F491878
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1222 | 1002 | 447 | 252 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2937822353|2937825694 |
| Length | 300 |
| Sequence | PGNANASLRWNHPSSVSALSRRSTFSHKGRRKNCDNRSIAQQPPPVYLDRMSDTSSRLTGWTDLANPTRFVGLADRLVPWLASVAAILLAVGLYMSFAAPEDFQQGITVRIMYIHVPFAWLAMMCYTVMAVAALGTLVWRHPLADVALKSAAPIGATFTALALITGSIWGKPMWGTWWVWDARLTSVFVLFLMYLGIIALTRALDDASRAAWAAAIITLVGFINIPIIKFSVDWWNTLHQPASVFRLGGPTIDPSLLWPLLVMALGFTVLFFALHLTAMRTEIRRRRVIAMRRVAARQAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 5 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 6 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 7 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 8 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 9 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 10 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 11 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 12 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 13 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 14 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 15 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 16 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 17 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 18 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 19 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 20 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 21 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 22 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 23 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 24 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 25 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 26 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 27 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 28 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 29 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 30 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 31 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 32 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 33 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 34 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 35 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 36 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 37 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 38 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 39 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 40 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 41 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 42 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 43 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 44 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 45 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 46 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 47 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 48 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 49 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 50 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 51 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 52 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 53 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 54 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 55 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 56 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 57 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 58 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 59 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 60 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 61 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 62 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 63 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 64 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 65 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 66 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 67 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 68 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 69 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 70 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 71 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 72 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 73 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 74 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 75 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 76 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 77 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 78 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 79 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 80 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 81 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 82 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 83 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 84 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 85 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 86 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 87 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 88 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 89 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 90 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 91 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 92 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 93 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 94 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 95 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 96 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 97 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 98 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 99 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 100 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 101 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 102 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 103 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 104 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 105 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 106 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 107 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 108 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 109 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 110 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 111 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 112 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 113 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 114 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 115 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 116 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 117 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 118 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 119 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 120 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 121 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 122 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 123 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 124 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 125 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 126 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 127 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 128 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 129 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 130 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 131 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 132 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 133 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 134 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 135 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 136 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 137 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 138 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 139 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 140 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 141 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 142 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 143 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 144 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 145 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 146 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 147 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 148 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 149 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 150 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 151 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 152 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 153 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 154 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 155 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 156 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 157 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 158 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 159 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 160 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 161 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 162 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 163 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 164 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 165 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 166 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 167 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 168 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 169 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 170 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 171 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 172 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 173 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 174 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 175 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 176 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 177 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 178 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 179 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 180 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 181 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 182 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 183 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 184 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 185 