F491852

General Info

Members Datasets Scaffolds Average Seq Length
1221 1025 448 444

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10001536|Ga0105251_100015367
Length 475
Sequence MIVASATNLPGEIIMTIQAIPQGMVRASVTTGTVEGYMPGFGNDFETEALPGALPQGQNSPQKCNYGLYAEQLSGTAFTAPRGQNERTWCYRIRPSVHHTGRFKLFDVPYWKTAPNLPVGDPQRHNITSLGQYRWNPIPLPESDEDLTWITGMRTMTTAGDVNIQIGMASHVYLITRSMQDEYFYSADSELLVVPQEGRLRFCTELGVIDLEPKEIAIIPRGLVYRVEVLEGPCRGFVCENYGQKFDLPGRGPIGANCLANPRDFKSPVAAYEDKQARSRVVIKWCGQFHETWIDHSPLDIVAWHGNYCAYKYDLRAYSPVGAILFDHPDPSIFTVLTAPSGQEGTANIDFVLFRERWLVAEHSFRPPWYHKNIMSELMGNIYGVYDAKPQGFAPGGISLHNCMLPHGPDRDAFEGASNAELRPEKLDNTMSFMFETRFPQHLTEFAAYEAPMQEKYIEVWDHLEKKFDGTPGVK

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
5 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
6 2509276019 Ensifer aridi TW10 Isolate Nodule
7 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
8 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
9 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
10 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
11 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
12 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
13 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
14 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
15 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
16 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
17 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
18 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
19 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
20 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
21 2512875024 Mesorhizobium loti R88b Isolate Nodule
22 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
23 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
24 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
25 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
26 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
27 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
28 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
29 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
30 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
31 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
32 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
33 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
34 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
35 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
36 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
37 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
38 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
39 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
40 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
41 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
42 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
43 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
44 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
45 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
46 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
47 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
48 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
49 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
50 2516143018 Ensifer sp. BR816 Isolate Nodule
51 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
52 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
53 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
54 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
55 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
56 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
57 2519899620 Rhizobium sp. Pop5 Isolate Nodule
58 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
59 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
60 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
61 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
62 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
63 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
64 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
65 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
66 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
67 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
68 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
69 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
70 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
71 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
72 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
73 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
74 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
75 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
76 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
77 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
78 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
79 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
80 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
81 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
82 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
83 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
84 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
85 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
86 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
87 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
88 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
89 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
90 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
91 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
92 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
93 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
94 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
95 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
96 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
97 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
98 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
99 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
100 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
101 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
102 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
103 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
104 2643221557 Ensifer sp. Root558 Isolate Unclassified
105 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
106 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
107 2643221607 Rhizobium sp. Root73 Isolate Unclassified
108 2643221610 Ensifer sp. Root74 Isolate Unclassified
109 2643221618 Ensifer sp. Root231 Isolate Unclassified
110 2643221626 Ensifer sp. Root31 Isolate Unclassified
111 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
112 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
113 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
114 2643221655 Ensifer sp. Root1252 Isolate Unclassified
115 2643221659 Ensifer sp. Root127 Isolate Unclassified
116 2643221668 Ensifer sp. Root423 Isolate Unclassified
117 2643221675 Ensifer sp. Root1298 Isolate Unclassified
118 2643221680 Ensifer sp. Root1312 Isolate Unclassified
119 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
120 2643221688 Rhizobium sp. Root482 Isolate Unclassified
121 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
122 2643221698 Ensifer sp. Root142 Isolate Unclassified
123 2643221712 Ensifer sp. Root258 Isolate Unclassified
124 2643221723 Ensifer sp. Root278 Isolate Unclassified
125 2643221726 Ensifer sp. Root954 Isolate Unclassified
126 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
127 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
128 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
129 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
130 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
131 2718217882 Rhizobium sp. N741 Isolate Nodule
132 2718217927 Rhizobium sp. N324 Isolate Nodule
133 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
134 2718218009 Rhizobium sp. N561 Isolate Nodule
135 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
136 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
137 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
138 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
139 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
140 2718218363 Rhizobium sp. N113 Isolate Nodule
141 2718218365 Rhizobium sp. N731 Isolate Nodule
142 2718218366 Rhizobium sp. N621 Isolate Nodule
143 2718218423 Rhizobium sp. N941 Isolate Nodule
144 2721755514 Rhizobium sp. N6212 Isolate Nodule
145 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
146 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
147 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
148 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
149 2721755809 Rhizobium sp. N541 Isolate Nodule
150 2721755810 Rhizobium sp. N871 Isolate Nodule
151 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
152 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
153 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
154 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
155 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
156 2728369365 Rhizobium sp. N1341 Isolate Nodule
157 2728369397 Rhizobium sp. N1314 Isolate Nodule
158 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
159 2738543024 Aminobacter sp. AP02 Isolate Unclassified
160 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
161 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
162 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
163 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
164 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
165 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
166 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
167 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
168 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
169 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
170 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
171 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
172 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
173 2791355256 Rhizobium sp. M10 Isolate Nodule
174 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
175 2791355260 Rhizobium sp. L9 Isolate Nodule
176 2791355261 Rhizobium sp. J15 Isolate Nodule
177 2791355262 Rhizobium sp. M1 Isolate Nodule
178 2791355263 Rhizobium chutanense C5 Isolate Nodule
179 2791355264 Rhizobium sp. S9 Isolate Nodule
180 2791355265 Rhizobium sp. H4 Isolate Nodule
181 2791355266 Rhizobium sp. L43 Isolate Nodule
182 2791355267 Rhizobium sp. L18 Isolate Nodule
183 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
184 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
185 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
186 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
187 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
188 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
189 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
190 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
191 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
192 2802429633 Rhizobium anhuiense J3 Isolate Nodule
193 2802429634 Rhizobium anhuiense S10 Isolate Nodule
194 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
195 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
196 2802429637 Rhizobium anhuiense C15 Isolate Nodule
197 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
198 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
199 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
200 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
201 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
202 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
203 2838048938 Rhizobium pisi 27/80 Isolate Nodule
204 2838061910 Rhizobium phaseoli L15 Isolate Nodule
205 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
206 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
207 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
208 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
209 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
210 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
211 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
212 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
213 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
214 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
215 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
216 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
217 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
218 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
219 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
220 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
221 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
222 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
223 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
224 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
225 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
226 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
227 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
228 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
229 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
230 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
231 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
232 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
233 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
234 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
235 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
236 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
237 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
238 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
239 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
240 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
241 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
242 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
243 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
244 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
245 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
246 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
247 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
248 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
249 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
250 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
251 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
252 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
253 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
254 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
255 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
256 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
257 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
258 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
259 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
260 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
261 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
262 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
263 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
264 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
265 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
266 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
267 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
268 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
269 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
270 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
271 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
272 2844163670 Ensifer sp. 1H6 Isolate Unclassified
273 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
274 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
275 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
276 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
277 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
278 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
279 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
280 2854911287 Brucella lupini LUP21 Isolate Unclassified
281 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
282 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
283 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
284 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
285 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
286 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
287 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
288 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
289 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
290 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
291 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
292 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
293 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
294 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
295 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
296 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
297 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
298 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
299 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
300 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
301 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
302 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
303 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
304 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
305 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
306 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
307 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
308 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
309 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
310 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
311 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
312 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
313 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
314 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
315 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
316 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
317 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
318 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
319 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
320 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
321 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
322 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
323 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
324 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
325 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
326 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
327 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
328 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
329 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
330 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
331 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
332 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
333 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
334 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
335 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
336 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
337 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
338 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
339 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
340 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
341 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
342 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
343 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
344 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
345 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
346 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
347 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
348 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
349 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
350 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
351 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
352 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
353 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
354 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
