F491878

General Info

Members Datasets Scaffolds Average Seq Length
1222 1002 447 252

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2937822353|2937825694
Length 300
Sequence PGNANASLRWNHPSSVSALSRRSTFSHKGRRKNCDNRSIAQQPPPVYLDRMSDTSSRLTGWTDLANPTRFVGLADRLVPWLASVAAILLAVGLYMSFAAPEDFQQGITVRIMYIHVPFAWLAMMCYTVMAVAALGTLVWRHPLADVALKSAAPIGATFTALALITGSIWGKPMWGTWWVWDARLTSVFVLFLMYLGIIALTRALDDASRAAWAAAIITLVGFINIPIIKFSVDWWNTLHQPASVFRLGGPTIDPSLLWPLLVMALGFTVLFFALHLTAMRTEIRRRRVIAMRRVAARQAN

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
15 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
16 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
17 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
18 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
19 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
20 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
21 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
22 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
23 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
24 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
25 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
26 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
27 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
28 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
29 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
30 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
31 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
32 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
33 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
34 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
35 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
36 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
37 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
38 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
39 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
40 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
41 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
42 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
43 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
44 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
45 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
46 2516143018 Ensifer sp. BR816 Isolate Nodule
47 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
48 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
49 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
50 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
51 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
52 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
53 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
54 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
55 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
56 2534681786 Brucella suis 92/29 Isolate Unclassified
57 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
58 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
59 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
60 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
61 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
62 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
63 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
64 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
65 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
66 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
67 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
68 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
69 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
70 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
71 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
72 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
73 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
74 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
75 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
76 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
77 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
78 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
79 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
80 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
81 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
82 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
83 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
84 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
85 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
86 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
87 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
88 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
89 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
90 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
91 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
92 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
93 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
94 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
95 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
96 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
97 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
98 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
99 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
100 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
101 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
102 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
103 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
104 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
105 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
106 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
107 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
108 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
109 2643221557 Ensifer sp. Root558 Isolate Unclassified
110 2643221558 Rhizobium sp. Root149 Isolate Unclassified
111 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
112 2643221568 Rhizobium sp. Root564 Isolate Unclassified
113 2643221582 Rhizobium sp. Root651 Isolate Unclassified
114 2643221599 Rhizobium sp. Root708 Isolate Unclassified
115 2643221607 Rhizobium sp. Root73 Isolate Unclassified
116 2643221610 Ensifer sp. Root74 Isolate Unclassified
117 2643221618 Ensifer sp. Root231 Isolate Unclassified
118 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
119 2643221626 Ensifer sp. Root31 Isolate Unclassified
120 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
121 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
122 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
123 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
124 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
125 2643221655 Ensifer sp. Root1252 Isolate Unclassified
126 2643221659 Ensifer sp. Root127 Isolate Unclassified
127 2643221668 Ensifer sp. Root423 Isolate Unclassified
128 2643221675 Ensifer sp. Root1298 Isolate Unclassified
129 2643221680 Ensifer sp. Root1312 Isolate Unclassified
130 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
131 2643221688 Rhizobium sp. Root482 Isolate Unclassified
132 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
133 2643221693 Rhizobium sp. Root491 Isolate Unclassified
134 2643221698 Ensifer sp. Root142 Isolate Unclassified
135 2643221712 Ensifer sp. Root258 Isolate Unclassified
136 2643221718 Rhizobium sp. Root268 Isolate Unclassified
137 2643221719 Rhizobium sp. Root274 Isolate Unclassified
138 2643221723 Ensifer sp. Root278 Isolate Unclassified
139 2643221726 Ensifer sp. Root954 Isolate Unclassified
140 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
141 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
142 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
143 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
144 2718217882 Rhizobium sp. N741 Isolate Nodule
145 2718217927 Rhizobium sp. N324 Isolate Nodule
146 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
147 2718218009 Rhizobium sp. N561 Isolate Nodule
148 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
149 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
150 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
151 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
152 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
153 2718218363 Rhizobium sp. N113 Isolate Nodule
154 2718218365 Rhizobium sp. N731 Isolate Nodule
155 2718218366 Rhizobium sp. N621 Isolate Nodule
156 2718218423 Rhizobium sp. N941 Isolate Nodule
157 2721755514 Rhizobium sp. N6212 Isolate Nodule
158 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
159 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
160 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
161 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
162 2721755809 Rhizobium sp. N541 Isolate Nodule
163 2721755810 Rhizobium sp. N871 Isolate Nodule
164 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
165 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
166 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
167 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
168 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
169 2728369365 Rhizobium sp. N1341 Isolate Nodule
170 2728369397 Rhizobium sp. N1314 Isolate Nodule
171 2738541293 Rhizobium sp. GV031 Isolate Unclassified
172 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
173 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
174 2738543024 Aminobacter sp. AP02 Isolate Unclassified
175 2751185800 Brucella pituitosa AA2 Isolate Unclassified
176 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
177 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
178 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
179 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
180 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
181 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
182 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
183 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
184 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
185 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
186 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
187 2791355260 Rhizobium sp. L9 Isolate Nodule
188 2791355261 Rhizobium sp. J15 Isolate Nodule
189 2791355263 Rhizobium chutanense C5 Isolate Nodule
190 2791355264 Rhizobium sp. S9 Isolate Nodule
191 2791355265 Rhizobium sp. H4 Isolate Nodule
192 2791355267 Rhizobium sp. L18 Isolate Nodule
193 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
194 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
195 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
196 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
197 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
198 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
199 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
200 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
201 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
202 2802429633 Rhizobium anhuiense J3 Isolate Nodule
203 2802429634 Rhizobium anhuiense S10 Isolate Nodule
204 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
205 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
206 2802429637 Rhizobium anhuiense C15 Isolate Nodule
207 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
208 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
209 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
210 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
211 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
212 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
213 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
214 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
215 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
216 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
217 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
218 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
219 2838048938 Rhizobium pisi 27/80 Isolate Nodule
220 2838061910 Rhizobium phaseoli L15 Isolate Nodule
221 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
222 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
223 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
224 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
225 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
226 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
227 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
228 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
229 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
230 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
231 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
232 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
233 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
234 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
235 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
236 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
237 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
238 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
239 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
240 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
241 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
242 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
243 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
244 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
245 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
246 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
247 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
248 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
249 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
250 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
251 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
252 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
253 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
254 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
255 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
256 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
257 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
258 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
259 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
260 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
261 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
262 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
263 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
264 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
265 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
266 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
267 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
268 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
269 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
270 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
271 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
272 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
273 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
274 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
275 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
276 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
277 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
278 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
279 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
280 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
281 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
282 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
283 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
284 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
285 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
286 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
287 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
288 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
289 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
290 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
291 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
292 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
293 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
294 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
295 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
296 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
297 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
298 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
299 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
300 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
301 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
302 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
303 2844163670 Ensifer sp. 1H6 Isolate Unclassified
304 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
305 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
306 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
307 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
308 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
309 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
310 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
311 2854911287 Brucella lupini LUP21 Isolate Unclassified
312 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
313 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
314 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
315 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
316 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
317 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
318 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
319 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
320 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
321 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