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 186 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 187 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 188 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 189 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 190 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 191 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 192 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 193 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 194 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 195 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 196 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 197 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 198 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 199 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 200 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 201 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 202 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 203 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 204 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 205 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 206 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 207 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 208 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 209 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 210 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 211 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 212 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 213 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 214 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 215 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 216 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 217 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 218 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 219 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 220 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 221 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 222 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 223 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 224 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 225 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 226 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 227 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 228 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 229 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 230 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 231 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 232 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 233 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 234 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 235 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 236 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 237 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 238 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 239 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 240 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 241 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 242 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 243 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 244 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 245 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 246 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 247 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 248 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 249 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 250 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 251 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 252 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 253 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 254 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 255 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 256 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 257 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 258 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 259 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 260 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 261 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 262 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 263 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 264 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 265 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 266 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 267 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 268 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 269 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 270 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 271 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 272 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 273 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 274 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 275 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 276 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 277 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 278 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 279 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 280 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 281 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 282 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 283 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 284 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 285 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 286 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 287 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 288 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 289 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 290 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 291 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 292 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 293 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 294 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 295 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 296 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 297 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 298 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 299 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 300 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 301 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 302 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 303 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 304 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 305 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 306 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 307 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 308 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 309 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 310 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 311 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 312 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 313 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 314 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 315 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 316 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 317 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 318 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 319 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 320 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 321 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 322 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 323 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 324 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 325 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 326 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 327 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 328 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 329 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 330 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 331 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 332 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 333 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 334 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 335 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 336 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 337 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 338 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 339 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 340 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 341 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 342 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 343 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 344 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 345 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 346 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 347 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 348 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 349 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 350 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 351 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 352 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 353 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 354 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 355 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 356 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 357 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 358 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 359 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 360 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 361 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 362 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 363 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 364 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 365 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 366 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 367 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 368 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 369 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 370 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 371 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 372 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 373 