355 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
356 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
357 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
358 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
359 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
360 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
361 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
362 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
363 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
364 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
365 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
366 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
367 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
368 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
369 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
370 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
371 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
372 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
373 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
374 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
375 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
376 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
377 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
378 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
379 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
380 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
381 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
382 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
383 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
384 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
385 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
386 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
387 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
388 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
389 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
390 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
391 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
392 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
393 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
394 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
395 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
396 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
397 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
398 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
399 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
400 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
401 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
402 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
403 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
404 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
405 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
406 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
407 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
408 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
409 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
410 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
411 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
412 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
413 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
414 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
415 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
416 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
417 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
418 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
419 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
420 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
421 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
422 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
423 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
424 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
425 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
426 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
427 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
428 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
429 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
430 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
431 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
432 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
433 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
434 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
435 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
436 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
437 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
438 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
439 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
440 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
441 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
442 2933599457 Rhizobium phaseoli M3 Isolate Nodule
443 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
444 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
445 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
446 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
447 2936381700 Rhizobium chutanense C16 Isolate Unclassified
448 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
449 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
450 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
451 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
452 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
453 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
454 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
455 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
456 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
457 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
458 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
459 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
460 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
461 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
462 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
463 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
464 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
465 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
466 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
467 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
468 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
469 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
470 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
471 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
472 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
473 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
474 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
475 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
476 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
477 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
478 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
479 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
480 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
481 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
482 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
483 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
484 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
485 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
486 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
487 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
488 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
489 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
490 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
491 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
492 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
493 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
494 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
495 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
496 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
497 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
498 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
499 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
500 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
501 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
502 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
503 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
504 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
505 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
506 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
507 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
508 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
509 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
510 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
511 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
512 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
513 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
514 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
515 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
516 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
517 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
518 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
519 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
520 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
521 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
522 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
523 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
524 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
525 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
526 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
527 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
528 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
529 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
530 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
531 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
532 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
533 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
534 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
535 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
536 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
537 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
538 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
539 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
540 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
541 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
542 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
543 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
544 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
545 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
546 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
547 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
548 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
549 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
550 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
551 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
552 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
553 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
554 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
555 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
556 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
557 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
558 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
559 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
560 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
561 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
562 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
563 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
564 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
565 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
566 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
567 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
568 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
569 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
570 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
571 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
572 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
573 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
574 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
575 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
576 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
577 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
578 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
579 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
580 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
581 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
582 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
583 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
584 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
585 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
586 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
587 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
588 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
589 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
590 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
591 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
592 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
593 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
594 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
595 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
596 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
597 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
598 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
599 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
600 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
601 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
602 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
603 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
604 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
605 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
606 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
607 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
608 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
609 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
610 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
611 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
612 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
613 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
614 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
615 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
616 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
617 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
618 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
619 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
620 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
621 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
622 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
623 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
624 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
625 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
626 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
627 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
628 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
629 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
630 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
631 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
632 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
633 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
634 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
635 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
636 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
637 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
638 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
639 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
640 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
641 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
642 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
643 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
644 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
645 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
646 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
647 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
648 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
649 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
650 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
651 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
652 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
653 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
654 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
655 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
656 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
657 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
658 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
659 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
660 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
661 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
662 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
663 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
664 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
665 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
666 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
667 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
668 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
669 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
670 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
671 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
672 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
673 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
674 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
675 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
676 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
677 2996887358 Rhizobium sp. R711 Isolate Nodule
678 2996893221 Rhizobium sp. R635 Isolate Nodule
679 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
680 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
681 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
682 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
683 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
684 3004167301 Mesorhizobium loti 582 Isolate Unclassified
685 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
686 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
687 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
688 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
689 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
690 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
691 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
692 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
693 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
694 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
695 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
696 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
697 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
698 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
699 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
700 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
701 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
702 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
703 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
704 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
705 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
706 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
707 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
708 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
709 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
710 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