322 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
323 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
324 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
325 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
326 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
327 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
328 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
329 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
330 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
331 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
332 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
333 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
334 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
335 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
336 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
337 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
338 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
339 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
340 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
341 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
342 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
343 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
344 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
345 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
346 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
347 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
348 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
349 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
350 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
351 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
352 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
353 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
354 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
355 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
356 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
357 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
358 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
359 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
360 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
361 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
362 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
363 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
364 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
365 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
366 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
367 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
368 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
369 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
370 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
371 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
372 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
373 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
374 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
375 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
376 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
377 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
378 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
379 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
380 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
381 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
382 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
383 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
384 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
385 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
386 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
387 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
388 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
389 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
390 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
391 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
392 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
393 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
394 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
395 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
396 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
397 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
398 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
399 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
400 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
401 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
402 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
403 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
404 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
405 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
406 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
407 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
408 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
409 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
410 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
411 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
412 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
413 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
414 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
415 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
416 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
417 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
418 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
419 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
420 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
421 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
422 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
423 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
424 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
425 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
426 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
427 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
428 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
429 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
430 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
431 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
432 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
433 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
434 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
435 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
436 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
437 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
438 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
439 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
440 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
441 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
442 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
443 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
444 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
445 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
446 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
447 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
448 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
449 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
450 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
451 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
452 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
453 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
454 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
455 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
456 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
457 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
458 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
459 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
460 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
461 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
462 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
463 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
464 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
465 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
466 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
467 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
468 2933599457 Rhizobium phaseoli M3 Isolate Nodule
469 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
470 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
471 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
472 2936381700 Rhizobium chutanense C16 Isolate Unclassified
473 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
474 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
475 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
476 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
477 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
478 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
479 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
480 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
481 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
482 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
483 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
484 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
485 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
486 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
487 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
488 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
489 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
490 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
491 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
492 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
493 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
494 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
495 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
496 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
497 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
498 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
499 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
500 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
501 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
502 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
503 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
504 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
505 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
506 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
507 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
508 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
509 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
510 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
511 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
512 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
513 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
514 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
515 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
516 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
517 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
518 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
519 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
520 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
521 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
522 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
523 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
524 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
525 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
526 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
527 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
528 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
529 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
530 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
531 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
532 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
533 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
534 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
535 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
536 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
537 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
538 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
539 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
540 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
541 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
542 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
543 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
544 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
545 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
546 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
547 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
548 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
549 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
550 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
551 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
552 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
553 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
554 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
555 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
556 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
557 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
558 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
559 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
560 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
561 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
562 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
563 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
564 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
565 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
566 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
567 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
568 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
569 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
570 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
571 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
572 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
573 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
574 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
575 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
576 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
577 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
578 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
579 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
580 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
581 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
582 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
583 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
584 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
585 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
586 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
587 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
588 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
589 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
590 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
591 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
592 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
593 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
594 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
595 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
596 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
597 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
598 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
599 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
600 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
601 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
602 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
603 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
604 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
605 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
606 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
607 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
608 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
609 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
610 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
611 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
612 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
613 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
614 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
615 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
616 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
617 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
618 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
619 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
620 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
621 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
622 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
623 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
624 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
625 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
626 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
627 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
628 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
629 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
630 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
631 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
632 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