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 374 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 375 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 376 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 377 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 378 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 379 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 380 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 381 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 382 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 383 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 384 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 385 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 386 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 387 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 388 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 389 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 390 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 391 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 392 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 393 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 394 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 395 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 396 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 397 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 398 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 399 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 400 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 401 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 402 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 403 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 404 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 405 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 406 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 407 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 408 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 409 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 410 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 411 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 412 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 413 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 414 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 415 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 416 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 417 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 418 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 419 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 420 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 421 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 422 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 423 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 424 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 425 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 426 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 427 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 428 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 429 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 430 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 431 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 432 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 433 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 434 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 435 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 436 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 437 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 438 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 439 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 440 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 441 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 442 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 443 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 444 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 445 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 446 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 447 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 448 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 449 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 450 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 451 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 452 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 453 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 454 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 455 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 456 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 457 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 458 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 459 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 460 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 461 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 462 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 463 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 464 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 465 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 466 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 467 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 468 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 469 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 470 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 471 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 472 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 473 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 474 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 475 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 476 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 477 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 478 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 479 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 480 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 481 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 482 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 483 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 484 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 485 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 486 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 487 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 488 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 489 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 490 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 491 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 492 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 493 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 494 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 495 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 496 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 497 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 498 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 499 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 500 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 501 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 502 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 503 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 504 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 505 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 506 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 507 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 508 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 509 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 510 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 511 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 512 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 513 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 514 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 515 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 516 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 517 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 518 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 519 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 520 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 521 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 522 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 523 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 524 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 525 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 526 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 527 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 528 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 529 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 530 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 531 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 532 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 533 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 534 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 535 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 536 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 537 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 538 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 539 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 540 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 541 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 542 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 543 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 544 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 545 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 546 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 547 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 548 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 549 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 550 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 551 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 552 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 553 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 554 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 555 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 556 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 557 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 558 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 559 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 560 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 561 