711 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
712 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
713 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
714 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
715 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
716 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
717 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
718 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
719 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
720 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
721 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
722 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
723 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
724 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
725 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
726 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
727 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
728 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
729 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
730 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
731 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
732 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
733 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
734 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
735 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
736 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
737 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
738 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
739 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
740 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
741 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
742 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
743 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
744 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
745 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
746 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
747 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
748 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
749 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
750 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
751 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
752 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
753 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
754 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
755 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
756 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
757 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
758 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
759 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
760 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
761 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
762 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
763 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
764 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
765 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
766 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
767 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
768 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
769 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
770 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
771 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
772 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
773 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
774 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
775 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
776 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
777 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
778 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
779 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
780 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
781 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
782 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
783 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
784 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
785 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
786 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
787 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
788 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
789 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
790 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
791 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
792 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
793 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
794 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
795 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
796 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
797 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
798 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
799 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
800 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
801 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
802 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
803 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
804 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
805 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
806 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
807 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
808 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
809 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
810 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
811 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
812 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
813 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
814 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
815 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
816 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
817 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
818 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
819 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
820 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
821 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
822 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
823 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
824 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
825 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
826 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
827 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
828 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
829 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
830 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
831 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
832 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
833 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
834 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
835 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
836 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
837 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
838 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
839 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
840 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
841 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
842 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
843 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
844 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
845 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
846 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
847 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
848 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
849 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
850 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
851 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
852 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
853 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
854 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
855 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
856 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
857 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
858 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
859 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
860 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
861 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
862 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
863 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
864 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
865 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
866 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
867 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
868 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
869 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
870 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
871 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
872 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
873 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
874 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
875 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
876 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
877 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
878 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
879 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
880 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
881 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
882 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
883 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
884 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
885 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
886 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
887 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
888 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
889 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
890 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
891 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
892 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
893 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
894 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
895 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
896 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
897 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
898 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
899 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
900 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
901 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
902 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
903 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
904 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
905 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
906 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
907 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
908 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
909 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
910 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
911 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
912 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
913 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
914 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
915 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
916 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
917 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
918 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
919 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
920 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
921 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
922 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
923 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
924 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
925 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
926 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
927 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
928 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
929 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
930 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
931 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
932 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
933 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
934 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
935 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
936 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
937 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
938 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
939 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
940 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
941 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
942 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
943 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
944 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
945 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
946 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
947 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
948 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
949 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
950 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
951 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
952 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
953 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
954 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
955 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
956 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
957 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
958 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
959 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
960 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
961 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
962 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
963 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
964 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
965 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
966 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
967 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
968 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
969 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
970 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
971 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
972 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
973 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
974 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
975 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
976 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
977 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
978 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
979 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
980 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
981 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
982 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
983 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
984 8005258706 Rhizobium sp. R693 Isolate Nodule
985 8005275841 Rhizobium sp. N4311 Isolate Nodule
986 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
987 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
988 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
989 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
990 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
991 8005321885 Rhizobium sp. R72 Isolate Nodule
992 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
993 8005382845 Rhizobium sp. R634 Isolate Nodule
994 8005395548 Rhizobium sp. R339 Isolate Nodule
995 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
996 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
997 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
998 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
999 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1000 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1001 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1002 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1003 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1004 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1005 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1006 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1007 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1008 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1009 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1010 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1011 8018176218 Rhizobium sp. N122 Isolate Nodule
1012 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1013 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1014 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1015 8024501048 Rhizobium sp. H4 Isolate Nodule
1016 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1017 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1018 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1019 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1020 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1021 8056382006 Rhizobium croatiense 13T Isolate Nodule
1022 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1023 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere
1024 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1025 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.53
Metatranscriptomes 0.16
Isolates 63.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 53.15
Rhizoplane 1.15
Rhizosphere 23.26
Stem 0
Stem Tuber 0
Unclassified 11.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000183 3300002704 Bacteria 26908
2 JGI25156J39149_1000405 3300002705 Bacteria 27011
3 JGI25162J39368_1000111 3300002737 Bacteria 89317
4 JGI25154J39366_1000342 3300002738 Bacteria 26841
5 JGI25158J39367_1000155 3300002739 Bacteria 16080
6 JGI25157J39369_1000437 3300002741 Bacteria 27009
7 JGI25157J39369_1000888 3300002741 Bacteria 14398
8 JGI25152J39213_1001943 3300002773 Bacteria 8228
9 JGI25152J39213_1010090 3300002773 Bacteria 2185
10 JGI25159J45721_1000106 3300002987 Bacteria 39688
11 JGI25159J45721_1000117 3300002987 Bacteria 37812
12 JGI25159J45721_1005257 3300002987 Bacteria 4091
13 JGI25151J46595_10001002 3300003187 Bacteria 21356
14 JGI25151J46595_10004348 3300003187 Bacteria 7513
15 JGI25151J46595_10011367 3300003187 Bacteria 4092
16 JGI25406J46586_10007067 3300003203 Bacteria 5146
17 JGI25165J46597_1000070 3300003214 Bacteria 193557
18 JGI25165J46597_1000440 3300003214 Bacteria 41868
19 JGI25153J46596_10003651 3300003215 Bacteria 8520
20 JGI25153J46596_10007535 3300003215 Bacteria 5332
21 JGI25153J46596_10011509 3300003215 Bacteria 3902
22 JGI25153J46596_10016048 3300003215 Bacteria 3022
23 JGI25160J50197_1000081 3300003354 Bacteria 99495
24 JGI25160J50197_1000134 3300003354 Bacteria 66627
25 JGI25160J50197_1005559 3300003354 Bacteria 5228
26 JGI25161J50226_1000025 3300003374 Bacteria 148471
27 JGI25161J50226_1000063 3300003374 Bacteria 99495
28 JGI25161J50226_1000116 3300003374 Bacteria 62089
29 Ga0006562J51391_1050999 3300003578 Bacteria 1482
30 JGI25404J52841_10001118 3300003659 Bacteria 4527
31 Ga0055542_1000344 3300003762 Bacteria 49138
32 Ga0055542_1000824 3300003762 Bacteria 22231
33 Ga0055526_1000557 3300003771 Bacteria 29469
34 Ga0055526_1001298 3300003771 Bacteria 17909
35 Ga0055526_1013051 3300003771 Bacteria 3552
36 Ga0055526_1014271 3300003771 Bacteria 3281
37 Ga0055524_1000530 3300003775 Bacteria 29086
38 Ga0055524_1004363 3300003775 Bacteria 6533
39 Ga0055524_1008755 3300003775 Bacteria 4178
40 Ga0055524_1018509 3300003775 Bacteria 2415
41 Ga0055536_1002112 3300003781 Bacteria 11316
42 Ga0055536_1024031 3300003781 Bacteria 1776
43 Ga0055528_1000067 3300003790 Bacteria 83853
44 Ga0055528_1007332 3300003790 Bacteria 4891