633 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
634 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
635 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
636 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
637 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
638 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
639 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
640 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
641 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
642 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
643 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
644 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
645 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
646 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
647 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
648 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
649 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
650 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
651 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
652 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
653 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
654 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
655 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
656 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
657 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
658 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
659 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
660 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
661 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
662 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
663 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
664 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
665 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
666 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
667 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
668 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
669 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
670 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
671 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
672 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
673 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
674 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
675 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
676 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
677 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
678 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
679 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
680 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
681 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
682 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
683 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
684 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
685 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
686 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
687 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
688 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
689 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
690 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
691 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
692 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
693 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
694 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
695 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
696 2996887358 Rhizobium sp. R711 Isolate Nodule
697 2996893221 Rhizobium sp. R635 Isolate Nodule
698 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
699 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
700 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
701 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
702 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
703 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
704 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
705 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
706 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
707 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
708 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
709 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
710 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
711 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
712 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
713 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
714 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
715 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
716 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
717 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
718 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
719 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
720 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
721 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
722 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
723 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
724 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
725 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
726 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
727 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
728 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
729 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
730 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
731 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
732 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
733 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
734 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
735 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
736 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
737 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
738 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
739 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
740 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
741 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
742 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
743 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
744 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
745 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
746 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
747 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
748 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
749 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
750 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
751 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
752 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
753 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
754 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
755 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
756 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
757 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
758 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
759 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
760 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
761 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
762 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
763 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
764 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
765 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
766 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
767 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
768 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
769 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
770 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
771 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
772 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
773 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
774 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
775 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
776 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
777 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
778 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
779 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
780 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
781 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
782 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
783 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
784 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
785 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
786 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
787 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
788 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
789 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
790 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
791 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
792 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
793 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
794 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
795 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
796 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
797 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
798 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
799 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
800 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
801 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
802 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
803 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
804 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
805 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
806 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
807 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
808 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
809 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
810 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
811 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
812 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
813 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
814 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
815 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
816 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
817 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
818 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
819 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
820 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
821 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
822 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
823 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
824 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
825 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
826 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
827 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
828 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
829 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
830 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
831 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
832 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
833 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
834 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
835 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
836 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
837 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
838 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
839 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
840 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
841 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
842 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
843 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
844 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
845 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
846 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
847 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
848 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
849 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
850 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
851 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
852 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
853 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
854 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
855 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
856 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
857 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
858 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
859 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
860 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
861 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
862 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
863 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
864 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
865 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
866 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
867 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
868 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
869 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
870 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
871 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
872 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
873 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
874 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
875 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
876 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
877 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
878 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
879 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
880 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
881 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
882 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
883 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
884 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
885 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
886 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
887 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
888 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
889 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
890 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
891 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
892 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
893 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
894 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
895 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
896 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
897 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
898 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
899 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
900 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
901 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
902 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
903 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
904 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
905 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
906 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
907 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
908 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
909 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
910 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
911 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
912 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
913 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
914 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
915 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
916 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
917 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
918 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
919 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
920 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
921 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
922 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
923 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
924 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
925 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
926 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
927 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
928 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
929 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
930 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
931 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
932 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
933 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
934 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
935 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
936 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
937 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
938 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
939 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
940 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
941 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
942 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
943 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
944 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