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 562 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 563 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 564 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 565 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 566 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 567 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 568 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 569 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 570 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 571 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 572 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 573 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 574 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 575 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 576 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 577 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 578 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 579 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 580 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 581 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 582 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 583 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 584 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 585 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 586 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 587 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 588 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 589 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 590 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 591 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 592 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 593 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 594 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 595 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 596 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 597 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 598 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 599 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 600 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 601 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 602 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 603 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 604 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 605 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 606 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 607 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 608 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 609 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 610 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 611 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 612 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 613 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 614 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 615 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 616 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 617 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 618 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 619 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 620 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 621 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 622 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 623 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 624 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 625 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 626 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 627 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 628 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 629 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 630 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 631 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 632 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 633 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 634 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 635 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 636 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 637 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 638 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 639 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 640 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 641 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 642 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 643 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 644 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 645 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 646 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 647 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 648 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 649 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 650 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 651 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 652 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 653 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 654 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 655 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 656 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 657 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 658 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 659 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 660 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 661 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 662 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 663 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 664 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 665 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 666 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 667 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 668 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 669 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 670 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 671 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 672 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 673 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 674 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 675 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 676 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 677 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 678 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 679 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 680 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 681 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 682 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 683 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 684 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 685 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 686 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 687 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 688 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 689 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 690 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 691 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 692 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 693 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 694 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 695 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 696 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 697 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 698 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 699 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 700 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 701 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 702 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 703 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 704 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 705 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 706 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 707 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 708 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 709 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 710 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 711 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 712 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 713 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 714 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 715 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 716 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 717 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 718 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 719 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 720 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 721 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 722 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 723 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 724 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 725 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 726 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 727 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 728 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 729 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 730 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 731 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 732 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 733 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 734 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 735 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 736 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 737 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 738 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 739 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 740 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 741 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 742 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 743 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 744 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 745 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 746 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 747 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 748 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 749 