45 Ga0055528_1007542 3300003790 Bacteria 4797
46 Ga0055528_1012347 3300003790 Bacteria 3323
47 Ga0055540_1000126 3300003792 Bacteria 78462
48 Ga0055531_10011613 3300003794 Bacteria 4225
49 Ga0055543_1000088 3300004625 Bacteria 80513
50 Ga0055543_1000427 3300004625 Bacteria 26126
51 Ga0055543_1000574 3300004625 Bacteria 20329
52 Ga0055543_1000584 3300004625 Bacteria 20156
53 Ga0065165_1000196 3300005262 Bacteria 104569
54 Ga0065165_1000426 3300005262 Bacteria 66367
55 Ga0065165_1020740 3300005262 Bacteria 2303
56 Ga0065704_10076623 3300005289 Bacteria 5047
57 Ga0070658_10027711 3300005327 Bacteria 4546
58 Ga0070683_100129360 3300005329 Bacteria 2388
59 Ga0070690_100003390 3300005330 Bacteria 8707
60 Ga0070677_10040469 3300005333 Bacteria 1834
61 Ga0070680_100011068 3300005336 Bacteria 6972
62 Ga0070660_100009955 3300005339 Bacteria 6704
63 Ga0070674_100025116 3300005356 Bacteria 3874
64 Ga0070714_100019550 3300005435 Bacteria 5520
65 Ga0070713_100004226 3300005436 Bacteria 9595
66 Ga0070710_10018121 3300005437 Bacteria 3617
67 Ga0070711_100053024 3300005439 Bacteria 2794
68 Ga0070685_10098755 3300005466 Bacteria 1779
69 Ga0070679_100013927 3300005530 Bacteria 7706
70 Ga0070679_100121312 3300005530 Bacteria 2599
71 Ga0068853_100059049 3300005539 Bacteria 3313
72 Ga0070665_100009839 3300005548 Bacteria 9664
73 Ga0068855_100083776 3300005563 Bacteria 3694
74 Ga0068852_100027394 3300005616 Bacteria 4644
75 Ga0068852_100092897 3300005616 Bacteria 2703
76 Ga0068864_100023236 3300005618 Bacteria 5204
77 Ga0068864_100211028 3300005618 Bacteria 1788
78 Ga0068862_100097901 3300005844 Bacteria 2562
79 Ga0081540_1000011 3300005983 Bacteria 191880
80 Ga0081540_1044793 3300005983 Bacteria 2255
81 Ga0081539_10003026 3300005985 Bacteria 21797
82 Ga0081539_10004862 3300005985 Bacteria 14366
83 Ga0070717_10235551 3300006028 Bacteria 1613
84 Ga0075365_10002849 3300006038 Bacteria 8680
85 Ga0075365_10014080 3300006038 Bacteria 4804
86 Ga0075365_10016079 3300006038 Bacteria 4541
87 Ga0075365_10032039 3300006038 Bacteria 3377
88 Ga0075368_10007117 3300006042 Bacteria 3938
89 Ga0075363_100002911 3300006048 Bacteria 7132
90 Ga0075363_100084293 3300006048 Bacteria 1742
91 Ga0075364_10005593 3300006051 Bacteria 7323
92 Ga0075362_10009058 3300006177 Bacteria 3833
93 Ga0075362_10045746 3300006177 Bacteria 1944
94 Ga0075367_10040645 3300006178 Bacteria 2716
95 Ga0075369_10005002 3300006186 Bacteria 4933
96 Ga0075366_10022204 3300006195 Bacteria 3691
97 Ga0075428_100080643 3300006844 Bacteria 3551
98 Ga0075431_100001771 3300006847 Bacteria 20351
99 Ga0075434_100181674 3300006871 Bacteria 2124
100 Ga0075429_100002539 3300006880 Bacteria 15378
101 Ga0079104_1000986 3300006946 Bacteria 22164
102 Ga0079104_1010558 3300006946 Bacteria 3034
103 Ga0105251_10001536 3300009011 Bacteria 19805
104 Ga0105240_10000240 3300009093 Bacteria 109195
105 Ga0105240_10025766 3300009093 Bacteria 7723
106 Ga0111539_10035473 3300009094 Bacteria 6038
107 Ga0114129_10001020 3300009147 Bacteria 36568
108 Ga0114129_10065536 3300009147 Bacteria 5069
109 Ga0105243_10183792 3300009148 Bacteria 1820
110 Ga0105242_10135105 3300009176 Bacteria 2134
111 Ga0105248_10278306 3300009177 Bacteria 1884
112 Ga0105237_10001680 3300009545 Bacteria 28647
113 Ga0105237_10029880 3300009545 Bacteria 5535
114 Ga0105238_10020832 3300009551 Bacteria 6679
115 Ga0123341_1000001 3300009765 Bacteria 314908
116 Ga0123342_1017634 3300009766 Bacteria 5893
117 Ga0105239_10021688 3300010375 Bacteria 7080
118 Ga0105239_10078613 3300010375 Bacteria 3630
119 Ga0157373_10001598 3300013100 Bacteria 17300
120 Ga0157370_10044350 3300013104 Bacteria 4275
121 Ga0157370_10088415 3300013104 Bacteria 2910
122 Ga0157369_10197541 3300013105 Bacteria 2111
123 Ga0171463_1014 3300013249 Bacteria 83917
124 Ga0157372_10296950 3300013307 Bacteria 1879
125 Ga0157372_10435604 3300013307 Bacteria 1528
126 Ga0157380_10043299 3300014326 Bacteria 3524
127 Ga0182007_10000579 3300015262 Bacteria 21512
128 Ga0182005_1015734 3300015265 Bacteria 2108
129 Ga0183363_1028 3300015690 Bacteria 50706
130 Ga0214544_1000012 3300021320 Bacteria 229808
131 Ga0214544_1000123 3300021320 Bacteria 110258
132 Ga0214542_1000011 3300021321 Bacteria 238260
133 Ga0214542_1000141 3300021321 Bacteria 104386
134 Ga0214542_1020440 3300021321 Bacteria 4853
135 Ga0214543_1000004 3300021327 Bacteria 527190
136 Ga0214543_1000008 3300021327 Bacteria 385680
137 Ga0214543_1000026 3300021327 Bacteria 220652
138 Ga0213875_10000003 3300021388 Bacteria 719367
139 Ga0228711_1001864 3300022739 Bacteria 31722
140 Ga0228710_1001994 3300022740 Bacteria 31627
141 Ga0209435_100039 3300025206 Bacteria 116879
142 Ga0209436_100017 3300025208 Bacteria 116238
143 Ga0209437_100064 3300025233 Bacteria 334360
144 Ga0207425_1013013 3300025245 Bacteria 1932
145 Ga0207425_1015995 3300025245 Bacteria 1672
146 Ga0209646_1000137 3300025246 Bacteria 116791
147 Ga0209026_1000002 3300025250 Bacteria 1136158
148 Ga0209026_1000135 3300025250 Bacteria 117001
149 Ga0209677_100261 3300025253 Bacteria 35631
150 Ga0209148_1000123 3300025254 Bacteria 185406
151 Ga0209148_1004051 3300025254 Bacteria 3733
152 Ga0209759_1000154 3300025256 Bacteria 119427
153 Ga0209759_1000677 3300025256 Bacteria 31109
154 Ga0209129_1000474 3300025258 Bacteria 29449
155 Ga0209129_1000846 3300025258 Bacteria 19175
156 Ga0209129_1004536 3300025258 Bacteria 5366
157 Ga0209129_1008892 3300025258 Bacteria 2723
158 Ga0209233_1000081 3300025261 Bacteria 336832
159 Ga0209233_1000131 3300025261 Bacteria 205257
160 Ga0209233_1000203 3300025261 Bacteria 118984
161 Ga0209455_1000129 3300025272 Bacteria 161691
162 Ga0209673_1000310 3300025273 Bacteria 89821
163 Ga0209673_1000348 3300025273 Bacteria 84966
164 Ga0209130_1000001 3300025284 Bacteria 831557
165 Ga0209130_1000162 3300025284 Bacteria 99549
166 Ga0209130_1000198 3300025284 Bacteria 82557
167 Ga0209676_1000547 3300025292 Bacteria 57868
168 Ga0209676_1001775 3300025292 Bacteria 18179
169 Ga0209676_1021872 3300025292 Bacteria 2133
170 Ga0209025_1000097 3300025294 Bacteria 236632
171 Ga0209025_1000339 3300025294 Bacteria 103239
172 Ga0209025_1006672 3300025294 Bacteria 8866
173 Ga0209025_1010790 3300025294 Bacteria 6137
174 Ga0209564_1000137 3300025295 Bacteria 183874
175 Ga0209564_1000353 3300025295 Bacteria 85747
176 Ga0209564_1001306 3300025295 Bacteria 26845
177 Ga0209758_1000128 3300025297 Bacteria 186771
178 Ga0209758_1000237 3300025297 Bacteria 115867
179 Ga0209758_1000714 3300025297 Bacteria 49025
180 Ga0209758_1001821 3300025297 Bacteria 23523
181 Ga0209758_1003449 3300025297 Bacteria 14359
182 Ga0209758_1006356 3300025297 Bacteria 8545
183 Ga0209758_1007411 3300025297 Bacteria 7479
184 Ga0209758_1012206 3300025297 Bacteria 4838
185 Ga0209050_1004164 3300025298 Bacteria 10015
186 Ga0209050_1025229 3300025298 Bacteria 2027
187 Ga0209256_1000397 3300025299 Bacteria 68947
188 Ga0209256_1000456 3300025299 Bacteria 61717
189 Ga0209256_1000845 3300025299 Bacteria 38396
190 Ga0209256_1009745 3300025299 Bacteria 4149
191 Ga0207426_1000005 3300025302 Bacteria 1037188
192 Ga0207426_1000048 3300025302 Bacteria 409127
193 Ga0207426_1000094 3300025302 Bacteria 275293
194 Ga0207426_1000126 3300025302 Bacteria 213341
195 Ga0207426_1005340 3300025302 Bacteria 5902
196 Ga0209051_1000201 3300025303 Bacteria 106123
197 Ga0209051_1001477 3300025303 Bacteria 19852
198 Ga0209051_1001712 3300025303 Bacteria 17510
199 Ga0209257_1004433 3300025304 Bacteria 10878
200 Ga0209257_1004845 3300025304 Bacteria 9957
201 Ga0209257_1018340 3300025304 Bacteria 2698
202 Ga0207713_1001292 3300025735 Bacteria 20629
203 Ga0207682_10003844 3300025893 Bacteria 6448
204 Ga0207647_10046972 3300025904 Bacteria 2687
205 Ga0207645_10052771 3300025907 Bacteria 2598
206 Ga0207654_10000574 3300025911 Bacteria 20794
207 Ga0207695_10000118 3300025913 Bacteria 237085
208 Ga0207671_10000954 3300025914 Bacteria 35929
209 Ga0207671_10009485 3300025914 Bacteria 8130
210 Ga0207693_10024602 3300025915 Bacteria 4776
211 Ga0207663_10062362 3300025916 Bacteria 2369
212 Ga0207660_10098988 3300025917 Bacteria 2175
213 Ga0207657_10011163 3300025919 Bacteria 8930
214 Ga0207652_10082549 3300025921 Bacteria 2812
215 Ga0207646_10140895 3300025922 Bacteria 2171
216 Ga0207694_10033546 3300025924 Bacteria 3932
217 Ga0207706_10036755 3300025933 Bacteria 4350
218 Ga0207665_10001690 3300025939 Bacteria 14832
219 Ga0207691_10001569 3300025940 Bacteria 22690
220 Ga0207711_10205091 3300025941 Bacteria 1800
221 Ga0207661_10191916 3300025944 Bacteria 1791
222 Ga0207667_10357437 3300025949 Bacteria 1489
223 Ga0207668_10097601 3300025972 Bacteria 2175
224 Ga0207658_10009123 3300025986 Bacteria 6728
225 Ga0207677_10149329 3300026023 Bacteria 1801
226 Ga0207639_10058201 3300026041 Bacteria 2971
227 Ga0207678_10016380 3300026067 Bacteria 6508
228 Ga0207702_10095411 3300026078 Bacteria 2613
229 Ga0207648_10021142 3300026089 Bacteria 5851
230 Ga0207648_10071108 3300026089 Bacteria 3033
231 Ga0207676_10203627 3300026095 Bacteria 1750
232 Ga0207683_10013355 3300026121 Bacteria 7004
233 Ga0207698_10032574 3300026142 Bacteria 3778
234 Ga0207698_10036666 3300026142 Bacteria 3602
235 Ga0209281_1000141 3300027111 Bacteria 175634
236 Ga0209281_1000731 3300027111 Bacteria 32139
237 Ga0209282_1000203 3300027666 Bacteria 31858
238 Ga0207428_10007598 3300027907 Bacteria 9880
239 Ga0268266_10006748 3300028379 Bacteria 10468
240 Ga0268265_10048249 3300028380 Bacteria 3196
241 Ga0307515_10003211 3300028794 Bacteria 34601
242 Ga0307515_10019793 3300028794 Bacteria 12076
243 Ga0265330_10039774 3300031235 Bacteria 2088
244 Ga0265325_10001113 3300031241 Bacteria 19332
245 Ga0265325_10080780 3300031241 Bacteria 1616
246 Ga0265340_10003501 3300031247 Bacteria 8831
247 Ga0265340_10018288 3300031247 Bacteria 3615
248 Ga0265331_10054383 3300031250 Bacteria 1906
249 Ga0265316_10119891 3300031344 Bacteria 1987
250 Ga0307513_10099390 3300031456 Bacteria 2938
251 Ga0307513_10125437 3300031456 Bacteria 2524
252 Ga0265313_10008977 3300031595 Bacteria 6557
253 Ga0265313_10012187 3300031595 Bacteria 5278
254 Ga0316575_10033680 3300031665 Bacteria 2010
255 Ga0265342_10013871 3300031712 Bacteria 5377
256 Ga0265342_10106380 3300031712 Bacteria 1592
257 Ga0315914_1001932 3300031967 Bacteria 31627
258 Ga0307414_10049575 3300032004 Bacteria 2904
259 Ga0307510_10001795 3300033180 Bacteria 23961
260 Ga0315913_1000745 3300033430 Bacteria 31622
261 Ga0315915_1000005 3300033464 Bacteria 397591
262 Ga0373931_0101102 3300035691 Bacteria 1621
263 Ga0373935_0031762 3300035692 Bacteria 3279
264 Ga0373927_0000655 3300035695 Bacteria 26267
265 Ga0373925_0001826 3300037068 Bacteria 17766
266 Ga0373925_0060638 3300037068 Bacteria 2841
267 Ga0373925_0101987 3300037068 Bacteria 2207
268 Ga0395900_0038974 3300037418 Bacteria 4898
269 Ga0395898_0093723 3300037466 Bacteria 2886
270 Ga0395905_0003543 3300037471 Bacteria 16639
271 Ga0395905_0011767 3300037471 Bacteria 8446
272 Ga0395905_0075752 3300037471 Bacteria 3153
273 Ga0395905_0288148 3300037471 Bacteria 1529
274 Ga0436364_0136730 3300037853 Bacteria 39336
275 Ga0395901_0081397 3300038443 Bacteria 3382
276 Ga0400483_125752 3300039062 Bacteria 5599
277 Ga0400483_129555 3300039062 Bacteria 1373
278 Ga0400483_276140 3300039062 Bacteria 5796
279 Ga0439453_0001733 3300041408 Bacteria 2874
280 Ga0439465_0037328 3300041413 Bacteria 1562
281 Ga0451837_0272173 3300041494 Bacteria 5633
282 Ga0451839_0211155 3300041496 Bacteria 7198
283 Ga0451839_0320786 3300041496 Bacteria 1766
284 Ga0451841_0285467 3300041498 Bacteria 3671
285 Ga0451846_06798 3300041502 Bacteria 1523
286 Ga0451847_0335240 3300041503 Bacteria 6928
287 Ga0451851_1232134 3300041507 Bacteria 2421
288 Ga0439443_002782 3300042003 Bacteria 2132
289 Ga0439432_002182 3300042006 Bacteria 7390
290 Ga0439444_0005247 3300042437 Bacteria 1915
291 Ga0466957_0034522 3300044842 Bacteria 3034
292 Ga0466967_0003883 3300045976 Bacteria 9910
293 Ga0495592_0062304 3300046454 Bacteria 2739
294 Ga0495638_0005945 3300046460 Bacteria 8956
295 Ga0495638_0020829 3300046460 Bacteria 4330
296 Ga0495606_0020615 3300046507 Bacteria 4852
297 Ga0495618_0112876 3300046514 Bacteria 1740
298 Ga0495637_0030954 3300046520 Bacteria 2370
299 Ga0495643_0060192 3300046522 Bacteria 2016
300 Ga0495648_0053832 3300046524 Bacteria 2435
301 Ga0495648_0093833 3300046524 Bacteria 1673
302 Ga0495663_0002526 3300046525 Bacteria 5482
303 Ga0495597_0033711 3300046542 Bacteria 2317
304 Ga0495625_0031914 3300046660 Bacteria 3913
305 Ga0495625_0035970 3300046660 Bacteria 3644
306 Ga0495625_0065895 3300046660 Bacteria 2552
307 Ga0495613_0017681 3300046689 Bacteria 5312
308 Ga0495660_0047003 3300046810 Bacteria 2365
309 Ga0495604_0101348 3300047317 Bacteria 2115
310 Ga0495687_000093 3300047443 Bacteria 138076
311 Ga0496101_0044965 3300048904 Bacteria 3161
312 Ga0496101_0046485 3300048904 Bacteria 3113
313 Ga0496104_0002291 3300048907 Bacteria 16513
314 Ga0496105_0006057 3300048908 Bacteria 9252
315 Ga0496106_0000401 3300048909 Bacteria 30792
316 Ga0496110_0040019 3300048913 Bacteria 4084
317 Ga0496112_0020327 3300048915 Bacteria 6291
318 Ga0496112_0210323 3300048915 Bacteria 1903
319 Ga0496113_0019814 3300048916 Bacteria 4715
320 Ga0496115_0090644 3300048918 Bacteria 2497
321 Ga0496117_0002425 3300048920 Bacteria 23586
322 Ga0496119_0008989 3300048922 Bacteria 8672
323 Ga0496119_0009293 3300048922 Bacteria 8463
324 Ga0496119_0093093 3300048922 Bacteria 1708
325 Ga0496120_0001004 3300048923 Bacteria 38046
326 Ga0496120_0001561 3300048923 Bacteria 26795
327 Ga0496121_0001339 3300048924 Bacteria 42173
328 Ga0496121_0003845 3300048924 Bacteria 20886
329 Ga0496121_0020002 3300048924 Bacteria 6659
330 Ga0496121_0133652 3300048924 Bacteria 1852
331 Ga0496122_0023231 3300048925 Bacteria 5475
332 Ga0496124_0017382 3300048927 Bacteria 6778
333 Ga0496124_0053093 3300048927 Bacteria 3439
334 Ga0496124_0135121 3300048927 Bacteria 1953
335 Ga0496126_0071839 3300048929 Bacteria 3080
336 Ga0496126_0113058 3300048929 Bacteria 2364
337 Ga0495678_000490 3300049459 Bacteria 39259
338 Ga0501031_0000037 3300049568 Bacteria 73210
339 Ga0501031_0031159 3300049568 Bacteria 3479
340 Ga0501032_0000081 3300049569 Bacteria 82613
341 Ga0501032_0010364 3300049569 Bacteria 6720
342 Ga0501033_0000097 3300049570 Bacteria 83228
343 Ga0501033_0001819 3300049570 Bacteria 18627
344 Ga0501033_0069064 3300049570 Bacteria 2598
345 Ga0501033_0095452 3300049570 Bacteria 2173
346 Ga0501033_0140567 3300049570 Bacteria 1745
347 Ga0501033_0140830 3300049570 Bacteria 1743
348 Ga0501034_0000186 3300049571 Bacteria 116500
349 Ga0501034_0011702 3300049571 Bacteria 9076
350 Ga0501034_0015707 3300049571 Bacteria 7774
351 Ga0501034_0049375 3300049571 Bacteria 4245
352 Ga0501034_0071994 3300049571 Bacteria 3465
353 Ga0501034_0174198 3300049571 Bacteria 2118
354 Ga0501034_0181136 3300049571 Bacteria 2072
355 Ga0501034_0181436 3300049571 Bacteria 2070
356 Ga0501036_0000002 3300049572 Bacteria 293106
357 Ga0501036_0035447 3300049572 Bacteria 4223
358 Ga0501037_0000095 3300049573 Bacteria 82641
359 Ga0501037_0000544 3300049573 Bacteria 30056
360 Ga0501038_0000002 3300049574 Bacteria 330446
361 Ga0501038_0010827 3300049574 Bacteria 8335
362 Ga0501039_0000002 3300049575 Bacteria 375152
363 Ga0501043_0000081 3300049579 Bacteria 85059
364 Ga0501043_0000162 3300049579 Bacteria 60676
365 Ga0501043_0083901 3300049579 Bacteria 2504
366 Ga0501043_0121154 3300049579 Bacteria 2052
367 Ga0501047_0013114 3300049581 Bacteria 7849
368 Ga0501047_0028624 3300049581 Bacteria 5373
369 Ga0501047_0032632 3300049581 Bacteria 5028
370 Ga0501047_0057636 3300049581 Bacteria 3756
371 Ga0501047_0083410 3300049581 Bacteria 3072
372 Ga0501047_0126474 3300049581 Bacteria 2436
373 Ga0501048_0008862 3300049582 Bacteria 7575
374 Ga0501069_0000134 3300049585 Bacteria 32368
375 Ga0501069_0007803 3300049585 Bacteria 5619
376 Ga0501069_0008160 3300049585 Bacteria 5499
377 Ga0501069_0070276 3300049585 Bacteria 1961
378 Ga0501070_0000127 3300049586 Bacteria 68100
379 Ga0501070_0003125 3300049586 Bacteria 14415
380 Ga0501070_0011935 3300049586 Bacteria 7339
381 Ga0501070_0019237 3300049586 Bacteria 5728
382 Ga0501070_0019893 3300049586 Bacteria 5630
383 Ga0501070_0030810 3300049586 Bacteria 4493
384 Ga0501070_0082190 3300049586 Bacteria 2666
385 Ga0501070_0095903 3300049586 Bacteria 2454
386 Ga0501070_0183808 3300049586 Bacteria 1720
387 Ga0501073_0021678 3300049589 Bacteria 4628
388 Ga0501074_0000062 3300049590 Bacteria 51831
389 Ga0501074_0034633 3300049590 Bacteria 3660
390 Ga0501074_0116443 3300049590 Bacteria 1912
391 Ga0501238_000977 3300049671 Bacteria 3280
392 Ga0501080_0003969 3300049742 Bacteria 13102
393 Ga0501080_0006377 3300049742 Bacteria 10582
394 Ga0501080_0022623 3300049742 Bacteria 5822
395 Ga0501080_0050515 3300049742 Bacteria 3870
396 Ga0501080_0088084 3300049742 Bacteria 2884
397 Ga0501083_0000090 3300049744 Bacteria 62000
398 Ga0501083_0010693 3300049744 Bacteria 6456
399 Ga0501083_0056866 3300049744 Bacteria 2620
400 Ga0501035_0000017 3300049822 Bacteria 241915
401 Ga0501035_0000100 3300049822 Bacteria 107321
402 Ga0501035_0004245 3300049822 Bacteria 13610
403 Ga0501035_0004321 3300049822 Bacteria 13498
404 Ga0501035_0063627 3300049822 Bacteria 3280
405 Ga0501035_0163124 3300049822 Bacteria 1928
406 Ga0501044_0000002 3300049823 Bacteria 375152
407 Ga0501044_0000034 3300049823 Bacteria 164058
408 Ga0501044_0002611 3300049823 Bacteria 20470
409 Ga0501044_0010034 3300049823 Bacteria 10291
410 Ga0501044_0031266 3300049823 Bacteria 5604
411 Ga0501044_0036441 3300049823 Bacteria 5147
412 Ga0501044_0059404 3300049823 Bacteria 3918
413 Ga0501044_0174846 3300049823 Bacteria 2117
414 Ga0501044_0176194 3300049823 Bacteria 2107
415 Ga0501044_0180837 3300049823 Bacteria 2076
416 nmdc:mga03683_48937_c1 3300050489 Bacteria 1758
417 nmdc:mga03683_49383_c1 3300050489 Bacteria 1751
418 nmdc:mga03n38_10129_c1 3300050490 Bacteria 3456
419 nmdc:mga00v17_3727_c1 3300050491 Bacteria 7865
420 nmdc:mga0k408_4751_c1 3300050493 Bacteria 7198
421 nmdc:mga06z11_34377_c1 3300050494 Bacteria 2488
422 nmdc:mga05p37_4579_c1 3300050507 Bacteria 16168
423 nmdc:mga09592_13305_c1 3300050508 Bacteria 6719
424 nmdc:mga06r32_4723_c1 3300050510 Bacteria 12250
425 nmdc:mga0sz30_14444_c2 3300050516 Bacteria 2770
426 Ga0495595_0026681 3300053084 Bacteria 2568
427 Ga0495619_0033609 3300053085 Bacteria 3331
428 Ga0500643_000018 3300053087 Bacteria 296505
429 Ga0500641_0006489 3300053096 Bacteria 4150
430 Ga0500618_009764 3300053125 Bacteria 2606
431 Ga0500652_007683 3300053131 Bacteria 3546
432 Ga0500658_0001854 3300053134 Bacteria 8315
433 Ga0500568_0000188 3300053139 Bacteria 54105
434 Ga0500574_000004 3300053141 Bacteria 79976
435 Ga0500590_004310 3300053148 Bacteria 6696
436 Ga0500604_0020877 3300053151 Bacteria 1847
437 Ga0500616_0006201 3300053153 Bacteria 7888
438 Ga0500616_0049896 3300053153 Bacteria 2212
439 Ga0500622_0000533 3300053156 Bacteria 35317
440 Ga0500624_002448 3300053157 Bacteria 2517
441 Ga0500627_0012765 3300053158 Bacteria 3160
442 Ga0500634_0009499 3300053161 Bacteria 4926
443 Ga0500638_000058 3300053162 Bacteria 21331
444 Ga0501084_0098668 3300054114 Bacteria 2453
445 Ga0501082_0000859 3300060353 Bacteria 26851
446 Ga0501082_0029278 3300060353 Bacteria 4743
447 Ga0501082_0083154 3300060353 Bacteria 2762
448 Ga0530510_0298814 3300061734 Bacteria 1205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006042 Ga0075368_10007117 Ga0075368_100071174 364
2 iso_pu_bacteria 2924214083 2924221297 366
3 iso_pu_bacteria 2924221636 2924227763 366
4 3300061734 Ga0530510_0298814 Ga0530510_0298814_65_1180 370
5 iso_pu_bacteria 2885334103 2885339151 375
6 iso_pu_bacteria 2881861095 2881865422 388
7 iso_pu_bacteria 8004395343 8004396297 396
8 iso_pu_bacteria 2906427513 2906434819 399
9 iso_pu_bacteria 3003930520 3003935262 402
10 3300039062 Ga0400483_129555 Ga0400483_129555_124_1347 406
11 3300049823 Ga0501044_0176194 Ga0501044_0176194_847_2085 409
12 3300041502 Ga0451846_06798 Ga0451846_06798_13_1263 416
13 iso_pu_bacteria 2881845957 2881850190 416
14 iso_pu_bacteria 2968138860 2968146312 417
15 3300025939 Ga0207665_10001690 Ga0207665_1000169013 426
16 3300048904 Ga0496101_0044965 Ga0496101_0044965_25_1308 426
17 3300006844 Ga0075428_100080643 Ga0075428_1000806432 427
18 3300006847 Ga0075431_100001771 Ga0075431_1000017719 427
19 3300006880 Ga0075429_100002539 Ga0075429_10000253916 427
20 3300009147 Ga0114129_10001020 Ga0114129_1000102034 427
21 3300027907 Ga0207428_10007598 Ga0207428_100075985 427
22 3300049570 Ga0501033_0095452 Ga0501033_0095452_500_1795 427
23 3300049572 Ga0501036_0035447 Ga0501036_0035447_1973_3268 427
24 3300049579 Ga0501043_0121154 Ga0501043_0121154_607_1902 427