945 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
946 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
947 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
948 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
949 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
950 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
951 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
952 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
953 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
954 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
955 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
956 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
957 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
958 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
959 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
960 8005258706 Rhizobium sp. R693 Isolate Nodule
961 8005275841 Rhizobium sp. N4311 Isolate Nodule
962 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
963 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
964 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
965 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
966 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
967 8005321885 Rhizobium sp. R72 Isolate Nodule
968 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
969 8005395548 Rhizobium sp. R339 Isolate Nodule
970 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
971 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
972 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
973 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
974 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
975 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
976 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
977 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
978 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
979 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
980 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
981 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
982 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
983 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
984 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
985 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
986 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
987 8018176218 Rhizobium sp. N122 Isolate Nodule
988 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
989 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
990 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
991 8024501048 Rhizobium sp. H4 Isolate Nodule
992 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
993 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
994 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
995 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
996 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
997 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
998 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
999 8056382006 Rhizobium croatiense 13T Isolate Nodule
1000 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1001 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1002 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.17
Metatranscriptomes 0.49
Isolates 63.34

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 12.77
Nodule 49.59
Rhizoplane 1.23
Rhizosphere 18.41
Stem 0
Stem Tuber 0
Unclassified 17.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000013 3300001979 Bacteria 62177
2 JGI24739J22299_10061530 3300001989 Bacteria 1185
3 JGI25155J39150_1000010 3300002704 Bacteria 207717
4 JGI25156J39149_1000102 3300002705 Bacteria 62463
5 JGI25162J39368_1002243 3300002737 Bacteria 7888
6 JGI25154J39366_1000096 3300002738 Bacteria 79168
7 JGI25158J39367_1000116 3300002739 Bacteria 18332
8 JGI25158J39367_1014000 3300002739 Bacteria 1041
9 JGI25157J39369_1000009 3300002741 Bacteria 207868
10 JGI25152J39213_1002679 3300002773 Bacteria 6558
11 JGI25152J39213_1007127 3300002773 Bacteria 2934
12 JGI25152J39213_1015884 3300002773 Bacteria 1471
13 JGI25150J39212_1000037 3300002774 Bacteria 88885
14 JGI25159J45721_1002450 3300002987 Bacteria 7046
15 JGI25151J46595_10000220 3300003187 Bacteria 67327
16 JGI25151J46595_10011616 3300003187 Bacteria 4041
17 JGI25151J46595_10013759 3300003187 Bacteria 3630
18 JGI25165J46597_1000070 3300003214 Bacteria 193557
19 JGI25165J46597_1001449 3300003214 Bacteria 12524
20 JGI25153J46596_10007468 3300003215 Bacteria 5371
21 JGI25153J46596_10039259 3300003215 Bacteria 1481
22 rootL2_10053278 3300003322 Bacteria 3771
23 JGI25160J50197_1000027 3300003354 Bacteria 182809
24 JGI25161J50226_1000327 3300003374 Bacteria 25949
25 JGI25161J50226_1000501 3300003374 Bacteria 17353
26 Ga0006562J51391_1011280 3300003578 Bacteria 1090
27 Ga0006562J51391_1037909 3300003578 Bacteria 2120
28 Ga0055526_1001473 3300003771 Bacteria 16693
29 Ga0055526_1008010 3300003771 Bacteria 5352
30 Ga0055526_1016809 3300003771 Bacteria 2835
31 Ga0055526_1038822 3300003771 Bacteria 1221
32 Ga0055524_1002650 3300003775 Bacteria 9086
33 Ga0055524_1004200 3300003775 Bacteria 6711
34 Ga0055524_1014167 3300003775 Bacteria 2970
35 Ga0055524_1021291 3300003775 Bacteria 2154
36 Ga0055536_1001323 3300003781 Bacteria 15170
37 Ga0055528_1000099 3300003790 Bacteria 68463
38 Ga0055528_1003479 3300003790 Bacteria 7866
39 Ga0055528_1003641 3300003790 Bacteria 7651
40 Ga0055530_10043447 3300003791 Bacteria 1083
41 Ga0055540_1009091 3300003792 Bacteria 3483
42 Ga0055531_10004054 3300003794 Bacteria 9079
43 Ga0058692_1004143 3300003856 Bacteria 4342
44 Ga0058692_1006819 3300003856 Bacteria 3085
45 Ga0055543_1000030 3300004625 Bacteria 130849
46 Ga0055543_1000062 3300004625 Bacteria 98034
47 Ga0065165_1000122 3300005262 Bacteria 132524
48 Ga0065165_1009930 3300005262 Bacteria 4192
49 Ga0065165_1020897 3300005262 Bacteria 2288
50 Ga0070670_100000116 3300005331 Bacteria 74586
51 Ga0070668_100073821 3300005347 Bacteria 2660
52 Ga0070669_100071728 3300005353 Bacteria 2563
53 Ga0070669_100423593 3300005353 Bacteria 1093
54 Ga0070671_100057902 3300005355 Bacteria 3225
55 Ga0070667_100305966 3300005367 Bacteria 1432
56 Ga0070678_100334366 3300005456 Bacteria 1297
57 Ga0070665_100004011 3300005548 Bacteria 15524
58 Ga0070665_100036324 3300005548 Bacteria 4957
59 Ga0070665_100043495 3300005548 Bacteria 4514
60 Ga0070665_100483703 3300005548 Bacteria 1249
61 Ga0068852_100143657 3300005616 Bacteria 2211
62 Ga0068852_100326072 3300005616 Bacteria 1492
63 Ga0068851_10117485 3300005834 Bacteria 1426
64 Ga0068862_100544907 3300005844 Bacteria 1107
65 Ga0081539_10002530 3300005985 Bacteria 25517
66 Ga0075365_10000498 3300006038 Bacteria 14945
67 Ga0075365_10034493 3300006038 Bacteria 3268
68 Ga0075365_10093998 3300006038 Bacteria 2046
69 Ga0075365_10095323 3300006038 Bacteria 2032
70 Ga0075365_10232525 3300006038 Bacteria 1294
71 Ga0075368_10003863 3300006042 Bacteria 5041
72 Ga0075363_100031175 3300006048 Bacteria 2763
73 Ga0075363_100080411 3300006048 Bacteria 1782
74 Ga0075364_10000026 3300006051 Bacteria 51217
75 Ga0075362_10021353 3300006177 Bacteria 2715
76 Ga0075362_10022878 3300006177 Bacteria 2637
77 Ga0075367_10004009 3300006178 Bacteria 7117
78 Ga0075367_10004494 3300006178 Bacteria 6818
79 Ga0075367_10040098 3300006178 Bacteria 2733
80 Ga0075367_10087255 3300006178 Bacteria 1895
81 Ga0075367_10134531 3300006178 Bacteria 1529
82 Ga0075369_10002071 3300006186 Bacteria 7079
83 Ga0075369_10091960 3300006186 Bacteria 1355
84 Ga0075369_10128867 3300006186 Bacteria 1148
85 Ga0075369_10217669 3300006186 Bacteria 884
86 Ga0075370_10025818 3300006353 Bacteria 3251
87 Ga0079104_1000195 3300006946 Bacteria 85244
88 Ga0079104_1014561 3300006946 Bacteria 2367
89 Ga0099826_10000958 3300006948 Bacteria 16050
90 Ga0105240_10000013 3300009093 Bacteria 483458
91 Ga0105243_10005164 3300009148 Bacteria 10226
92 Ga0105237_10012810 3300009545 Bacteria 8820
93 Ga0105237_10016781 3300009545 Bacteria 7602
94 Ga0105238_10011895 3300009551 Bacteria 8767
95 Ga0123341_1000009 3300009765 Bacteria 122597
96 Ga0123341_1023081 3300009765 Bacteria 5142
97 Ga0123342_1009724 3300009766 Bacteria 11342
98 Ga0123342_1037770 3300009766 Bacteria 1918
99 Ga0105239_10000820 3300010375 Bacteria 44190
100 Ga0157373_10094150 3300013100 Bacteria 2109
101 Ga0157371_10000108 3300013102 Bacteria 126288
102 Ga0157371_10009815 3300013102 Bacteria 7505
103 Ga0157370_10004961 3300013104 Bacteria 15062
104 Ga0157370_10005427 3300013104 Bacteria 14303
105 Ga0157370_10330905 3300013104 Bacteria 1405
106 Ga0157369_10032455 3300013105 Bacteria 5742
107 Ga0157369_10352336 3300013105 Bacteria 1529
108 Ga0171463_1004 3300013249 Bacteria 437207
109 Ga0157378_10914981 3300013297 Bacteria 908
110 Ga0182007_10002575 3300015262 Bacteria 8925
111 Ga0182005_1004658 3300015265 Bacteria 4386
112 Ga0183363_1019 3300015690 Bacteria 61083
113 Ga0206352_10368268 3300020078 Bacteria 1524
114 Ga0206353_10130919 3300020082 Bacteria 1365
115 Ga0214544_1000288 3300021320 Bacteria 85073
116 Ga0214542_1000008 3300021321 Bacteria 278895
117 Ga0214543_1000015 3300021327 Bacteria 305679
118 Ga0214543_1000031 3300021327 Bacteria 206436
119 Ga0213874_10104565 3300021377 Bacteria 945
120 Ga0228711_1000004 3300022739 Bacteria 250146
121 Ga0228710_1000002 3300022740 Bacteria 287279
122 Ga0209435_100009 3300025206 Bacteria 476614
123 Ga0209436_100018 3300025208 Bacteria 113499
124 Ga0209436_100664 3300025208 Bacteria 14651
125 Ga0209436_107083 3300025208 Bacteria 2386
126 Ga0209672_103233 3300025228 Bacteria 3465
127 Ga0209437_100057 3300025233 Bacteria 362922
128 Ga0207425_1000034 3300025245 Bacteria 227886
129 Ga0207425_1002143 3300025245 Bacteria 7234
130 Ga0209646_1000018 3300025246 Bacteria 476716
131 Ga0209646_1003848 3300025246 Bacteria 2865
132 Ga0209026_1000068 3300025250 Bacteria 207601
133 Ga0209677_100199 3300025253 Bacteria 48030
134 Ga0209759_1000007 3300025256 Bacteria 476614
135 Ga0209129_1000118 3300025258 Bacteria 139972
136 Ga0209129_1000253 3300025258 Bacteria 55709
137 Ga0209129_1000971 3300025258 Bacteria 17232
138 Ga0209129_1003196 3300025258 Bacteria 7326
139 Ga0209129_1003252 3300025258 Bacteria 7210
140 Ga0209129_1004160 3300025258 Bacteria 5843
141 Ga0209233_1000130 3300025261 Bacteria 205687
142 Ga0209233_1000131 3300025261 Bacteria 205257
143 Ga0209233_1006961 3300025261 Bacteria 3613
144 Ga0209455_1011173 3300025272 Bacteria 2229
145 Ga0209673_1000033 3300025273 Bacteria 335369
146 Ga0209673_1004625 3300025273 Bacteria 7285
147 Ga0209673_1005860 3300025273 Bacteria 6081
148 Ga0209673_1037398 3300025273 Bacteria 1427
149 Ga0209130_1000009 3300025284 Bacteria 498952
150 Ga0209130_1000027 3300025284 Bacteria 327700
151 Ga0209676_1000406 3300025292 Bacteria 77603
152 Ga0209025_1000042 3300025294 Bacteria 370577
153 Ga0209025_1000241 3300025294 Bacteria 128329
154 Ga0209025_1000487 3300025294 Bacteria 76541
155 Ga0209025_1000533 3300025294 Bacteria 72404
156 Ga0209025_1002217 3300025294 Bacteria 21448
157 Ga0209564_1000111 3300025295 Bacteria 212210
158 Ga0209564_1000782 3300025295 Bacteria 44138
159 Ga0209564_1016817 3300025295 Bacteria 2888
160 Ga0209564_1024253 3300025295 Bacteria 2077
161 Ga0209758_1000415 3300025297 Bacteria 72404
162 Ga0209758_1000570 3300025297 Bacteria 57866
163 Ga0209758_1001085 3300025297 Bacteria 35309
164 Ga0209758_1001086 3300025297 Bacteria 35300
165 Ga0209758_1002520 3300025297 Bacteria 18534
166 Ga0209758_1014230 3300025297 Bacteria 4252
167 Ga0209758_1015745 3300025297 Bacteria 3893
168 Ga0209758_1033127 3300025297 Bacteria 2083
169 Ga0209758_1081103 3300025297 Bacteria 981
170 Ga0209050_1000572 3300025298 Bacteria 59716
171 Ga0209050_1004558 3300025298 Bacteria 9300
172 Ga0209256_1003544 3300025299 Bacteria 10827
173 Ga0209256_1003766 3300025299 Bacteria 10227
174 Ga0209256_1007283 3300025299 Bacteria 5513
175 Ga0209256_1016905 3300025299 Bacteria 2456
176 Ga0207426_1000041 3300025302 Bacteria 433536
177 Ga0207426_1000072 3300025302 Bacteria 327700
178 Ga0207426_1001232 3300025302 Bacteria 22539
179 Ga0209051_1001068 3300025303 Bacteria 25445
180 Ga0209051_1005359 3300025303 Bacteria 7531
181 Ga0209051_1006368 3300025303 Bacteria 6674
182 Ga0209051_1009487 3300025303 Bacteria 5011
183 Ga0209257_1007840 3300025304 Bacteria 6305
184 Ga0207647_10341561 3300025904 Bacteria 848
185 Ga0207695_10000044 3300025913 Bacteria 440819
186 Ga0207671_10000400 3300025914 Bacteria 60604
187 Ga0207681_10336655 3300025923 Bacteria 1204
188 Ga0207681_10465700 3300025923 Bacteria 1030
189 Ga0207694_10019075 3300025924 Bacteria 5183
190 Ga0207650_10000691 3300025925 Bacteria 26420
191 Ga0207668_10599635 3300025972 Bacteria 959
192 Ga0207639_10030702 3300026041 Bacteria 3943
193 Ga0207678_10157915 3300026067 Bacteria 1937
194 Ga0207678_10555784 3300026067 Bacteria 1004
195 Ga0207648_10598053 3300026089 Bacteria 1016
196 Ga0207698_10148018 3300026142 Bacteria 2034
197 Ga0209281_1000028 3300027111 Bacteria 440027
198 Ga0209281_1000030 3300027111 Bacteria 425931
199 Ga0209281_1000144 3300027111 Bacteria 172471
200 Ga0209371_1000037 3300027312 Bacteria 367074
201 Ga0209371_1003285 3300027312 Bacteria 8011
202 Ga0209282_1000004 3300027666 Bacteria 425931
203 Ga0209282_1003026 3300027666 Bacteria 9890
204 Ga0209813_10008558 3300027866 Bacteria 2590
205 Ga0268266_10004208 3300028379 Bacteria 13852
206 Ga0268266_10006277 3300028379 Bacteria 10907
207 Ga0268266_10452834 3300028379 Bacteria 1220
208 Ga0268266_10733278 3300028379 Bacteria 953
209 Ga0268265_10527461 3300028380 Bacteria 1117
210 Ga0307515_10001330 3300028794 Bacteria 55993
211 Ga0307515_10040955 3300028794 Bacteria 7305
212 Ga0307515_10324407 3300028794 Bacteria 1203
213 Ga0268256_1000039 3300030500 Bacteria 354969
214 Ga0268256_1003721 3300030500 Bacteria 6713
215 Ga0268256_1006192 3300030500 Bacteria 4501
216 Ga0307513_10005665 3300031456 Bacteria 16445
217 Ga0307408_100133551 3300031548 Bacteria 1939
218 Ga0307508_10188191 3300031616 Bacteria 1666
219 Ga0307405_10014073 3300031731 Bacteria 4290
220 Ga0307410_10220262 3300031852 Bacteria 1460
221 Ga0307406_10019368 3300031901 Bacteria 3992
222 Ga0307412_10005736 3300031911 Bacteria 6978
223 Ga0315914_1000001 3300031967 Bacteria 416633
224 Ga0307409_100018253 3300031995 Bacteria 4709
225 Ga0307409_100603870 3300031995 Bacteria 1085
226 Ga0307414_10092769 3300032004 Bacteria 2249
227 Ga0315913_1000004 3300033430 Bacteria 192741
228 Ga0315915_1000002 3300033464 Bacteria 425854
229 Ga0316582_0101645 3300036647 Bacteria 1905
230 Ga0395899_0075980 3300037312 Bacteria 2453
231 Ga0395900_0000027 3300037418 Bacteria 285957
232 Ga0395900_0089901 3300037418 Bacteria 3156
233 Ga0395900_0108539 3300037418 Bacteria 2851
234 Ga0395900_0804429 3300037418 Bacteria 868
235 Ga0395898_0000255 3300037466 Bacteria 131017
236 Ga0395905_0000032 3300037471 Bacteria 285932
237 Ga0395905_0001780 3300037471 Bacteria 24999
238 Ga0395905_0008738 3300037471 Bacteria 9964
239 Ga0395905_0021304 3300037471 Bacteria 6132
240 Ga0395905_0424658 3300037471 Bacteria 1226
241 Ga0395901_0000110 3300038443 Bacteria 112682
242 Ga0395901_0073195 3300038443 Bacteria 3573
243 Ga0395901_0171280 3300038443 Bacteria 2278
244 Ga0400488_35929 3300038741 Bacteria 1343
245 Ga0436363_0703352 3300039450 Bacteria 945
246 Ga0439436_0025270 3300041404 Bacteria 1745
247 Ga0439436_0029222 3300041404 Bacteria 1606
248 Ga0439465_0025792 3300041413 Bacteria 1856
249 Ga0439465_0035904 3300041413 Bacteria 1590
250 Ga0451837_0421092 3300041494 Bacteria 1456
251 Ga0451839_0198282 3300041496 Bacteria 2420
252 Ga0439449_0001259 3300042007 Bacteria 9917
253 Ga0439449_0011037 3300042007 Bacteria 3407
254 Ga0450909_002914 3300042185 Bacteria 2430
255 Ga0466960_0033427 3300044901 Bacteria 2390
256 Ga0495629_0012949 3300046459 Bacteria 6032
257 Ga0495638_0003269 3300046460 Bacteria 12786
258 Ga0495638_0026140 3300046460 Bacteria 3787
259 Ga0495638_0209005 3300046460 Bacteria 1097
260 Ga0495605_0002525 3300046474 Bacteria 11283
261 Ga0495662_0002948 3300046476 Bacteria 8590
262 Ga0495585_0027948 3300046492 Bacteria 3219
263 Ga0495585_0092034 3300046492 Bacteria 1632
264 Ga0495610_0172230 3300046512 Bacteria 907
265 Ga0495616_0020903 3300046513 Bacteria 3554
266 Ga0495620_0051274 3300046515 Bacteria 1757
267 Ga0495631_0002242 3300046518 Bacteria 11099
268 Ga0495632_0009845 3300046519 Bacteria 5718
269 Ga0495632_0018201 3300046519 Bacteria 3860
270 Ga0495643_0009187 3300046522 Bacteria 6169
271 Ga0495654_0005406 3300046530 Bacteria 7421
272 Ga0495587_0043343 3300046536 Bacteria 2680
273 Ga0495609_0025182 3300046538 Bacteria 2729
274 Ga0495597_0078539 3300046542 Bacteria 1414
275 Ga0495633_0017477 3300046558 Bacteria 3666
276 Ga0495668_0006323 3300046616 Bacteria 7788
277 Ga0495668_0033189 3300046616 Bacteria 2901
278 Ga0495668_0130550 3300046616 Bacteria 1375
279 Ga0495668_0206271 3300046616 Bacteria 1076
280 Ga0495611_0010753 3300046648 Bacteria 3876
281 Ga0495625_0004490 3300046660 Bacteria 13166
282 Ga0495625_0089092 3300046660 Bacteria 2136
283 Ga0495624_0162002 3300046690 Bacteria 1366
284 Ga0495660_0159607 3300046810 Bacteria 1107
285 Ga0495604_0030094 3300047317 Bacteria 4315
286 Ga0495672_0050339 3300047320 Bacteria 2460
287 Ga0495681_0004907 3300047470 Bacteria 9040
288 Ga0495686_0015554 3300047472 Bacteria 5189
289 Ga0496104_0059574 3300048907 Bacteria 3615
290 Ga0496105_0097508 3300048908 Bacteria 2428
291 Ga0496106_0004976 3300048909 Bacteria 9835
292 Ga0496110_0153941 3300048913 Bacteria 2082
293 Ga0496116_0000057 3300048919 Bacteria 281652
294 Ga0496116_0005573 3300048919 Bacteria 11611
295 Ga0496116_0025349 3300048919 Bacteria 4361
296 Ga0496116_0028421 3300048919 Bacteria 4052
297 Ga0496116_0052803 3300048919 Bacteria 2689
298 Ga0496116_0055253 3300048919 Bacteria 2609
299 Ga0496116_0073743 3300048919 Bacteria 2149
300 Ga0496117_0000031 3300048920 Bacteria 381048
301 Ga0496117_0002097 3300048920 Bacteria 26238
302 Ga0496117_0032840 3300048920 Bacteria 3935
303 Ga0496117_0053245 3300048920 Bacteria 2845