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 750 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 751 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 752 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 753 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 754 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 755 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 756 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 757 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 758 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 759 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 760 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 761 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 762 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 763 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 764 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 765 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 766 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 767 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 768 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 769 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 770 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 771 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 772 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 773 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 774 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 775 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 776 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 777 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 778 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 779 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 780 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 781 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 782 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 783 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 784 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 785 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 786 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 787 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 788 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 789 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 790 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 791 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 792 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 793 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 794 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 795 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 796 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 797 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 798 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 799 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 800 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 801 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 802 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 803 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 804 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 805 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 806 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 807 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 808 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 809 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 810 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 811 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 812 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 813 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 814 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 815 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 816 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 817 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 818 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 819 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 820 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 821 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 822 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 823 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 824 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 825 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 826 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 827 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 828 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 829 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 830 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 831 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 832 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 833 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 834 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 835 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 836 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 837 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 838 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 839 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 840 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 841 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 842 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 843 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 844 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 845 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 846 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 847 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 848 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 849 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 850 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 851 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 852 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 853 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 854 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 855 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 856 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 857 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 858 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 859 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 860 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 861 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 862 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 863 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 864 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 865 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 866 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 867 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 868 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 869 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 870 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 871 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 872 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 873 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 874 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 875 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 876 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 877 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 878 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 879 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 880 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 881 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 882 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 883 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 884 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 885 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 886 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 887 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 888 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 889 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 890 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 891 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 892 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 893 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 894 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 895 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 896 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 897 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 898 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 899 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 900 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 901 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 902 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 903 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 904 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 905 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 906 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 907 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 908 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 909 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 910 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 911 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 912 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 913 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 914 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 915 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 916 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 917 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 918 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 919 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 920 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 921 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 922 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 923 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 924 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 925 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 926 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 927 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 928 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 929 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 930 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 931 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 932 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 933 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 934 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 935 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 936 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 937 