25 3300049586 Ga0501070_0030810 Ga0501070_0030810_923_2218 427
26 3300050507 nmdc:mga05p37_4579_c1 nmdc:mga05p37_4579_c1_12321_13616 427
27 3300050508 nmdc:mga09592_13305_c1 nmdc:mga09592_13305_c1_4026_5321 427
28 3300050510 nmdc:mga06r32_4723_c1 nmdc:mga06r32_4723_c1_5922_7217 427
29 iso_pu_bacteria 2839993093 2839996440 428
30 iso_pu_bacteria 2904578770 2904582572 428
31 iso_pu_bacteria 2919119836 2919124052 428
32 iso_pu_bacteria 2928521798 2928525056 428
33 iso_pu_bacteria 2954011201 2954011331 428
34 iso_pu_bacteria 3002141150 3002145427 428
35 3300049586 Ga0501070_0082190 Ga0501070_0082190_167_1465 429
36 3300049823 Ga0501044_0174846 Ga0501044_0174846_548_1906 429
37 3300053096 Ga0500641_0006489 Ga0500641_0006489_15_1316 429
38 3300053139 Ga0500568_0000188 Ga0500568_0000188_41616_42917 429
39 iso_pu_bacteria 2511231027 2511391072 429
40 iso_pu_bacteria 2765235802 2765467221 429
41 iso_pu_bacteria 2767802442 2770198721 429
42 iso_pu_bacteria 2775506902 2776273025 429
43 iso_pu_bacteria 2775506904 2776282132 429
44 iso_pu_bacteria 2840764183 2840770378 429
45 iso_pu_bacteria 2842871566 2842874204 429
46 iso_pu_bacteria 2503198000 2503203074 430
47 iso_pu_bacteria 2508501123 2509114795 430
48 iso_pu_bacteria 2508501127 2509143386 430
49 iso_pu_bacteria 2509276018 2509373754 430
50 iso_pu_bacteria 2509276022 2509397539 430
51 iso_pu_bacteria 2510065059 2510319388 430
52 iso_pu_bacteria 2512875016 2512930115 430
53 iso_pu_bacteria 2512875024 2512964802 430
54 iso_pu_bacteria 2513237090 2513611812 430
55 iso_pu_bacteria 2513237164 2514033101 430
56 iso_pu_bacteria 2513237305 2514422465 430
57 iso_pu_bacteria 2513237351 2514589747 430
58 iso_pu_bacteria 2588253730 2588515731 430
59 iso_pu_bacteria 2597489875 2597812807 430
60 iso_pu_bacteria 2597489875 2597814806 430
61 iso_pu_bacteria 2599185301 2599937371 430
62 iso_pu_bacteria 2643221550 2643773524 430
63 iso_pu_bacteria 2643221564 2643837276 430
64 iso_pu_bacteria 2643221595 2643986631 430
65 iso_pu_bacteria 2643221627 2644157566 430
66 iso_pu_bacteria 2687453392 2688599933 430
67 iso_pu_bacteria 2693429783 2694634005 430
68 iso_pu_bacteria 2693429784 2694638624 430
69 iso_pu_bacteria 2721755686 2723576732 430
70 iso_pu_bacteria 2756170246 2756677843 430
71 iso_pu_bacteria 2791355123 2792748914 430
72 iso_pu_bacteria 2841734538 2841740889 430
73 iso_pu_bacteria 2844002411 2844005984 430
74 iso_pu_bacteria 2844009547 2844015199 430
75 iso_pu_bacteria 2847670302 2847671165 430
76 iso_pu_bacteria 2847686936 2847687304 430
77 iso_pu_bacteria 2856314179 2856316679 430
78 iso_pu_bacteria 2856320880 2856324604 430
79 iso_pu_bacteria 2856328259 2856333185 430
80 iso_pu_bacteria 2856334872 2856339160 430
81 iso_pu_bacteria 2856342000 2856342209 430
82 iso_pu_bacteria 2856349417 2856352543 430
83 iso_pu_bacteria 2857349434 2857355275 430
84 iso_pu_bacteria 2857367948 2857368936 430
85 iso_pu_bacteria 2869162929 2869167916 430
86 iso_pu_bacteria 2869234852 2869238660 430
87 iso_pu_bacteria 2869242130 2869243410 430
88 iso_pu_bacteria 2869249662 2869254760 430
89 iso_pu_bacteria 2869256925 2869263167 430
90 iso_pu_bacteria 2869264136 2869268936 430
91 iso_pu_bacteria 2869271264 2869272397 430
92 iso_pu_bacteria 2869278585 2869281399 430
93 iso_pu_bacteria 2869285874 2869292134 430
94 iso_pu_bacteria 2871429161 2871435341 430
95 iso_pu_bacteria 2871435913 2871443814 430
96 iso_pu_bacteria 2871444079 2871447452 430
97 iso_pu_bacteria 2871451962 2871452723 430
98 iso_pu_bacteria 2871459585 2871463839 430
99 iso_pu_bacteria 2871466892 2871467227 430
100 iso_pu_bacteria 2871474448 2871477987 430
101 iso_pu_bacteria 2871481445 2871486637 430
102 iso_pu_bacteria 2871488783 2871488810 430
103 iso_pu_bacteria 2871495908 2871495980 430
104 iso_pu_bacteria 2874102143 2874108610 430
105 iso_pu_bacteria 2874116593 2874123311 430
106 iso_pu_bacteria 2874123672 2874131141 430
107 iso_pu_bacteria 2874131515 2874134752 430
108 iso_pu_bacteria 2874139085 2874140935 430
109 iso_pu_bacteria 2874146452 2874155042 430
110 iso_pu_bacteria 2874155637 2874161361 430
111 iso_pu_bacteria 2874162495 2874164625 430
112 iso_pu_bacteria 2874168670 2874170419 430
113 iso_pu_bacteria 2876363079 2876366321 430
114 iso_pu_bacteria 2876386047 2876387022 430
115 iso_pu_bacteria 2876392853 2876395516 430
116 iso_pu_bacteria 2876399893 2876404034 430
117 iso_pu_bacteria 2876406927 2876411607 430
118 iso_pu_bacteria 2876413966 2876420498 430
119 iso_pu_bacteria 2876420981 2876423308 430
120 iso_pu_bacteria 2878035449 2878036889 430
121 iso_pu_bacteria 2878730984 2878737675 430
122 iso_pu_bacteria 2878738818 2878742714 430
123 iso_pu_bacteria 2878745973 2878752476 430
124 iso_pu_bacteria 2878753008 2878753573 430
125 iso_pu_bacteria 2878760144 2878760213 430
126 iso_pu_bacteria 2878767105 2878767173 430
127 iso_pu_bacteria 2878774303 2878778658 430
128 iso_pu_bacteria 2878781027 2878787065 430
129 iso_pu_bacteria 2878788777 2878788999 430
130 iso_pu_bacteria 2881147464 2881152292 430
131 iso_pu_bacteria 2881155292 2881156692 430
132 iso_pu_bacteria 2881161766 2881162110 430
133 iso_pu_bacteria 2882632389 2882633483 430
134 iso_pu_bacteria 2882912400 2882919615 430
135 iso_pu_bacteria 2885305155 2885310952 430
136 iso_pu_bacteria 2885312484 2885316592 430
137 iso_pu_bacteria 2885318864 2885319354 430
138 iso_pu_bacteria 2885326080 2885327688 430
139 iso_pu_bacteria 2888350351 2888357288 430
140 iso_pu_bacteria 2889010040 2889012242 430
141 iso_pu_bacteria 2889016732 2889022865 430
142 iso_pu_bacteria 2889790730 2889794944 430
143 iso_pu_bacteria 2889914905 2889918309 430
144 iso_pu_bacteria 2903448605 2903452580 430
145 iso_pu_bacteria 2903492973 2903495469 430
146 iso_pu_bacteria 2903492973 2903505351 430
147 iso_pu_bacteria 2903521522 2903524189 430
148 iso_pu_bacteria 2903528002 2903533628 430
149 iso_pu_bacteria 2903540706 2903540775 430
150 iso_pu_bacteria 2904659560 2904662147 430
151 iso_pu_bacteria 2906308376 2906314870 430
152 iso_pu_bacteria 2906321335 2906328042 430
153 iso_pu_bacteria 2906328253 2906332687 430
154 iso_pu_bacteria 2906354277 2906355398 430
155 iso_pu_bacteria 2906363423 2906365459 430
156 iso_pu_bacteria 2906370794 2906377784 430
157 iso_pu_bacteria 2906378014 2906380482 430
158 iso_pu_bacteria 2906386501 2906391396 430
159 iso_pu_bacteria 2906393657 2906397836 430
160 iso_pu_bacteria 2906401398 2906403381 430
161 iso_pu_bacteria 2906408224 2906412023 430
162 iso_pu_bacteria 2906414383 2906416816 430
163 iso_pu_bacteria 2922151315 2922151742 430
164 iso_pu_bacteria 2922158528 2922161644 430
165 iso_pu_bacteria 2922172374 2922174973 430
166 iso_pu_bacteria 2922178524 2922183795 430
167 iso_pu_bacteria 2922185730 2922191958 430
168 iso_pu_bacteria 2924710171 2924714595 430
169 iso_pu_bacteria 2924726620 2924728829 430
170 iso_pu_bacteria 2924733363 2924735180 430
171 iso_pu_bacteria 2924741084 2924743013 430
172 iso_pu_bacteria 2924748358 2924748406 430
173 iso_pu_bacteria 2924762789 2924765731 430
174 iso_pu_bacteria 2924776078 2924780514 430
175 iso_pu_bacteria 2924784321 2924791985 430
176 iso_pu_bacteria 2937813078 2937821268 430
177 iso_pu_bacteria 2937822353 2937825675 430
178 iso_pu_bacteria 2937836603 2937839452 430
179 iso_pu_bacteria 2937843397 2937843616 430
180 iso_pu_bacteria 2937848649 2937855252 430
181 iso_pu_bacteria 2937861824 2937863026 430
182 iso_pu_bacteria 2937877337 2937883040 430
183 iso_pu_bacteria 2937891427 2937895477 430
184 iso_pu_bacteria 2937972304 2937973790 430
185 iso_pu_bacteria 2937994558 2937994630 430
186 iso_pu_bacteria 2938014810 2938019856 430
187 iso_pu_bacteria 2958034702 2958037361 430
188 iso_pu_bacteria 2958041894 2958047073 430
189 iso_pu_bacteria 2958064165 2958069607 430
190 iso_pu_bacteria 2958071322 2958076669 430
191 iso_pu_bacteria 2958084443 2958090166 430
192 iso_pu_bacteria 2958092219 2958098360 430
193 iso_pu_bacteria 2958100919 2958103440 430
194 iso_pu_bacteria 2958115193 2958117715 430
195 iso_pu_bacteria 2958122699 2958127571 430
196 iso_pu_bacteria 2958130278 2958136534 430
197 iso_pu_bacteria 2958137437 2958143731 430
198 iso_pu_bacteria 2958158011 2958160001 430
199 iso_pu_bacteria 2958165035 2958165108 430
200 iso_pu_bacteria 2958179912 2958186028 430
201 iso_pu_bacteria 2961077736 2961084509 430
202 iso_pu_bacteria 2961114664 2961117301 430
203 iso_pu_bacteria 2961127735 2961136462 430
204 iso_pu_bacteria 2961163497 2961163568 430
205 iso_pu_bacteria 2961170736 2961170763 430
206 iso_pu_bacteria 2961183825 2961185474 430
207 iso_pu_bacteria 2963644680 2963649117 430
208 iso_pu_bacteria 2965018300 2965018371 430
209 iso_pu_bacteria 2965025482 2965030457 430
210 iso_pu_bacteria 2965032056 2965040067 430
211 iso_pu_bacteria 2965040258 2965041504 430
212 iso_pu_bacteria 2965047637 2965051233 430
213 iso_pu_bacteria 2965062239 2965063082 430
214 iso_pu_bacteria 2965089291 2965090475 430
215 iso_pu_bacteria 2965102966 2965105398 430
216 iso_pu_bacteria 2965110997 2965111410 430
217 iso_pu_bacteria 2965119406 2965127147 430
218 iso_pu_bacteria 2967996073 2968003342 430
219 iso_pu_bacteria 2968003550 2968004109 430
220 iso_pu_bacteria 2968016561 2968019798 430
221 iso_pu_bacteria 2968083720 2968084361 430
222 iso_pu_bacteria 2968091066 2968096729 430
223 iso_pu_bacteria 2968097103 2968099931 430
224 iso_pu_bacteria 2968110612 2968113209 430
225 iso_pu_bacteria 2968117919 2968123626 430
226 iso_pu_bacteria 2968128360 2968132895 430
227 iso_pu_bacteria 2968171901 2968171971 430
228 iso_pu_bacteria 2970469710 2970473119 430
229 iso_pu_bacteria 2970489779 2970495272 430
230 iso_pu_bacteria 2970503327 2970503353 430
231 iso_pu_bacteria 2970510686 2970515727 430
232 iso_pu_bacteria 2970524798 2970531351 430
233 iso_pu_bacteria 2970532167 2970536714 430
234 iso_pu_bacteria 2970540015 2970546701 430
235 iso_pu_bacteria 2970547951 2970550512 430
236 iso_pu_bacteria 2970554993 2970555064 430
237 iso_pu_bacteria 2970593180 2970596003 430
238 iso_pu_bacteria 2970619444 2970622301 430
239 iso_pu_bacteria 2970627176 2970629282 430
240 iso_pu_bacteria 2977821940 2977822790 430
241 iso_pu_bacteria 2977828996 2977830965 430
242 iso_pu_bacteria 2977843712 2977849531 430
243 iso_pu_bacteria 2977851361 2977855901 430
244 iso_pu_bacteria 2977858184 2977863062 430
245 iso_pu_bacteria 2977864932 2977866402 430
246 iso_pu_bacteria 2977872689 2977876194 430
247 iso_pu_bacteria 2977898635 2977900281 430
248 iso_pu_bacteria 2977915119 2977917470 430
249 iso_pu_bacteria 2977922695 2977926934 430
250 iso_pu_bacteria 2977935797 2977939356 430
251 iso_pu_bacteria 2977942078 2977948820 430
252 iso_pu_bacteria 2977950692 2977952854 430
253 iso_pu_bacteria 2977971508 2977975100 430
254 iso_pu_bacteria 2977986579 2977988273 430
255 iso_pu_bacteria 2979710463 2979714248 430
256 iso_pu_bacteria 2979742915 2979747239 430
257 iso_pu_bacteria 2979764755 2979769642 430
258 iso_pu_bacteria 2979779861 2979780369 430
259 iso_pu_bacteria 2979793036 2979800655 430
260 iso_pu_bacteria 2979808191 2979815582 430
261 iso_pu_bacteria 2987636660 2987640408 430
262 iso_pu_bacteria 2987645492 2987651867 430
263 iso_pu_bacteria 2987652177 2987656218 430
264 iso_pu_bacteria 2987659509 2987659576 430
265 iso_pu_bacteria 2987666974 2987673056 430
266 iso_pu_bacteria 2987673487 2987679977 430
267 iso_pu_bacteria 2996310559 2996316698 430
268 iso_pu_bacteria 2996341866 2996343343 430
269 iso_pu_bacteria 2996348954 2996351757 430
270 iso_pu_bacteria 2996386984 2996389571 430
271 iso_pu_bacteria 3000135777 3000139026 430
272 iso_pu_bacteria 3004167301 3004170688 430
273 iso_pu_bacteria 3004188549 3004188619 430
274 iso_pu_bacteria 3004195979 3004199266 430
275 iso_pu_bacteria 3004203850 3004208606 430
276 iso_pu_bacteria 3004211236 3004214855 430
277 iso_pu_bacteria 3004218560 3004222554 430
278 iso_pu_bacteria 3004232784 3004239163 430
279 iso_pu_bacteria 3004239961 3004240564 430
280 iso_pu_bacteria 3004248173 3004255142 430
281 iso_pu_bacteria 3004268573 3004271726 430
282 iso_pu_bacteria 3004275668 3004278457 430
283 iso_pu_bacteria 3004289098 3004289975 430
284 iso_pu_bacteria 3004334049 3004339651 430
285 iso_pu_bacteria 649633066 649874411 430
286 iso_pu_bacteria 8004300914 8004301784 430
287 iso_pu_bacteria 8004312739 8004316074 430
288 iso_pu_bacteria 8004361976 8004367455 430
289 iso_pu_bacteria 8004374579 8004375146 430
290 iso_pu_bacteria 8004387939 8004394886 430
291 iso_pu_bacteria 8004445564 8004450540 430
292 iso_pu_bacteria 8004633249 8004635341 430
293 iso_pu_bacteria 8004640170 8004642836 430
294 iso_pu_bacteria 8004703790 8004711598 430
295 iso_pu_bacteria 8004714634 8004721131 430
296 iso_pu_bacteria 8004727605 8004728085 430
297 iso_pu_bacteria 8055617313 8055622485 430
298 3300005333 Ga0070677_10040469 Ga0070677_100404692 431
299 3300005356 Ga0070674_100025116 Ga0070674_1000251164 431
300 3300005618 Ga0068864_100023236 Ga0068864_1000232365 431
301 3300014326 Ga0157380_10043299 Ga0157380_100432992 431
302 3300025893 Ga0207682_10003844 Ga0207682_100038446 431
303 3300025907 Ga0207645_10052771 Ga0207645_100527712 431
304 3300025940 Ga0207691_10001569 Ga0207691_1000156917 431
305 3300025986 Ga0207658_10009123 Ga0207658_100091234 431
306 3300026089 Ga0207648_10021142 Ga0207648_100211426 431
307 3300026121 Ga0207683_10013355 Ga0207683_100133552 431
308 3300031247 Ga0265340_10003501 Ga0265340_100035013 431
309 3300031712 Ga0265342_10106380 Ga0265342_101063801 431
310 3300049571 Ga0501034_0049375 Ga0501034_0049375_1116_2423 431
311 3300049581 Ga0501047_0013114 Ga0501047_0013114_5418_6725 431
312 3300060353 Ga0501082_0029278 Ga0501082_0029278_2159_3466 431
313 iso_pu_bacteria 2924718760 2924718894 431
314 3300003578 Ga0006562J51391_1050999 Ga0006562J51391_10509991 432
315 3300005330 Ga0070690_100003390 Ga0070690_1000033908 432
316 3300005336 Ga0070680_100011068 Ga0070680_1000110685 432
317 3300005339 Ga0070660_100009955 Ga0070660_1000099552 432
318 3300005436 Ga0070713_100004226 Ga0070713_1000042265 432
319 3300005437 Ga0070710_10018121 Ga0070710_100181212 432
320 3300005439 Ga0070711_100053024 Ga0070711_1000530243 432
321 3300005466 Ga0070685_10098755 Ga0070685_100987552 432
322 3300005530 Ga0070679_100013927 Ga0070679_1000139275 432
323 3300005530 Ga0070679_100121312 Ga0070679_1001213122 432
324 3300005616 Ga0068852_100027394 Ga0068852_1000273944 432
325 3300005618 Ga0068864_100211028 Ga0068864_1002110281 432
326 3300005844 Ga0068862_100097901 Ga0068862_1000979012 432
327 3300009148 Ga0105243_10183792 Ga0105243_101837921 432
328 3300009176 Ga0105242_10135105 Ga0105242_101351052 432
329 3300009177 Ga0105248_10278306 Ga0105248_102783061 432
330 3300009551 Ga0105238_10020832 Ga0105238_100208326 432
331 3300013307 Ga0157372_10296950 Ga0157372_102969501 432
332 3300025915 Ga0207693_10024602 Ga0207693_100246023 432
333 3300025916 Ga0207663_10062362 Ga0207663_100623622 432
334 3300025919 Ga0207657_10011163 Ga0207657_100111635 432
335 3300025924 Ga0207694_10033546 Ga0207694_100335462 432
336 3300025941 Ga0207711_10205091 Ga0207711_102050911 432
337 3300025949 Ga0207667_10357437 Ga0207667_103574371 432
338 3300026023 Ga0207677_10149329 Ga0207677_101493292 432
339 3300026041 Ga0207639_10058201 Ga0207639_100582013 432
340 3300026078 Ga0207702_10095411 Ga0207702_100954112 432
341 3300026095 Ga0207676_10203627 Ga0207676_102036272 432
342 3300026142 Ga0207698_10032574 Ga0207698_100325743 432
343 3300028380 Ga0268265_10048249 Ga0268265_100482493 432
344 3300031241 Ga0265325_10001113 Ga0265325_100011137 432
345 3300031241 Ga0265325_10080780 Ga0265325_100807801 432
346 3300031247 Ga0265340_10018288 Ga0265340_100182883 432
347 3300031595 Ga0265313_10012187 Ga0265313_100121875 432
348 3300031665 Ga0316575_10033680 Ga0316575_100336802 432
349 3300031712 Ga0265342_10013871 Ga0265342_100138713 432
350 3300035691 Ga0373931_0101102 Ga0373931_0101102_12_1322 432
351 3300035692 Ga0373935_0031762 Ga0373935_0031762_311_1621 432
352 3300037068 Ga0373925_0060638 Ga0373925_0060638_1287_2597 432
353 3300037068 Ga0373925_0101987 Ga0373925_0101987_818_2128 432
354 3300044842 Ga0466957_0034522 Ga0466957_0034522_1091_2401 432
355 3300045976 Ga0466967_0003883 Ga0466967_0003883_6565_7875 432
356 3300046454 Ga0495592_0062304 Ga0495592_0062304_181_1491 432
357 3300048904 Ga0496101_0046485 Ga0496101_0046485_121_1431 432
358 3300048913 Ga0496110_0040019 Ga0496110_0040019_1816_3126 432
359 3300048925 Ga0496122_0023231 Ga0496122_0023231_1616_2914 432
360 3300048927 Ga0496124_0017382 Ga0496124_0017382_1778_3076 432
361 3300049570 Ga0501033_0140830 Ga0501033_0140830_298_1608 432
362 3300049571 Ga0501034_0015707 Ga0501034_0015707_3559_4869 432
363 3300049571 Ga0501034_0174198 Ga0501034_0174198_19_1329 432
364 3300049571 Ga0501034_0181136 Ga0501034_0181136_370_1680 432
365 3300049571 Ga0501034_0181436 Ga0501034_0181436_413_1723 432
366 3300049574 Ga0501038_0010827 Ga0501038_0010827_38_1348 432
367 3300049582 Ga0501048_0008862 Ga0501048_0008862_2959_4269 432
368 3300049585 Ga0501069_0008160 Ga0501069_0008160_529_1839 432
369 3300049585 Ga0501069_0070276 Ga0501069_0070276_13_1323 432
370 3300049589 Ga0501073_0021678 Ga0501073_0021678_135_1445 432
371 3300049590 Ga0501074_0034633 Ga0501074_0034633_2129_3439 432
372 3300049742 Ga0501080_0022623 Ga0501080_0022623_136_1446 432
373 3300049744 Ga0501083_0010693 Ga0501083_0010693_196_1506 432
374 3300049822 Ga0501035_0063627 Ga0501035_0063627_442_1752 432
375 3300053084 Ga0495595_0026681 Ga0495595_0026681_275_1585 432
376 3300053085 Ga0495619_0033609 Ga0495619_0033609_1581_2891 432
377 3300054114 Ga0501084_0098668 Ga0501084_0098668_791_2101 432
378 3300003215 JGI25153J46596_10003651 JGI25153J46596_100036514 433
379 3300025297 Ga0209758_1000128 Ga0209758_10001287 433
380 3300002741 JGI25157J39369_1000888 JGI25157J39369_10008889 434
381 3300003203 JGI25406J46586_10007067 JGI25406J46586_100070676 434
382 3300003214 JGI25165J46597_1000070 JGI25165J46597_100007071 434
383 3300003762 Ga0055542_1000344 Ga0055542_100034443 434
384 3300003762 Ga0055542_1000824 Ga0055542_10008245 434
385 3300005539 Ga0068853_100059049 Ga0068853_1000590493 434
386 3300005548 Ga0070665_100009839 Ga0070665_1000098392 434
387 3300005985 Ga0081539_10003026 Ga0081539_1000302623 434
388 3300006038 Ga0075365_10002849 Ga0075365_100028495 434
389 3300006038 Ga0075365_10014080 Ga0075365_100140802 434
390 3300006051 Ga0075364_10005593 Ga0075364_100055936 434
391 3300025250 Ga0209026_1000002 Ga0209026_10000021020 434
392 3300025254 Ga0209148_1000123 Ga0209148_1000123122 434
393 3300025254 Ga0209148_1004051 Ga0209148_10040512 434
394 3300025256 Ga0209759_1000677 Ga0209759_10006779 434
395 3300025261 Ga0209233_1000131 Ga0209233_100013185 434
396 3300025272 Ga0209455_1000129 Ga0209455_100012991 434
397 3300025297 Ga0209758_1003449 Ga0209758_100344915 434
398 3300025904 Ga0207647_10046972 Ga0207647_100469722 434
399 3300025914 Ga0207671_10009485 Ga0207671_1000948510 434
400 3300026067 Ga0207678_10016380 Ga0207678_100163803 434
401 3300026089 Ga0207648_10071108 Ga0207648_100711082 434
402 3300028379 Ga0268266_10006748 Ga0268266_100067489 434
403 3300037418 Ga0395900_0038974 Ga0395900_0038974_2343_3656 434
404 3300037466 Ga0395898_0093723 Ga0395898_0093723_1231_2544 434
405 3300037471 Ga0395905_0075752 Ga0395905_0075752_48_1361 434
406 3300038443 Ga0395901_0081397 Ga0395901_0081397_1858_3171 434
407 3300046660 Ga0495625_0065895 Ga0495625_0065895_479_1792 434
408 3300048907 Ga0496104_0002291 Ga0496104_0002291_11904_13211 434
409 3300048915 Ga0496112_0020327 Ga0496112_0020327_1582_2889 434
410 3300048915 Ga0496112_0210323 Ga0496112_0210323_475_1788 434
411 3300048916 Ga0496113_0019814 Ga0496113_0019814_1973_3280 434
412 3300048918 Ga0496115_0090644 Ga0496115_0090644_931_2238 434
413 3300048922 Ga0496119_0009293 Ga0496119_0009293_3558_4865 434
414 3300048922 Ga0496119_0093093 Ga0496119_0093093_348_1655 434
415 3300048923 Ga0496120_0001561 Ga0496120_0001561_2367_3680 434
416 3300048927 Ga0496124_0053093 Ga0496124_0053093_146_1459 434
417 3300049568 Ga0501031_0000037 Ga0501031_0000037_43730_45043 434
418 3300049568 Ga0501031_0031159 Ga0501031_0031159_1715_3028 434
419 3300049569 Ga0501032_0000081 Ga0501032_0000081_43974_45287 434
420 3300049569 Ga0501032_0010364 Ga0501032_0010364_5014_6327 434
421 3300049570 Ga0501033_0000097 Ga0501033_0000097_77841_79154 434
422 3300049570 Ga0501033_0001819 Ga0501033_0001819_5033_6346 434
423 3300049571 Ga0501034_0000186 Ga0501034_0000186_37345_38658 434
424 3300049571 Ga0501034_0011702 Ga0501034_0011702_4627_5940 434
425 3300049572 Ga0501036_0000002 Ga0501036_0000002_213955_215268 434
426 3300049573 Ga0501037_0000095 Ga0501037_0000095_44002_45315 434
427 3300049573 Ga0501037_0000544 Ga0501037_0000544_25791_27104 434