304 Ga0496118_0000899 3300048921 Bacteria 46663
305 Ga0496118_0002291 3300048921 Bacteria 26051
306 Ga0496118_0035409 3300048921 Bacteria 4053
307 Ga0496119_0000806 3300048922 Bacteria 41963
308 Ga0496119_0006994 3300048922 Bacteria 10276
309 Ga0496119_0011551 3300048922 Bacteria 7292
310 Ga0496119_0021707 3300048922 Bacteria 4628
311 Ga0496119_0068615 3300048922 Bacteria 2087
312 Ga0496119_0086936 3300048922 Bacteria 1785
313 Ga0496120_0000337 3300048923 Bacteria 78140
314 Ga0496120_0006272 3300048923 Bacteria 9173
315 Ga0496120_0011695 3300048923 Bacteria 6020
316 Ga0496120_0018267 3300048923 Bacteria 4526
317 Ga0496120_0038869 3300048923 Bacteria 2812
318 Ga0496120_0041040 3300048923 Bacteria 2715
319 Ga0496121_0000034 3300048924 Bacteria 377095
320 Ga0496121_0005857 3300048924 Bacteria 15571
321 Ga0496121_0017796 3300048924 Bacteria 7221
322 Ga0496121_0018473 3300048924 Bacteria 7028
323 Ga0496121_0026755 3300048924 Bacteria 5420
324 Ga0496121_0027371 3300048924 Bacteria 5336
325 Ga0496121_0032092 3300048924 Bacteria 4781
326 Ga0496121_0038490 3300048924 Bacteria 4233
327 Ga0496121_0378304 3300048924 Bacteria 934
328 Ga0496122_0000023 3300048925 Bacteria 381035
329 Ga0496122_0000286 3300048925 Bacteria 112940
330 Ga0496122_0004227 3300048925 Bacteria 18047
331 Ga0496122_0017308 3300048925 Bacteria 6750
332 Ga0496122_0021693 3300048925 Bacteria 5738
333 Ga0496122_0025165 3300048925 Bacteria 5180
334 Ga0496122_0029168 3300048925 Bacteria 4660
335 Ga0496122_0061075 3300048925 Bacteria 2769
336 Ga0496122_0072613 3300048925 Bacteria 2445
337 Ga0496122_0108551 3300048925 Bacteria 1830
338 Ga0496123_0000027 3300048926 Bacteria 306773
339 Ga0496123_0001238 3300048926 Bacteria 37104
340 Ga0496123_0007630 3300048926 Bacteria 10125
341 Ga0496123_0017095 3300048926 Bacteria 5854
342 Ga0496123_0028278 3300048926 Bacteria 4155
343 Ga0496123_0036008 3300048926 Bacteria 3517
344 Ga0496123_0092555 3300048926 Bacteria 1788
345 Ga0496124_0002248 3300048927 Bacteria 25664
346 Ga0496124_0005858 3300048927 Bacteria 13630
347 Ga0496124_0021541 3300048927 Bacteria 5937
348 Ga0496124_0024118 3300048927 Bacteria 5537
349 Ga0496124_0037520 3300048927 Bacteria 4214
350 Ga0496124_0086992 3300048927 Bacteria 2556
351 Ga0496124_0154210 3300048927 Bacteria 1798
352 Ga0496124_0171436 3300048927 Bacteria 1680
353 Ga0496125_0000030 3300048928 Bacteria 375023
354 Ga0496125_0008659 3300048928 Bacteria 10606
355 Ga0496125_0013275 3300048928 Bacteria 8105
356 Ga0496125_0013946 3300048928 Bacteria 7860
357 Ga0496125_0027541 3300048928 Bacteria 5150
358 Ga0496125_0042092 3300048928 Bacteria 3896
359 Ga0496125_0131962 3300048928 Bacteria 1756
360 Ga0496126_0002368 3300048929 Bacteria 25688
361 Ga0496126_0017925 3300048929 Bacteria 7043
362 Ga0496126_0083325 3300048929 Bacteria 2822
363 Ga0496126_0115270 3300048929 Bacteria 2337
364 Ga0496126_0155592 3300048929 Bacteria 1956
365 Ga0496126_0213832 3300048929 Bacteria 1622
366 Ga0495678_006181 3300049459 Bacteria 6412
367 Ga0501031_0065374 3300049568 Bacteria 2369
368 Ga0501032_0047061 3300049569 Bacteria 2914
369 Ga0501032_0182790 3300049569 Bacteria 1372
370 Ga0501032_0192395 3300049569 Bacteria 1333
371 Ga0501033_0003048 3300049570 Bacteria 13930
372 Ga0501033_0061358 3300049570 Bacteria 2771
373 Ga0501033_0146730 3300049570 Bacteria 1703
374 Ga0501034_0000675 3300049571 Bacteria 51860
375 Ga0501034_0014386 3300049571 Bacteria 8150
376 Ga0501037_0157352 3300049573 Bacteria 1621
377 Ga0501038_0132051 3300049574 Bacteria 2049
378 Ga0501038_0240267 3300049574 Bacteria 1438
379 Ga0501039_0144383 3300049575 Bacteria 1870
380 Ga0501043_0025472 3300049579 Bacteria 4641
381 Ga0501043_0070321 3300049579 Bacteria 2749
382 Ga0501043_0352215 3300049579 Bacteria 1118
383 Ga0501047_0015909 3300049581 Bacteria 7170
384 Ga0501047_0079562 3300049581 Bacteria 3151
385 Ga0501047_0281150 3300049581 Bacteria 1509
386 Ga0501047_0533322 3300049581 Bacteria 999
387 Ga0501067_0116844 3300049583 Bacteria 1484
388 Ga0501069_0089510 3300049585 Bacteria 1740
389 Ga0501070_0016288 3300049586 Bacteria 6246
390 Ga0501070_0115859 3300049586 Bacteria 2213
391 Ga0501070_0351943 3300049586 Bacteria 1195
392 Ga0501073_0155164 3300049589 Bacteria 1587
393 Ga0501074_0110304 3300049590 Bacteria 1968
394 Ga0501079_0341914 3300049741 Bacteria 1172
395 Ga0501080_0004712 3300049742 Bacteria 12174
396 Ga0501080_0120205 3300049742 Bacteria 2435
397 Ga0501083_0020575 3300049744 Bacteria 4589
398 Ga0501083_0121136 3300049744 Bacteria 1716
399 Ga0501035_0006106 3300049822 Bacteria 11338
400 Ga0501035_0025028 3300049822 Bacteria 5473
401 Ga0501035_0026392 3300049822 Bacteria 5314
402 Ga0501035_0042655 3300049822 Bacteria 4091
403 Ga0501035_0189913 3300049822 Bacteria 1766
404 Ga0501044_0039749 3300049823 Bacteria 4905
405 Ga0501044_0095281 3300049823 Bacteria 3000
406 nmdc:mga03683_23864_c1 3300050489 Bacteria 2387
407 nmdc:mga00v17_1285_c1 3300050491 Bacteria 13183
408 nmdc:mga00v17_151_c1 3300050491 Bacteria 40348
409 nmdc:mga00v17_248604_c1 3300050491 Bacteria 1153
410 nmdc:mga00v17_25914_c1 3300050491 Bacteria 3411
411 nmdc:mga0yw44_75984_c1 3300050492 Bacteria 2096
412 nmdc:mga0k408_282485_c1 3300050493 Bacteria 991
413 nmdc:mga06z11_46516_c1 3300050494 Bacteria 2199
414 nmdc:mga06z11_6588_c1 3300050494 Bacteria 4741
415 nmdc:mga07m45_136748_c1 3300050496 Bacteria 1418
416 nmdc:mga07m45_88205_c1 3300050496 Bacteria 1775
417 nmdc:mga0sz30_107341_c1 3300050516 Bacteria 1222
418 nmdc:mga0sz30_107_c1 3300050516 Bacteria 31264
419 nmdc:mga0sz30_773_c1 3300050516 Bacteria 1133
420 Ga0500610_0012502 3300053079 Bacteria 3914
421 Ga0500644_0036300 3300053088 Bacteria 1603
422 Ga0500556_0000963 3300053104 Bacteria 15438
423 Ga0500594_0007425 3300053118 Bacteria 2479
424 Ga0500618_001412 3300053125 Bacteria 10762
425 Ga0500618_058667 3300053125 Bacteria 866
426 Ga0500652_019094 3300053131 Bacteria 2541
427 Ga0500559_0003675 3300053136 Bacteria 7485
428 Ga0500559_0117563 3300053136 Bacteria 1235
429 Ga0500561_0001013 3300053137 Bacteria 4502
430 Ga0500568_0000048 3300053139 Bacteria 119025
431 Ga0500568_0051067 3300053139 Bacteria 1628
432 Ga0500568_0070787 3300053139 Bacteria 1336
433 Ga0500573_0000334 3300053140 Bacteria 19960
434 Ga0500590_016346 3300053148 Bacteria 3837
435 Ga0500616_0005597 3300053153 Bacteria 8483
436 Ga0500616_0077588 3300053153 Bacteria 1677
437 Ga0500620_000163 3300053155 Bacteria 13341
438 Ga0500622_0003318 3300053156 Bacteria 10874
439 Ga0500622_0003847 3300053156 Bacteria 9763
440 Ga0500624_004755 3300053157 Bacteria 1795
441 Ga0500633_0012605 3300053160 Bacteria 2341
442 Ga0500636_0000040 3300053177 Bacteria 69881
443 Ga0500636_0074565 3300053177 Bacteria 1963
444 Ga0500645_053876 3300053730 Bacteria 1170
445 Ga0587077_048477 3300059493 Bacteria 880
446 Ga0587086_023105 3300059507 Bacteria 865
447 Ga0501082_0087550 3300060353 Bacteria 2687

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053125 Ga0500618_058667 Ga0500618_058667_41_808 215
2 3300049581 Ga0501047_0533322 Ga0501047_0533322_88_915 227
3 3300049822 Ga0501035_0189913 Ga0501035_0189913_204_1031 227
4 3300009765 Ga0123341_1000009 Ga0123341_100000984 232
5 3300009766 Ga0123342_1037770 Ga0123342_10377703 232
6 3300041494 Ga0451837_0421092 Ga0451837_0421092_547_1344 235
7 3300046492 Ga0495585_0092034 Ga0495585_0092034_313_1110 235
8 3300046660 Ga0495625_0089092 Ga0495625_0089092_692_1489 235
9 3300050489 nmdc:mga03683_23864_c1 nmdc:mga03683_23864_c1_1136_1909 235
10 3300050496 nmdc:mga07m45_136748_c1 nmdc:mga07m45_136748_c1_13_810 235
11 3300003187 JGI25151J46595_10011616 JGI25151J46595_100116165 239
12 3300013104 Ga0157370_10330905 Ga0157370_103309052 240
13 3300021377 Ga0213874_10104565 Ga0213874_101045652 240
14 3300025294 Ga0209025_1000042 Ga0209025_1000042236 240
15 3300039450 Ga0436363_0703352 Ga0436363_0703352_26_784 240
16 3300041496 Ga0451839_0198282 Ga0451839_0198282_275_1072 240
17 3300046616 Ga0495668_0206271 Ga0495668_0206271_120_872 240
18 3300048920 Ga0496117_0032840 Ga0496117_0032840_1116_1877 240
19 3300048922 Ga0496119_0000806 Ga0496119_0000806_11395_12129 240
20 3300048925 Ga0496122_0000286 Ga0496122_0000286_1604_2365 240
21 3300048925 Ga0496122_0004227 Ga0496122_0004227_8577_9311 240
22 3300048926 Ga0496123_0001238 Ga0496123_0001238_1999_2733 240
23 3300048926 Ga0496123_0007630 Ga0496123_0007630_1439_2200 240
24 3300053104 Ga0500556_0000963 Ga0500556_0000963_3517_4251 240
25 3300053131 Ga0500652_019094 Ga0500652_019094_67_801 240
26 3300053730 Ga0500645_053876 Ga0500645_053876_230_964 240
27 3300013102 Ga0157371_10009815 Ga0157371_100098155 241
28 3300013105 Ga0157369_10032455 Ga0157369_100324555 241
29 3300048919 Ga0496116_0000057 Ga0496116_0000057_233645_234406 241
30 3300048922 Ga0496119_0068615 Ga0496119_0068615_957_1718 241
31 3300048929 Ga0496126_0002368 Ga0496126_0002368_24042_24803 241
32 3300005262 Ga0065165_1009930 Ga0065165_10099306 242
33 3300005985 Ga0081539_10002530 Ga0081539_100025304 242
34 3300013297 Ga0157378_10914981 Ga0157378_109149811 242
35 3300049568 Ga0501031_0065374 Ga0501031_0065374_1303_2073 242
36 3300049570 Ga0501033_0146730 Ga0501033_0146730_231_1001 242
37 3300049571 Ga0501034_0000675 Ga0501034_0000675_46795_47559 242
38 3300049579 Ga0501043_0025472 Ga0501043_0025472_3013_3783 242
39 3300049822 Ga0501035_0026392 Ga0501035_0026392_4194_4964 242
40 3300059507 Ga0587086_023105 Ga0587086_023105_45_776 242
41 3300020078 Ga0206352_10368268 Ga0206352_103682681 243
42 3300020082 Ga0206353_10130919 Ga0206353_101309192 243
43 3300053153 Ga0500616_0077588 Ga0500616_0077588_424_1158 243
44 iso_pu_bacteria 2885312484 2885316617 243
45 3300005331 Ga0070670_100000116 Ga0070670_10000011621 244
46 3300025925 Ga0207650_10000691 Ga0207650_1000069116 244
47 3300046459 Ga0495629_0012949 Ga0495629_0012949_4296_5057 244
48 3300046476 Ga0495662_0002948 Ga0495662_0002948_2464_3225 244
49 3300046536 Ga0495587_0043343 Ga0495587_0043343_363_1124 244
50 3300046690 Ga0495624_0162002 Ga0495624_0162002_36_797 244
51 3300047317 Ga0495604_0030094 Ga0495604_0030094_1305_2066 244
52 3300053148 Ga0500590_016346 Ga0500590_016346_669_1430 244
53 iso_pu_bacteria 2920760137 2920760328 244
54 iso_pu_bacteria 2513237305 2514422486 245
55 iso_pu_bacteria 2721755686 2723576711 245
56 iso_pu_bacteria 2856356410 2856358028 245
57 iso_pu_bacteria 2871488783 2871488831 245
58 iso_pu_bacteria 2878753008 2878753594 245
59 iso_pu_bacteria 2881845957 2881846129 245
60 iso_pu_bacteria 2881861095 2881861761 245
61 iso_pu_bacteria 2882632389 2882633507 245
62 iso_pu_bacteria 2882912400 2882919678 245
63 iso_pu_bacteria 2885318864 2885321768 245
64 iso_pu_bacteria 2891373044 2891377927 245
65 iso_pu_bacteria 2903492973 2903495490 245
66 iso_pu_bacteria 2924762789 2924766459 245
67 iso_pu_bacteria 2924784321 2924792006 245
68 iso_pu_bacteria 2961170736 2961170784 245
69 iso_pu_bacteria 2967996073 2968003363 245
70 iso_pu_bacteria 2968003550 2968004130 245
71 iso_pu_bacteria 2970503327 2970503374 245
72 iso_pu_bacteria 2977821940 2977822811 245
73 iso_pu_bacteria 2977828996 2977831336 245
74 iso_pu_bacteria 2979808191 2979815603 245
75 iso_pu_bacteria 2987666974 2987670862 245
76 iso_pu_bacteria 2989349275 2989354958 245
77 iso_pu_bacteria 3003930520 3003931023 245
78 iso_pu_bacteria 8004374579 8004375167 245
79 3300044901 Ga0466960_0033427 Ga0466960_0033427_503_1348 246
80 3300049569 Ga0501032_0192395 Ga0501032_0192395_109_867 246
81 3300049570 Ga0501033_0061358 Ga0501033_0061358_1115_1873 246
82 3300049579 Ga0501043_0352215 Ga0501043_0352215_227_985 246
83 3300049581 Ga0501047_0015909 Ga0501047_0015909_3379_4137 246
84 3300049586 Ga0501070_0115859 Ga0501070_0115859_570_1328 246
85 3300049742 Ga0501080_0120205 Ga0501080_0120205_752_1510 246
86 3300049822 Ga0501035_0025028 Ga0501035_0025028_1576_2334 246
87 iso_pu_bacteria 2599185156 2599335116 246
88 iso_pu_bacteria 2643221550 2643773504 246
89 iso_pu_bacteria 2842922631 2842926306 246
90 iso_pu_bacteria 2891048133 2891049920 246
91 iso_pu_bacteria 2894817345 2894821524 246
92 iso_pu_bacteria 8045864390 8045867222 246
93 iso_pu_bacteria 2513237090 2513611791 247
94 iso_pu_bacteria 2599185301 2599937395 247
95 iso_pu_bacteria 2643221564 2643837295 247
96 iso_pu_bacteria 2738541317 2738947071 247
97 iso_pu_bacteria 2847670302 2847671144 247
98 iso_pu_bacteria 2847686936 2847687282 247
99 iso_pu_bacteria 2856314179 2856316659 247
100 iso_pu_bacteria 2857349434 2857355301 247
101 iso_pu_bacteria 2871444079 2871448579 247
102 iso_pu_bacteria 2871495908 2871496001 247
103 iso_pu_bacteria 2874139085 2874140959 247
104 iso_pu_bacteria 2876369609 2876373210 247
105 iso_pu_bacteria 2876377896 2876385321 247
106 iso_pu_bacteria 2876392853 2876395494 247
107 iso_pu_bacteria 2878035449 2878037060 247
108 iso_pu_bacteria 2878760144 2878760234 247
109 iso_pu_bacteria 2878767105 2878767194 247
110 iso_pu_bacteria 2881161766 2881162088 247
111 iso_pu_bacteria 2888337043 2888341088 247
112 iso_pu_bacteria 2888350351 2888357264 247
113 iso_pu_bacteria 2903540706 2903540796 247
114 iso_pu_bacteria 2904659560 2904662125 247
115 iso_pu_bacteria 2906328253 2906332707 247
116 iso_pu_bacteria 2906354277 2906356935 247
117 iso_pu_bacteria 2906414383 2906416796 247
118 iso_pu_bacteria 2913308742 2913312100 247
119 iso_pu_bacteria 2922130491 2922135542 247
120 iso_pu_bacteria 2922158528 2922163641 247
121 iso_pu_bacteria 2922185730 2922186919 247
122 iso_pu_bacteria 2924718760 2924719661 247
123 iso_pu_bacteria 2924726620 2924733001 247
124 iso_pu_bacteria 2937891427 2937894453 247
125 iso_pu_bacteria 2937972304 2937973815 247
126 iso_pu_bacteria 2937994558 2937994651 247
127 iso_pu_bacteria 2938014810 2938020195 247
128 iso_pu_bacteria 2958115193 2958117736 247
129 iso_pu_bacteria 2958144490 2958146364 247
130 iso_pu_bacteria 2958165035 2958165129 247
131 iso_pu_bacteria 2961114664 2961117279 247
132 iso_pu_bacteria 2961163497 2961163589 247
133 iso_pu_bacteria 2965018300 2965018392 247
134 iso_pu_bacteria 2965062239 2965065439 247
135 iso_pu_bacteria 2968091066 2968096750 247
136 iso_pu_bacteria 2968097103 2968102646 247
137 iso_pu_bacteria 2968110612 2968113187 247
138 iso_pu_bacteria 2968117919 2968123649 247
139 iso_pu_bacteria 2968128360 2968132916 247
140 iso_pu_bacteria 2968171901 2968171992 247
141 iso_pu_bacteria 2970554993 2970555085 247
142 iso_pu_bacteria 2977858184 2977860785 247
143 iso_pu_bacteria 2977864932 2977866381 247
144 iso_pu_bacteria 2977942078 2977948847 247
145 iso_pu_bacteria 2977971508 2977974990 247
146 iso_pu_bacteria 2979742915 2979751381 247
147 iso_pu_bacteria 2979779861 2979780348 247
148 iso_pu_bacteria 2987636660 2987640434 247
149 iso_pu_bacteria 2987652177 2987656740 247
150 iso_pu_bacteria 2987659509 2987659597 247
151 iso_pu_bacteria 2996341866 2996348200 247
152 iso_pu_bacteria 3000135777 3000139002 247
153 iso_pu_bacteria 3004188549 3004188640 247
154 iso_pu_bacteria 3004203850 3004208632 247
155 iso_pu_bacteria 3004289098 3004294953 247
156 iso_pu_bacteria 8004445564 8004451920 247
157 iso_pu_bacteria 8004640170 8004642858 247
158 iso_pu_bacteria 8004703790 8004711619 247
159 3300046530 Ga0495654_0005406 Ga0495654_0005406_2530_3288 248
160 iso_pu_bacteria 2503198000 2503203052 248
161 iso_pu_bacteria 2508501122 2509109582 248
162 iso_pu_bacteria 2508501123 2509114774 248
163 iso_pu_bacteria 2508501127 2509143408 248
164 iso_pu_bacteria 2509276018 2509374008 248
165 iso_pu_bacteria 2509276019 2509378094 248
166 iso_pu_bacteria 2509276021 2509389426 248
167 iso_pu_bacteria 2509276022 2509397517 248
168 iso_pu_bacteria 2509276033 2509446177 248
169 iso_pu_bacteria 2510065019 2510135231 248
170 iso_pu_bacteria 2510065057 2510305475 248
171 iso_pu_bacteria 2510461069 2510843328 248
172 iso_pu_bacteria 2510461076 2510896686 248
173 iso_pu_bacteria 2510917022 2511133859 248
174 iso_pu_bacteria 2510917026 2511169788 248
175 iso_pu_bacteria 2510917028 2511183983 248
176 iso_pu_bacteria 2510917030 2511194587 248
177 iso_pu_bacteria 2511231027 2511391835 248
178 iso_pu_bacteria 2511231052 2511498487 248
179 iso_pu_bacteria 2512047086 2512534628 248
180 iso_pu_bacteria 2512875026 2512973564 248
181 iso_pu_bacteria 2513237084 2513571615 248
182 iso_pu_bacteria 2513237086 2513583649 248
183 iso_pu_bacteria 2513237088 2513596814 248
184 iso_pu_bacteria 2513237089 2513601917 248
185 iso_pu_bacteria 2513237091 2513615722 248
186 iso_pu_bacteria 2513237093 2513630166 248
187 iso_pu_bacteria 2513237103 2513711335 248
188 iso_pu_bacteria 2513237138 2513867465 248
189 iso_pu_bacteria 2513237140 2513884983 248
190 iso_pu_bacteria 2513237143 2513905193 248
191 iso_pu_bacteria 2513237144 2513912364 248
192 iso_pu_bacteria 2513237146 2513928451 248
193 iso_pu_bacteria 2513237156 2513988042 248
194 iso_pu_bacteria 2513237159 2513998473 248
195 iso_pu_bacteria 2513237160 2514003483 248
196 iso_pu_bacteria 2513237162 2514019386 248
197 iso_pu_bacteria 2513237351 2514588815 248
198 iso_pu_bacteria 2515075009 2515114389 248
199 iso_pu_bacteria 2515154113 2515635392 248
200 iso_pu_bacteria 2515154114 2515643200 248
201 iso_pu_bacteria 2515154116 2515657664 248
202 iso_pu_bacteria 2515154134 2515741573 248
203 iso_pu_bacteria 2516143018 2516205570 248
204 iso_pu_bacteria 2516653046 2516894767 248
205 iso_pu_bacteria 2516653077 2517038039 248
206 iso_pu_bacteria 2516653085 2517078303 248
207 iso_pu_bacteria 2517093000 2517097062 248
208 iso_pu_bacteria 2517287029 2517408554 248
209 iso_pu_bacteria 2517487022 2517571432 248
210 iso_pu_bacteria 2524023207 2524450422 248
211 iso_pu_bacteria 2524023209 2524458452 248
212 iso_pu_bacteria 2529292951 2530647366 248
213 iso_pu_bacteria 2534681786 2535485714 248
214 iso_pu_bacteria 2534681796 2535519006 248
215 iso_pu_bacteria 2537561587 2537873834 248
216 iso_pu_bacteria 2551306084 2551676621 248
217 iso_pu_bacteria 2551306084 2551680245 248
218 iso_pu_bacteria 2551306085 2551685075 248
219 iso_pu_bacteria 2551306086 2551694474 248
220 iso_pu_bacteria 2551306087 2551697733 248
221 iso_pu_bacteria 2551306091 2551731606 248
222 iso_pu_bacteria 2551306092 2551736190 248