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 938 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 939 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 940 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 941 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 942 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 943 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 944 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 945 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 946 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 947 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 948 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 949 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 950 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 951 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 952 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 953 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 954 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 955 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 956 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 957 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 958 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 959 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 960 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 961 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 962 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 963 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 964 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 965 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 966 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 967 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 968 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 969 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 970 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 971 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 972 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 973 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 974 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 975 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 976 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 977 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 978 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 979 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 980 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 981 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 982 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 983 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 984 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 985 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 986 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 987 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 988 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 989 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 990 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 991 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 992 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 993 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 994 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 995 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 996 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 997 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 998 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 999 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1000 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1001 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1002 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 36.17 |
| Metatranscriptomes | 0.49 |
| Isolates | 63.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.41 |
| Bulb | 0 |
| Endosphere | 12.77 |
| Nodule | 49.59 |
| Rhizoplane | 1.23 |
| Rhizosphere | 18.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000013 | 3300001979 | Bacteria | 62177 |
| 2 | JGI24739J22299_10061530 | 3300001989 | Bacteria | 1185 |
| 3 | JGI25155J39150_1000010 | 3300002704 | Bacteria | 207717 |
| 4 | JGI25156J39149_1000102 | 3300002705 | Bacteria | 62463 |
| 5 | JGI25162J39368_1002243 | 3300002737 | Bacteria | 7888 |
| 6 | JGI25154J39366_1000096 | 3300002738 | Bacteria | 79168 |
| 7 | JGI25158J39367_1000116 | 3300002739 | Bacteria | 18332 |
| 8 | JGI25158J39367_1014000 | 3300002739 | Bacteria | 1041 |
| 9 | JGI25157J39369_1000009 | 3300002741 | Bacteria | 207868 |
| 10 | JGI25152J39213_1002679 | 3300002773 | Bacteria | 6558 |
| 11 | JGI25152J39213_1007127 | 3300002773 | Bacteria | 2934 |
| 12 | JGI25152J39213_1015884 | 3300002773 | Bacteria | 1471 |
| 13 | JGI25150J39212_1000037 | 3300002774 | Bacteria | 88885 |
| 14 | JGI25159J45721_1002450 | 3300002987 | Bacteria | 7046 |
| 15 | JGI25151J46595_10000220 | 3300003187 | Bacteria | 67327 |
| 16 | JGI25151J46595_10011616 | 3300003187 | Bacteria | 4041 |
| 17 | JGI25151J46595_10013759 | 3300003187 | Bacteria | 3630 |
| 18 | JGI25165J46597_1000070 | 3300003214 | Bacteria | 193557 |
| 19 | JGI25165J46597_1001449 | 3300003214 | Bacteria | 12524 |
| 20 | JGI25153J46596_10007468 | 3300003215 | Bacteria | 5371 |
| 21 | JGI25153J46596_10039259 | 3300003215 | Bacteria | 1481 |
| 22 | rootL2_10053278 | 3300003322 | Bacteria | 3771 |
| 23 | JGI25160J50197_1000027 | 3300003354 | Bacteria | 182809 |
| 24 | JGI25161J50226_1000327 | 3300003374 | Bacteria | 25949 |
| 25 | JGI25161J50226_1000501 | 3300003374 | Bacteria | 17353 |
| 26 | Ga0006562J51391_1011280 | 3300003578 | Bacteria | 1090 |
| 27 | Ga0006562J51391_1037909 | 3300003578 | Bacteria | 2120 |
| 28 | Ga0055526_1001473 | 3300003771 | Bacteria | 16693 |
| 29 | Ga0055526_1008010 | 3300003771 | Bacteria | 5352 |
| 30 | Ga0055526_1016809 | 3300003771 | Bacteria | 2835 |
| 31 | Ga0055526_1038822 | 3300003771 | Bacteria | 1221 |
| 32 | Ga0055524_1002650 | 3300003775 | Bacteria | 9086 |
| 33 | Ga0055524_1004200 | 3300003775 | Bacteria | 6711 |
| 34 | Ga0055524_1014167 | 3300003775 | Bacteria | 2970 |
| 35 | Ga0055524_1021291 | 3300003775 | Bacteria | 2154 |
| 36 | Ga0055536_1001323 | 3300003781 | Bacteria | 15170 |
| 37 | Ga0055528_1000099 | 3300003790 | Bacteria | 68463 |
| 38 | Ga0055528_1003479 | 3300003790 | Bacteria | 7866 |
| 39 | Ga0055528_1003641 | 3300003790 | Bacteria | 7651 |
| 40 | Ga0055530_10043447 | 3300003791 | Bacteria | 1083 |
| 41 | Ga0055540_1009091 | 3300003792 | Bacteria | 3483 |
| 42 | Ga0055531_10004054 | 3300003794 | Bacteria | 9079 |
| 43 | Ga0058692_1004143 | 3300003856 | Bacteria | 4342 |
| 44 | Ga0058692_1006819 | 3300003856 | Bacteria | 3085 |
| 45 | Ga0055543_1000030 | 3300004625 | Bacteria | 130849 |
| 46 | Ga0055543_1000062 | 3300004625 | Bacteria | 98034 |
| 47 | Ga0065165_1000122 | 3300005262 | Bacteria | 132524 |
| 48 | Ga0065165_1009930 | 3300005262 | Bacteria | 4192 |
| 49 | Ga0065165_1020897 | 3300005262 | Bacteria | 2288 |
| 50 | Ga0070670_100000116 | 3300005331 | Bacteria | 74586 |
| 51 | Ga0070668_100073821 | 3300005347 | Bacteria | 2660 |
| 52 | Ga0070669_100071728 | 3300005353 | Bacteria | 2563 |
| 53 | Ga0070669_100423593 | 3300005353 | Bacteria | 1093 |
| 54 | Ga0070671_100057902 | 3300005355 | Bacteria | 3225 |
| 55 | Ga0070667_100305966 | 3300005367 | Bacteria | 1432 |
| 56 | Ga0070678_100334366 | 3300005456 | Bacteria | 1297 |
| 57 | Ga0070665_100004011 | 3300005548 | Bacteria | 15524 |
| 58 | Ga0070665_100036324 | 3300005548 | Bacteria | 4957 |
| 59 | Ga0070665_100043495 | 3300005548 | Bacteria | 4514 |
| 60 | Ga0070665_100483703 | 3300005548 | Bacteria | 1249 |
| 61 | Ga0068852_100143657 | 3300005616 | Bacteria | 2211 |
| 62 | Ga0068852_100326072 | 3300005616 | Bacteria | 1492 |
| 63 | Ga0068851_10117485 | 3300005834 | Bacteria | 1426 |
| 64 | Ga0068862_100544907 | 3300005844 | Bacteria | 1107 |
| 65 | Ga0081539_10002530 | 3300005985 | Bacteria | 25517 |
| 66 | Ga0075365_10000498 | 3300006038 | Bacteria | 14945 |
| 67 | Ga0075365_10034493 | 3300006038 | Bacteria | 3268 |
| 68 | Ga0075365_10093998 | 3300006038 | Bacteria | 2046 |
| 69 | Ga0075365_10095323 | 3300006038 | Bacteria | 2032 |
| 70 | Ga0075365_10232525 | 3300006038 | Bacteria | 1294 |
| 71 | Ga0075368_10003863 | 3300006042 | Bacteria | 5041 |
| 72 | Ga0075363_100031175 | 3300006048 | Bacteria | 2763 |
| 73 | Ga0075363_100080411 | 3300006048 | Bacteria | 1782 |
| 74 | Ga0075364_10000026 | 3300006051 | Bacteria | 51217 |
| 75 | Ga0075362_10021353 | 3300006177 | Bacteria | 2715 |
| 76 | Ga0075362_10022878 | 3300006177 | Bacteria | 2637 |
| 77 | Ga0075367_10004009 | 3300006178 | Bacteria | 7117 |
| 78 | Ga0075367_10004494 | 3300006178 | Bacteria | 6818 |
| 79 | Ga0075367_10040098 | 3300006178 | Bacteria | 2733 |
| 80 | Ga0075367_10087255 | 3300006178 | Bacteria | 1895 |
| 81 | Ga0075367_10134531 | 3300006178 | Bacteria | 1529 |
| 82 | Ga0075369_10002071 | 3300006186 | Bacteria | 7079 |
| 83 | Ga0075369_10091960 | 3300006186 | Bacteria | 1355 |
| 84 | Ga0075369_10128867 | 3300006186 | Bacteria | 1148 |
| 85 | Ga0075369_10217669 | 3300006186 | Bacteria | 884 |
| 86 | Ga0075370_10025818 | 3300006353 | Bacteria | 3251 |
| 87 | Ga0079104_1000195 | 3300006946 | Bacteria | 85244 |
| 88 | Ga0079104_1014561 | 3300006946 | Bacteria | 2367 |
| 89 | Ga0099826_10000958 | 3300006948 | Bacteria | 16050 |
| 90 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 91 | Ga0105243_10005164 | 3300009148 | Bacteria | 10226 |
| 92 | Ga0105237_10012810 | 3300009545 | Bacteria | 8820 |
| 93 | Ga0105237_10016781 | 3300009545 | Bacteria | 7602 |
| 94 | Ga0105238_10011895 | 3300009551 | Bacteria | 8767 |
| 95 | Ga0123341_1000009 | 3300009765 | Bacteria | 122597 |
| 96 | Ga0123341_1023081 | 3300009765 | Bacteria | 5142 |
| 97 | Ga0123342_1009724 | 3300009766 | Bacteria | 11342 |
| 98 | Ga0123342_1037770 | 3300009766 | Bacteria | 1918 |
| 99 | Ga0105239_10000820 | 3300010375 | Bacteria | 44190 |
| 100 | Ga0157373_10094150 | 3300013100 | Bacteria | 2109 |
| 101 | Ga0157371_10000108 | 3300013102 | Bacteria | 126288 |
| 102 | Ga0157371_10009815 | 3300013102 | Bacteria | 7505 |
| 103 | Ga0157370_10004961 | 3300013104 | Bacteria | 15062 |
| 104 | Ga0157370_10005427 | 3300013104 | Bacteria | 14303 |
| 105 | Ga0157370_10330905 | 3300013104 | Bacteria | 1405 |
| 106 | Ga0157369_10032455 | 3300013105 | Bacteria | 5742 |
| 107 | Ga0157369_10352336 | 3300013105 | Bacteria | 1529 |
| 108 | Ga0171463_1004 | 3300013249 | Bacteria | 437207 |
| 109 | Ga0157378_10914981 | 3300013297 | Bacteria | 908 |
| 110 | Ga0182007_10002575 | 3300015262 | Bacteria | 8925 |
| 111 | Ga0182005_1004658 | 3300015265 | Bacteria | 4386 |
| 112 | Ga0183363_1019 | 3300015690 | Bacteria | 61083 |
| 113 | Ga0206352_10368268 | 3300020078 | Bacteria | 1524 |
| 114 | Ga0206353_10130919 | 3300020082 | Bacteria | 1365 |