428 3300049574 Ga0501038_0000002 Ga0501038_0000002_51201_52514 434
429 3300049575 Ga0501039_0000002 Ga0501039_0000002_295999_297312 434
430 3300049579 Ga0501043_0000081 Ga0501043_0000081_62929_64242 434
431 3300049579 Ga0501043_0000162 Ga0501043_0000162_43530_44843 434
432 3300049581 Ga0501047_0032632 Ga0501047_0032632_844_2157 434
433 3300049585 Ga0501069_0000134 Ga0501069_0000134_22926_24239 434
434 3300049586 Ga0501070_0000127 Ga0501070_0000127_45545_46858 434
435 3300049586 Ga0501070_0011935 Ga0501070_0011935_4676_5989 434
436 3300049586 Ga0501070_0019893 Ga0501070_0019893_2326_3639 434
437 3300049590 Ga0501074_0000062 Ga0501074_0000062_3229_4542 434
438 3300049742 Ga0501080_0006377 Ga0501080_0006377_982_2295 434
439 3300049742 Ga0501080_0050515 Ga0501080_0050515_857_2170 434
440 3300049744 Ga0501083_0000090 Ga0501083_0000090_45138_46451 434
441 3300049822 Ga0501035_0000017 Ga0501035_0000017_207043_208356 434
442 3300049822 Ga0501035_0000100 Ga0501035_0000100_28168_29481 434
443 3300049823 Ga0501044_0000002 Ga0501044_0000002_77841_79154 434
444 3300049823 Ga0501044_0000034 Ga0501044_0000034_154555_155868 434
445 3300053153 Ga0500616_0049896 Ga0500616_0049896_788_2101 434
446 3300053158 Ga0500627_0012765 Ga0500627_0012765_274_1587 434
447 3300005327 Ga0070658_10027711 Ga0070658_100277112 435
448 3300005983 Ga0081540_1044793 Ga0081540_10447931 435
449 3300006871 Ga0075434_100181674 Ga0075434_1001816743 435
450 3300009147 Ga0114129_10065536 Ga0114129_100655363 435
451 3300025917 Ga0207660_10098988 Ga0207660_100989882 435
452 3300025921 Ga0207652_10082549 Ga0207652_100825493 435
453 3300025922 Ga0207646_10140895 Ga0207646_101408952 435
454 3300025972 Ga0207668_10097601 Ga0207668_100976011 435
455 3300049742 Ga0501080_0088084 Ga0501080_0088084_19_1335 435
456 iso_pu_bacteria 2958108152 2958113279 437
457 3300037471 Ga0395905_0011767 Ga0395905_0011767_1153_2472 439
458 3300047443 Ga0495687_000093 Ga0495687_000093_118157_119491 439
459 iso_pu_bacteria 3005587118 3005592293 439
460 3300025292 Ga0209676_1000547 Ga0209676_100054738 440
461 3300026142 Ga0207698_10036666 Ga0207698_100366664 440
462 3300050489 nmdc:mga03683_49383_c1 nmdc:mga03683_49383_c1_354_1703 440
463 iso_pu_bacteria 2558860100 2558864542 440
464 iso_pu_bacteria 2791355094 2792641496 440
465 3300005563 Ga0068855_100083776 Ga0068855_1000837761 441
466 3300005616 Ga0068852_100092897 Ga0068852_1000928972 441
467 3300053087 Ga0500643_000018 Ga0500643_000018_145130_146476 441
468 3300053131 Ga0500652_007683 Ga0500652_007683_1135_2481 441
469 3300005329 Ga0070683_100129360 Ga0070683_1001293602 442
470 3300005985 Ga0081539_10004862 Ga0081539_100048625 442
471 3300009093 Ga0105240_10025766 Ga0105240_100257664 442
472 3300013104 Ga0157370_10088415 Ga0157370_100884153 442
473 3300013307 Ga0157372_10435604 Ga0157372_104356041 442
474 3300025933 Ga0207706_10036755 Ga0207706_100367552 442
475 3300025944 Ga0207661_10191916 Ga0207661_101919162 442
476 3300041408 Ga0439453_0001733 Ga0439453_0001733_687_2042 442
477 3300042003 Ga0439443_002782 Ga0439443_002782_101_1456 442
478 3300042437 Ga0439444_0005247 Ga0439444_0005247_135_1490 442
479 3300046460 Ga0495638_0020829 Ga0495638_0020829_145_1485 442
480 3300049581 Ga0501047_0083410 Ga0501047_0083410_374_1735 442
481 iso_pu_bacteria 2844002411 2844008731 442
482 iso_pu_bacteria 2878738818 2878745873 442
483 iso_pu_bacteria 2899275550 2899275960 442
484 iso_pu_bacteria 2924776078 2924784273 442
485 iso_pu_bacteria 2958092219 2958096789 442
486 iso_pu_bacteria 2989349275 2989350226 442
487 iso_pu_bacteria 3000405567 3000408000 442
488 3300006048 Ga0075363_100002911 Ga0075363_1000029112 443
489 3300006177 Ga0075362_10009058 Ga0075362_100090582 443
490 3300006178 Ga0075367_10040645 Ga0075367_100406452 443
491 3300049570 Ga0501033_0069064 Ga0501033_0069064_584_1930 443
492 3300049586 Ga0501070_0095903 Ga0501070_0095903_1015_2361 443
493 3300050489 nmdc:mga03683_48937_c1 nmdc:mga03683_48937_c1_27_1427 443
494 3300050490 nmdc:mga03n38_10129_c1 nmdc:mga03n38_10129_c1_55_1416 443
495 3300050491 nmdc:mga00v17_3727_c1 nmdc:mga00v17_3727_c1_6319_7680 443
496 3300050493 nmdc:mga0k408_4751_c1 nmdc:mga0k408_4751_c1_5501_6901 443
497 3300050494 nmdc:mga06z11_34377_c1 nmdc:mga06z11_34377_c1_718_2079 443
498 iso_pu_bacteria 2869169390 2869170217 443
499 3300005435 Ga0070714_100019550 Ga0070714_1000195504 444
500 3300006028 Ga0070717_10235551 Ga0070717_102355511 444
501 3300021320 Ga0214544_1000012 Ga0214544_1000012211 444
502 3300021321 Ga0214542_1000011 Ga0214542_1000011203 444
503 3300021327 Ga0214543_1000004 Ga0214543_1000004297 444
504 3300031235 Ga0265330_10039774 Ga0265330_100397742 444
505 3300031250 Ga0265331_10054383 Ga0265331_100543831 444
506 3300031344 Ga0265316_10119891 Ga0265316_101198912 444
507 3300031595 Ga0265313_10008977 Ga0265313_100089779 444
508 3300037471 Ga0395905_0288148 Ga0395905_0288148_142_1509 444
509 3300046514 Ga0495618_0112876 Ga0495618_0112876_301_1713 444
510 3300049671 Ga0501238_000977 Ga0501238_000977_755_2122 444
511 3300060353 Ga0501082_0000859 Ga0501082_0000859_8204_9589 444
512 iso_pu_bacteria 2513237159 2514001343 444
513 iso_pu_bacteria 2582581294 2585200932 444
514 iso_pu_bacteria 2791355082 2792584494 444
515 iso_pu_bacteria 2840878972 2840882650 444
516 iso_pu_bacteria 2854911287 2854915969 444
517 iso_pu_bacteria 2995392953 2995396325 444
518 iso_pu_bacteria 3000376612 3000378950 444
519 iso_pu_bacteria 8049293176 8049297125 444
520 iso_pu_bacteria 8056875544 8056876939 444
521 iso_pu_bacteria 8057132660 8057132733 444
522 3300003659 JGI25404J52841_10001118 JGI25404J52841_100011184 445
523 3300005983 Ga0081540_1000011 Ga0081540_100001123 445
524 3300009094 Ga0111539_10035473 Ga0111539_100354735 445
525 3300021388 Ga0213875_10000003 Ga0213875_10000003300 445
526 3300037853 Ga0436364_0136730 Ga0436364_0136730_16649_18028 445
527 3300039062 Ga0400483_276140 Ga0400483_276140_2873_4225 445
528 3300049581 Ga0501047_0028624 Ga0501047_0028624_1967_3322 445
529 3300049581 Ga0501047_0057636 Ga0501047_0057636_2339_3706 445
530 3300049581 Ga0501047_0126474 Ga0501047_0126474_32_1387 445
531 3300049585 Ga0501069_0007803 Ga0501069_0007803_1980_3335 445
532 3300049586 Ga0501070_0003125 Ga0501070_0003125_6730_8085 445
533 3300049586 Ga0501070_0019237 Ga0501070_0019237_2804_4159 445
534 3300049586 Ga0501070_0183808 Ga0501070_0183808_330_1685 445
535 3300049742 Ga0501080_0003969 Ga0501080_0003969_8682_10037 445
536 3300049822 Ga0501035_0004245 Ga0501035_0004245_3134_4489 445
537 3300049822 Ga0501035_0004321 Ga0501035_0004321_5856_7211 445
538 3300049822 Ga0501035_0163124 Ga0501035_0163124_190_1545 445
539 3300049823 Ga0501044_0002611 Ga0501044_0002611_14190_15578 445
540 3300049823 Ga0501044_0010034 Ga0501044_0010034_1783_3138 445
541 3300049823 Ga0501044_0031266 Ga0501044_0031266_2357_3712 445
542 3300049823 Ga0501044_0036441 Ga0501044_0036441_3538_4902 445
543 3300049823 Ga0501044_0059404 Ga0501044_0059404_1211_2566 445
544 3300049823 Ga0501044_0180837 Ga0501044_0180837_233_1594 445
545 3300050516 nmdc:mga0sz30_14444_c2 nmdc:mga0sz30_14444_c2_1217_2611 445
546 3300060353 Ga0501082_0083154 Ga0501082_0083154_39_1403 445
547 iso_pu_bacteria 2582581306 2585265415 445
548 iso_pu_bacteria 2582581865 2585388505 445
549 iso_pu_bacteria 2738543024 2739305801 445
550 iso_pu_bacteria 8002285264 8002289877 445
551 3300048929 Ga0496126_0113058 Ga0496126_0113058_125_1465 446
552 3300049570 Ga0501033_0140567 Ga0501033_0140567_95_1435 446
553 3300049579 Ga0501043_0083901 Ga0501043_0083901_159_1499 446
554 3300053151 Ga0500604_0020877 Ga0500604_0020877_437_1828 446
555 iso_pu_bacteria 2510917028 2511184374 446
556 3300049590 Ga0501074_0116443 Ga0501074_0116443_415_1791 447
557 iso_pu_bacteria 2513237088 2513595087 447
558 iso_pu_bacteria 2513237138 2513867417 447
559 iso_pu_bacteria 2513237144 2513911599 447
560 iso_pu_bacteria 2513237146 2513927784 447
561 iso_pu_bacteria 2513237159 2513998044 447
562 iso_pu_bacteria 2534681796 2535520030 447
563 iso_pu_bacteria 2582581283 2585167981 447
564 iso_pu_bacteria 2582581866 2585392381 447
565 iso_pu_bacteria 2582581867 2585401658 447
566 iso_pu_bacteria 2585427590 2585821352 447
567 iso_pu_bacteria 2599185170 2599416783 447
568 iso_pu_bacteria 2643221607 2644051070 447
569 iso_pu_bacteria 2643221636 2644205550 447
570 iso_pu_bacteria 2643221686 2644483974 447
571 iso_pu_bacteria 2643221688 2644496328 447
572 iso_pu_bacteria 2643221689 2644500244 447
573 iso_pu_bacteria 2838035591 2838036897 447
574 iso_pu_bacteria 2838661181 2838662065 447
575 iso_pu_bacteria 2842521101 2842523149 447
576 iso_pu_bacteria 2923556063 2923556757 447
577 iso_pu_bacteria 2933016740 2933017343 447
578 iso_pu_bacteria 2996887358 2996888624 447
579 iso_pu_bacteria 3005409236 3005413389 447
580 iso_pu_bacteria 643692032 643827187 447
581 iso_pu_bacteria 8005258706 8005264444 447
582 iso_pu_bacteria 8005321885 8005323151 447
583 iso_pu_bacteria 8005542996 8005547762 447
584 3300005289 Ga0065704_10076623 Ga0065704_100766233 448
585 3300009011 Ga0105251_10001536 Ga0105251_100015367 448
586 3300009545 Ga0105237_10029880 Ga0105237_100298808 448
587 3300010375 Ga0105239_10078613 Ga0105239_100786133 448
588 3300013100 Ga0157373_10001598 Ga0157373_100015987 448
589 3300013105 Ga0157369_10197541 Ga0157369_101975412 448
590 3300025735 Ga0207713_1001292 Ga0207713_10012928 448
591 3300025911 Ga0207654_10000574 Ga0207654_100005748 448
592 3300033180 Ga0307510_10001795 Ga0307510_100017955 448
593 3300039062 Ga0400483_125752 Ga0400483_125752_2921_4282 448
594 3300042006 Ga0439432_002182 Ga0439432_002182_3459_4886 448
595 3300046520 Ga0495637_0030954 Ga0495637_0030954_652_2079 448
596 3300046525 Ga0495663_0002526 Ga0495663_0002526_2430_3854 448
597 3300046689 Ga0495613_0017681 Ga0495613_0017681_1489_2913 448
598 3300048924 Ga0496121_0001339 Ga0496121_0001339_7416_8828 448
599 3300048924 Ga0496121_0133652 Ga0496121_0133652_119_1516 448
600 3300049459 Ga0495678_000490 Ga0495678_000490_6790_8214 448
601 3300049571 Ga0501034_0071994 Ga0501034_0071994_464_1843 448
602 3300053125 Ga0500618_009764 Ga0500618_009764_651_2075 448
603 3300053141 Ga0500574_000004 Ga0500574_000004_60114_61538 448
604 3300053157 Ga0500624_002448 Ga0500624_002448_414_1838 448
605 3300053162 Ga0500638_000058 Ga0500638_000058_18583_20007 448
606 iso_pu_bacteria 2524023207 2524453914 448
607 iso_pu_bacteria 2643221634 2644196165 448
608 iso_pu_bacteria 2690316117 2692320029 448
609 iso_pu_bacteria 2847417321 2847420548 448
610 iso_pu_bacteria 2848992105 2848995420 448
611 iso_pu_bacteria 2855872281 2855876429 448
612 iso_pu_bacteria 2913295892 2913299928 448
613 iso_pu_bacteria 2989771324 2989773033 448
614 iso_pu_bacteria 2996893221 2996893980 448
615 iso_pu_bacteria 637000159 637079898 448
616 iso_pu_bacteria 2508501122 2509110165 449
617 iso_pu_bacteria 2509276019 2509378896 449
618 iso_pu_bacteria 2509276021 2509387374 449
619 iso_pu_bacteria 2509276033 2509442766 449
620 iso_pu_bacteria 2510065019 2510132623 449
621 iso_pu_bacteria 2510065057 2510307951 449
622 iso_pu_bacteria 2510461076 2510893960 449
623 iso_pu_bacteria 2510461076 2510898985 449
624 iso_pu_bacteria 2510917022 2511136422 449
625 iso_pu_bacteria 2510917030 2511198316 449
626 iso_pu_bacteria 2511231052 2511503087 449
627 iso_pu_bacteria 2512047086 2512534350 449
628 iso_pu_bacteria 2512875026 2512973830 449
629 iso_pu_bacteria 2513237084 2513570236 449
630 iso_pu_bacteria 2513237085 2513575694 449
631 iso_pu_bacteria 2513237086 2513586786 449
632 iso_pu_bacteria 2513237089 2513606914 449
633 iso_pu_bacteria 2513237091 2513620348 449
634 iso_pu_bacteria 2513237093 2513636318 449
635 iso_pu_bacteria 2513237103 2513710487 449
636 iso_pu_bacteria 2513237140 2513886648 449
637 iso_pu_bacteria 2513237143 2513906646 449
638 iso_pu_bacteria 2513237156 2513987633 449
639 iso_pu_bacteria 2513237160 2514008617 449
640 iso_pu_bacteria 2513237162 2514019663 449
641 iso_pu_bacteria 2515075009 2515111620 449
642 iso_pu_bacteria 2515154107 2515613109 449
643 iso_pu_bacteria 2515154113 2515638231 449
644 iso_pu_bacteria 2515154114 2515641909 449
645 iso_pu_bacteria 2515154116 2515655928 449
646 iso_pu_bacteria 2515154134 2515739316 449
647 iso_pu_bacteria 2516143018 2516205352 449
648 iso_pu_bacteria 2516653046 2516894491 449
649 iso_pu_bacteria 2516653077 2517040252 449
650 iso_pu_bacteria 2516653085 2517075798 449
651 iso_pu_bacteria 2517093000 2517094382 449
652 iso_pu_bacteria 2517287029 2517406180 449
653 iso_pu_bacteria 2517487022 2517571108 449
654 iso_pu_bacteria 2519899620 2520376277 449
655 iso_pu_bacteria 2524023209 2524459227 449
656 iso_pu_bacteria 2529292951 2530644918 449
657 iso_pu_bacteria 2551306084 2551678588 449
658 iso_pu_bacteria 2551306084 2551681780 449
659 iso_pu_bacteria 2551306085 2551685588 449
660 iso_pu_bacteria 2551306086 2551692287 449
661 iso_pu_bacteria 2551306087 2551697810 449
662 iso_pu_bacteria 2551306089 2551715138 449
663 iso_pu_bacteria 2551306090 2551718922 449
664 iso_pu_bacteria 2551306091 2551727911 449
665 iso_pu_bacteria 2558860100 2558860509 449
666 iso_pu_bacteria 2582581298 2585221747 449
667 iso_pu_bacteria 2582581299 2585232020 449
668 iso_pu_bacteria 2582581307 2585274789 449
669 iso_pu_bacteria 2582581308 2585278555 449
670 iso_pu_bacteria 2582581315 2585324586 449
671 iso_pu_bacteria 2582581316 2585335456 449
672 iso_pu_bacteria 2585427526 2585528949 449
673 iso_pu_bacteria 2585427527 2585535404 449
674 iso_pu_bacteria 2585427528 2585540080 449
675 iso_pu_bacteria 2585427529 2585544083 449
676 iso_pu_bacteria 2585427530 2585556791 449
677 iso_pu_bacteria 2585427531 2585562155 449
678 iso_pu_bacteria 2585427593 2585838278 449
679 iso_pu_bacteria 2585427608 2585899320 449
680 iso_pu_bacteria 2585427609 2585907901 449
681 iso_pu_bacteria 2585428125 2587983321 449
682 iso_pu_bacteria 2599185352 2600194196 449
683 iso_pu_bacteria 2615840624 2616292993 449
684 iso_pu_bacteria 2615840626 2616308073 449
685 iso_pu_bacteria 2617270742 2617385440 449
686 iso_pu_bacteria 2643221557 2643809663 449
687 iso_pu_bacteria 2643221610 2644063843 449
688 iso_pu_bacteria 2643221618 2644106667 449
689 iso_pu_bacteria 2643221626 2644149640 449
690 iso_pu_bacteria 2643221655 2644309741 449
691 iso_pu_bacteria 2643221659 2644333412 449
692 iso_pu_bacteria 2643221668 2644381365 449
693 iso_pu_bacteria 2643221675 2644415676 449
694 iso_pu_bacteria 2643221680 2644448716 449
695 iso_pu_bacteria 2643221698 2644543596 449
696 iso_pu_bacteria 2643221712 2644618188 449
697 iso_pu_bacteria 2643221723 2644676637 449
698 iso_pu_bacteria 2643221726 2644686890 449
699 iso_pu_bacteria 2657244999 2657684510 449
700 iso_pu_bacteria 2718217882 2719180585 449
701 iso_pu_bacteria 2718217927 2719385178 449
702 iso_pu_bacteria 2718217997 2719664941 449
703 iso_pu_bacteria 2718218009 2719731334 449
704 iso_pu_bacteria 2718218199 2720491361 449
705 iso_pu_bacteria 2718218232 2720612721 449
706 iso_pu_bacteria 2718218233 2720619561 449
707 iso_pu_bacteria 2718218235 2720631016 449
708 iso_pu_bacteria 2718218269 2720774654 449
709 iso_pu_bacteria 2718218363 2721146679 449
710 iso_pu_bacteria 2718218365 2721158204 449
711 iso_pu_bacteria 2718218366 2721163558 449
712 iso_pu_bacteria 2718218423 2721398898 449
713 iso_pu_bacteria 2721755514 2722839728 449
714 iso_pu_bacteria 2721755556 2723026379 449
715 iso_pu_bacteria 2721755684 2723559922 449
716 iso_pu_bacteria 2721755685 2723566542 449
717 iso_pu_bacteria 2721755809 2724037711 449
718 iso_pu_bacteria 2721755810 2724044090 449
719 iso_pu_bacteria 2721755819 2724089261 449
720 iso_pu_bacteria 2721755822 2724103807 449
721 iso_pu_bacteria 2721755823 2724109643 449
722 iso_pu_bacteria 2724679232 2725951616 449
723 iso_pu_bacteria 2728369352 2730107315 449
724 iso_pu_bacteria 2728369365 2730163822 449
725 iso_pu_bacteria 2728369397 2730297836 449
726 iso_pu_bacteria 2738541333 2739037795 449
727 iso_pu_bacteria 2751185821 2753460985 449
728 iso_pu_bacteria 2765235942 2766063643 449
729 iso_pu_bacteria 2775507266 2778176938 449
730 iso_pu_bacteria 2791355091 2792623658 449
731 iso_pu_bacteria 2791355092 2792625619 449
732 iso_pu_bacteria 2791355094 2792643493 449
733 iso_pu_bacteria 2791355256 2793296965 449
734 iso_pu_bacteria 2791355259 2793315459 449
735 iso_pu_bacteria 2791355260 2793321431 449
736 iso_pu_bacteria 2791355261 2793328680 449
737 iso_pu_bacteria 2791355262 2793335159 449
738 iso_pu_bacteria 2791355263 2793342617 449
739 iso_pu_bacteria 2791355264 2793350232 449
740 iso_pu_bacteria 2791355265 2793352070 449
741 iso_pu_bacteria 2791355266 2793364230 449
742 iso_pu_bacteria 2791355267 2793366160 449
743 iso_pu_bacteria 2802428858 2802721758 449
744 iso_pu_bacteria 2802428859 2802725347 449
745 iso_pu_bacteria 2802428860 2802734558 449
746 iso_pu_bacteria 2802428861 2802741124 449
747 iso_pu_bacteria 2802428862 2802747405 449
748 iso_pu_bacteria 2802428863 2802753061 449
749 iso_pu_bacteria 2802429268 2804753411 449
750 iso_pu_bacteria 2802429605 2805930124 449
751 iso_pu_bacteria 2802429606 2805937969 449
752 iso_pu_bacteria 2802429633 2806048558 449
753 iso_pu_bacteria 2802429634 2806056194 449
754 iso_pu_bacteria 2802429635 2806063202 449
755 iso_pu_bacteria 2802429636 2806070452 449
756 iso_pu_bacteria 2802429637 2806077793 449
757 iso_pu_bacteria 2818991448 2819608112 449
758 iso_pu_bacteria 2818991453 2819641002 449
759 iso_pu_bacteria 2838016132 2838018507 449
760 iso_pu_bacteria 2838022645 2838022827 449
761 iso_pu_bacteria 2838042994 2838047769 449
762 iso_pu_bacteria 2838048938 2838054078 449
763 iso_pu_bacteria 2838061910 2838066581 449
764 iso_pu_bacteria 2838068647 2838071142 449
765 iso_pu_bacteria 2838074704 2838077536 449
766 iso_pu_bacteria 2838668709 2838669765 449
767 iso_pu_bacteria 2838680041 2838682862 449
768 iso_pu_bacteria 2838686498 2838693488 449
769 iso_pu_bacteria 2838694306 2838697494 449
770 iso_pu_bacteria 2838701080 2838702137 449
771 iso_pu_bacteria 2838707686 2838709328 449
772 iso_pu_bacteria 2838729681 2838735244 449
773 iso_pu_bacteria 2838742623 2838747905 449
774 iso_pu_bacteria 2841851746 2841857997 449
775 iso_pu_bacteria 2841864319 2841865155 449
776 iso_pu_bacteria 2842077413 2842077438 449
777 iso_pu_bacteria 2842110456 2842111212 449
778 iso_pu_bacteria 2842118031 2842120053 449
779 iso_pu_bacteria 2842146304 2842147318 449
780 iso_pu_bacteria 2842156927 2842162945 449
781 iso_pu_bacteria 2842163707 2842165248 449
782 iso_pu_bacteria 2842180545 2842186525 449
783 iso_pu_bacteria 2842192696 2842197254 449
784 iso_pu_bacteria 2842198810 2842201346 449
785 iso_pu_bacteria 2842205361 2842206643 449
786 iso_pu_bacteria 2842217011 2842220338 449
787 iso_pu_bacteria 2842229732 2842235729 449
788 iso_pu_bacteria 2842237096 2842238739 449
789 iso_pu_bacteria 2842243621 2842248994 449
790 iso_pu_bacteria 2842250916 2842252384 449
791 iso_pu_bacteria 2842257432 2842262949 449
792 iso_pu_bacteria 2842264693 2842268673 449
793 iso_pu_bacteria 2842271015 2842277905 449
794 iso_pu_bacteria 2842278818 2842280100 449
795 iso_pu_bacteria 2842285085 2842287824 449
796 iso_pu_bacteria 2842291075 2842291100 449
797 iso_pu_bacteria 2842298080 2842301015 449
798 iso_pu_bacteria 2842304105 2842309888 449
799 iso_pu_bacteria 2842311132 2842315108 449
800 iso_pu_bacteria 2842317721 2842322893 449
801 iso_pu_bacteria 2842341865 2842348434 449
802 iso_pu_bacteria 2842357229 2842359971 449
803 iso_pu_bacteria 2842363717 2842366985 449
804 iso_pu_bacteria 2842370503 2842373491 449
805 iso_pu_bacteria 2842377471 2842377496 449
806 iso_pu_bacteria 2842384541 2842386564 449
807 iso_pu_bacteria 2842395702 2842399754 449
808 iso_pu_bacteria 2842402390 2842404648 449
809 iso_pu_bacteria 2842409023 2842411231 449
810 iso_pu_bacteria 2842415677 2842418320 449
811 iso_pu_bacteria 2842422224 2842425202 449
812 iso_pu_bacteria 2842428310 2842432806 449
813 iso_pu_bacteria 2842434925 2842439111 449
814 iso_pu_bacteria 2842441272 2842445740 449
815 iso_pu_bacteria 2842447887 2842451410 449
816 iso_pu_bacteria 2842462802 2842466908 449
817 iso_pu_bacteria 2842469257 2842473725 449
818 iso_pu_bacteria 2842482326 2842484291 449
819 iso_pu_bacteria 2842489311 2842494536 449
820 iso_pu_bacteria 2842495871 2842500534 449
821 iso_pu_bacteria 2842509118 2842513802 449
822 iso_pu_bacteria 2844163670 2844167619 449
823 iso_pu_bacteria 2844454524 2844454800 449
824 iso_pu_bacteria 2850079185 2850082406 449
825 iso_pu_bacteria 2852387548 2852393340 449
826 iso_pu_bacteria 2855825444 2855827127 449
827 iso_pu_bacteria 2855839649 2855842524 449
828 iso_pu_bacteria 2857516855 2857523385 449
829 iso_pu_bacteria 2858800743 2858803340 449