223 iso_pu_bacteria 2551306093 2551746083 248
224 iso_pu_bacteria 2554235003 2554248852 248
225 iso_pu_bacteria 2558860100 2558867405 248
226 iso_pu_bacteria 2558860242 2559295940 248
227 iso_pu_bacteria 2558860983 2561467102 248
228 iso_pu_bacteria 2582581283 2585166705 248
229 iso_pu_bacteria 2582581294 2585201753 248
230 iso_pu_bacteria 2582581299 2585228756 248
231 iso_pu_bacteria 2582581304 2585257363 248
232 iso_pu_bacteria 2582581306 2585266955 248
233 iso_pu_bacteria 2582581307 2585271648 248
234 iso_pu_bacteria 2582581308 2585280709 248
235 iso_pu_bacteria 2582581315 2585326494 248
236 iso_pu_bacteria 2582581316 2585334164 248
237 iso_pu_bacteria 2582581865 2585387996 248
238 iso_pu_bacteria 2582581866 2585396645 248
239 iso_pu_bacteria 2582581867 2585399733 248
240 iso_pu_bacteria 2585427526 2585526060 248
241 iso_pu_bacteria 2585427527 2585531643 248
242 iso_pu_bacteria 2585427530 2585551410 248
243 iso_pu_bacteria 2585427531 2585563112 248
244 iso_pu_bacteria 2585427590 2585820820 248
245 iso_pu_bacteria 2585427594 2585844876 248
246 iso_pu_bacteria 2585427608 2585902837 248
247 iso_pu_bacteria 2585427609 2585907330 248
248 iso_pu_bacteria 2585427633 2585997764 248
249 iso_pu_bacteria 2585427634 2586002349 248
250 iso_pu_bacteria 2585428125 2587982676 248
251 iso_pu_bacteria 2597489875 2597814781 248
252 iso_pu_bacteria 2599185170 2599420163 248
253 iso_pu_bacteria 2599185210 2599603269 248
254 iso_pu_bacteria 2599185236 2599720319 248
255 iso_pu_bacteria 2599185352 2600193358 248
256 iso_pu_bacteria 2600254933 2600373251 248
257 iso_pu_bacteria 2600255279 2601610827 248
258 iso_pu_bacteria 2600255308 2601747601 248
259 iso_pu_bacteria 2615840624 2616296330 248
260 iso_pu_bacteria 2615840626 2616306746 248
261 iso_pu_bacteria 2615840698 2616557592 248
262 iso_pu_bacteria 2643221557 2643808056 248
263 iso_pu_bacteria 2643221558 2643813752 248
264 iso_pu_bacteria 2643221568 2643855065 248
265 iso_pu_bacteria 2643221582 2643921465 248
266 iso_pu_bacteria 2643221599 2644002455 248
267 iso_pu_bacteria 2643221607 2644052239 248
268 iso_pu_bacteria 2643221610 2644068755 248
269 iso_pu_bacteria 2643221618 2644110161 248
270 iso_pu_bacteria 2643221623 2644133059 248
271 iso_pu_bacteria 2643221626 2644150437 248
272 iso_pu_bacteria 2643221634 2644194839 248
273 iso_pu_bacteria 2643221636 2644201378 248
274 iso_pu_bacteria 2643221637 2644209487 248
275 iso_pu_bacteria 2643221643 2644240519 248
276 iso_pu_bacteria 2643221653 2644299819 248
277 iso_pu_bacteria 2643221655 2644313041 248
278 iso_pu_bacteria 2643221659 2644336589 248
279 iso_pu_bacteria 2643221668 2644379490 248
280 iso_pu_bacteria 2643221675 2644419825 248
281 iso_pu_bacteria 2643221680 2644453182 248
282 iso_pu_bacteria 2643221686 2644484517 248
283 iso_pu_bacteria 2643221688 2644493095 248
284 iso_pu_bacteria 2643221689 2644499303 248
285 iso_pu_bacteria 2643221693 2644521518 248
286 iso_pu_bacteria 2643221698 2644546236 248
287 iso_pu_bacteria 2643221712 2644618771 248
288 iso_pu_bacteria 2643221718 2644653015 248
289 iso_pu_bacteria 2643221719 2644658046 248
290 iso_pu_bacteria 2643221723 2644677084 248
291 iso_pu_bacteria 2643221726 2644688790 248
292 iso_pu_bacteria 2657244999 2657682403 248
293 iso_pu_bacteria 2667528174 2671113488 248
294 iso_pu_bacteria 2690316117 2692319949 248
295 iso_pu_bacteria 2693429783 2694633981 248
296 iso_pu_bacteria 2718217882 2719182948 248
297 iso_pu_bacteria 2718217927 2719387661 248
298 iso_pu_bacteria 2718217997 2719667293 248
299 iso_pu_bacteria 2718218009 2719733665 248
300 iso_pu_bacteria 2718218199 2720493713 248
301 iso_pu_bacteria 2718218232 2720615166 248
302 iso_pu_bacteria 2718218233 2720621961 248
303 iso_pu_bacteria 2718218235 2720633311 248
304 iso_pu_bacteria 2718218269 2720777009 248
305 iso_pu_bacteria 2718218363 2721149060 248
306 iso_pu_bacteria 2718218365 2721160458 248
307 iso_pu_bacteria 2718218366 2721165873 248
308 iso_pu_bacteria 2718218423 2721401295 248
309 iso_pu_bacteria 2721755514 2722842043 248
310 iso_pu_bacteria 2721755556 2723028607 248
311 iso_pu_bacteria 2721755684 2723562211 248
312 iso_pu_bacteria 2721755685 2723568914 248
313 iso_pu_bacteria 2721755809 2724040109 248
314 iso_pu_bacteria 2721755810 2724046421 248
315 iso_pu_bacteria 2721755819 2724091616 248
316 iso_pu_bacteria 2721755822 2724106179 248
317 iso_pu_bacteria 2721755823 2724111985 248
318 iso_pu_bacteria 2724679232 2725947522 248
319 iso_pu_bacteria 2728369352 2730109543 248
320 iso_pu_bacteria 2728369365 2730166183 248
321 iso_pu_bacteria 2728369397 2730300090 248
322 iso_pu_bacteria 2738541293 2738805588 248
323 iso_pu_bacteria 2738543024 2739306315 248
324 iso_pu_bacteria 2751185800 2753358439 248
325 iso_pu_bacteria 2751185821 2753462453 248
326 iso_pu_bacteria 2757320392 2757570171 248
327 iso_pu_bacteria 2758568016 2758640670 248
328 iso_pu_bacteria 2765235802 2765465723 248
329 iso_pu_bacteria 2765235942 2766064283 248
330 iso_pu_bacteria 2775506902 2776269570 248
331 iso_pu_bacteria 2775506904 2776282501 248
332 iso_pu_bacteria 2775507049 2776915612 248
333 iso_pu_bacteria 2791355082 2792582247 248
334 iso_pu_bacteria 2791355094 2792639982 248
335 iso_pu_bacteria 2791355259 2793313394 248
336 iso_pu_bacteria 2791355260 2793320696 248
337 iso_pu_bacteria 2791355261 2793327268 248
338 iso_pu_bacteria 2791355263 2793338797 248
339 iso_pu_bacteria 2791355264 2793346585 248
340 iso_pu_bacteria 2791355265 2793353876 248
341 iso_pu_bacteria 2791355267 2793365889 248
342 iso_pu_bacteria 2802428858 2802717201 248
343 iso_pu_bacteria 2802428859 2802724810 248
344 iso_pu_bacteria 2802428860 2802729561 248
345 iso_pu_bacteria 2802428861 2802736907 248
346 iso_pu_bacteria 2802428862 2802743312 248
347 iso_pu_bacteria 2802428863 2802749562 248
348 iso_pu_bacteria 2802429268 2804753704 248
349 iso_pu_bacteria 2802429605 2805926200 248
350 iso_pu_bacteria 2802429606 2805933926 248
351 iso_pu_bacteria 2808606387 2808988236 248
352 iso_pu_bacteria 2818991272 2819244605 248
353 iso_pu_bacteria 2818991439 2819560950 248
354 iso_pu_bacteria 2818991448 2819611231 248
355 iso_pu_bacteria 2818991453 2819638840 248
356 iso_pu_bacteria 2818991461 2819687023 248
357 iso_pu_bacteria 2821123053 2821128712 248
358 iso_pu_bacteria 2838016132 2838018347 248
359 iso_pu_bacteria 2838022645 2838024030 248
360 iso_pu_bacteria 2838029111 2838030920 248
361 iso_pu_bacteria 2838035591 2838040369 248
362 iso_pu_bacteria 2838042994 2838047824 248
363 iso_pu_bacteria 2838048938 2838050791 248
364 iso_pu_bacteria 2838061910 2838062557 248
365 iso_pu_bacteria 2838068647 2838072108 248
366 iso_pu_bacteria 2838074704 2838078172 248
367 iso_pu_bacteria 2838661181 2838667783 248
368 iso_pu_bacteria 2838668709 2838672149 248
369 iso_pu_bacteria 2838675328 2838678687 248
370 iso_pu_bacteria 2838680041 2838683894 248
371 iso_pu_bacteria 2838686498 2838690266 248
372 iso_pu_bacteria 2838694306 2838698422 248
373 iso_pu_bacteria 2838701080 2838704981 248
374 iso_pu_bacteria 2838707686 2838711537 248
375 iso_pu_bacteria 2838714209 2838718225 248
376 iso_pu_bacteria 2838719591 2838722983 248
377 iso_pu_bacteria 2838724970 2838728291 248
378 iso_pu_bacteria 2838729681 2838732041 248
379 iso_pu_bacteria 2838736955 2838741728 248
380 iso_pu_bacteria 2838742623 2838744937 248
381 iso_pu_bacteria 2839993093 2839993367 248
382 iso_pu_bacteria 2841734538 2841740866 248
383 iso_pu_bacteria 2841840854 2841845438 248
384 iso_pu_bacteria 2841846520 2841850539 248
385 iso_pu_bacteria 2841851746 2841855995 248
386 iso_pu_bacteria 2841859092 2841863208 248
387 iso_pu_bacteria 2841864319 2841867775 248
388 iso_pu_bacteria 2842077413 2842081338 248
389 iso_pu_bacteria 2842110456 2842116870 248
390 iso_pu_bacteria 2842118031 2842121885 248
391 iso_pu_bacteria 2842124991 2842128951 248
392 iso_pu_bacteria 2842130223 2842133579 248
393 iso_pu_bacteria 2842140634 2842145141 248
394 iso_pu_bacteria 2842146304 2842148783 248
395 iso_pu_bacteria 2842152218 2842155509 248
396 iso_pu_bacteria 2842156927 2842161165 248
397 iso_pu_bacteria 2842163707 2842166677 248
398 iso_pu_bacteria 2842170452 2842174533 248
399 iso_pu_bacteria 2842175837 2842179193 248
400 iso_pu_bacteria 2842180545 2842184781 248
401 iso_pu_bacteria 2842187318 2842190649 248
402 iso_pu_bacteria 2842192696 2842194897 248
403 iso_pu_bacteria 2842198810 2842201623 248
404 iso_pu_bacteria 2842211629 2842215027 248
405 iso_pu_bacteria 2842217011 2842221764 248
406 iso_pu_bacteria 2842224351 2842227748 248
407 iso_pu_bacteria 2842229732 2842232363 248
408 iso_pu_bacteria 2842237096 2842240899 248
409 iso_pu_bacteria 2842243621 2842246779 248
410 iso_pu_bacteria 2842250916 2842254662 248
411 iso_pu_bacteria 2842257432 2842261120 248
412 iso_pu_bacteria 2842264693 2842269623 248
413 iso_pu_bacteria 2842271015 2842274286 248
414 iso_pu_bacteria 2842285085 2842288503 248
415 iso_pu_bacteria 2842291075 2842294995 248
416 iso_pu_bacteria 2842298080 2842300291 248
417 iso_pu_bacteria 2842304105 2842305871 248
418 iso_pu_bacteria 2842311132 2842311395 248
419 iso_pu_bacteria 2842317721 2842321096 248
420 iso_pu_bacteria 2842341865 2842346599 248
421 iso_pu_bacteria 2842357229 2842361191 248
422 iso_pu_bacteria 2842363717 2842366288 248
423 iso_pu_bacteria 2842370503 2842374987 248
424 iso_pu_bacteria 2842377471 2842381394 248
425 iso_pu_bacteria 2842384541 2842388464 248
426 iso_pu_bacteria 2842395702 2842395960 248
427 iso_pu_bacteria 2842402390 2842406151 248
428 iso_pu_bacteria 2842409023 2842412736 248
429 iso_pu_bacteria 2842415677 2842419385 248
430 iso_pu_bacteria 2842422224 2842425740 248
431 iso_pu_bacteria 2842428310 2842433615 248
432 iso_pu_bacteria 2842434925 2842439943 248
433 iso_pu_bacteria 2842441272 2842446572 248
434 iso_pu_bacteria 2842447887 2842448796 248
435 iso_pu_bacteria 2842462802 2842467919 248
436 iso_pu_bacteria 2842469257 2842474552 248
437 iso_pu_bacteria 2842475841 2842477652 248
438 iso_pu_bacteria 2842482326 2842484957 248
439 iso_pu_bacteria 2842489311 2842491149 248
440 iso_pu_bacteria 2842495871 2842498486 248
441 iso_pu_bacteria 2842502639 2842504475 248
442 iso_pu_bacteria 2842509118 2842511723 248
443 iso_pu_bacteria 2842515876 2842520054 248
444 iso_pu_bacteria 2842521101 2842524499 248
445 iso_pu_bacteria 2842871566 2842873988 248
446 iso_pu_bacteria 2844163670 2844166249 248
447 iso_pu_bacteria 2844454524 2844457035 248
448 iso_pu_bacteria 2847417321 2847420827 248
449 iso_pu_bacteria 2850079185 2850082644 248
450 iso_pu_bacteria 2852387548 2852391682 248
451 iso_pu_bacteria 2854896431 2854901738 248
452 iso_pu_bacteria 2854911287 2854913967 248
453 iso_pu_bacteria 2854916844 2854919467 248
454 iso_pu_bacteria 2855825444 2855827395 248
455 iso_pu_bacteria 2855839649 2855842773 248
456 iso_pu_bacteria 2855872281 2855878190 248
457 iso_pu_bacteria 2856320880 2856324629 248
458 iso_pu_bacteria 2856334872 2856339138 248
459 iso_pu_bacteria 2856342000 2856342233 248
460 iso_pu_bacteria 2856349417 2856352500 248
461 iso_pu_bacteria 2857367948 2857372677 248
462 iso_pu_bacteria 2857516855 2857519558 248
463 iso_pu_bacteria 2857531043 2857534135 248
464 iso_pu_bacteria 2858800743 2858802111 248
465 iso_pu_bacteria 2869162929 2869167785 248
466 iso_pu_bacteria 2869249662 2869251264 248
467 iso_pu_bacteria 2869264136 2869266702 248
468 iso_pu_bacteria 2869271264 2869272081 248
469 iso_pu_bacteria 2869278585 2869281375 248
470 iso_pu_bacteria 2869285874 2869292114 248
471 iso_pu_bacteria 2871429161 2871435321 248
472 iso_pu_bacteria 2871459585 2871462384 248
473 iso_pu_bacteria 2871474448 2871478011 248
474 iso_pu_bacteria 2874131515 2874132521 248
475 iso_pu_bacteria 2874146452 2874155022 248
476 iso_pu_bacteria 2874155637 2874161341 248
477 iso_pu_bacteria 2874162495 2874164647 248
478 iso_pu_bacteria 2876399893 2876402365 248
479 iso_pu_bacteria 2876406927 2876413958 248
480 iso_pu_bacteria 2876413966 2876420478 248
481 iso_pu_bacteria 2878738818 2878742738 248
482 iso_pu_bacteria 2878745973 2878752456 248
483 iso_pu_bacteria 2878774303 2878776931 248
484 iso_pu_bacteria 2878781027 2878788671 248
485 iso_pu_bacteria 2878788777 2878792836 248
486 iso_pu_bacteria 2881147464 2881152313 248
487 iso_pu_bacteria 2881155292 2881156670 248
488 iso_pu_bacteria 2881853255 2881855884 248
489 iso_pu_bacteria 2885305155 2885310927 248
490 iso_pu_bacteria 2888343758 2888348274 248
491 iso_pu_bacteria 2889010040 2889012215 248
492 iso_pu_bacteria 2889790730 2889793088 248
493 iso_pu_bacteria 2889914905 2889917341 248
494 iso_pu_bacteria 2896384573 2896390201 248
495 iso_pu_bacteria 2899792073 2899795308 248
496 iso_pu_bacteria 2899803654 2899808055 248
497 iso_pu_bacteria 2899845264 2899849288 248
498 iso_pu_bacteria 2903492973 2903505371 248
499 iso_pu_bacteria 2904578770 2904579984 248
500 iso_pu_bacteria 2906308376 2906314850 248
501 iso_pu_bacteria 2906321335 2906328022 248
502 iso_pu_bacteria 2906363423 2906364586 248
503 iso_pu_bacteria 2906370794 2906371966 248
504 iso_pu_bacteria 2906386501 2906393347 248
505 iso_pu_bacteria 2906393657 2906396303 248
506 iso_pu_bacteria 2906408224 2906412045 248
507 iso_pu_bacteria 2913295892 2913300189 248
508 iso_pu_bacteria 2915650412 2915650822 248
509 iso_pu_bacteria 2915980308 2915982414 248
510 iso_pu_bacteria 2915986958 2915992777 248
511 iso_pu_bacteria 2915993759 2915999334 248
512 iso_pu_bacteria 2916000859 2916002824 248
513 iso_pu_bacteria 2916007675 2916010601 248
514 iso_pu_bacteria 2916014648 2916018153 248
515 iso_pu_bacteria 2916021584 2916023829 248
516 iso_pu_bacteria 2916028427 2916034389 248
517 iso_pu_bacteria 2916035215 2916040396 248
518 iso_pu_bacteria 2916041962 2916045068 248
519 iso_pu_bacteria 2916048683 2916050746 248
520 iso_pu_bacteria 2916055098 2916056759 248
521 iso_pu_bacteria 2916061851 2916065000 248
522 iso_pu_bacteria 2916068649 2916073579 248
523 iso_pu_bacteria 2916076590 2916077743 248
524 iso_pu_bacteria 2919114240 2919118517 248
525 iso_pu_bacteria 2919119836 2919120344 248
526 iso_pu_bacteria 2919166419 2919170601 248
527 iso_pu_bacteria 2919171160 2919175802 248
528 iso_pu_bacteria 2919408235 2919411055 248
529 iso_pu_bacteria 2920822456 2920825941 248
530 iso_pu_bacteria 2921208531 2921215118 248
531 iso_pu_bacteria 2921237296 2921239810 248
532 iso_pu_bacteria 2921244191 2921249037 248
533 iso_pu_bacteria 2921250672 2921252924 248
534 iso_pu_bacteria 2921257292 2921259006 248
535 iso_pu_bacteria 2921263974 2921266340 248
536 iso_pu_bacteria 2921282425 2921286995 248
537 iso_pu_bacteria 2921289301 2921296112 248
538 iso_pu_bacteria 2921296804 2921303391 248
539 iso_pu_bacteria 2922151315 2922154356 248
540 iso_pu_bacteria 2922172374 2922174995 248
541 iso_pu_bacteria 2922178524 2922183045 248
542 iso_pu_bacteria 2923556063 2923559506 248
543 iso_pu_bacteria 2924144063 2924149540 248
544 iso_pu_bacteria 2924150972 2924153113 248
545 iso_pu_bacteria 2924158325 2924163231 248
546 iso_pu_bacteria 2924165586 2924169667 248
547 iso_pu_bacteria 2924172951 2924174206 248
548 iso_pu_bacteria 2924179722 2924181855 248
549 iso_pu_bacteria 2924186466 2924187844 248
550 iso_pu_bacteria 2924193448 2924193586 248
551 iso_pu_bacteria 2924200457 2924201770 248
552 iso_pu_bacteria 2924207177 2924210313 248
553 iso_pu_bacteria 2924214083 2924219005 248
554 iso_pu_bacteria 2924221636 2924225848 248
555 iso_pu_bacteria 2924228884 2924235318 248
556 iso_pu_bacteria 2924748358 2924752853 248
557 iso_pu_bacteria 2924754689 2924754943 248
558 iso_pu_bacteria 2924776078 2924780538 248
559 iso_pu_bacteria 2926754445 2926755047 248
560 iso_pu_bacteria 2926760298 2926762207 248
561 iso_pu_bacteria 2928521798 2928522778 248
562 iso_pu_bacteria 2929138655 2929141855 248
563 iso_pu_bacteria 2933006813 2933010641 248
564 iso_pu_bacteria 2933011516 2933015687 248
565 iso_pu_bacteria 2933016740 2933017011 248
566 iso_pu_bacteria 2933570622 2933572376 248
567 iso_pu_bacteria 2933586486 2933593125 248
568 iso_pu_bacteria 2933594066 2933597572 248
569 iso_pu_bacteria 2933599457 2933603039 248
570 iso_pu_bacteria 2935894831 2935897927 248
571 iso_pu_bacteria 2935901341 2935903651 248
572 iso_pu_bacteria 2936367885 2936369873 248
573 iso_pu_bacteria 2936381700 2936381967 248
574 iso_pu_bacteria 2936996657 2936998954 248
575 iso_pu_bacteria 2937002841 2937006623 248
576 iso_pu_bacteria 2937009748 2937015563 248
577 iso_pu_bacteria 2937016420 2937017822 248
578 iso_pu_bacteria 2937023124 2937026029 248
579 iso_pu_bacteria 2937029754 2937031844 248
580 iso_pu_bacteria 2937036028 2937036225 248
581 iso_pu_bacteria 2937042894 2937046031 248
582 iso_pu_bacteria 2937049772 2937051001 248
583 iso_pu_bacteria 2937056579 2937060059 248
584 iso_pu_bacteria 2937063883 2937065124 248
585 iso_pu_bacteria 2937071275 2937077393 248
586 iso_pu_bacteria 2937078374 2937082061 248
587 iso_pu_bacteria 2937084907 2937089999 248
588 iso_pu_bacteria 2937091812 2937098082 248
589 iso_pu_bacteria 2937098957 2937101278 248
590 iso_pu_bacteria 2937106411 2937109125 248
591 iso_pu_bacteria 2937113482 2937115995 248
592 iso_pu_bacteria 2937119839 2937120143 248
593 iso_pu_bacteria 2937126314 2937127732 248
594 iso_pu_bacteria 2937813078 2937821248 248
595 iso_pu_bacteria 2937836603 2937839428 248
596 iso_pu_bacteria 2937868953 2937874102 248
597 iso_pu_bacteria 2937877337 2937883065 248
598 iso_pu_bacteria 2941499720 2941501362 248
599 iso_pu_bacteria 2954011201 2954013855 248
600 iso_pu_bacteria 2957375807 2957381814 248
601 iso_pu_bacteria 2957382221 2957384590 248
602 iso_pu_bacteria 2957388812 2957395296 248
603 iso_pu_bacteria 2957395598 2957400795 248
604 iso_pu_bacteria 2957402308 2957404441 248
605 iso_pu_bacteria 2957408893 2957411813 248
606 iso_pu_bacteria 2957415311 2957416714 248
607 iso_pu_bacteria 2957422303 2957428729 248
608 iso_pu_bacteria 2957430029 2957432016 248
609 iso_pu_bacteria 2957437181 2957442073 248
610 iso_pu_bacteria 2957443900 2957450302 248
611 iso_pu_bacteria 2957450854 2957451364 248
612 iso_pu_bacteria 2957457609 2957460899 248
613 iso_pu_bacteria 2957464669 2957470931 248
614 iso_pu_bacteria 2957471148 2957474157 248