| 115 | Ga0214544_1000288 | 3300021320 | Bacteria | 85073 |
| 116 | Ga0214542_1000008 | 3300021321 | Bacteria | 278895 |
| 117 | Ga0214543_1000015 | 3300021327 | Bacteria | 305679 |
| 118 | Ga0214543_1000031 | 3300021327 | Bacteria | 206436 |
| 119 | Ga0213874_10104565 | 3300021377 | Bacteria | 945 |
| 120 | Ga0228711_1000004 | 3300022739 | Bacteria | 250146 |
| 121 | Ga0228710_1000002 | 3300022740 | Bacteria | 287279 |
| 122 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 123 | Ga0209436_100018 | 3300025208 | Bacteria | 113499 |
| 124 | Ga0209436_100664 | 3300025208 | Bacteria | 14651 |
| 125 | Ga0209436_107083 | 3300025208 | Bacteria | 2386 |
| 126 | Ga0209672_103233 | 3300025228 | Bacteria | 3465 |
| 127 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 128 | Ga0207425_1000034 | 3300025245 | Bacteria | 227886 |
| 129 | Ga0207425_1002143 | 3300025245 | Bacteria | 7234 |
| 130 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 131 | Ga0209646_1003848 | 3300025246 | Bacteria | 2865 |
| 132 | Ga0209026_1000068 | 3300025250 | Bacteria | 207601 |
| 133 | Ga0209677_100199 | 3300025253 | Bacteria | 48030 |
| 134 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 135 | Ga0209129_1000118 | 3300025258 | Bacteria | 139972 |
| 136 | Ga0209129_1000253 | 3300025258 | Bacteria | 55709 |
| 137 | Ga0209129_1000971 | 3300025258 | Bacteria | 17232 |
| 138 | Ga0209129_1003196 | 3300025258 | Bacteria | 7326 |
| 139 | Ga0209129_1003252 | 3300025258 | Bacteria | 7210 |
| 140 | Ga0209129_1004160 | 3300025258 | Bacteria | 5843 |
| 141 | Ga0209233_1000130 | 3300025261 | Bacteria | 205687 |
| 142 | Ga0209233_1000131 | 3300025261 | Bacteria | 205257 |
| 143 | Ga0209233_1006961 | 3300025261 | Bacteria | 3613 |
| 144 | Ga0209455_1011173 | 3300025272 | Bacteria | 2229 |
| 145 | Ga0209673_1000033 | 3300025273 | Bacteria | 335369 |
| 146 | Ga0209673_1004625 | 3300025273 | Bacteria | 7285 |
| 147 | Ga0209673_1005860 | 3300025273 | Bacteria | 6081 |
| 148 | Ga0209673_1037398 | 3300025273 | Bacteria | 1427 |
| 149 | Ga0209130_1000009 | 3300025284 | Bacteria | 498952 |
| 150 | Ga0209130_1000027 | 3300025284 | Bacteria | 327700 |
| 151 | Ga0209676_1000406 | 3300025292 | Bacteria | 77603 |
| 152 | Ga0209025_1000042 | 3300025294 | Bacteria | 370577 |
| 153 | Ga0209025_1000241 | 3300025294 | Bacteria | 128329 |
| 154 | Ga0209025_1000487 | 3300025294 | Bacteria | 76541 |
| 155 | Ga0209025_1000533 | 3300025294 | Bacteria | 72404 |
| 156 | Ga0209025_1002217 | 3300025294 | Bacteria | 21448 |
| 157 | Ga0209564_1000111 | 3300025295 | Bacteria | 212210 |
| 158 | Ga0209564_1000782 | 3300025295 | Bacteria | 44138 |
| 159 | Ga0209564_1016817 | 3300025295 | Bacteria | 2888 |
| 160 | Ga0209564_1024253 | 3300025295 | Bacteria | 2077 |
| 161 | Ga0209758_1000415 | 3300025297 | Bacteria | 72404 |
| 162 | Ga0209758_1000570 | 3300025297 | Bacteria | 57866 |
| 163 | Ga0209758_1001085 | 3300025297 | Bacteria | 35309 |
| 164 | Ga0209758_1001086 | 3300025297 | Bacteria | 35300 |
| 165 | Ga0209758_1002520 | 3300025297 | Bacteria | 18534 |
| 166 | Ga0209758_1014230 | 3300025297 | Bacteria | 4252 |
| 167 | Ga0209758_1015745 | 3300025297 | Bacteria | 3893 |
| 168 | Ga0209758_1033127 | 3300025297 | Bacteria | 2083 |
| 169 | Ga0209758_1081103 | 3300025297 | Bacteria | 981 |
| 170 | Ga0209050_1000572 | 3300025298 | Bacteria | 59716 |
| 171 | Ga0209050_1004558 | 3300025298 | Bacteria | 9300 |
| 172 | Ga0209256_1003544 | 3300025299 | Bacteria | 10827 |
| 173 | Ga0209256_1003766 | 3300025299 | Bacteria | 10227 |
| 174 | Ga0209256_1007283 | 3300025299 | Bacteria | 5513 |
| 175 | Ga0209256_1016905 | 3300025299 | Bacteria | 2456 |
| 176 | Ga0207426_1000041 | 3300025302 | Bacteria | 433536 |
| 177 | Ga0207426_1000072 | 3300025302 | Bacteria | 327700 |
| 178 | Ga0207426_1001232 | 3300025302 | Bacteria | 22539 |
| 179 | Ga0209051_1001068 | 3300025303 | Bacteria | 25445 |
| 180 | Ga0209051_1005359 | 3300025303 | Bacteria | 7531 |
| 181 | Ga0209051_1006368 | 3300025303 | Bacteria | 6674 |
| 182 | Ga0209051_1009487 | 3300025303 | Bacteria | 5011 |
| 183 | Ga0209257_1007840 | 3300025304 | Bacteria | 6305 |
| 184 | Ga0207647_10341561 | 3300025904 | Bacteria | 848 |
| 185 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 186 | Ga0207671_10000400 | 3300025914 | Bacteria | 60604 |
| 187 | Ga0207681_10336655 | 3300025923 | Bacteria | 1204 |
| 188 | Ga0207681_10465700 | 3300025923 | Bacteria | 1030 |
| 189 | Ga0207694_10019075 | 3300025924 | Bacteria | 5183 |
| 190 | Ga0207650_10000691 | 3300025925 | Bacteria | 26420 |
| 191 | Ga0207668_10599635 | 3300025972 | Bacteria | 959 |
| 192 | Ga0207639_10030702 | 3300026041 | Bacteria | 3943 |
| 193 | Ga0207678_10157915 | 3300026067 | Bacteria | 1937 |
| 194 | Ga0207678_10555784 | 3300026067 | Bacteria | 1004 |
| 195 | Ga0207648_10598053 | 3300026089 | Bacteria | 1016 |
| 196 | Ga0207698_10148018 | 3300026142 | Bacteria | 2034 |
| 197 | Ga0209281_1000028 | 3300027111 | Bacteria | 440027 |
| 198 | Ga0209281_1000030 | 3300027111 | Bacteria | 425931 |
| 199 | Ga0209281_1000144 | 3300027111 | Bacteria | 172471 |
| 200 | Ga0209371_1000037 | 3300027312 | Bacteria | 367074 |
| 201 | Ga0209371_1003285 | 3300027312 | Bacteria | 8011 |
| 202 | Ga0209282_1000004 | 3300027666 | Bacteria | 425931 |
| 203 | Ga0209282_1003026 | 3300027666 | Bacteria | 9890 |
| 204 | Ga0209813_10008558 | 3300027866 | Bacteria | 2590 |
| 205 | Ga0268266_10004208 | 3300028379 | Bacteria | 13852 |
| 206 | Ga0268266_10006277 | 3300028379 | Bacteria | 10907 |
| 207 | Ga0268266_10452834 | 3300028379 | Bacteria | 1220 |
| 208 | Ga0268266_10733278 | 3300028379 | Bacteria | 953 |
| 209 | Ga0268265_10527461 | 3300028380 | Bacteria | 1117 |
| 210 | Ga0307515_10001330 | 3300028794 | Bacteria | 55993 |
| 211 | Ga0307515_10040955 | 3300028794 | Bacteria | 7305 |
| 212 | Ga0307515_10324407 | 3300028794 | Bacteria | 1203 |
| 213 | Ga0268256_1000039 | 3300030500 | Bacteria | 354969 |
| 214 | Ga0268256_1003721 | 3300030500 | Bacteria | 6713 |
| 215 | Ga0268256_1006192 | 3300030500 | Bacteria | 4501 |
| 216 | Ga0307513_10005665 | 3300031456 | Bacteria | 16445 |
| 217 | Ga0307408_100133551 | 3300031548 | Bacteria | 1939 |
| 218 | Ga0307508_10188191 | 3300031616 | Bacteria | 1666 |
| 219 | Ga0307405_10014073 | 3300031731 | Bacteria | 4290 |
| 220 | Ga0307410_10220262 | 3300031852 | Bacteria | 1460 |
| 221 | Ga0307406_10019368 | 3300031901 | Bacteria | 3992 |
| 222 | Ga0307412_10005736 | 3300031911 | Bacteria | 6978 |
| 223 | Ga0315914_1000001 | 3300031967 | Bacteria | 416633 |
| 224 | Ga0307409_100018253 | 3300031995 | Bacteria | 4709 |
| 225 | Ga0307409_100603870 | 3300031995 | Bacteria | 1085 |
| 226 | Ga0307414_10092769 | 3300032004 | Bacteria | 2249 |
| 227 | Ga0315913_1000004 | 3300033430 | Bacteria | 192741 |
| 228 | Ga0315915_1000002 | 3300033464 | Bacteria | 425854 |
| 229 | Ga0316582_0101645 | 3300036647 | Bacteria | 1905 |
| 230 | Ga0395899_0075980 | 3300037312 | Bacteria | 2453 |
| 231 | Ga0395900_0000027 | 3300037418 | Bacteria | 285957 |
| 232 | Ga0395900_0089901 | 3300037418 | Bacteria | 3156 |
| 233 | Ga0395900_0108539 | 3300037418 | Bacteria | 2851 |
| 234 | Ga0395900_0804429 | 3300037418 | Bacteria | 868 |
| 235 | Ga0395898_0000255 | 3300037466 | Bacteria | 131017 |
| 236 | Ga0395905_0000032 | 3300037471 | Bacteria | 285932 |
| 237 | Ga0395905_0001780 | 3300037471 | Bacteria | 24999 |
| 238 | Ga0395905_0008738 | 3300037471 | Bacteria | 9964 |
| 239 | Ga0395905_0021304 | 3300037471 | Bacteria | 6132 |
| 240 | Ga0395905_0424658 | 3300037471 | Bacteria | 1226 |
| 241 | Ga0395901_0000110 | 3300038443 | Bacteria | 112682 |
| 242 | Ga0395901_0073195 | 3300038443 | Bacteria | 3573 |
| 243 | Ga0395901_0171280 | 3300038443 | Bacteria | 2278 |
| 244 | Ga0400488_35929 | 3300038741 | Bacteria | 1343 |
| 245 | Ga0436363_0703352 | 3300039450 | Bacteria | 945 |
| 246 | Ga0439436_0025270 | 3300041404 | Bacteria | 1745 |
| 247 | Ga0439436_0029222 | 3300041404 | Bacteria | 1606 |
| 248 | Ga0439465_0025792 | 3300041413 | Bacteria | 1856 |
| 249 | Ga0439465_0035904 | 3300041413 | Bacteria | 1590 |
| 250 | Ga0451837_0421092 | 3300041494 | Bacteria | 1456 |
| 251 | Ga0451839_0198282 | 3300041496 | Bacteria | 2420 |
| 252 | Ga0439449_0001259 | 3300042007 | Bacteria | 9917 |
| 253 | Ga0439449_0011037 | 3300042007 | Bacteria | 3407 |
| 254 | Ga0450909_002914 | 3300042185 | Bacteria | 2430 |
| 255 | Ga0466960_0033427 | 3300044901 | Bacteria | 2390 |
| 256 | Ga0495629_0012949 | 3300046459 | Bacteria | 6032 |
| 257 | Ga0495638_0003269 | 3300046460 | Bacteria | 12786 |
| 258 | Ga0495638_0026140 | 3300046460 | Bacteria | 3787 |
| 259 | Ga0495638_0209005 | 3300046460 | Bacteria | 1097 |
| 260 | Ga0495605_0002525 | 3300046474 | Bacteria | 11283 |
| 261 | Ga0495662_0002948 | 3300046476 | Bacteria | 8590 |
| 262 | Ga0495585_0027948 | 3300046492 | Bacteria | 3219 |
| 263 | Ga0495585_0092034 | 3300046492 | Bacteria | 1632 |
| 264 | Ga0495610_0172230 | 3300046512 | Bacteria | 907 |
| 265 | Ga0495616_0020903 | 3300046513 | Bacteria | 3554 |
| 266 | Ga0495620_0051274 | 3300046515 | Bacteria | 1757 |
| 267 | Ga0495631_0002242 | 3300046518 | Bacteria | 11099 |
| 268 | Ga0495632_0009845 | 3300046519 | Bacteria | 5718 |
| 269 | Ga0495632_0018201 | 3300046519 | Bacteria | 3860 |
| 270 | Ga0495643_0009187 | 3300046522 | Bacteria | 6169 |
| 271 | Ga0495654_0005406 | 3300046530 | Bacteria | 7421 |
| 272 | Ga0495587_0043343 | 3300046536 | Bacteria | 2680 |
| 273 | Ga0495609_0025182 | 3300046538 | Bacteria | 2729 |
| 274 | Ga0495597_0078539 | 3300046542 | Bacteria | 1414 |
| 275 | Ga0495633_0017477 | 3300046558 | Bacteria | 3666 |
| 276 | Ga0495668_0006323 | 3300046616 | Bacteria | 7788 |
| 277 | Ga0495668_0033189 | 3300046616 | Bacteria | 2901 |
| 278 | Ga0495668_0130550 | 3300046616 | Bacteria | 1375 |
| 279 | Ga0495668_0206271 | 3300046616 | Bacteria | 1076 |
| 280 | Ga0495611_0010753 | 3300046648 | Bacteria | 3876 |
| 281 | Ga0495625_0004490 | 3300046660 | Bacteria | 13166 |
| 282 | Ga0495625_0089092 | 3300046660 | Bacteria | 2136 |
| 283 | Ga0495624_0162002 | 3300046690 | Bacteria | 1366 |
| 284 | Ga0495660_0159607 | 3300046810 | Bacteria | 1107 |
| 285 | Ga0495604_0030094 | 3300047317 | Bacteria | 4315 |
| 286 | Ga0495672_0050339 | 3300047320 | Bacteria | 2460 |
| 287 | Ga0495681_0004907 | 3300047470 | Bacteria | 9040 |
| 288 | Ga0495686_0015554 | 3300047472 | Bacteria | 5189 |
| 289 | Ga0496104_0059574 | 3300048907 | Bacteria | 3615 |
| 290 | Ga0496105_0097508 | 3300048908 | Bacteria | 2428 |
| 291 | Ga0496106_0004976 | 3300048909 | Bacteria | 9835 |
| 292 | Ga0496110_0153941 | 3300048913 | Bacteria | 2082 |
| 293 | Ga0496116_0000057 | 3300048919 | Bacteria | 281652 |
| 294 | Ga0496116_0005573 | 3300048919 | Bacteria | 11611 |
| 295 | Ga0496116_0025349 | 3300048919 | Bacteria | 4361 |
| 296 | Ga0496116_0028421 | 3300048919 | Bacteria | 4052 |