830 iso_pu_bacteria 2896384573 2896387619 449
831 iso_pu_bacteria 2915980308 2915985100 449
832 iso_pu_bacteria 2915986958 2915990195 449
833 iso_pu_bacteria 2915993759 2915997699 449
834 iso_pu_bacteria 2916000859 2916006918 449
835 iso_pu_bacteria 2916007675 2916009452 449
836 iso_pu_bacteria 2916014648 2916019514 449
837 iso_pu_bacteria 2916021584 2916026614 449
838 iso_pu_bacteria 2916028427 2916033673 449
839 iso_pu_bacteria 2916035215 2916036860 449
840 iso_pu_bacteria 2916041962 2916047498 449
841 iso_pu_bacteria 2916048683 2916053406 449
842 iso_pu_bacteria 2916055098 2916060253 449
843 iso_pu_bacteria 2916061851 2916067304 449
844 iso_pu_bacteria 2916068649 2916071788 449
845 iso_pu_bacteria 2916076590 2916080691 449
846 iso_pu_bacteria 2919100787 2919103287 449
847 iso_pu_bacteria 2920760137 2920760654 449
848 iso_pu_bacteria 2920822456 2920828380 449
849 iso_pu_bacteria 2921201388 2921201419 449
850 iso_pu_bacteria 2921208531 2921213858 449
851 iso_pu_bacteria 2921237296 2921237502 449
852 iso_pu_bacteria 2921244191 2921244315 449
853 iso_pu_bacteria 2921250672 2921255978 449
854 iso_pu_bacteria 2921257292 2921262424 449
855 iso_pu_bacteria 2921263974 2921269181 449
856 iso_pu_bacteria 2921282425 2921286325 449
857 iso_pu_bacteria 2921289301 2921293331 449
858 iso_pu_bacteria 2921296804 2921298238 449
859 iso_pu_bacteria 2924144063 2924148722 449
860 iso_pu_bacteria 2924150972 2924154955 449
861 iso_pu_bacteria 2924158325 2924164171 449
862 iso_pu_bacteria 2924165586 2924166572 449
863 iso_pu_bacteria 2924172951 2924178356 449
864 iso_pu_bacteria 2924179722 2924182290 449
865 iso_pu_bacteria 2924186466 2924188526 449
866 iso_pu_bacteria 2924193448 2924193871 449
867 iso_pu_bacteria 2924200457 2924206602 449
868 iso_pu_bacteria 2924207177 2924213034 449
869 iso_pu_bacteria 2924228884 2924231984 449
870 iso_pu_bacteria 2933570622 2933576383 449
871 iso_pu_bacteria 2933586486 2933587238 449
872 iso_pu_bacteria 2933599457 2933601941 449
873 iso_pu_bacteria 2935894831 2935900371 449
874 iso_pu_bacteria 2935901341 2935908123 449
875 iso_pu_bacteria 2936367885 2936373435 449
876 iso_pu_bacteria 2936375103 2936379520 449
877 iso_pu_bacteria 2936381700 2936387683 449
878 iso_pu_bacteria 2936996657 2937000159 449
879 iso_pu_bacteria 2937002841 2937006892 449
880 iso_pu_bacteria 2937009748 2937015026 449
881 iso_pu_bacteria 2937016420 2937018081 449
882 iso_pu_bacteria 2937023124 2937024285 449
883 iso_pu_bacteria 2937029754 2937032897 449
884 iso_pu_bacteria 2937036028 2937041552 449
885 iso_pu_bacteria 2937042894 2937048158 449
886 iso_pu_bacteria 2937049772 2937054879 449
887 iso_pu_bacteria 2937056579 2937062020 449
888 iso_pu_bacteria 2937063883 2937070121 449
889 iso_pu_bacteria 2937071275 2937071306 449
890 iso_pu_bacteria 2937078374 2937083338 449
891 iso_pu_bacteria 2937084907 2937088100 449
892 iso_pu_bacteria 2937091812 2937097357 449
893 iso_pu_bacteria 2937098957 2937104809 449
894 iso_pu_bacteria 2937106411 2937110545 449
895 iso_pu_bacteria 2937113482 2937114479 449
896 iso_pu_bacteria 2937119839 2937123793 449
897 iso_pu_bacteria 2937126314 2937129229 449
898 iso_pu_bacteria 2941499720 2941501587 449
899 iso_pu_bacteria 2957375807 2957380588 449
900 iso_pu_bacteria 2957382221 2957385990 449
901 iso_pu_bacteria 2957388812 2957390074 449
902 iso_pu_bacteria 2957395598 2957400437 449
903 iso_pu_bacteria 2957402308 2957406171 449
904 iso_pu_bacteria 2957408893 2957408924 449
905 iso_pu_bacteria 2957415311 2957421965 449
906 iso_pu_bacteria 2957422303 2957426109 449
907 iso_pu_bacteria 2957430029 2957430626 449
908 iso_pu_bacteria 2957437181 2957442330 449
909 iso_pu_bacteria 2957443900 2957444440 449
910 iso_pu_bacteria 2957450854 2957454450 449
911 iso_pu_bacteria 2957457609 2957459449 449
912 iso_pu_bacteria 2957464669 2957468290 449
913 iso_pu_bacteria 2957471148 2957477976 449
914 iso_pu_bacteria 2957478035 2957483078 449
915 iso_pu_bacteria 2957484790 2957485592 449
916 iso_pu_bacteria 2957491536 2957497722 449
917 iso_pu_bacteria 2957498199 2957500321 449
918 iso_pu_bacteria 2957505466 2957506961 449
919 iso_pu_bacteria 2960584000 2960587523 449
920 iso_pu_bacteria 2960591022 2960591373 449
921 iso_pu_bacteria 2960597568 2960602872 449
922 iso_pu_bacteria 2960603979 2960609864 449
923 iso_pu_bacteria 2960610863 2960615798 449
924 iso_pu_bacteria 2960617483 2960622227 449
925 iso_pu_bacteria 2960624210 2960629727 449
926 iso_pu_bacteria 2960631154 2960636493 449
927 iso_pu_bacteria 2960637947 2960638796 449
928 iso_pu_bacteria 2960645483 2960646653 449
929 iso_pu_bacteria 2960652885 2960657875 449
930 iso_pu_bacteria 2960660292 2960665782 449
931 iso_pu_bacteria 2960667422 2960671403 449
932 iso_pu_bacteria 2960674078 2960675391 449
933 iso_pu_bacteria 2960680706 2960685877 449
934 iso_pu_bacteria 2960687367 2960689214 449
935 iso_pu_bacteria 2960693952 2960700052 449
936 iso_pu_bacteria 2964607997 2964613658 449
937 iso_pu_bacteria 2964615318 2964618554 449
938 iso_pu_bacteria 2964621998 2964624872 449
939 iso_pu_bacteria 2964628898 2964631391 449
940 iso_pu_bacteria 2964636051 2964641699 449
941 iso_pu_bacteria 2964643177 2964648240 449
942 iso_pu_bacteria 2964649959 2964650955 449
943 iso_pu_bacteria 2964656573 2964659067 449
944 iso_pu_bacteria 2964663802 2964668764 449
945 iso_pu_bacteria 2964670856 2964675306 449
946 iso_pu_bacteria 2964678106 2964681698 449
947 iso_pu_bacteria 2964685014 2964689427 449
948 iso_pu_bacteria 2964691889 2964697140 449
949 iso_pu_bacteria 2964698721 2964704046 449
950 iso_pu_bacteria 2964705432 2964711511 449
951 iso_pu_bacteria 2964712639 2964719138 449
952 iso_pu_bacteria 2964719344 2964724315 449
953 iso_pu_bacteria 2967664464 2967669961 449
954 iso_pu_bacteria 2967671571 2967673177 449
955 iso_pu_bacteria 2967678726 2967682976 449
956 iso_pu_bacteria 2967686174 2967691788 449
957 iso_pu_bacteria 2967693043 2967696066 449
958 iso_pu_bacteria 2967699805 2967699956 449
959 iso_pu_bacteria 2967706974 2967709495 449
960 iso_pu_bacteria 2967714385 2967715874 449
961 iso_pu_bacteria 2967721400 2967726499 449
962 iso_pu_bacteria 2967728569 2967732391 449
963 iso_pu_bacteria 2967735183 2967735481 449
964 iso_pu_bacteria 2967742019 2967748775 449
965 iso_pu_bacteria 2967748971 2967750187 449
966 iso_pu_bacteria 2967755722 2967760640 449
967 iso_pu_bacteria 2967762386 2967769117 449
968 iso_pu_bacteria 2967769361 2967774494 449
969 iso_pu_bacteria 2967775926 2967781232 449
970 iso_pu_bacteria 2970019648 2970025028 449
971 iso_pu_bacteria 2970026789 2970029408 449
972 iso_pu_bacteria 2970033650 2970036360 449
973 iso_pu_bacteria 2970040964 2970041819 449
974 iso_pu_bacteria 2970047711 2970053701 449
975 iso_pu_bacteria 2970054988 2970060999 449
976 iso_pu_bacteria 2970061556 2970067799 449
977 iso_pu_bacteria 2970068827 2970071865 449
978 iso_pu_bacteria 2970076120 2970082063 449
979 iso_pu_bacteria 2970082768 2970084196 449
980 iso_pu_bacteria 2970088815 2970095444 449
981 iso_pu_bacteria 2970095765 2970099026 449
982 iso_pu_bacteria 2970102677 2970108772 449
983 iso_pu_bacteria 2970109326 2970115199 449
984 iso_pu_bacteria 2970116247 2970119261 449
985 iso_pu_bacteria 2970122695 2970128035 449
986 iso_pu_bacteria 2970129317 2970134241 449
987 iso_pu_bacteria 2970136068 2970142338 449
988 iso_pu_bacteria 2970143518 2970148861 449
989 iso_pu_bacteria 2970149975 2970155704 449
990 iso_pu_bacteria 2970156795 2970162444 449
991 iso_pu_bacteria 2970164137 2970165949 449
992 iso_pu_bacteria 2970170962 2970176114 449
993 iso_pu_bacteria 2970177841 2970179782 449
994 iso_pu_bacteria 2970184632 2970186468 449
995 iso_pu_bacteria 2970191845 2970194451 449
996 iso_pu_bacteria 2977516862 2977522678 449
997 iso_pu_bacteria 2977523885 2977530142 449
998 iso_pu_bacteria 2977530762 2977536308 449
999 iso_pu_bacteria 2977537788 2977540911 449
1000 iso_pu_bacteria 2977544691 2977550802 449
1001 iso_pu_bacteria 2977551784 2977556791 449
1002 iso_pu_bacteria 2977558990 2977565540 449
1003 iso_pu_bacteria 2977565890 2977569053 449
1004 iso_pu_bacteria 2977572785 2977578068 449
1005 iso_pu_bacteria 2977579622 2977579654 449
1006 iso_pu_bacteria 3005416602 3005420896 449
1007 iso_pu_bacteria 3005445848 3005450757 449
1008 iso_pu_bacteria 639633055 639647748 449
1009 iso_pu_bacteria 648276728 648735751 449
1010 iso_pu_bacteria 8003992118 8003995065 449
1011 iso_pu_bacteria 8003999396 8004002826 449
1012 iso_pu_bacteria 8005275841 8005279950 449
1013 iso_pu_bacteria 8005282627 8005284056 449
1014 iso_pu_bacteria 8005289223 8005294557 449
1015 iso_pu_bacteria 8005301065 8005303761 449
1016 iso_pu_bacteria 8005307578 8005314878 449
1017 iso_pu_bacteria 8005314921 8005319369 449
1018 iso_pu_bacteria 8005376324 8005378546 449
1019 iso_pu_bacteria 8005382845 8005384791 449
1020 iso_pu_bacteria 8005395548 8005398241 449
1021 iso_pu_bacteria 8005430974 8005436340 449
1022 iso_pu_bacteria 8005460587 8005462270 449
1023 iso_pu_bacteria 8005484373 8005487772 449
1024 iso_pu_bacteria 8005497431 8005499672 449
1025 iso_pu_bacteria 8005556819 8005558361 449
1026 iso_pu_bacteria 8005563573 8005569635 449
1027 iso_pu_bacteria 8005570704 8005575179 449
1028 iso_pu_bacteria 8005619151 8005620851 449
1029 iso_pu_bacteria 8005626139 8005627354 449
1030 iso_pu_bacteria 8005645114 8005650309 449
1031 iso_pu_bacteria 8005668836 8005671092 449
1032 iso_pu_bacteria 8005688590 8005691404 449
1033 iso_pu_bacteria 8005695170 8005696406 449
1034 iso_pu_bacteria 8018127388 8018128354 449
1035 iso_pu_bacteria 8018163183 8018164760 449
1036 iso_pu_bacteria 8018176218 8018177741 449
1037 iso_pu_bacteria 8023680758 8023682142 449
1038 iso_pu_bacteria 8024479707 8024485516 449
1039 iso_pu_bacteria 8024486573 8024490309 449
1040 iso_pu_bacteria 8024501048 8024504991 449
1041 iso_pu_bacteria 8046767195 8046773661 449
1042 iso_pu_bacteria 8056375014 8056379850 449
1043 iso_pu_bacteria 8056382006 8056387779 449
1044 iso_pu_bacteria 8057575449 8057579404 449
1045 iso_pu_bacteria 8057874678 8057875796 449
1046 3300006038 Ga0075365_10016079 Ga0075365_100160792 450
1047 3300006186 Ga0075369_10005002 Ga0075369_100050023 450
1048 iso_pu_bacteria 2585427633 2585996319 450
1049 iso_pu_bacteria 2585427634 2586000927 450
1050 iso_pu_bacteria 2919171160 2919174584 450
1051 3300002773 JGI25152J39213_1001943 JGI25152J39213_10019436 451
1052 3300003771 Ga0055526_1014271 Ga0055526_10142712 451
1053 3300003775 Ga0055524_1004363 Ga0055524_10043633 451
1054 3300003790 Ga0055528_1007542 Ga0055528_10075423 451
1055 3300009766 Ga0123342_1017634 Ga0123342_10176345 451
1056 3300025258 Ga0209129_1004536 Ga0209129_10045361 451
1057 3300025294 Ga0209025_1006672 Ga0209025_10066728 451
1058 3300025297 Ga0209758_1012206 Ga0209758_10122064 451
1059 3300025302 Ga0207426_1005340 Ga0207426_10053403 451
1060 3300025303 Ga0209051_1001712 Ga0209051_10017125 451
1061 3300028794 Ga0307515_10019793 Ga0307515_100197939 451
1062 3300031456 Ga0307513_10099390 Ga0307513_100993903 451
1063 3300032004 Ga0307414_10049575 Ga0307414_100495754 451
1064 3300041413 Ga0439465_0037328 Ga0439465_0037328_72_1436 451
1065 3300046460 Ga0495638_0005945 Ga0495638_0005945_6144_7505 451
1066 3300048908 Ga0496105_0006057 Ga0496105_0006057_3432_4790 451
1067 3300048927 Ga0496124_0135121 Ga0496124_0135121_114_1472 451
1068 3300048929 Ga0496126_0071839 Ga0496126_0071839_390_1748 451
1069 3300002987 JGI25159J45721_1000106 JGI25159J45721_100010622 452
1070 3300003187 JGI25151J46595_10004348 JGI25151J46595_100043486 452
1071 3300003354 JGI25160J50197_1000134 JGI25160J50197_100013437 452
1072 3300003374 JGI25161J50226_1000116 JGI25161J50226_100011651 452
1073 3300003771 Ga0055526_1000557 Ga0055526_100055718 452
1074 3300003775 Ga0055524_1000530 Ga0055524_10005308 452
1075 3300003781 Ga0055536_1002112 Ga0055536_10021127 452
1076 3300003794 Ga0055531_10011613 Ga0055531_100116134 452
1077 3300004625 Ga0055543_1000574 Ga0055543_100057411 452
1078 3300005262 Ga0065165_1000196 Ga0065165_100019671 452
1079 3300006946 Ga0079104_1000986 Ga0079104_10009864 452
1080 3300006946 Ga0079104_1010558 Ga0079104_10105581 452
1081 3300013249 Ga0171463_1014 Ga0171463_101422 452
1082 3300015690 Ga0183363_1028 Ga0183363_10289 452
1083 3300021320 Ga0214544_1000123 Ga0214544_1000123100 452
1084 3300021321 Ga0214542_1000141 Ga0214542_10001414 452
1085 3300021321 Ga0214542_1020440 Ga0214542_10204403 452
1086 3300021327 Ga0214543_1000008 Ga0214543_1000008318 452
1087 3300021327 Ga0214543_1000026 Ga0214543_1000026104 452
1088 3300022739 Ga0228711_1001864 Ga0228711_100186430 452
1089 3300022740 Ga0228710_1001994 Ga0228710_10019944 452
1090 3300025245 Ga0207425_1015995 Ga0207425_10159952 452
1091 3300025284 Ga0209130_1000198 Ga0209130_100019822 452
1092 3300025292 Ga0209676_1001775 Ga0209676_100177510 452
1093 3300025294 Ga0209025_1000339 Ga0209025_100033969 452
1094 3300025295 Ga0209564_1000353 Ga0209564_100035352 452
1095 3300025298 Ga0209050_1004164 Ga0209050_10041649 452
1096 3300025299 Ga0209256_1000456 Ga0209256_100045624 452
1097 3300025299 Ga0209256_1000845 Ga0209256_10008458 452
1098 3300025302 Ga0207426_1000048 Ga0207426_1000048357 452
1099 3300025304 Ga0209257_1004433 Ga0209257_10044337 452
1100 3300027111 Ga0209281_1000141 Ga0209281_1000141129 452
1101 3300027111 Ga0209281_1000731 Ga0209281_10007314 452
1102 3300027666 Ga0209282_1000203 Ga0209282_10002034 452
1103 3300028794 Ga0307515_10003211 Ga0307515_1000321130 452
1104 3300031456 Ga0307513_10125437 Ga0307513_101254372 452
1105 3300031967 Ga0315914_1001932 Ga0315914_100193230 452
1106 3300033430 Ga0315913_1000745 Ga0315913_100074530 452
1107 3300033464 Ga0315915_1000005 Ga0315915_1000005346 452
1108 3300037471 Ga0395905_0003543 Ga0395905_0003543_346_1707 452
1109 3300002704 JGI25155J39150_1000183 JGI25155J39150_100018315 453
1110 3300002705 JGI25156J39149_1000405 JGI25156J39149_100040515 453
1111 3300002737 JGI25162J39368_1000111 JGI25162J39368_100011147 453
1112 3300002738 JGI25154J39366_1000342 JGI25154J39366_100034210 453
1113 3300002739 JGI25158J39367_1000155 JGI25158J39367_100015511 453
1114 3300002741 JGI25157J39369_1000437 JGI25157J39369_100043715 453
1115 3300002773 JGI25152J39213_1010090 JGI25152J39213_10100902 453
1116 3300002987 JGI25159J45721_1000117 JGI25159J45721_100011726 453
1117 3300002987 JGI25159J45721_1005257 JGI25159J45721_10052572 453
1118 3300003187 JGI25151J46595_10001002 JGI25151J46595_1000100213 453
1119 3300003187 JGI25151J46595_10011367 JGI25151J46595_100113673 453
1120 3300003214 JGI25165J46597_1000440 JGI25165J46597_100044036 453
1121 3300003215 JGI25153J46596_10007535 JGI25153J46596_100075352 453
1122 3300003215 JGI25153J46596_10011509 JGI25153J46596_100115092 453
1123 3300003215 JGI25153J46596_10016048 JGI25153J46596_100160483 453
1124 3300003354 JGI25160J50197_1000081 JGI25160J50197_100008137 453
1125 3300003354 JGI25160J50197_1005559 JGI25160J50197_10055592 453
1126 3300003374 JGI25161J50226_1000025 JGI25161J50226_100002511 453
1127 3300003374 JGI25161J50226_1000063 JGI25161J50226_100006337 453
1128 3300003771 Ga0055526_1001298 Ga0055526_10012989 453
1129 3300003771 Ga0055526_1013051 Ga0055526_10130512 453
1130 3300003775 Ga0055524_1008755 Ga0055524_10087553 453
1131 3300003775 Ga0055524_1018509 Ga0055524_10185092 453
1132 3300003781 Ga0055536_1024031 Ga0055536_10240311 453
1133 3300003790 Ga0055528_1000067 Ga0055528_100006765 453
1134 3300003790 Ga0055528_1007332 Ga0055528_10073321 453
1135 3300003790 Ga0055528_1012347 Ga0055528_10123473 453
1136 3300003792 Ga0055540_1000126 Ga0055540_100012625 453
1137 3300004625 Ga0055543_1000088 Ga0055543_100008824 453
1138 3300004625 Ga0055543_1000427 Ga0055543_100042711 453
1139 3300004625 Ga0055543_1000584 Ga0055543_10005846 453
1140 3300005262 Ga0065165_1000426 Ga0065165_100042623 453
1141 3300005262 Ga0065165_1020740 Ga0065165_10207402 453
1142 3300006038 Ga0075365_10032039 Ga0075365_100320393 453
1143 3300006048 Ga0075363_100084293 Ga0075363_1000842932 453
1144 3300006177 Ga0075362_10045746 Ga0075362_100457462 453
1145 3300006195 Ga0075366_10022204 Ga0075366_100222043 453
1146 3300009093 Ga0105240_10000240 Ga0105240_1000024063 453
1147 3300009545 Ga0105237_10001680 Ga0105237_1000168029 453
1148 3300009765 Ga0123341_1000001 Ga0123341_1000001343 453
1149 3300010375 Ga0105239_10021688 Ga0105239_100216884 453
1150 3300013104 Ga0157370_10044350 Ga0157370_100443503 453
1151 3300015262 Ga0182007_10000579 Ga0182007_100005794 453
1152 3300015265 Ga0182005_1015734 Ga0182005_10157342 453
1153 3300025206 Ga0209435_100039 Ga0209435_10003999 453
1154 3300025208 Ga0209436_100017 Ga0209436_10001766 453
1155 3300025233 Ga0209437_100064 Ga0209437_100064112 453
1156 3300025245 Ga0207425_1013013 Ga0207425_10130132 453
1157 3300025246 Ga0209646_1000137 Ga0209646_100013712 453
1158 3300025250 Ga0209026_1000135 Ga0209026_100013599 453
1159 3300025253 Ga0209677_100261 Ga0209677_10026122 453
1160 3300025256 Ga0209759_1000154 Ga0209759_100015412 453
1161 3300025258 Ga0209129_1000474 Ga0209129_100047423 453
1162 3300025258 Ga0209129_1000846 Ga0209129_100084618 453
1163 3300025258 Ga0209129_1008892 Ga0209129_10088922 453
1164 3300025261 Ga0209233_1000081 Ga0209233_1000081189 453
1165 3300025261 Ga0209233_1000203 Ga0209233_100020356 453
1166 3300025273 Ga0209673_1000310 Ga0209673_100031079 453
1167 3300025273 Ga0209673_1000348 Ga0209673_100034864 453
1168 3300025284 Ga0209130_1000001 Ga0209130_100000184 453
1169 3300025284 Ga0209130_1000162 Ga0209130_100016238 453
1170 3300025292 Ga0209676_1021872 Ga0209676_10218721 453
1171 3300025294 Ga0209025_1000097 Ga0209025_1000097242 453
1172 3300025294 Ga0209025_1010790 Ga0209025_10107904 453
1173 3300025295 Ga0209564_1000137 Ga0209564_100013722 453
1174 3300025295 Ga0209564_1001306 Ga0209564_10013066 453
1175 3300025297 Ga0209758_1000237 Ga0209758_100023754 453
1176 3300025297 Ga0209758_1000714 Ga0209758_100071433 453
1177 3300025297 Ga0209758_1001821 Ga0209758_10018212 453
1178 3300025297 Ga0209758_1006356 Ga0209758_10063566 453
1179 3300025297 Ga0209758_1007411 Ga0209758_10074113 453
1180 3300025298 Ga0209050_1025229 Ga0209050_10252291 453
1181 3300025299 Ga0209256_1000397 Ga0209256_100039751 453
1182 3300025299 Ga0209256_1009745 Ga0209256_10097455 453
1183 3300025302 Ga0207426_1000005 Ga0207426_1000005689 453
1184 3300025302 Ga0207426_1000094 Ga0207426_1000094240 453
1185 3300025302 Ga0207426_1000126 Ga0207426_1000126153 453
1186 3300025303 Ga0209051_1000201 Ga0209051_100020125 453
1187 3300025303 Ga0209051_1001477 Ga0209051_100147713 453
1188 3300025304 Ga0209257_1004845 Ga0209257_100484512 453
1189 3300025304 Ga0209257_1018340 Ga0209257_10183401 453
1190 3300025913 Ga0207695_10000118 Ga0207695_1000011864 453
1191 3300025914 Ga0207671_10000954 Ga0207671_100009547 453
1192 3300035695 Ga0373927_0000655 Ga0373927_0000655_8263_9624 453
1193 3300037068 Ga0373925_0001826 Ga0373925_0001826_16052_17413 453
1194 3300041494 Ga0451837_0272173 Ga0451837_0272173_3557_4918 453
1195 3300041496 Ga0451839_0211155 Ga0451839_0211155_5675_7036 453
1196 3300041496 Ga0451839_0320786 Ga0451839_0320786_110_1471 453
1197 3300041498 Ga0451841_0285467 Ga0451841_0285467_2015_3376 453
1198 3300041503 Ga0451847_0335240 Ga0451847_0335240_115_1476 453
1199 3300041507 Ga0451851_1232134 Ga0451851_1232134_156_1517 453
1200 3300046507 Ga0495606_0020615 Ga0495606_0020615_3284_4645 453
1201 3300046522 Ga0495643_0060192 Ga0495643_0060192_614_1975 453
1202 3300046524 Ga0495648_0053832 Ga0495648_0053832_149_1510 453
1203 3300046524 Ga0495648_0093833 Ga0495648_0093833_71_1432 453
1204 3300046542 Ga0495597_0033711 Ga0495597_0033711_860_2221 453
1205 3300046660 Ga0495625_0031914 Ga0495625_0031914_275_1636 453
1206 3300046660 Ga0495625_0035970 Ga0495625_0035970_171_1532 453
1207 3300046810 Ga0495660_0047003 Ga0495660_0047003_886_2247 453
1208 3300047317 Ga0495604_0101348 Ga0495604_0101348_704_2065 453
1209 3300048909 Ga0496106_0000401 Ga0496106_0000401_502_1863 453
1210 3300048920 Ga0496117_0002425 Ga0496117_0002425_21289_22650 453
1211 3300048922 Ga0496119_0008989 Ga0496119_0008989_1786_3147 453
1212 3300048923 Ga0496120_0001004 Ga0496120_0001004_34900_36261 453
1213 3300048924 Ga0496121_0003845 Ga0496121_0003845_2292_3653 453
1214 3300048924 Ga0496121_0020002 Ga0496121_0020002_109_1470 453
1215 3300049744 Ga0501083_0056866 Ga0501083_0056866_328_1689 453
1216 3300053134 Ga0500658_0001854 Ga0500658_0001854_6325_7686 453
1217 3300053148 Ga0500590_004310 Ga0500590_004310_1841_3202 453
1218 3300053153 Ga0500616_0006201 Ga0500616_0006201_165_1526 453
1219 3300053156 Ga0500622_0000533 Ga0500622_0000533_33532_34893 453
1220 3300053161 Ga0500634_0009499 Ga0500634_0009499_106_1593 453
1221 iso_pu_bacteria 8054558443 8054560417 453