615 iso_pu_bacteria 2957478035 2957479367 248
616 iso_pu_bacteria 2957484790 2957489729 248
617 iso_pu_bacteria 2957491536 2957494536 248
618 iso_pu_bacteria 2957498199 2957504936 248
619 iso_pu_bacteria 2957505466 2957512220 248
620 iso_pu_bacteria 2958034702 2958037337 248
621 iso_pu_bacteria 2958041894 2958047049 248
622 iso_pu_bacteria 2958064165 2958069584 248
623 iso_pu_bacteria 2958071322 2958076694 248
624 iso_pu_bacteria 2958084443 2958090191 248
625 iso_pu_bacteria 2958092219 2958093907 248
626 iso_pu_bacteria 2958100919 2958103416 248
627 iso_pu_bacteria 2958122699 2958127593 248
628 iso_pu_bacteria 2958130278 2958136514 248
629 iso_pu_bacteria 2958137437 2958142762 248
630 iso_pu_bacteria 2958158011 2958164809 248
631 iso_pu_bacteria 2958172287 2958173723 248
632 iso_pu_bacteria 2958179912 2958186008 248
633 iso_pu_bacteria 2960584000 2960585371 248
634 iso_pu_bacteria 2960591022 2960592249 248
635 iso_pu_bacteria 2960597568 2960597998 248
636 iso_pu_bacteria 2960603979 2960609777 248
637 iso_pu_bacteria 2960610863 2960613290 248
638 iso_pu_bacteria 2960617483 2960618313 248
639 iso_pu_bacteria 2960624210 2960628490 248
640 iso_pu_bacteria 2960631154 2960633799 248
641 iso_pu_bacteria 2960637947 2960643782 248
642 iso_pu_bacteria 2960645483 2960647560 248
643 iso_pu_bacteria 2960652885 2960659395 248
644 iso_pu_bacteria 2960660292 2960666840 248
645 iso_pu_bacteria 2960667422 2960673189 248
646 iso_pu_bacteria 2960674078 2960674609 248
647 iso_pu_bacteria 2960680706 2960682356 248
648 iso_pu_bacteria 2960687367 2960691597 248
649 iso_pu_bacteria 2960693952 2960698218 248
650 iso_pu_bacteria 2961077736 2961084489 248
651 iso_pu_bacteria 2961127735 2961133924 248
652 iso_pu_bacteria 2961136820 2961144347 248
653 iso_pu_bacteria 2964607997 2964609516 248
654 iso_pu_bacteria 2964615318 2964619369 248
655 iso_pu_bacteria 2964621998 2964627104 248
656 iso_pu_bacteria 2964628898 2964633244 248
657 iso_pu_bacteria 2964636051 2964641599 248
658 iso_pu_bacteria 2964643177 2964648841 248
659 iso_pu_bacteria 2964649959 2964656295 248
660 iso_pu_bacteria 2964656573 2964659600 248
661 iso_pu_bacteria 2964663802 2964664962 248
662 iso_pu_bacteria 2964670856 2964673371 248
663 iso_pu_bacteria 2964678106 2964681257 248
664 iso_pu_bacteria 2964685014 2964686137 248
665 iso_pu_bacteria 2964691889 2964695042 248
666 iso_pu_bacteria 2964698721 2964702442 248
667 iso_pu_bacteria 2964705432 2964705925 248
668 iso_pu_bacteria 2964712639 2964712761 248
669 iso_pu_bacteria 2964719344 2964726704 248
670 iso_pu_bacteria 2965025482 2965030435 248
671 iso_pu_bacteria 2965032056 2965036832 248
672 iso_pu_bacteria 2965040258 2965041887 248
673 iso_pu_bacteria 2965047637 2965047666 248
674 iso_pu_bacteria 2965089291 2965090707 248
675 iso_pu_bacteria 2965110997 2965117372 248
676 iso_pu_bacteria 2965119406 2965123717 248
677 iso_pu_bacteria 2967664464 2967670610 248
678 iso_pu_bacteria 2967671571 2967678282 248
679 iso_pu_bacteria 2967678726 2967681723 248
680 iso_pu_bacteria 2967686174 2967690234 248
681 iso_pu_bacteria 2967693043 2967699299 248
682 iso_pu_bacteria 2967699805 2967705977 248
683 iso_pu_bacteria 2967706974 2967713295 248
684 iso_pu_bacteria 2967714385 2967718988 248
685 iso_pu_bacteria 2967721400 2967723893 248
686 iso_pu_bacteria 2967728569 2967730839 248
687 iso_pu_bacteria 2967735183 2967738363 248
688 iso_pu_bacteria 2967742019 2967748310 248
689 iso_pu_bacteria 2967748971 2967753958 248
690 iso_pu_bacteria 2967755722 2967761918 248
691 iso_pu_bacteria 2967762386 2967764670 248
692 iso_pu_bacteria 2967769361 2967775607 248
693 iso_pu_bacteria 2967775926 2967776593 248
694 iso_pu_bacteria 2970019648 2970023625 248
695 iso_pu_bacteria 2970026789 2970029551 248
696 iso_pu_bacteria 2970033650 2970034502 248
697 iso_pu_bacteria 2970040964 2970044918 248
698 iso_pu_bacteria 2970047711 2970052447 248
699 iso_pu_bacteria 2970054988 2970058937 248
700 iso_pu_bacteria 2970061556 2970062044 248
701 iso_pu_bacteria 2970068827 2970070224 248
702 iso_pu_bacteria 2970076120 2970082674 248
703 iso_pu_bacteria 2970082768 2970086264 248
704 iso_pu_bacteria 2970088815 2970092844 248
705 iso_pu_bacteria 2970095765 2970096721 248
706 iso_pu_bacteria 2970102677 2970105369 248
707 iso_pu_bacteria 2970109326 2970112984 248
708 iso_pu_bacteria 2970116247 2970116838 248
709 iso_pu_bacteria 2970122695 2970128916 248
710 iso_pu_bacteria 2970129317 2970133622 248
711 iso_pu_bacteria 2970136068 2970140958 248
712 iso_pu_bacteria 2970143518 2970143588 248
713 iso_pu_bacteria 2970149975 2970152927 248
714 iso_pu_bacteria 2970156795 2970158007 248
715 iso_pu_bacteria 2970164137 2970170855 248
716 iso_pu_bacteria 2970170962 2970174728 248
717 iso_pu_bacteria 2970177841 2970178120 248
718 iso_pu_bacteria 2970184632 2970185464 248
719 iso_pu_bacteria 2970191845 2970192208 248
720 iso_pu_bacteria 2970489779 2970495295 248
721 iso_pu_bacteria 2970524798 2970531374 248
722 iso_pu_bacteria 2970540015 2970547637 248
723 iso_pu_bacteria 2970547951 2970550534 248
724 iso_pu_bacteria 2970593180 2970595979 248
725 iso_pu_bacteria 2977516862 2977520039 248
726 iso_pu_bacteria 2977523885 2977525539 248
727 iso_pu_bacteria 2977530762 2977535068 248
728 iso_pu_bacteria 2977537788 2977544571 248
729 iso_pu_bacteria 2977544691 2977550613 248
730 iso_pu_bacteria 2977551784 2977553189 248
731 iso_pu_bacteria 2977558990 2977562169 248
732 iso_pu_bacteria 2977565890 2977571210 248
733 iso_pu_bacteria 2977572785 2977573733 248
734 iso_pu_bacteria 2977579622 2977582934 248
735 iso_pu_bacteria 2977843712 2977849551 248
736 iso_pu_bacteria 2977872689 2977875547 248
737 iso_pu_bacteria 2977915119 2977916003 248
738 iso_pu_bacteria 2977922695 2977926914 248
739 iso_pu_bacteria 2977935797 2977939334 248
740 iso_pu_bacteria 2977950692 2977952073 248
741 iso_pu_bacteria 2977957713 2977963326 248
742 iso_pu_bacteria 2978969890 2978972596 248
743 iso_pu_bacteria 2979089926 2979092523 248
744 iso_pu_bacteria 2979095461 2979100086 248
745 iso_pu_bacteria 2979100975 2979104494 248
746 iso_pu_bacteria 2979710463 2979714485 248
747 iso_pu_bacteria 2979793036 2979796686 248
748 iso_pu_bacteria 2984509177 2984513711 248
749 iso_pu_bacteria 2984518228 2984522711 248
750 iso_pu_bacteria 2984537506 2984542017 248
751 iso_pu_bacteria 2984587000 2984590848 248
752 iso_pu_bacteria 2984601300 2984601447 248
753 iso_pu_bacteria 2987645492 2987647717 248
754 iso_pu_bacteria 2987673487 2987675927 248
755 iso_pu_bacteria 2989776772 2989780139 248
756 iso_pu_bacteria 2996310559 2996316715 248
757 iso_pu_bacteria 2996348954 2996351733 248
758 iso_pu_bacteria 2996887358 2996890224 248
759 iso_pu_bacteria 2996893221 2996895264 248
760 iso_pu_bacteria 3002141150 3002141696 248
761 iso_pu_bacteria 3004195979 3004203480 248
762 iso_pu_bacteria 3004239961 3004245643 248
763 iso_pu_bacteria 3004275668 3004278433 248
764 iso_pu_bacteria 3005409236 3005415781 248
765 iso_pu_bacteria 3005416602 3005421633 248
766 iso_pu_bacteria 3005452660 3005455926 248
767 iso_pu_bacteria 639633055 639650416 248
768 iso_pu_bacteria 643692032 643827422 248
769 iso_pu_bacteria 648276728 648737211 248
770 iso_pu_bacteria 649633066 649874389 248
771 iso_pu_bacteria 650716007 650741153 248
772 iso_pu_bacteria 8002285264 8002287645 248
773 iso_pu_bacteria 8003570095 8003573787 248
774 iso_pu_bacteria 8003992118 8003995353 248
775 iso_pu_bacteria 8003999396 8004003094 248
776 iso_pu_bacteria 8004300914 8004307095 248
777 iso_pu_bacteria 8004361976 8004362665 248
778 iso_pu_bacteria 8004387939 8004394906 248
779 iso_pu_bacteria 8004633249 8004635317 248
780 iso_pu_bacteria 8004695233 8004696224 248
781 iso_pu_bacteria 8004714634 8004721111 248
782 iso_pu_bacteria 8005246636 8005249280 248
783 iso_pu_bacteria 8005258706 8005262408 248
784 iso_pu_bacteria 8005275841 8005282416 248
785 iso_pu_bacteria 8005282627 8005286765 248
786 iso_pu_bacteria 8005289223 8005295067 248
787 iso_pu_bacteria 8005301065 8005305946 248
788 iso_pu_bacteria 8005307578 8005313682 248
789 iso_pu_bacteria 8005314921 8005319662 248
790 iso_pu_bacteria 8005321885 8005324751 248
791 iso_pu_bacteria 8005376324 8005381584 248
792 iso_pu_bacteria 8005395548 8005400824 248
793 iso_pu_bacteria 8005430974 8005431089 248
794 iso_pu_bacteria 8005460587 8005465080 248
795 iso_pu_bacteria 8005542996 8005546655 248
796 iso_pu_bacteria 8005556819 8005561155 248
797 iso_pu_bacteria 8005563573 8005565780 248
798 iso_pu_bacteria 8005619151 8005623391 248
799 iso_pu_bacteria 8005626139 8005631029 248
800 iso_pu_bacteria 8005645114 8005646940 248
801 iso_pu_bacteria 8005658619 8005660792 248
802 iso_pu_bacteria 8005682033 8005688089 248
803 iso_pu_bacteria 8005688590 8005694355 248
804 iso_pu_bacteria 8005695170 8005695717 248
805 iso_pu_bacteria 8018127388 8018128894 248
806 iso_pu_bacteria 8018163183 8018165106 248
807 iso_pu_bacteria 8018176218 8018177134 248
808 iso_pu_bacteria 8023680758 8023686521 248
809 iso_pu_bacteria 8024479707 8024484354 248
810 iso_pu_bacteria 8024486573 8024490834 248
811 iso_pu_bacteria 8024501048 8024502341 248
812 iso_pu_bacteria 8046767195 8046767215 248
813 iso_pu_bacteria 8049293176 8049296302 248
814 iso_pu_bacteria 8054460903 8054463819 248
815 iso_pu_bacteria 8054558443 8054561771 248
816 iso_pu_bacteria 8055617313 8055622464 248
817 iso_pu_bacteria 8056375014 8056380398 248
818 iso_pu_bacteria 8056382006 8056385229 248
819 iso_pu_bacteria 8056875544 8056878238 248
820 iso_pu_bacteria 8057575449 8057581601 248
821 iso_pu_bacteria 8057874678 8057879271 248
822 3300006038 Ga0075365_10093998 Ga0075365_100939982 249
823 3300006038 Ga0075365_10095323 Ga0075365_100953232 249
824 3300006038 Ga0075365_10232525 Ga0075365_102325252 249
825 3300006048 Ga0075363_100080411 Ga0075363_1000804112 249
826 3300006177 Ga0075362_10022878 Ga0075362_100228783 249
827 3300006178 Ga0075367_10040098 Ga0075367_100400982 249
828 3300006186 Ga0075369_10128867 Ga0075369_101288672 249
829 3300037418 Ga0395900_0000027 Ga0395900_0000027_265550_266302 249
830 3300037466 Ga0395898_0000255 Ga0395898_0000255_110610_111362 249
831 3300037471 Ga0395905_0000032 Ga0395905_0000032_19631_20383 249
832 3300038443 Ga0395901_0000110 Ga0395901_0000110_19656_20408 249
833 3300046512 Ga0495610_0172230 Ga0495610_0172230_10_762 249
834 3300046542 Ga0495597_0078539 Ga0495597_0078539_161_913 249
835 3300046616 Ga0495668_0130550 Ga0495668_0130550_487_1239 249
836 3300046810 Ga0495660_0159607 Ga0495660_0159607_216_968 249
837 3300048928 Ga0496125_0008659 Ga0496125_0008659_8284_9045 249
838 3300050492 nmdc:mga0yw44_75984_c1 nmdc:mga0yw44_75984_c1_200_952 249
839 3300050516 nmdc:mga0sz30_773_c1 nmdc:mga0sz30_773_c1_200_952 249
840 3300053155 Ga0500620_000163 Ga0500620_000163_11584_12336 249
841 iso_pu_bacteria 2937822353 2937825694 249
842 iso_pu_bacteria 2995392953 2995396019 249
843 3300026089 Ga0207648_10598053 Ga0207648_105980532 250
844 3300037312 Ga0395899_0075980 Ga0395899_0075980_303_1058 250
845 3300037418 Ga0395900_0108539 Ga0395900_0108539_477_1232 250
846 3300038443 Ga0395901_0171280 Ga0395901_0171280_460_1215 250
847 3300046460 Ga0495638_0026140 Ga0495638_0026140_139_900 250
848 3300049574 Ga0501038_0240267 Ga0501038_0240267_80_835 250
849 3300049575 Ga0501039_0144383 Ga0501039_0144383_492_1262 250
850 3300001989 JGI24739J22299_10061530 JGI24739J22299_100615301 251
851 3300003791 Ga0055530_10043447 Ga0055530_100434472 251
852 3300003794 Ga0055531_10004054 Ga0055531_100040542 251
853 3300005616 Ga0068852_100326072 Ga0068852_1003260721 251
854 3300005834 Ga0068851_10117485 Ga0068851_101174852 251
855 3300006038 Ga0075365_10034493 Ga0075365_100344934 251
856 3300006051 Ga0075364_10000026 Ga0075364_1000002622 251
857 3300006946 Ga0079104_1000195 Ga0079104_100019543 251
858 3300009545 Ga0105237_10016781 Ga0105237_100167813 251
859 3300009551 Ga0105238_10011895 Ga0105238_100118958 251
860 3300013105 Ga0157369_10352336 Ga0157369_103523362 251
861 3300025297 Ga0209758_1000570 Ga0209758_100057055 251
862 3300025297 Ga0209758_1014230 Ga0209758_10142303 251
863 3300025297 Ga0209758_1033127 Ga0209758_10331273 251
864 3300025298 Ga0209050_1004558 Ga0209050_10045585 251
865 3300025303 Ga0209051_1005359 Ga0209051_10053594 251
866 3300025304 Ga0209257_1007840 Ga0209257_10078402 251
867 3300025904 Ga0207647_10341561 Ga0207647_103415611 251
868 3300025924 Ga0207694_10019075 Ga0207694_100190752 251
869 3300026041 Ga0207639_10030702 Ga0207639_100307024 251
870 3300027111 Ga0209281_1000028 Ga0209281_1000028402 251
871 3300027111 Ga0209281_1000028 Ga0209281_100002840 251
872 3300032004 Ga0307414_10092769 Ga0307414_100927694 251
873 3300036647 Ga0316582_0101645 Ga0316582_0101645_65_850 251
874 3300037418 Ga0395900_0089901 Ga0395900_0089901_1249_2007 251
875 3300037418 Ga0395900_0804429 Ga0395900_0804429_16_774 251
876 3300037471 Ga0395905_0021304 Ga0395905_0021304_2222_2980 251
877 3300037471 Ga0395905_0424658 Ga0395905_0424658_313_1077 251
878 3300038443 Ga0395901_0073195 Ga0395901_0073195_2636_3394 251
879 3300048923 Ga0496120_0006272 Ga0496120_0006272_4501_5259 251
880 3300048924 Ga0496121_0005857 Ga0496121_0005857_10853_11623 251
881 3300048924 Ga0496121_0017796 Ga0496121_0017796_5775_6545 251
882 3300048925 Ga0496122_0017308 Ga0496122_0017308_3795_4565 251
883 3300048927 Ga0496124_0037520 Ga0496124_0037520_955_1725 251
884 3300048928 Ga0496125_0013275 Ga0496125_0013275_2410_3168 251
885 3300048929 Ga0496126_0155592 Ga0496126_0155592_875_1633 251
886 3300048929 Ga0496126_0213832 Ga0496126_0213832_479_1237 251
887 3300049569 Ga0501032_0182790 Ga0501032_0182790_87_845 251
888 3300049570 Ga0501033_0003048 Ga0501033_0003048_249_1007 251
889 3300049573 Ga0501037_0157352 Ga0501037_0157352_470_1228 251
890 3300049574 Ga0501038_0132051 Ga0501038_0132051_119_877 251
891 3300049581 Ga0501047_0079562 Ga0501047_0079562_953_1711 251
892 3300049581 Ga0501047_0281150 Ga0501047_0281150_59_817 251
893 3300049583 Ga0501067_0116844 Ga0501067_0116844_402_1223 251
894 3300049585 Ga0501069_0089510 Ga0501069_0089510_36_794 251
895 3300049586 Ga0501070_0016288 Ga0501070_0016288_5332_6090 251
896 3300049586 Ga0501070_0351943 Ga0501070_0351943_380_1150 251
897 3300049590 Ga0501074_0110304 Ga0501074_0110304_304_1062 251
898 3300049741 Ga0501079_0341914 Ga0501079_0341914_28_786 251
899 3300049742 Ga0501080_0004712 Ga0501080_0004712_6030_6788 251
900 3300049822 Ga0501035_0006106 Ga0501035_0006106_5175_5933 251
901 3300049822 Ga0501035_0042655 Ga0501035_0042655_946_1704 251
902 3300049823 Ga0501044_0039749 Ga0501044_0039749_3104_3862 251
903 3300049823 Ga0501044_0095281 Ga0501044_0095281_132_890 251
904 3300050491 nmdc:mga00v17_1285_c1 nmdc:mga00v17_1285_c1_2686_3456 251
905 3300050491 nmdc:mga00v17_248604_c1 nmdc:mga00v17_248604_c1_321_1091 251
906 3300053125 Ga0500618_001412 Ga0500618_001412_4035_4805 251
907 3300053153 Ga0500616_0005597 Ga0500616_0005597_3311_4081 251
908 3300059493 Ga0587077_048477 Ga0587077_048477_101_859 251
909 3300001979 JGI24740J21852_10000013 JGI24740J21852_1000001359 252
910 3300002704 JGI25155J39150_1000010 JGI25155J39150_10000109 252
911 3300002705 JGI25156J39149_1000102 JGI25156J39149_10001029 252
912 3300002737 JGI25162J39368_1002243 JGI25162J39368_10022434 252
913 3300002738 JGI25154J39366_1000096 JGI25154J39366_10000963 252
914 3300002739 JGI25158J39367_1000116 JGI25158J39367_100011619 252
915 3300002739 JGI25158J39367_1014000 JGI25158J39367_10140001 252
916 3300002741 JGI25157J39369_1000009 JGI25157J39369_10000099 252
917 3300002773 JGI25152J39213_1002679 JGI25152J39213_10026797 252
918 3300002773 JGI25152J39213_1007127 JGI25152J39213_10071274 252
919 3300002773 JGI25152J39213_1015884 JGI25152J39213_10158842 252
920 3300002774 JGI25150J39212_1000037 JGI25150J39212_100003717 252
921 3300002987 JGI25159J45721_1002450 JGI25159J45721_10024504 252
922 3300003187 JGI25151J46595_10000220 JGI25151J46595_1000022058 252
923 3300003187 JGI25151J46595_10013759 JGI25151J46595_100137595 252
924 3300003214 JGI25165J46597_1000070 JGI25165J46597_100007046 252
925 3300003214 JGI25165J46597_1001449 JGI25165J46597_10014493 252
926 3300003215 JGI25153J46596_10007468 JGI25153J46596_100074686 252
927 3300003215 JGI25153J46596_10039259 JGI25153J46596_100392592 252
928 3300003322 rootL2_10053278 rootL2_100532783 252
929 3300003354 JGI25160J50197_1000027 JGI25160J50197_100002794 252
930 3300003374 JGI25161J50226_1000327 JGI25161J50226_10003274 252
931 3300003374 JGI25161J50226_1000501 JGI25161J50226_10005013 252
932 3300003578 Ga0006562J51391_1011280 Ga0006562J51391_10112802 252
933 3300003578 Ga0006562J51391_1037909 Ga0006562J51391_10379093 252
934 3300003771 Ga0055526_1001473 Ga0055526_100147310 252
935 3300003771 Ga0055526_1008010 Ga0055526_10080107 252
936 3300003771 Ga0055526_1016809 Ga0055526_10168094 252
937 3300003771 Ga0055526_1038822 Ga0055526_10388222 252
938 3300003775 Ga0055524_1002650 Ga0055524_100265011 252
939 3300003775 Ga0055524_1004200 Ga0055524_10042002 252
940 3300003775 Ga0055524_1014167 Ga0055524_10141673 252
941 3300003775 Ga0055524_1021291 Ga0055524_10212912 252
942 3300003781 Ga0055536_1001323 Ga0055536_10013237 252
943 3300003790 Ga0055528_1000099 Ga0055528_100009963 252
944 3300003790 Ga0055528_1003479 Ga0055528_10034795 252
945 3300003790 Ga0055528_1003641 Ga0055528_10036418 252
946 3300003792 Ga0055540_1009091 Ga0055540_10090914 252
947 3300003856 Ga0058692_1004143 Ga0058692_10041433 252
948 3300003856 Ga0058692_1006819 Ga0058692_10068195 252
949 3300004625 Ga0055543_1000030 Ga0055543_1000030102 252
950 3300004625 Ga0055543_1000062 Ga0055543_100006290 252
951 3300005262 Ga0065165_1000122 Ga0065165_100012290 252
952 3300005262 Ga0065165_1020897 Ga0065165_10208971 252
953 3300005347 Ga0070668_100073821 Ga0070668_1000738213 252
954 3300005353 Ga0070669_100071728 Ga0070669_1000717283 252
955 3300005353 Ga0070669_100423593 Ga0070669_1004235931 252
956 3300005355 Ga0070671_100057902 Ga0070671_1000579024 252
957 3300005367 Ga0070667_100305966 Ga0070667_1003059662 252
958 3300005456 Ga0070678_100334366 Ga0070678_1003343662 252
959 3300005548 Ga0070665_100004011 Ga0070665_10000401110 252
