866
1753 Ga0157376_10011929
1754 Ga0157376_10307270
1755 Ga0157376_10446644
1756 Ga0157376_10566754
1757 Ga0157376_11270112
1758 Ga0157376_11867499
1759 Ga0157376_11978697
1760 Ga0163161_10474974
1761 Ga0163161_10607261
1762 Ga0197907_10887154
1763 Ga0206356_11432270
1764 Ga0206356_11624237
1765 Ga0206356_11860972
1766 Ga0206355_1495824
1767 Ga0206351_10784960
1768 Ga0206352_10542231
1769 Ga0206352_11109900
1770 Ga0206354_10453284
1771 Ga0224712_10047956
1772 Ga0207697_10093685
1773 Ga0207697_10381675
1774 Ga0207656_10032234
1775 Ga0207696_1144202
1776 Ga0207682_10012771
1777 Ga0207682_10063274
1778 Ga0207692_11025832
1779 Ga0207642_10216397
1780 Ga0207642_10581545
1781 Ga0207710_10008385
1782 Ga0207710_10138900
1783 Ga0207710_10164671
1784 Ga0207710_10204618
1785 Ga0207710_10236266
1786 Ga0207688_10297517
1787 Ga0207680_10025132
1788 Ga0207680_10172827
1789 Ga0207680_10511148
1790 Ga0207680_10659128
1791 Ga0207685_10183868
1792 Ga0207685_10498023
1793 Ga0207685_10754441
1794 Ga0207699_10066470
1795 Ga0207699_10655174
1796 Ga0207645_10001211
1797 Ga0207645_10050366
1798 Ga0207645_10073597
1799 Ga0207645_10135616
1800 Ga0207643_10027534
1801 Ga0207643_10399155
1802 Ga0207643_10679300
1803 Ga0207705_11002030
1804 Ga0207684_10340941
1805 Ga0207684_11148446
1806 Ga0207707_10024560
1807 Ga0207707_10072855
1808 Ga0207707_10129630
1809 Ga0207695_10433116
1810 Ga0207695_10542603
1811 Ga0207695_10638451
1812 Ga0207671_10516880
1813 Ga0207663_10284281
1814 Ga0207663_10380405
1815 Ga0207660_10243424
1816 Ga0207660_10360092
1817 Ga0207662_10011646
1818 Ga0207662_10172047
1819 Ga0207662_10313673
1820 Ga0207662_10343990
1821 Ga0207662_10459508
1822 Ga0207657_10002850
1823 Ga0207657_10734604
1824 Ga0207652_10051931
1825 Ga0207652_10815665
1826 Ga0207646_10059862
1827 Ga0207646_10720154
1828 Ga0207646_10818770
1829 Ga0207646_11279588
1830 Ga0207646_11597452
1831 Ga0207681_10015878
1832 Ga0207681_10020093
1833 Ga0207681_10045177
1834 Ga0207681_10201307
1835 Ga0207694_10104022
1836 Ga0207694_10228140
1837 Ga0207694_10246893
1838 Ga0207694_11248729
1839 Ga0207650_10107865
1840 Ga0207650_11033185
1841 Ga0207659_10106102
1842 Ga0207659_10494902
1843 Ga0207659_10737203
1844 Ga0207687_10026017
1845 Ga0207687_10060805
1846 Ga0207687_10176697
1847 Ga0207687_10374322
1848 Ga0207687_10525910
1849 Ga0207687_10806032
1850 Ga0207687_10813285
1851 Ga0207644_10004183
1852 Ga0207644_10389396
1853 Ga0207644_10633506
1854 Ga0207644_10649360
1855 Ga0207644_11215884
1856 Ga0207690_10276906
1857 Ga0207706_10135407
1858 Ga0207706_10280677
1859 Ga0207706_10485721
1860 Ga0207686_10004178
1861 Ga0207686_10040300
1862 Ga0207686_10044062
1863 Ga0207709_10056123
1864 Ga0207709_10437882
1865 Ga0207709_11196114
1866 Ga0207670_10020704
1867 Ga0207670_10553551
1868 Ga0207669_10364858
1869 Ga0207669_10427583
1870 Ga0207669_10628088
1871 Ga0207704_10008908
1872 Ga0207704_10061112
1873 Ga0207704_10399726
1874 Ga0207704_10754120
1875 Ga0207665_10292699
1876 Ga0207665_10364524
1877 Ga0207691_10092084
1878 Ga0207691_10108559
1879 Ga0207691_10220844
1880 Ga0207691_10941864
1881 Ga0207711_10006661
1882 Ga0207711_10011869
1883 Ga0207711_10019410
1884 Ga0207711_10069291
1885 Ga0207711_10093774
1886 Ga0207711_10218026
1887 Ga0207711_10231152
1888 Ga0207711_10235445
1889 Ga0207711_10388703
1890 Ga0207689_10106820
1891 Ga0207689_10409050
1892 Ga0207689_10427463
1893 Ga0207661_10165249
1894 Ga0207661_11338024
1895 Ga0207679_10180980
1896 Ga0207679_11006799
1897 Ga0207667_10225136
1898 Ga0207667_10260915
1899 Ga0207667_10378297
1900 Ga0207667_10585597
1901 Ga0207651_10024523
1902 Ga0207651_10153392
1903 Ga0207651_10538928
1904 Ga0207651_11192943
1905 Ga0207651_11217175
1906 Ga0207651_11357787
1907 Ga0207651_11866872
1908 Ga0207712_10048619
1909 Ga0207712_10562738
1910 Ga0207712_10757180
1911 Ga0207712_11311303
1912 Ga0207668_10162758
1913 Ga0207668_10809865
1914 Ga0207668_11621341
1915 Ga0207640_10012925
1916 Ga0207640_10053128
1917 Ga0207640_10251062
1918 Ga0207640_10264992
1919 Ga0207640_11487673
1920 Ga0207658_10204844
1921 Ga0207658_10627332
1922 Ga0207658_11067029
1923 Ga0207658_11105351
1924 Ga0207677_10103051
1925 Ga0207677_10234913
1926 Ga0207677_10885670
1927 Ga0207703_10001811
1928 Ga0207703_10012192
1929 Ga0207703_10273955
1930 Ga0207703_10326502
1931 Ga0207703_10367984
1932 Ga0207703_10607797
1933 Ga0207703_12142001
1934 Ga0207639_10143192
1935 Ga0207639_11392720
1936 Ga0207678_10608489
1937 Ga0207708_10027766
1938 Ga0207708_10032297
1939 Ga0207708_10169752
1940 Ga0207708_11317551
1941 Ga0207641_10002105
1942 Ga0207641_10327978
1943 Ga0207641_10785253
1944 Ga0207641_10802377
1945 Ga0207648_10024373
1946 Ga0207648_10045780
1947 Ga0207648_10133044
1948 Ga0207648_10166543
1949 Ga0207648_10361086
1950 Ga0207676_10039689
1951 Ga0207676_10042982
1952 Ga0207676_10093973
1953 Ga0207676_10810560
1954 Ga0207676_10965976
1955 Ga0207676_10994175
1956 Ga0207674_10013671
1957 Ga0207674_10058289
1958 Ga0207674_11452602
1959 Ga0207675_100034095
1960 Ga0207675_100065358
1961 Ga0207675_100082114
1962 Ga0207675_100184209
1963 Ga0207675_100519391
1964 Ga0207675_100711170
1965 Ga0207675_100766054
1966 Ga0207675_101423666
1967 Ga0207683_10015366
1968 Ga0207683_10113553
1969 Ga0207683_10123395
1970 Ga0207683_10632864
1971 Ga0207683_11355464
1972 Ga0207698_10369945
1973 Ga0209999_1082553
1974 Ga0209998_10008773
1975 Ga0209974_10044580
1976 Ga0207428_10006364
1977 Ga0207428_10008027
1978 Ga0207428_10169775
1979 Ga0207428_10463511
1980 Ga0268266_10013912
1981 Ga0268266_10072243
1982 Ga0268266_10079309
1983 Ga0268266_10370467
1984 Ga0268266_10657866
1985 Ga0268266_11011693
1986 Ga0268265_10004086
1987 Ga0268265_10108325
1988 Ga0268265_10223626
1989 Ga0268265_10783475
1990 Ga0268265_10853444
1991 Ga0268265_12444238
1992 Ga0268264_10142502
1993 Ga0268264_10698346
1994 Ga0268264_10716213
1995 Ga0268264_10758201
1996 Ga0268264_11422049
1997 Ga0268264_11804252
1998 Ga0268264_12110816
1999 Ga0307408_100244483
2000 Ga0307408_100273024
2001 Ga0265314_10106006
2002 Ga0307413_11521900
2003 Ga0307410_10113237
2004 Ga0307412_10155537
2005 Ga0307412_11906985
2006 Ga0307411_10715933
2007 Ga0307415_100039893
2008 Ga0307415_101404808
2009 Ga0373930_0014282
2010 Ga0373948_0001910
2011 Ga0373950_0011871
2012 Ga0373958_0002174
2013 Ga0373958_0045682
2014 Ga0373958_0048041
2015 Ga0373959_0002901
2016 Ga0373938_0023726
2017 Ga0373928_0001584
2018 Ga0373928_0056678
2019 Ga0373929_0001310
2020 Ga0373929_0083664
2021 Ga0373934_0397742
2022 Ga0373940_0004300
2023 Ga0373949_0004565
2024 Ga0373951_0009649
2025 Ga0373952_0003164
2026 Ga0373952_0092644
2027 Ga0373932_0001227
2028 Ga0373932_0172272
2029 Ga0373936_0143794
2030 Ga0373939_0000417
2031 Ga0373939_0139925
2032 Ga0373939_0191461
2033 Ga0373941_0001684
2034 Ga0373941_0043809
2035 Ga0373945_0303319
2036 Ga0373953_0079484
2037 Ga0373953_0089294
2038 Ga0373953_0093027
2039 Ga0373957_0271812
2040 Ga0373960_0000383
2041 Ga0373960_0402306
2042 Ga0373943_0096711
2043 Ga0373943_0174539
2044 Ga0373946_0029613
2045 Ga0373946_0496437
2046 Ga0373955_0588197
2047 Ga0373942_0000206
2048 Ga0373942_0069474
2049 Ga0373961_0000423
2050 Ga0373961_0064331
2051 Ga0373961_0381492
2052 Ga0373962_0002541
2053 Ga0373962_0062658
2054 Ga0373931_0002559
2055 Ga0373931_0956720
2056 Ga0373927_0461142
2057 Ga0373927_0705189
2058 Ga0373933_0808964
2059 Ga0373947_0118463
2060 Ga0373947_1142262
2061 Ga0373937_0018583
2062 Ga0373937_0066960
2063 Ga0373937_0074440
2064 Ga0373937_0383329
2065 Ga0373937_0514887
2066 Ga0373937_0538121
2067 Ga0373937_0772770
2068 Ga0373925_0119813
2069 Ga0373925_0366733
2070 Ga0373925_0618990
2071 Ga0373925_1491515
2072 Ga0395898_0851901
2073 Ga0436365_1564356
2074 Ga0451804_1053224
2075 Ga0451853_2421316
2076 Ga0439431_0200712
2077 Ga0453683_0521581
2078 Ga0466963_0022955
2079 Ga0466964_0267614
2080 Ga0466957_0465128
2081 Ga0466957_1195512
2082 Ga0451576_0039489
2083 Ga0451576_0123050
2084 Ga0451576_0310851
2085 Ga0451576_1165140
2086 Ga0466967_0381804
2087 Ga0466967_0488346
2088 Ga0466967_0693527
2089 Ga0466967_0735542
2090 Ga0466967_1212865
2091 Ga0495603_0139429
2092 Ga0495603_0359822
2093 Ga0495629_0260600
2094 Ga0495629_0769683
2095 Ga0495629_1145709
2096 Ga0495582_0218983
2097 Ga0495582_0471581
2098 Ga0495639_0585397
2099 Ga0495662_0449126
2100 Ga0495664_0493332
2101 Ga0495628_0343585
2102 Ga0495630_0622722
2103 Ga0495630_0708402
2104 Ga0495666_0467059
2105 Ga0495642_0233952
2106 Ga0495652_0292822
2107 Ga0495640_0014890
2108 Ga0495586_0149511
2109 Ga0495586_0212397
2110 Ga0495621_0079804
2111 Ga0495645_0000509
2112 Ga0495635_0098051
2113 Ga0495635_0287767
2114 Ga0495647_0297526
2115 Ga0495658_0136510
2116 Ga0495658_0193547
2117 Ga0495658_0243186
2118 Ga0495658_0310097
2119 Ga0495669_0503056
2120 Ga0495613_0229851
2121 Ga0495613_0488936
2122 Ga0495624_0315593
2123 Ga0495600_0238311
2124 Ga0495581_0240843
2125 Ga0495604_0442036
2126 Ga0495636_0133591
2127 Ga0495674_0219274
2128 Ga0495674_0858680
2129 Ga0495672_0139808
2130 Ga0495676_0541743
2131 Ga0495676_0782385
2132 Ga0495684_0613201
2133 Ga0495602_0413191
2134 Ga0495602_0948454
2135 Ga0496100_0023442
2136 Ga0496100_0711774
2137 Ga0496100_1193621
2138 Ga0496101_0008263
2139 Ga0496102_0039911
2140 Ga0496102_0183611
2141 Ga0496102_0904808
2142 Ga0496102_0995975
2143 Ga0496103_0679340
2144 Ga0496104_0008370
2145 Ga0496104_0092666
2146 Ga0496104_0238629
2147 Ga0496104_0629219
2148 Ga0496104_1051985
2149 Ga0496105_0131253
2150 Ga0496105_0363852
2151 Ga0496105_0547653
2152 Ga0496105_0574366
2153 Ga0496105_1129144
2154 Ga0496106_0170424
2155 Ga0496106_0192956
2156 Ga0496106_0242937
2157 Ga0496106_0319117
2158 Ga0496107_0168851
2159 Ga0496107_0324419
2160 Ga0496108_0086890
2161 Ga0496108_0720306
2162 Ga0496109_0257859
2163 Ga0496109_0445836
2164 Ga0496109_1197699
2165 Ga0496110_0417846
2166 Ga0496110_1021062
2167 Ga0496111_0387003
2168 Ga0496111_0774448
2169 Ga0496112_0030063
2170 Ga0496112_0171416
2171 Ga0496112_0216455
2172 Ga0496112_0373552
2173 Ga0496112_0502510
2174 Ga0496112_0617987
2175 Ga0496112_0764269
2176 Ga0496113_0011324
2177 Ga0496113_1329950
2178 Ga0496113_1363503
2179 Ga0496114_0079280
2180 Ga0496114_0193587
2181 Ga0496114_0381888
2182 Ga0496114_0828104
2183 Ga0496114_1223030
2184 Ga0496115_0378383
2185 Ga0501047_0258794
2186 Ga0501068_0209778
2187 Ga0501069_0455299
2188 Ga0501070_0719052
2189 Ga0501270_028914
2190 Ga0501035_1120856
2191 Ga0501044_0005972
2192 nmdc:mga05p37_106008_c1
2193 nmdc:mga05p37_109188_c1
2194 nmdc:mga05p37_11450_c1
2195 nmdc:mga05p37_13045_c1
2196 nmdc:mga05p37_1346817_c1
2197 nmdc:mga05p37_1551_c1
2198 nmdc:mga05p37_1667387_c1
2199 nmdc:mga05p37_1788810_c1
2200 nmdc:mga05p37_19613_c1
2201 nmdc:mga05p37_283727_c1
2202 nmdc:mga05p37_31436_c1
2203 nmdc:mga05p37_33089_c1
2204 nmdc:mga05p37_446635_c1
2205 nmdc:mga05p37_58340_c1
2206 nmdc:mga05p37_645204_c1
2207 nmdc:mga05p37_778591_c1
2208 nmdc:mga09592_341929_c1
2209 nmdc:mga06r32_53617_c1
2210 nmdc:mga06r32_669353_c1
2211 nmdc:mga08y16_1054093_c1
2212 nmdc:mga08y16_2433_c2
2213 nmdc:mga08y16_36565_c1
2214 nmdc:mga08y16_44512_c1
2215 nmdc:mga08y16_97676_c1
2216 nmdc:mga0n895_1298300_c1
2217 nmdc:mga0n895_133675_c1
2218 nmdc:mga0n895_1436720_c1
2219 nmdc:mga0n895_1771086_c1
2220 nmdc:mga0n895_2345_c1
2221 nmdc:mga0n895_235457_c1
2222 nmdc:mga0n895_287218_c1
2223 nmdc:mga0n895_29627_c1
2224 nmdc:mga0n895_360872_c1
2225 nmdc:mga0n895_416433_c1
2226 nmdc:mga0n895_457357_c1
2227 nmdc:mga0n895_60819_c1
2228 nmdc:mga0n895_634453_c1
2229 nmdc:mga0n895_725055_c1
2230 nmdc:mga0n895_8_c1
2231 nmdc:mga0n895_96669_c1
2232 nmdc:mga0rr50_109364_c1
2233 nmdc:mga0rr50_119_c1
2234 nmdc:mga0rr50_24324_c1
2235 nmdc:mga0rr50_31102_c1
2236 nmdc:mga0rr50_69851_c1
2237 nmdc:mga0rr50_932546_c1
2238 nmdc:mga08x19_127741_c1
2239 nmdc:mga08x19_1319323_c1
2240 nmdc:mga08x19_1669_c1
2241 nmdc:mga08x19_180602_c1
2242 nmdc:mga08x19_20081_c1
2243 nmdc:mga08x19_382707_c1
2244 nmdc:mga08x19_384138_c1
2245 nmdc:mga08x19_591038_c1
2246 nmdc:mga08x19_631219_c1
2247 nmdc:mga08x19_92990_c1
2248 nmdc:mga0a205_126843_c1
2249 nmdc:mga0a205_206601_c1
2250 nmdc:mga0a205_222919_c1
2251 nmdc:mga0a205_350700_c1
2252 nmdc:mga0a205_366472_c1
2253 nmdc:mga0a205_43427_c1
2254 nmdc:mga0a205_6877_c1
2255 nmdc:mga0a205_877439_c1
2256 Ga0495601_0209514
2257 Ga0495601_0328461
2258 Ga0495601_0394612
2259 Ga0495601_0544816
2260 Ga0495595_0060856
2261 Ga0495595_0167947
2262 Ga0495619_0022737
2263 Ga0495619_0062975
2264 Ga0495619_0288181
2265 Ga0495619_0376053
2266 Ga0495619_0625344
2267 Ga0495619_0642449
2268 Ga0500658_0125370
2269 Ga0587084_006303
2270 Ga0587084_016774
2271 Ga0587084_017196
2272 Ga0587084_018734
2273 Ga0587084_022635
2274 Ga0587084_030517
2275 Ga0587084_032188
2276 Ga0587084_037250
2277 Ga0587093_004941
2278 Ga0587093_018471
2279 Ga0587093_043131
2280 Ga0587066_001392
2281 Ga0587066_014432
2282 Ga0587066_016790
2283 Ga0587066_022279
2284 Ga0587066_028222
2285 Ga0587066_061140
2286 Ga0587070_013731
2287 Ga0587070_015134
2288 Ga0587070_027229
2289 Ga0587070_087995
2290 Ga0587073_0025332
2291 Ga0587073_0057681
2292 Ga0587073_0112429
2293 Ga0587073_0205093
2294 Ga0587077_004110
2295 Ga0587077_005878
2296 Ga0587077_016404
2297 Ga0587077_019964
2298 Ga0587077_037380
2299 Ga0587077_039283
2300 Ga0587077_069874
2301 Ga0587077_102717
2302 Ga0587077_112178
2303 Ga0587077_149036
2304 Ga0587077_157051
2305 Ga0587080_011059
2306 Ga0587080_027804
2307 Ga0587082_009184
2308 Ga0587082_028990
2309 Ga0587082_033926
2310 Ga0587082_041800
2311 Ga0587082_050497
2312 Ga0587082_052644
2313 Ga0587082_067377
2314 Ga0587082_074571
2315 Ga0587082_088296
2316 Ga0587083_0007085
2317 Ga0587083_0028038
2318 Ga0587083_0040957
2319 Ga0587083_0081933
2320 Ga0587083_0106193
2321 Ga0587083_0166458
2322 Ga0587083_0219178
2323 Ga0587085_021598
2324 Ga0587085_021850
2325 Ga0587085_028226
2326 Ga0587085_029602
2327 Ga0587085_040529
2328 Ga0587085_044924
2329 Ga0587085_080341
2330 Ga0587086_010264
2331 Ga0587086_026789
2332 Ga0587088_011543
2333 Ga0587089_006225
2334 Ga0587089_048596
2335 Ga0587090_010749
2336 Ga0587090_011436
2337 Ga0587090_019028
2338 Ga0587090_019336
2339 Ga0587091_009707
2340 Ga0587091_024301
2341 Ga0587091_045302
2342 Ga0587091_070679
2343 Ga0587091_079602
2344 Ga0587092_007759
2345 Ga0587092_011506
2346 Ga0587092_015242
2347 Ga0587092_060089
2348 Ga0587094_005397
2349 Ga0587094_008518
2350 Ga0587094_073577
2351 Ga0587106_076202
2352 Ga0587106_149788
2353 Ga0587125_011387
2354 Ga0587131_002258
2355 Ga0587099_017036
2356 Ga0587101_011037
2357 Ga0587101_013466
2358 Ga0587101_014970
2359 Ga0587101_032478
2360 Ga0587101_036179
2361 Ga0587101_068754
2362 Ga0587101_101852
2363 Ga0587109_023275
2364 Ga0587109_037244
2365 Ga0587109_039128
2366 Ga0587109_042157
2367 Ga0587109_135511
2368 Ga0587115_001579
2369 Ga0587115_021733
2370 Ga0587115_021765
2371 Ga0587115_052268
2372 Ga0587117_012894
2373 Ga0587117_020630
2374 Ga0587128_048879
2375 Ga0587062_006883
2376 Ga0587062_024422
2377 Ga0587062_024839
2378 Ga0587062_035873
2379 Ga0587067_010641
2380 Ga0587067_014669
2381 Ga0587067_023463
2382 Ga0587067_030081
2383 Ga0587067_090350
2384 Ga0587068_009216
2385 Ga0587068_010717
2386 Ga0587068_021773
2387 Ga0587068_028906
2388 Ga0587068_033650
2389 Ga0587068_077516
2390 Ga0587069_002652
2391 Ga0587069_028003
2392 Ga0587069_028191
2393 Ga0587069_100170
2394 Ga0587072_013991
2395 Ga0587072_057849
2396 Ga0587072_066457
2397 Ga0587072_097957
2398 Ga0587072_111112
2399 Ga0587072_133491
2400 Ga0587075_011165
2401 Ga0587075_117265
2402 Ga0587076_007491
2403 Ga0587076_020875
2404 Ga0587076_048268
2405 Ga0587076_065043
2406 Ga0587079_015793
2407 Ga0587079_018920
2408 Ga0587079_022699
2409 Ga0587079_024716
2410 Ga0587079_035978
2411 Ga0587079_042730
2412 Ga0587079_056244
2413 Ga0587079_064686
2414 Ga0587079_077499
2415 Ga0587079_095434
2416 Ga0587079_098546
2417 Ga0587079_110256
2418 Ga0587079_149893
2419 Ga0587100_022777
2420 Ga0587100_027080
2421 Ga0587102_023417
2422 Ga0587107_024739
2423 Ga0587107_081759
2424 Ga0587110_026769
2425 Ga0587114_003380
2426 Ga0587119_014099
2427 Ga0587119_051833
2428 Ga0587124_023402
2429 Ga0587071_009087
2430 Ga0587071_012801
2431 Ga0587071_015453
2432 Ga0587071_024210
2433 Ga0587071_046564
2434 Ga0587071_060504
2435 Ga0587071_072294
2436 Ga0587071_094392
2437 Ga0587111_0001422
2438 Ga0587111_0023436
2439 Ga0587111_0030694
2440 Ga0587111_0031932
2441 Ga0587111_0034205
2442 Ga0587111_0038817
2443 Ga0587111_0047896
2444 Ga0587111_0056409
2445 Ga0587111_0227722
2446 Ga0501082_0862075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

12

128

0.93

Map