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04209

HgmA_C

Homogentisate 1,2-dioxygenase C-terminal

316

468

0.98

PF20510

HgmA_N

Homogentisate 1,2-dioxygenase N-terminal

36

315

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4aq6-assembly2.cif.gz_K substrate bound homogentisate 1,2-dioxygenase 0.897 18 453
4aq6-assembly2.cif.gz_K substrate bound homogentisate 1,2-dioxygenase 0.895 18 453
4aq2-assembly2.cif.gz_L resting state of homogentisate 1,2-dioxygenase 0.8933 19 453
4aq2-assembly2.cif.gz_L resting state of homogentisate 1,2-dioxygenase 0.8913 19 453
4aq2-assembly2.cif.gz_G resting state of homogentisate 1,2-dioxygenase 0.8879 18 453
ID Description Score Start End Superfamily
2vpvB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8685 144 217 2.60.120.10
af_Q9ZRA2_1_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.86 10 280 2.60.120.10
af_A0A1D6NXP1_1_243_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.854 42 280 2.60.120.10
af_Q9ZRA2_1_273_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.852 10 280 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8402 144 218 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A536Z6R2-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9828 113 228 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A7K3HLB9-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9825 137 223 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A536Z6R2-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9661 113 228 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A7K3HLB9-F1-model_v4 Homogentisate 1,2-dioxygenase 0.9601 137 223 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872
AF-A0A5S3YVJ4-F1-model_v4 Homogentisate 1,2-dioxygenase (EC 1.13.11.5) 0.9549 113 280 GO:0004411
GO:0005737
GO:0006559
GO:0006570
GO:0046872

Feature Viewer

pLDDT pTM Quality
78.05 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map