960 3300005548 Ga0070665_100036324 Ga0070665_1000363248 252
961 3300005548 Ga0070665_100043495 Ga0070665_1000434953 252
962 3300005548 Ga0070665_100483703 Ga0070665_1004837032 252
963 3300005616 Ga0068852_100143657 Ga0068852_1001436573 252
964 3300005844 Ga0068862_100544907 Ga0068862_1005449072 252
965 3300006038 Ga0075365_10000498 Ga0075365_100004982 252
966 3300006042 Ga0075368_10003863 Ga0075368_100038633 252
967 3300006048 Ga0075363_100031175 Ga0075363_1000311753 252
968 3300006177 Ga0075362_10021353 Ga0075362_100213533 252
969 3300006178 Ga0075367_10004009 Ga0075367_100040094 252
970 3300006178 Ga0075367_10004494 Ga0075367_100044943 252
971 3300006178 Ga0075367_10087255 Ga0075367_100872552 252
972 3300006178 Ga0075367_10134531 Ga0075367_101345311 252
973 3300006186 Ga0075369_10002071 Ga0075369_100020716 252
974 3300006186 Ga0075369_10091960 Ga0075369_100919602 252
975 3300006186 Ga0075369_10217669 Ga0075369_102176691 252
976 3300006353 Ga0075370_10025818 Ga0075370_100258183 252
977 3300006946 Ga0079104_1014561 Ga0079104_10145613 252
978 3300006948 Ga0099826_10000958 Ga0099826_1000095813 252
979 3300009093 Ga0105240_10000013 Ga0105240_10000013200 252
980 3300009148 Ga0105243_10005164 Ga0105243_100051647 252
981 3300009545 Ga0105237_10012810 Ga0105237_100128105 252
982 3300009765 Ga0123341_1023081 Ga0123341_10230814 252
983 3300009766 Ga0123342_1009724 Ga0123342_10097244 252
984 3300010375 Ga0105239_10000820 Ga0105239_100008208 252
985 3300013100 Ga0157373_10094150 Ga0157373_100941502 252
986 3300013102 Ga0157371_10000108 Ga0157371_1000010866 252
987 3300013104 Ga0157370_10004961 Ga0157370_1000496110 252
988 3300013104 Ga0157370_10005427 Ga0157370_1000542714 252
989 3300013249 Ga0171463_1004 Ga0171463_1004204 252
990 3300015262 Ga0182007_10002575 Ga0182007_100025753 252
991 3300015265 Ga0182005_1004658 Ga0182005_10046585 252
992 3300015690 Ga0183363_1019 Ga0183363_101929 252
993 3300021320 Ga0214544_1000288 Ga0214544_100028868 252
994 3300021321 Ga0214542_1000008 Ga0214542_100000880 252
995 3300021327 Ga0214543_1000015 Ga0214543_100001585 252
996 3300021327 Ga0214543_1000031 Ga0214543_100003111 252
997 3300022739 Ga0228711_1000004 Ga0228711_1000004116 252
998 3300022740 Ga0228710_1000002 Ga0228710_100000264 252
999 3300025206 Ga0209435_100009 Ga0209435_100009266 252
1000 3300025208 Ga0209436_100018 Ga0209436_10001811 252
1001 3300025208 Ga0209436_100664 Ga0209436_10066411 252
1002 3300025208 Ga0209436_107083 Ga0209436_1070832 252
1003 3300025228 Ga0209672_103233 Ga0209672_1032335 252
1004 3300025233 Ga0209437_100057 Ga0209437_100057201 252
1005 3300025245 Ga0207425_1000034 Ga0207425_100003418 252
1006 3300025245 Ga0207425_1002143 Ga0207425_10021437 252
1007 3300025246 Ga0209646_1000018 Ga0209646_1000018266 252
1008 3300025246 Ga0209646_1003848 Ga0209646_10038482 252
1009 3300025250 Ga0209026_1000068 Ga0209026_100006810 252
1010 3300025253 Ga0209677_100199 Ga0209677_1001993 252
1011 3300025256 Ga0209759_1000007 Ga0209759_1000007266 252
1012 3300025258 Ga0209129_1000118 Ga0209129_100011834 252
1013 3300025258 Ga0209129_1000253 Ga0209129_100025318 252
1014 3300025258 Ga0209129_1000971 Ga0209129_100097112 252
1015 3300025258 Ga0209129_1003196 Ga0209129_10031966 252
1016 3300025258 Ga0209129_1003252 Ga0209129_10032527 252
1017 3300025258 Ga0209129_1004160 Ga0209129_10041603 252
1018 3300025261 Ga0209233_1000130 Ga0209233_10001303 252
1019 3300025261 Ga0209233_1000131 Ga0209233_100013160 252
1020 3300025261 Ga0209233_1006961 Ga0209233_10069614 252
1021 3300025272 Ga0209455_1011173 Ga0209455_10111734 252
1022 3300025273 Ga0209673_1000033 Ga0209673_1000033250 252
1023 3300025273 Ga0209673_1004625 Ga0209673_10046256 252
1024 3300025273 Ga0209673_1005860 Ga0209673_10058606 252
1025 3300025273 Ga0209673_1037398 Ga0209673_10373982 252
1026 3300025284 Ga0209130_1000009 Ga0209130_1000009281 252
1027 3300025284 Ga0209130_1000027 Ga0209130_1000027229 252
1028 3300025292 Ga0209676_1000406 Ga0209676_100040610 252
1029 3300025294 Ga0209025_1000241 Ga0209025_10002418 252
1030 3300025294 Ga0209025_1000487 Ga0209025_100048742 252
1031 3300025294 Ga0209025_1000533 Ga0209025_100053359 252
1032 3300025294 Ga0209025_1002217 Ga0209025_10022178 252
1033 3300025295 Ga0209564_1000111 Ga0209564_1000111210 252
1034 3300025295 Ga0209564_1000782 Ga0209564_100078237 252
1035 3300025295 Ga0209564_1016817 Ga0209564_10168172 252
1036 3300025295 Ga0209564_1024253 Ga0209564_10242534 252
1037 3300025297 Ga0209758_1000415 Ga0209758_100041559 252
1038 3300025297 Ga0209758_1001085 Ga0209758_100108525 252
1039 3300025297 Ga0209758_1001086 Ga0209758_100108624 252
1040 3300025297 Ga0209758_1002520 Ga0209758_100252010 252
1041 3300025297 Ga0209758_1015745 Ga0209758_10157453 252
1042 3300025297 Ga0209758_1081103 Ga0209758_10811031 252
1043 3300025298 Ga0209050_1000572 Ga0209050_100057220 252
1044 3300025299 Ga0209256_1003544 Ga0209256_10035444 252
1045 3300025299 Ga0209256_1003766 Ga0209256_10037668 252
1046 3300025299 Ga0209256_1007283 Ga0209256_10072836 252
1047 3300025299 Ga0209256_1016905 Ga0209256_10169053 252
1048 3300025302 Ga0207426_1000041 Ga0207426_1000041219 252
1049 3300025302 Ga0207426_1000072 Ga0207426_100007287 252
1050 3300025302 Ga0207426_1001232 Ga0207426_10012324 252
1051 3300025303 Ga0209051_1001068 Ga0209051_100106820 252
1052 3300025303 Ga0209051_1006368 Ga0209051_10063687 252
1053 3300025303 Ga0209051_1009487 Ga0209051_10094872 252
1054 3300025913 Ga0207695_10000044 Ga0207695_10000044157 252
1055 3300025914 Ga0207671_10000400 Ga0207671_1000040024 252
1056 3300025923 Ga0207681_10336655 Ga0207681_103366551 252
1057 3300025923 Ga0207681_10465700 Ga0207681_104657001 252
1058 3300025972 Ga0207668_10599635 Ga0207668_105996352 252
1059 3300026067 Ga0207678_10157915 Ga0207678_101579151 252
1060 3300026067 Ga0207678_10555784 Ga0207678_105557842 252
1061 3300026142 Ga0207698_10148018 Ga0207698_101480183 252
1062 3300027111 Ga0209281_1000030 Ga0209281_1000030195 252
1063 3300027111 Ga0209281_1000144 Ga0209281_1000144137 252
1064 3300027312 Ga0209371_1000037 Ga0209371_1000037133 252
1065 3300027312 Ga0209371_1003285 Ga0209371_10032858 252
1066 3300027666 Ga0209282_1000004 Ga0209282_1000004195 252
1067 3300027666 Ga0209282_1003026 Ga0209282_10030269 252
1068 3300027866 Ga0209813_10008558 Ga0209813_100085583 252
1069 3300028379 Ga0268266_10004208 Ga0268266_1000420813 252
1070 3300028379 Ga0268266_10006277 Ga0268266_100062777 252
1071 3300028379 Ga0268266_10452834 Ga0268266_104528342 252
1072 3300028379 Ga0268266_10733278 Ga0268266_107332782 252
1073 3300028380 Ga0268265_10527461 Ga0268265_105274611 252
1074 3300028794 Ga0307515_10001330 Ga0307515_1000133014 252
1075 3300028794 Ga0307515_10040955 Ga0307515_100409555 252
1076 3300028794 Ga0307515_10324407 Ga0307515_103244071 252
1077 3300030500 Ga0268256_1000039 Ga0268256_1000039176 252
1078 3300030500 Ga0268256_1003721 Ga0268256_10037214 252
1079 3300030500 Ga0268256_1006192 Ga0268256_10061924 252
1080 3300031456 Ga0307513_10005665 Ga0307513_1000566518 252
1081 3300031548 Ga0307408_100133551 Ga0307408_1001335513 252
1082 3300031616 Ga0307508_10188191 Ga0307508_101881913 252
1083 3300031731 Ga0307405_10014073 Ga0307405_100140735 252
1084 3300031852 Ga0307410_10220262 Ga0307410_102202621 252
1085 3300031901 Ga0307406_10019368 Ga0307406_100193683 252
1086 3300031911 Ga0307412_10005736 Ga0307412_100057362 252
1087 3300031967 Ga0315914_1000001 Ga0315914_1000001188 252
1088 3300031995 Ga0307409_100018253 Ga0307409_1000182534 252
1089 3300031995 Ga0307409_100603870 Ga0307409_1006038702 252
1090 3300033430 Ga0315913_1000004 Ga0315913_1000004112 252
1091 3300033464 Ga0315915_1000002 Ga0315915_1000002196 252
1092 3300037471 Ga0395905_0001780 Ga0395905_0001780_11856_12626 252
1093 3300037471 Ga0395905_0008738 Ga0395905_0008738_8582_9352 252
1094 3300038741 Ga0400488_35929 Ga0400488_35929_390_1151 252
1095 3300041404 Ga0439436_0025270 Ga0439436_0025270_836_1597 252
1096 3300041404 Ga0439436_0029222 Ga0439436_0029222_400_1212 252
1097 3300041413 Ga0439465_0025792 Ga0439465_0025792_621_1382 252
1098 3300041413 Ga0439465_0035904 Ga0439465_0035904_495_1313 252
1099 3300042007 Ga0439449_0001259 Ga0439449_0001259_563_1333 252
1100 3300042007 Ga0439449_0011037 Ga0439449_0011037_319_1131 252
1101 3300042185 Ga0450909_002914 Ga0450909_002914_770_1531 252
1102 3300046460 Ga0495638_0003269 Ga0495638_0003269_10007_10768 252
1103 3300046460 Ga0495638_0209005 Ga0495638_0209005_150_920 252
1104 3300046474 Ga0495605_0002525 Ga0495605_0002525_9757_10518 252
1105 3300046492 Ga0495585_0027948 Ga0495585_0027948_384_1145 252
1106 3300046513 Ga0495616_0020903 Ga0495616_0020903_1988_2749 252
1107 3300046515 Ga0495620_0051274 Ga0495620_0051274_100_897 252
1108 3300046518 Ga0495631_0002242 Ga0495631_0002242_3024_3785 252
1109 3300046519 Ga0495632_0009845 Ga0495632_0009845_2631_3392 252
1110 3300046519 Ga0495632_0018201 Ga0495632_0018201_347_1108 252
1111 3300046522 Ga0495643_0009187 Ga0495643_0009187_4396_5157 252
1112 3300046538 Ga0495609_0025182 Ga0495609_0025182_1484_2245 252
1113 3300046558 Ga0495633_0017477 Ga0495633_0017477_1031_1828 252
1114 3300046616 Ga0495668_0006323 Ga0495668_0006323_2595_3356 252
1115 3300046616 Ga0495668_0033189 Ga0495668_0033189_295_1092 252
1116 3300046648 Ga0495611_0010753 Ga0495611_0010753_1856_2617 252
1117 3300046660 Ga0495625_0004490 Ga0495625_0004490_9494_10255 252
1118 3300047320 Ga0495672_0050339 Ga0495672_0050339_834_1595 252
1119 3300047470 Ga0495681_0004907 Ga0495681_0004907_754_1515 252
1120 3300047472 Ga0495686_0015554 Ga0495686_0015554_2678_3439 252
1121 3300048907 Ga0496104_0059574 Ga0496104_0059574_2037_2798 252
1122 3300048908 Ga0496105_0097508 Ga0496105_0097508_1155_1916 252
1123 3300048909 Ga0496106_0004976 Ga0496106_0004976_1735_2496 252
1124 3300048913 Ga0496110_0153941 Ga0496110_0153941_305_1102 252
1125 3300048919 Ga0496116_0005573 Ga0496116_0005573_4313_5074 252
1126 3300048919 Ga0496116_0025349 Ga0496116_0025349_2739_3500 252
1127 3300048919 Ga0496116_0028421 Ga0496116_0028421_2031_2792 252
1128 3300048919 Ga0496116_0052803 Ga0496116_0052803_1265_2026 252
1129 3300048919 Ga0496116_0055253 Ga0496116_0055253_485_1282 252
1130 3300048919 Ga0496116_0073743 Ga0496116_0073743_1229_1990 252
1131 3300048920 Ga0496117_0000031 Ga0496117_0000031_154266_155027 252
1132 3300048920 Ga0496117_0002097 Ga0496117_0002097_15552_16313 252
1133 3300048920 Ga0496117_0053245 Ga0496117_0053245_1636_2397 252
1134 3300048921 Ga0496118_0000899 Ga0496118_0000899_3801_4562 252
1135 3300048921 Ga0496118_0002291 Ga0496118_0002291_15656_16417 252
1136 3300048921 Ga0496118_0035409 Ga0496118_0035409_894_1655 252
1137 3300048922 Ga0496119_0006994 Ga0496119_0006994_4437_5198 252
1138 3300048922 Ga0496119_0011551 Ga0496119_0011551_602_1387 252
1139 3300048922 Ga0496119_0021707 Ga0496119_0021707_2285_3046 252
1140 3300048922 Ga0496119_0086936 Ga0496119_0086936_594_1355 252
1141 3300048923 Ga0496120_0000337 Ga0496120_0000337_3479_4240 252
1142 3300048923 Ga0496120_0011695 Ga0496120_0011695_3805_4566 252
1143 3300048923 Ga0496120_0018267 Ga0496120_0018267_844_1629 252
1144 3300048923 Ga0496120_0038869 Ga0496120_0038869_1349_2110 252
1145 3300048923 Ga0496120_0041040 Ga0496120_0041040_1647_2408 252
1146 3300048924 Ga0496121_0000034 Ga0496121_0000034_232079_232840 252
1147 3300048924 Ga0496121_0018473 Ga0496121_0018473_5106_5867 252
1148 3300048924 Ga0496121_0026755 Ga0496121_0026755_2681_3442 252
1149 3300048924 Ga0496121_0027371 Ga0496121_0027371_1638_2399 252
1150 3300048924 Ga0496121_0032092 Ga0496121_0032092_2066_2827 252
1151 3300048924 Ga0496121_0038490 Ga0496121_0038490_1615_2376 252
1152 3300048924 Ga0496121_0378304 Ga0496121_0378304_20_781 252
1153 3300048925 Ga0496122_0000023 Ga0496122_0000023_154266_155027 252
1154 3300048925 Ga0496122_0021693 Ga0496122_0021693_2261_3022 252
1155 3300048925 Ga0496122_0025165 Ga0496122_0025165_2441_3202 252
1156 3300048925 Ga0496122_0029168 Ga0496122_0029168_3828_4613 252
1157 3300048925 Ga0496122_0061075 Ga0496122_0061075_112_870 252
1158 3300048925 Ga0496122_0072613 Ga0496122_0072613_779_1540 252
1159 3300048925 Ga0496122_0108551 Ga0496122_0108551_500_1261 252
1160 3300048926 Ga0496123_0000027 Ga0496123_0000027_226009_226770 252
1161 3300048926 Ga0496123_0017095 Ga0496123_0017095_2164_2925 252
1162 3300048926 Ga0496123_0028278 Ga0496123_0028278_1505_2266 252
1163 3300048926 Ga0496123_0036008 Ga0496123_0036008_1807_2568 252
1164 3300048926 Ga0496123_0092555 Ga0496123_0092555_47_808 252
1165 3300048927 Ga0496124_0002248 Ga0496124_0002248_1389_2150 252
1166 3300048927 Ga0496124_0005858 Ga0496124_0005858_12284_13045 252
1167 3300048927 Ga0496124_0021541 Ga0496124_0021541_4099_4860 252
1168 3300048927 Ga0496124_0024118 Ga0496124_0024118_2681_3442 252
1169 3300048927 Ga0496124_0086992 Ga0496124_0086992_1308_2105 252
1170 3300048927 Ga0496124_0154210 Ga0496124_0154210_10_771 252
1171 3300048927 Ga0496124_0171436 Ga0496124_0171436_762_1523 252
1172 3300048928 Ga0496125_0000030 Ga0496125_0000030_141678_142439 252
1173 3300048928 Ga0496125_0013946 Ga0496125_0013946_3696_4457 252
1174 3300048928 Ga0496125_0027541 Ga0496125_0027541_2514_3275 252
1175 3300048928 Ga0496125_0042092 Ga0496125_0042092_2306_3067 252
1176 3300048928 Ga0496125_0131962 Ga0496125_0131962_381_1142 252
1177 3300048929 Ga0496126_0017925 Ga0496126_0017925_5768_6529 252
1178 3300048929 Ga0496126_0083325 Ga0496126_0083325_1999_2760 252
1179 3300048929 Ga0496126_0115270 Ga0496126_0115270_443_1228 252
1180 3300049459 Ga0495678_006181 Ga0495678_006181_1904_2665 252
1181 3300049569 Ga0501032_0047061 Ga0501032_0047061_497_1258 252
1182 3300049571 Ga0501034_0014386 Ga0501034_0014386_2527_3288 252
1183 3300049579 Ga0501043_0070321 Ga0501043_0070321_605_1366 252
1184 3300049589 Ga0501073_0155164 Ga0501073_0155164_632_1393 252
1185 3300049744 Ga0501083_0020575 Ga0501083_0020575_2606_3367 252
1186 3300049744 Ga0501083_0121136 Ga0501083_0121136_707_1468 252
1187 3300050491 nmdc:mga00v17_151_c1 nmdc:mga00v17_151_c1_26472_27233 252
1188 3300050491 nmdc:mga00v17_25914_c1 nmdc:mga00v17_25914_c1_859_1620 252
1189 3300050493 nmdc:mga0k408_282485_c1 nmdc:mga0k408_282485_c1_62_832 252
1190 3300050494 nmdc:mga06z11_46516_c1 nmdc:mga06z11_46516_c1_708_1469 252
1191 3300050494 nmdc:mga06z11_6588_c1 nmdc:mga06z11_6588_c1_2330_3091 252
1192 3300050496 nmdc:mga07m45_88205_c1 nmdc:mga07m45_88205_c1_635_1405 252
1193 3300050516 nmdc:mga0sz30_107341_c1 nmdc:mga0sz30_107341_c1_177_938 252
1194 3300050516 nmdc:mga0sz30_107_c1 nmdc:mga0sz30_107_c1_15945_16706 252
1195 3300053079 Ga0500610_0012502 Ga0500610_0012502_1710_2471 252
1196 3300053088 Ga0500644_0036300 Ga0500644_0036300_91_861 252
1197 3300053118 Ga0500594_0007425 Ga0500594_0007425_464_1225 252
1198 3300053136 Ga0500559_0003675 Ga0500559_0003675_2997_3779 252
1199 3300053136 Ga0500559_0117563 Ga0500559_0117563_19_792 252
1200 3300053137 Ga0500561_0001013 Ga0500561_0001013_1010_1771 252
1201 3300053139 Ga0500568_0000048 Ga0500568_0000048_113763_114557 252
1202 3300053139 Ga0500568_0051067 Ga0500568_0051067_710_1471 252
1203 3300053139 Ga0500568_0070787 Ga0500568_0070787_36_800 252
1204 3300053140 Ga0500573_0000334 Ga0500573_0000334_3360_4127 252
1205 3300053156 Ga0500622_0003318 Ga0500622_0003318_7125_7886 252
1206 3300053156 Ga0500622_0003847 Ga0500622_0003847_877_1647 252
1207 3300053157 Ga0500624_004755 Ga0500624_004755_236_997 252
1208 3300053160 Ga0500633_0012605 Ga0500633_0012605_1433_2194 252
1209 3300053177 Ga0500636_0000040 Ga0500636_0000040_14665_15435 252
1210 3300053177 Ga0500636_0074565 Ga0500636_0074565_323_1105 252
1211 3300060353 Ga0501082_0087550 Ga0501082_0087550_1633_2394 252
1212 iso_pu_bacteria 2585427528 2585540763 252
1213 iso_pu_bacteria 2585427593 2585839033 252
1214 iso_pu_bacteria 2738541333 2739037260 252
1215 iso_pu_bacteria 2802429633 2806047351 252
1216 iso_pu_bacteria 2802429634 2806054206 252
1217 iso_pu_bacteria 2802429635 2806060210 252
1218 iso_pu_bacteria 2802429636 2806068821 252
1219 iso_pu_bacteria 2802429637 2806076427 252
1220 iso_pu_bacteria 8005497431 8005497657 252
1221 iso_pu_bacteria 8005570704 8005571827 252
1222 iso_pu_bacteria 8005668836 8005669062 252

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01578

Cytochrom_C_asm

Cytochrome C assembly protein

61

239

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8698 13 232
7f02-assembly1.cif.gz_C cytochrome c-type biogenesis protein ccmabcd from e. coli 0.8201 13 232
6ot4-assembly1.cif.gz_A bimetallic dodecameric cage design 2 (bmc2) from cytochrome cb562 0.6049 64 166
8sjf-assembly1.cif.gz_A apo structure of computationally designed homotrimer tet4 0.5991 67 167
3m4c-assembly1.cif.gz_C a zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase 0.5953 64 167
ID Description Score Start End Superfamily
af_A4I9Q4_9_159_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7353 50 149 1.20.140.150
af_Q45RH2_55_171_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6789 60 170 1.20.140.150
af_Q08CE6_110_279_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6406 60 145 1.20.140.150
af_Q99598_187_272_1.20.58.200 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Translin; domain 2 0.61 60 158 1.20.58.200
1xzqA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);tRNA modification GTPase MnmE domain 2 0.6087 66 168 1.20.120.430
ID Description Score Start End GO Terms
AF-A0A7W0W9W9-F1-model_v4 Heme exporter protein C 0.9137 30 175 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A6I1JNI9-F1-model_v4 Heme exporter protein C 0.9116 9 164 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A348ZI84-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein CcmC) 0.9113 49 172 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-T0YZH0-F1-model_v4 Cytochrome c assembly protein 0.9069 13 170 GO:0005886
GO:0015232
GO:0017004
GO:0020037
AF-A0A724V1H0-F1-model_v4 Heme exporter protein C (Cytochrome c-type biogenesis protein) 0.9021 49 173 GO:0005886
GO:0015232
GO:0017004
GO:0020037

Feature Viewer

pLDDT pTM Quality
83.59 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map