| 297 | Ga0496116_0052803 | 3300048919 | Bacteria | 2689 |
| 298 | Ga0496116_0055253 | 3300048919 | Bacteria | 2609 |
| 299 | Ga0496116_0073743 | 3300048919 | Bacteria | 2149 |
| 300 | Ga0496117_0000031 | 3300048920 | Bacteria | 381048 |
| 301 | Ga0496117_0002097 | 3300048920 | Bacteria | 26238 |
| 302 | Ga0496117_0032840 | 3300048920 | Bacteria | 3935 |
| 303 | Ga0496117_0053245 | 3300048920 | Bacteria | 2845 |
| 304 | Ga0496118_0000899 | 3300048921 | Bacteria | 46663 |
| 305 | Ga0496118_0002291 | 3300048921 | Bacteria | 26051 |
| 306 | Ga0496118_0035409 | 3300048921 | Bacteria | 4053 |
| 307 | Ga0496119_0000806 | 3300048922 | Bacteria | 41963 |
| 308 | Ga0496119_0006994 | 3300048922 | Bacteria | 10276 |
| 309 | Ga0496119_0011551 | 3300048922 | Bacteria | 7292 |
| 310 | Ga0496119_0021707 | 3300048922 | Bacteria | 4628 |
| 311 | Ga0496119_0068615 | 3300048922 | Bacteria | 2087 |
| 312 | Ga0496119_0086936 | 3300048922 | Bacteria | 1785 |
| 313 | Ga0496120_0000337 | 3300048923 | Bacteria | 78140 |
| 314 | Ga0496120_0006272 | 3300048923 | Bacteria | 9173 |
| 315 | Ga0496120_0011695 | 3300048923 | Bacteria | 6020 |
| 316 | Ga0496120_0018267 | 3300048923 | Bacteria | 4526 |
| 317 | Ga0496120_0038869 | 3300048923 | Bacteria | 2812 |
| 318 | Ga0496120_0041040 | 3300048923 | Bacteria | 2715 |
| 319 | Ga0496121_0000034 | 3300048924 | Bacteria | 377095 |
| 320 | Ga0496121_0005857 | 3300048924 | Bacteria | 15571 |
| 321 | Ga0496121_0017796 | 3300048924 | Bacteria | 7221 |
| 322 | Ga0496121_0018473 | 3300048924 | Bacteria | 7028 |
| 323 | Ga0496121_0026755 | 3300048924 | Bacteria | 5420 |
| 324 | Ga0496121_0027371 | 3300048924 | Bacteria | 5336 |
| 325 | Ga0496121_0032092 | 3300048924 | Bacteria | 4781 |
| 326 | Ga0496121_0038490 | 3300048924 | Bacteria | 4233 |
| 327 | Ga0496121_0378304 | 3300048924 | Bacteria | 934 |
| 328 | Ga0496122_0000023 | 3300048925 | Bacteria | 381035 |
| 329 | Ga0496122_0000286 | 3300048925 | Bacteria | 112940 |
| 330 | Ga0496122_0004227 | 3300048925 | Bacteria | 18047 |
| 331 | Ga0496122_0017308 | 3300048925 | Bacteria | 6750 |
| 332 | Ga0496122_0021693 | 3300048925 | Bacteria | 5738 |
| 333 | Ga0496122_0025165 | 3300048925 | Bacteria | 5180 |
| 334 | Ga0496122_0029168 | 3300048925 | Bacteria | 4660 |
| 335 | Ga0496122_0061075 | 3300048925 | Bacteria | 2769 |
| 336 | Ga0496122_0072613 | 3300048925 | Bacteria | 2445 |
| 337 | Ga0496122_0108551 | 3300048925 | Bacteria | 1830 |
| 338 | Ga0496123_0000027 | 3300048926 | Bacteria | 306773 |
| 339 | Ga0496123_0001238 | 3300048926 | Bacteria | 37104 |
| 340 | Ga0496123_0007630 | 3300048926 | Bacteria | 10125 |
| 341 | Ga0496123_0017095 | 3300048926 | Bacteria | 5854 |
| 342 | Ga0496123_0028278 | 3300048926 | Bacteria | 4155 |
| 343 | Ga0496123_0036008 | 3300048926 | Bacteria | 3517 |
| 344 | Ga0496123_0092555 | 3300048926 | Bacteria | 1788 |
| 345 | Ga0496124_0002248 | 3300048927 | Bacteria | 25664 |
| 346 | Ga0496124_0005858 | 3300048927 | Bacteria | 13630 |
| 347 | Ga0496124_0021541 | 3300048927 | Bacteria | 5937 |
| 348 | Ga0496124_0024118 | 3300048927 | Bacteria | 5537 |
| 349 | Ga0496124_0037520 | 3300048927 | Bacteria | 4214 |
| 350 | Ga0496124_0086992 | 3300048927 | Bacteria | 2556 |
| 351 | Ga0496124_0154210 | 3300048927 | Bacteria | 1798 |
| 352 | Ga0496124_0171436 | 3300048927 | Bacteria | 1680 |
| 353 | Ga0496125_0000030 | 3300048928 | Bacteria | 375023 |
| 354 | Ga0496125_0008659 | 3300048928 | Bacteria | 10606 |
| 355 | Ga0496125_0013275 | 3300048928 | Bacteria | 8105 |
| 356 | Ga0496125_0013946 | 3300048928 | Bacteria | 7860 |
| 357 | Ga0496125_0027541 | 3300048928 | Bacteria | 5150 |
| 358 | Ga0496125_0042092 | 3300048928 | Bacteria | 3896 |
| 359 | Ga0496125_0131962 | 3300048928 | Bacteria | 1756 |
| 360 | Ga0496126_0002368 | 3300048929 | Bacteria | 25688 |
| 361 | Ga0496126_0017925 | 3300048929 | Bacteria | 7043 |
| 362 | Ga0496126_0083325 | 3300048929 | Bacteria | 2822 |
| 363 | Ga0496126_0115270 | 3300048929 | Bacteria | 2337 |
| 364 | Ga0496126_0155592 | 3300048929 | Bacteria | 1956 |
| 365 | Ga0496126_0213832 | 3300048929 | Bacteria | 1622 |
| 366 | Ga0495678_006181 | 3300049459 | Bacteria | 6412 |
| 367 | Ga0501031_0065374 | 3300049568 | Bacteria | 2369 |
| 368 | Ga0501032_0047061 | 3300049569 | Bacteria | 2914 |
| 369 | Ga0501032_0182790 | 3300049569 | Bacteria | 1372 |
| 370 | Ga0501032_0192395 | 3300049569 | Bacteria | 1333 |
| 371 | Ga0501033_0003048 | 3300049570 | Bacteria | 13930 |
| 372 | Ga0501033_0061358 | 3300049570 | Bacteria | 2771 |
| 373 | Ga0501033_0146730 | 3300049570 | Bacteria | 1703 |
| 374 | Ga0501034_0000675 | 3300049571 | Bacteria | 51860 |
| 375 | Ga0501034_0014386 | 3300049571 | Bacteria | 8150 |
| 376 | Ga0501037_0157352 | 3300049573 | Bacteria | 1621 |
| 377 | Ga0501038_0132051 | 3300049574 | Bacteria | 2049 |
| 378 | Ga0501038_0240267 | 3300049574 | Bacteria | 1438 |
| 379 | Ga0501039_0144383 | 3300049575 | Bacteria | 1870 |
| 380 | Ga0501043_0025472 | 3300049579 | Bacteria | 4641 |
| 381 | Ga0501043_0070321 | 3300049579 | Bacteria | 2749 |
| 382 | Ga0501043_0352215 | 3300049579 | Bacteria | 1118 |
| 383 | Ga0501047_0015909 | 3300049581 | Bacteria | 7170 |
| 384 | Ga0501047_0079562 | 3300049581 | Bacteria | 3151 |
| 385 | Ga0501047_0281150 | 3300049581 | Bacteria | 1509 |
| 386 | Ga0501047_0533322 | 3300049581 | Bacteria | 999 |
| 387 | Ga0501067_0116844 | 3300049583 | Bacteria | 1484 |
| 388 | Ga0501069_0089510 | 3300049585 | Bacteria | 1740 |
| 389 | Ga0501070_0016288 | 3300049586 | Bacteria | 6246 |
| 390 | Ga0501070_0115859 | 3300049586 | Bacteria | 2213 |
| 391 | Ga0501070_0351943 | 3300049586 | Bacteria | 1195 |
| 392 | Ga0501073_0155164 | 3300049589 | Bacteria | 1587 |
| 393 | Ga0501074_0110304 | 3300049590 | Bacteria | 1968 |
| 394 | Ga0501079_0341914 | 3300049741 | Bacteria | 1172 |
| 395 | Ga0501080_0004712 | 3300049742 | Bacteria | 12174 |
| 396 | Ga0501080_0120205 | 3300049742 | Bacteria | 2435 |
| 397 | Ga0501083_0020575 | 3300049744 | Bacteria | 4589 |
| 398 | Ga0501083_0121136 | 3300049744 | Bacteria | 1716 |
| 399 | Ga0501035_0006106 | 3300049822 | Bacteria | 11338 |
| 400 | Ga0501035_0025028 | 3300049822 | Bacteria | 5473 |
| 401 | Ga0501035_0026392 | 3300049822 | Bacteria | 5314 |
| 402 | Ga0501035_0042655 | 3300049822 | Bacteria | 4091 |
| 403 | Ga0501035_0189913 | 3300049822 | Bacteria | 1766 |
| 404 | Ga0501044_0039749 | 3300049823 | Bacteria | 4905 |
| 405 | Ga0501044_0095281 | 3300049823 | Bacteria | 3000 |
| 406 | nmdc:mga03683_23864_c1 | 3300050489 | Bacteria | 2387 |
| 407 | nmdc:mga00v17_1285_c1 | 3300050491 | Bacteria | 13183 |
| 408 | nmdc:mga00v17_151_c1 | 3300050491 | Bacteria | 40348 |
| 409 | nmdc:mga00v17_248604_c1 | 3300050491 | Bacteria | 1153 |
| 410 | nmdc:mga00v17_25914_c1 | 3300050491 | Bacteria | 3411 |
| 411 | nmdc:mga0yw44_75984_c1 | 3300050492 | Bacteria | 2096 |
| 412 | nmdc:mga0k408_282485_c1 | 3300050493 | Bacteria | 991 |
| 413 | nmdc:mga06z11_46516_c1 | 3300050494 | Bacteria | 2199 |
| 414 | nmdc:mga06z11_6588_c1 | 3300050494 | Bacteria | 4741 |
| 415 | nmdc:mga07m45_136748_c1 | 3300050496 | Bacteria | 1418 |
| 416 | nmdc:mga07m45_88205_c1 | 3300050496 | Bacteria | 1775 |
| 417 | nmdc:mga0sz30_107341_c1 | 3300050516 | Bacteria | 1222 |
| 418 | nmdc:mga0sz30_107_c1 | 3300050516 | Bacteria | 31264 |
| 419 | nmdc:mga0sz30_773_c1 | 3300050516 | Bacteria | 1133 |
| 420 | Ga0500610_0012502 | 3300053079 | Bacteria | 3914 |
| 421 | Ga0500644_0036300 | 3300053088 | Bacteria | 1603 |
| 422 | Ga0500556_0000963 | 3300053104 | Bacteria | 15438 |
| 423 | Ga0500594_0007425 | 3300053118 | Bacteria | 2479 |
| 424 | Ga0500618_001412 | 3300053125 | Bacteria | 10762 |
| 425 | Ga0500618_058667 | 3300053125 | Bacteria | 866 |
| 426 | Ga0500652_019094 | 3300053131 | Bacteria | 2541 |
| 427 | Ga0500559_0003675 | 3300053136 | Bacteria | 7485 |
| 428 | Ga0500559_0117563 | 3300053136 | Bacteria | 1235 |
| 429 | Ga0500561_0001013 | 3300053137 | Bacteria | 4502 |
| 430 | Ga0500568_0000048 | 3300053139 | Bacteria | 119025 |
| 431 | Ga0500568_0051067 | 3300053139 | Bacteria | 1628 |
| 432 | Ga0500568_0070787 | 3300053139 | Bacteria | 1336 |
| 433 | Ga0500573_0000334 | 3300053140 | Bacteria | 19960 |
| 434 | Ga0500590_016346 | 3300053148 | Bacteria | 3837 |
| 435 | Ga0500616_0005597 | 3300053153 | Bacteria | 8483 |
| 436 | Ga0500616_0077588 | 3300053153 | Bacteria | 1677 |
| 437 | Ga0500620_000163 | 3300053155 | Bacteria | 13341 |
| 438 | Ga0500622_0003318 | 3300053156 | Bacteria | 10874 |
| 439 | Ga0500622_0003847 | 3300053156 | Bacteria | 9763 |
| 440 | Ga0500624_004755 | 3300053157 | Bacteria | 1795 |
| 441 | Ga0500633_0012605 | 3300053160 | Bacteria | 2341 |
| 442 | Ga0500636_0000040 | 3300053177 | Bacteria | 69881 |
| 443 | Ga0500636_0074565 | 3300053177 | Bacteria | 1963 |
| 444 | Ga0500645_053876 | 3300053730 | Bacteria | 1170 |
| 445 | Ga0587077_048477 | 3300059493 | Bacteria | 880 |
| 446 | Ga0587086_023105 | 3300059507 | Bacteria | 865 |
| 447 | Ga0501082_0087550 | 3300060353 | Bacteria | 2687 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.8698 | 13 | 232 |
| 7f02-assembly1.cif.gz_C | cytochrome c-type biogenesis protein ccmabcd from e. coli | 0.8201 | 13 | 232 |
| 6ot4-assembly1.cif.gz_A | bimetallic dodecameric cage design 2 (bmc2) from cytochrome cb562 | 0.6049 | 64 | 166 |
| 8sjf-assembly1.cif.gz_A | apo structure of computationally designed homotrimer tet4 | 0.5991 | 67 | 167 |
| 3m4c-assembly1.cif.gz_C | a zn-mediated tetrahedral protein lattice cage encapsulating a microperoxidase | 0.5953 | 64 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4I9Q4_9_159_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.7353 | 50 | 149 | 1.20.140.150 |
| af_Q45RH2_55_171_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6789 | 60 | 170 | 1.20.140.150 |
| af_Q08CE6_110_279_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.6406 | 60 | 145 | 1.20.140.150 |
| af_Q99598_187_272_1.20.58.200 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Translin; domain 2 | 0.61 | 60 | 158 | 1.20.58.200 |
| 1xzqA02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);tRNA modification GTPase MnmE domain 2 | 0.6087 | 66 | 168 | 1.20.120.430 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0W9W9-F1-model_v4 | Heme exporter protein C | 0.9137 | 30 | 175 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A6I1JNI9-F1-model_v4 | Heme exporter protein C | 0.9116 | 9 | 164 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A348ZI84-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein CcmC) | 0.9113 | 49 | 172 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-T0YZH0-F1-model_v4 | Cytochrome c assembly protein | 0.9069 | 13 | 170 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
| AF-A0A724V1H0-F1-model_v4 | Heme exporter protein C (Cytochrome c-type biogenesis protein) | 0.9021 | 49 | 173 |
GO:0005886
GO:0015232 GO:0017004 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar