F491796

General Info

Members Datasets Scaffolds Average Seq Length
1216 383 1207 246

Family's Representative Sequence

Representative Sequence 3300027876|Ga0209974_10032510|Ga0209974_100325102
Length 284
Sequence MGTLDFASAMNNPGRTFGSPEALEASADLSDGQKHDLLLQWKDQLEQLTKRYGRSEALKGIDLTIGTGVVGLLGPNGAGKTTLLRMIATLVAPDAGSARVDGIDVTMDRHAVRRRIGVLSDARGLYPRLTARENVRYFGRLHGLRGDALDARVDRLFATLGATPIAERRAAALSQGERMKVAIARALVHDPHTLLLDEPTNGLDILSVRTLREHLRALRGEGKCLLFSSHVLQEVAALCDRIVVLAQGRVVAVGTEAELVARVGAGNLEDALIALVGSPEGLAA

Samples

Sample ID Description Type Environment
1 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
2 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
3 2734482264 Dyella sp. AD052 Isolate Unclassified
4 2738543009 Luteibacter sp. OK325 Isolate Unclassified
5 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
6 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
7 2919085039 Luteibacter sp. 1214 Isolate Unclassified
8 2919404418 Luteibacter sp. 3190 Isolate Unclassified
9 2941471342 Luteibacter sp. 621 Isolate Unclassified
10 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
11 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
12 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
137 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
217 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
237 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
238 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
240 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
241 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
242 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
243 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
246 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
254 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
257 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
258 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
259 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
260 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
261 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
262 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
263 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
264 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
269 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
270 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
271 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
272 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
275 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
276 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
277 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
283 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
284 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
285 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
286 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
287 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
288 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
289 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
290 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
293 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
301 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
302 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
303 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
304 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
305 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
306 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
307 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
308 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
309 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
310 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
311 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
312 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
313 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
316 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
317 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
318 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
319 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
320 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
321 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
322 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
323 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
324 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
325 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
326 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
327 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
328 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
329 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
330 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
331 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
332 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
333 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
334 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
335 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
336 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
337 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
338 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
339 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
340 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
341 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
351 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
352 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
357 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
368 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
369 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
370 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
373 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
374 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
375 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
378 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
379 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
380 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.25
Isolates 0.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.56
Nodule 0
Rhizoplane 3.62
Rhizosphere 92.68
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1005354 3300002737 Bacteria 2554
2 JGI25152J39213_1029203 3300002773 Bacteria 870
3 rootH1_10020837 3300003316 Bacteria 11170
4 rootH1_10020837 3300003323 Bacteria 1633
5 Ga0006562J51391_1019682 3300003578 Bacteria 19150
6 Ga0006562J51391_1019685 3300003578 Bacteria 3440
7 Ga0055543_1013036 3300004625 Bacteria 1653
8 Ga0065165_1000199 3300005262 Bacteria 104204
9 Ga0065715_10098761 3300005293 Bacteria 3502
10 Ga0065715_10154764 3300005293 Bacteria 1689
11 Ga0065715_10171010 3300005293 Bacteria 1547
12 Ga0070658_10119416 3300005327 Bacteria 2190
13 Ga0070658_10248886 3300005327 Bacteria 1508
14 Ga0070676_10001385 3300005328 Bacteria 12227
15 Ga0070676_10002180 3300005328 Bacteria 9983
16 Ga0070676_10099424 3300005328 Bacteria 1795
17 Ga0070683_100048441 3300005329 Bacteria 3929
18 Ga0070683_100088115 3300005329 Bacteria 2912
19 Ga0070690_100022957 3300005330 Bacteria 3822
20 Ga0070690_100377022 3300005330 Bacteria 1036
21 Ga0070670_100007729 3300005331 Bacteria 9143
22 Ga0070670_100025717 3300005331 Bacteria 5065
23 Ga0070670_100031990 3300005331 Bacteria 4530
24 Ga0070670_100041936 3300005331 Bacteria 3933
25 Ga0070670_100048785 3300005331 Bacteria 3643
26 Ga0070670_100111199 3300005331 Bacteria 2360
27 Ga0070670_100213541 3300005331 Bacteria 1678
28 Ga0070670_100449433 3300005331 Bacteria 1142
29 Ga0070677_10000279 3300005333 Bacteria 17887
30 Ga0070677_10022211 3300005333 Bacteria 2334
31 Ga0068869_100000025 3300005334 Bacteria 63244
32 Ga0068869_100017152 3300005334 Bacteria 4901
33 Ga0068869_100083250 3300005334 Bacteria 2392
34 Ga0068869_100237800 3300005334 Bacteria 1450
35 Ga0068869_100421180 3300005334 Bacteria 1102
36 Ga0070666_10000909 3300005335 Bacteria 17984
37 Ga0070666_10003744 3300005335 Bacteria 9220
38 Ga0070666_10015249 3300005335 Bacteria 4901
39 Ga0070666_10304641 3300005335 Bacteria 1135
40 Ga0070680_100053810 3300005336 Bacteria 3285
41 Ga0070680_100077960 3300005336 Bacteria 2729
42 Ga0070680_100101907 3300005336 Bacteria 2383
43 Ga0070680_100372458 3300005336 Bacteria 1215
44 Ga0070682_100072548 3300005337 Bacteria 2206
45 Ga0068868_100005951 3300005338 Bacteria 8601
46 Ga0068868_100014717 3300005338 Bacteria 5770
47 Ga0068868_100024536 3300005338 Bacteria 4577
48 Ga0068868_100036191 3300005338 Bacteria 3819
49 Ga0068868_100078556 3300005338 Bacteria 2642
50 Ga0068868_100101680 3300005338 Bacteria 2326
51 Ga0068868_100230687 3300005338 Bacteria 1553
52 Ga0070660_100011071 3300005339 Bacteria 6396
53 Ga0070660_100025523 3300005339 Bacteria 4392
54 Ga0070660_100028351 3300005339 Bacteria 4188
55 Ga0070660_100032425 3300005339 Bacteria 3931
56 Ga0070660_100215447 3300005339 Bacteria 1560
57 Ga0070660_100305155 3300005339 Bacteria 1306
58 Ga0070660_100397046 3300005339 Bacteria 1140
59 Ga0070689_100015809 3300005340 Bacteria 5513
60 Ga0070689_100016777 3300005340 Bacteria 5366
61 Ga0070689_100061132 3300005340 Bacteria 2930
62 Ga0070689_100072967 3300005340 Bacteria 2683
63 Ga0070689_100159990 3300005340 Bacteria 1820
64 Ga0070689_100212728 3300005340 Bacteria 1583
65 Ga0070661_100002686 3300005344 Bacteria 12176
66 Ga0070661_100032678 3300005344 Bacteria 3767
67 Ga0070661_100077790 3300005344 Bacteria 2446
68 Ga0070661_100080157 3300005344 Bacteria 2409
69 Ga0070661_100172771 3300005344 Bacteria 1642
70 Ga0070661_100231159 3300005344 Bacteria 1421
71 Ga0070692_10047011 3300005345 Bacteria 2232
72 Ga0070692_10137675 3300005345 Bacteria 1379
73 Ga0070668_100001156 3300005347 Bacteria 18615
74 Ga0070668_100002498 3300005347 Bacteria 13540
75 Ga0070668_100004641 3300005347 Bacteria 10178
76 Ga0070668_100006984 3300005347 Bacteria 8364
77 Ga0070668_100017618 3300005347 Bacteria 5356
78 Ga0070668_100052567 3300005347 Bacteria 3139
79 Ga0070668_100145908 3300005347 Bacteria 1910
80 Ga0070668_100156596 3300005347 Bacteria 1846
81 Ga0070668_100272483 3300005347 Bacteria 1411
82 Ga0070668_100359563 3300005347 Bacteria 1234
83 Ga0070668_100416703 3300005347 Bacteria 1149
84 Ga0070668_100688593 3300005347 Bacteria 901
85 Ga0070669_100004372 3300005353 Bacteria 10193
86 Ga0070669_100012003 3300005353 Bacteria 6148
87 Ga0070669_100015460 3300005353 Bacteria 5438
88 Ga0070669_100023178 3300005353 Bacteria 4444
89 Ga0070669_100081409 3300005353 Bacteria 2412
90 Ga0070669_100095561 3300005353 Bacteria 2235
91 Ga0070669_100148465 3300005353 Bacteria 1813
92 Ga0070675_100003551 3300005354 Bacteria 11840
93 Ga0070675_100020708 3300005354 Bacteria 5249
94 Ga0070675_100026173 3300005354 Bacteria 4680
95 Ga0070675_100089649 3300005354 Bacteria 2575
96 Ga0070675_100302823 3300005354 Bacteria 1409
97 Ga0070671_100006391 3300005355 Bacteria 9415
98 Ga0070671_100007760 3300005355 Bacteria 8572
99 Ga0070671_100007805 3300005355 Bacteria 8549
100 Ga0070671_100017414 3300005355 Bacteria 5819
101 Ga0070671_100018218 3300005355 Bacteria 5700
102 Ga0070671_100024580 3300005355 Bacteria 4934
103 Ga0070671_100084928 3300005355 Bacteria 2647
104 Ga0070674_100004021 3300005356 Bacteria 8338
105 Ga0070674_100032314 3300005356 Bacteria 3475
106 Ga0070674_100033913 3300005356 Bacteria 3403
107 Ga0070674_100040581 3300005356 Bacteria 3149
108 Ga0070674_100046826 3300005356 Bacteria 2961
109 Ga0070674_100059560 3300005356 Bacteria 2658
110 Ga0070674_100187251 3300005356 Bacteria 1589
111 Ga0070673_100000900 3300005364 Bacteria 16784
112 Ga0070673_100001846 3300005364 Bacteria 12667
113 Ga0070673_100012649 3300005364 Bacteria 5804
114 Ga0070673_100016258 3300005364 Bacteria 5255
115 Ga0070673_100016379 3300005364 Bacteria 5240
116 Ga0070673_100073403 3300005364 Bacteria 2754
117 Ga0070673_100148597 3300005364 Bacteria 1983
118 Ga0070673_100158709 3300005364 Bacteria 1922
119 Ga0070673_100181902 3300005364 Bacteria 1800
120 Ga0070673_100228697 3300005364 Bacteria 1613
121 Ga0070673_100586787 3300005364 Bacteria 1015
122 Ga0070688_100000350 3300005365 Bacteria 23433
123 Ga0070688_100028177 3300005365 Bacteria 3350
124 Ga0070688_100033867 3300005365 Bacteria 3090
125 Ga0070688_100044733 3300005365 Bacteria 2733
126 Ga0070688_100052937 3300005365 Bacteria 2538
127 Ga0070659_100014022 3300005366 Bacteria 5980
128 Ga0070659_100024162 3300005366 Bacteria 4657
129 Ga0070659_100035797 3300005366 Bacteria 3867
130 Ga0070659_100063046 3300005366 Bacteria 2932
131 Ga0070659_100084577 3300005366 Bacteria 2537
132 Ga0070659_100096984 3300005366 Bacteria 2369
133 Ga0070659_100141123 3300005366 Bacteria 1962
134 Ga0070667_100001812 3300005367 Bacteria 19031
135 Ga0070667_100007579 3300005367 Bacteria 9005
136 Ga0070667_100018152 3300005367 Bacteria 5833
137 Ga0070667_100025860 3300005367 Bacteria 4883
138 Ga0070667_100080490 3300005367 Bacteria 2786
139 Ga0070667_100088214 3300005367 Bacteria 2663
140 Ga0070667_100110975 3300005367 Bacteria 2378
141 Ga0070667_100155852 3300005367 Bacteria 2009
142 Ga0070667_100589033 3300005367 Bacteria 1024
143 Ga0070709_10063339 3300005434 Bacteria 2361
144 Ga0070709_10171104 3300005434 Bacteria 1518
145 Ga0070709_10174932 3300005434 Bacteria 1503
146 Ga0070709_10359504 3300005434 Bacteria 1078
147 Ga0070714_100005054 3300005435 Bacteria 10033
148 Ga0070714_100018781 3300005435 Bacteria 5622
149 Ga0070714_100020847 3300005435 Bacteria 5357
150 Ga0070713_100000028 3300005436 Bacteria 93227
151 Ga0070713_100001230 3300005436 Bacteria 16362
152 Ga0070713_100005285 3300005436 Bacteria 8807
153 Ga0070713_100016855 3300005436 Bacteria 5505
154 Ga0070713_100043939 3300005436 Bacteria 3655
155 Ga0070710_10001633 3300005437 Bacteria 10599
156 Ga0070710_10234899 3300005437 Bacteria 1172
157 Ga0070701_10011100 3300005438 Bacteria 4011
158 Ga0070711_100009917 3300005439 Bacteria 5873
159 Ga0070711_100273402 3300005439 Bacteria 1334
160 Ga0070711_100345745 3300005439 Bacteria 1194
161 Ga0070711_100580580 3300005439 Bacteria 933
162 Ga0070705_100013150 3300005440 Bacteria 4226
163 Ga0070705_100057870 3300005440 Bacteria 2288
164 Ga0070700_100127158 3300005441 Bacteria 1715
165 Ga0070700_100288232 3300005441 Bacteria 1193
166 Ga0070694_100085054 3300005444 Bacteria 2208
167 Ga0070694_100137443 3300005444 Bacteria 1772
168 Ga0070708_100000284 3300005445 Bacteria 38024
169 Ga0070708_100114295 3300005445 Bacteria 2484
170 Ga0070663_100006202 3300005455 Bacteria 7166
171 Ga0070663_100009504 3300005455 Bacteria 6024
172 Ga0070663_100010536 3300005455 Bacteria 5764
173 Ga0070663_100039613 3300005455 Bacteria 3294
174 Ga0070678_100000351 3300005456 Bacteria 21500
175 Ga0070678_100001685 3300005456 Bacteria 11856
176 Ga0070678_100002700 3300005456 Bacteria 9789
177 Ga0070678_100010478 3300005456 Bacteria 5668
178 Ga0070678_100356400 3300005456 Bacteria 1259
179 Ga0070678_100473655 3300005456 Bacteria 1101
180 Ga0070662_100000176 3300005457 Bacteria 37127
181 Ga0070662_100007365 3300005457 Bacteria 7129
182 Ga0070662_100011700 3300005457 Bacteria 5792
183 Ga0070662_100106806 3300005457 Bacteria 2127
184 Ga0070662_100302031 3300005457 Bacteria 1301
185 Ga0070681_10006305 3300005458 Bacteria 11531
186 Ga0070681_10010101 3300005458 Bacteria 9304
187 Ga0070681_10015448 3300005458 Bacteria 7602
188 Ga0070681_10018775 3300005458 Bacteria 6920
189 Ga0070681_10029801 3300005458 Bacteria 5477
190 Ga0070681_10043733 3300005458 Bacteria 4484
191 Ga0070681_10045147 3300005458 Bacteria 4410
192 Ga0070681_10317073 3300005458 Bacteria 1468
193 Ga0068867_100002727 3300005459 Bacteria 12450
194 Ga0068867_100004173 3300005459 Bacteria 10165
195 Ga0068867_100012504 3300005459 Bacteria 6008
196 Ga0068867_100019471 3300005459 Bacteria 4835
197 Ga0068867_100064362 3300005459 Bacteria 2726
198 Ga0068867_100090250 3300005459 Bacteria 2324
199 Ga0068867_100187395 3300005459 Bacteria 1649
200 Ga0070685_10001662 3300005466 Bacteria 11685
201 Ga0070685_10003062 3300005466 Bacteria 8521
202 Ga0070685_10125412 3300005466 Bacteria 1599
203 Ga0070699_100006205 3300005518 Bacteria 10431
204 Ga0070699_100028657 3300005518 Bacteria 4802
205 Ga0070699_100151213 3300005518 Bacteria 2053
206 Ga0070679_100004523 3300005530 Bacteria 12853
207 Ga0070679_100060397 3300005530 Bacteria 3777
208 Ga0070679_100070962 3300005530 Bacteria 3474
209 Ga0070679_100082668 3300005530 Bacteria 3201
210 Ga0070679_100115832 3300005530 Bacteria 2665
211 Ga0070679_100152994 3300005530 Bacteria 2283
212 Ga0070679_100183376 3300005530 Bacteria 2065
213 Ga0070679_100187515 3300005530 Bacteria 2038
214 Ga0070684_100012934 3300005535 Bacteria 6710
215 Ga0070684_100137293 3300005535 Bacteria 2209
216 Ga0070684_100337807 3300005535 Bacteria 1384
217 Ga0068853_100002699 3300005539 Bacteria 13382
218 Ga0068853_100006766 3300005539 Bacteria 9134
219 Ga0068853_100067140 3300005539 Bacteria 3115
220 Ga0068853_100105520 3300005539 Bacteria 2496
221 Ga0070672_100004215 3300005543 Bacteria 9405
222 Ga0070672_100010540 3300005543 Bacteria 6414
223 Ga0070672_100011727 3300005543 Bacteria 6122
224 Ga0070672_100015217 3300005543 Bacteria 5472
225 Ga0070672_100029407 3300005543 Bacteria 4120
226 Ga0070672_100029637 3300005543 Bacteria 4105
227 Ga0070672_100031336 3300005543 Bacteria 4001
228 Ga0070672_100080302 3300005543 Bacteria 2613
229 Ga0070672_100111935 3300005543 Bacteria 2226
230 Ga0070672_100114215 3300005543 Bacteria 2204
231 Ga0070672_100151754 3300005543 Bacteria 1917
232 Ga0070672_100219123 3300005543 Bacteria 1596
233 Ga0070672_100235669 3300005543 Bacteria 1538
234 Ga0070672_100342847 3300005543 Bacteria 1273
235 Ga0070686_100013508 3300005544 Bacteria 4680
236 Ga0070686_100089345 3300005544 Bacteria 2058
237 Ga0070686_100328420 3300005544 Bacteria 1143
238 Ga0070695_100425206 3300005545 Bacteria 1012
239 Ga0070696_100132746 3300005546 Bacteria 1813
240 Ga0070693_100000424 3300005547 Bacteria 19141
241 Ga0070693_100147426 3300005547 Bacteria 1487
242 Ga0070665_100006557 3300005548 Bacteria 11831
243 Ga0070665_100018643 3300005548 Bacteria 6955
244 Ga0070665_100030226 3300005548 Bacteria 5452
245 Ga0070665_100032953 3300005548 Bacteria 5212
246 Ga0070665_100227358 3300005548 Bacteria 1866
247 Ga0070665_100280487 3300005548 Bacteria 1668
248 Ga0068855_100000851 3300005563 Bacteria 37847
249 Ga0068855_100006879 3300005563 Bacteria 13795
250 Ga0068855_100084517 3300005563 Bacteria 3674
251 Ga0068855_100098206 3300005563 Bacteria 3374
252 Ga0068855_100177821 3300005563 Bacteria 2407
253 Ga0068855_100180326 3300005563 Bacteria 2388
254 Ga0068855_100254567 3300005563 Bacteria 1958
255 Ga0070664_100002258 3300005564 Bacteria 15506
256 Ga0070664_100017540 3300005564 Bacteria 5880
257 Ga0070664_100019173 3300005564 Bacteria 5626
258 Ga0070664_100028860 3300005564 Bacteria 4621
259 Ga0070664_100068818 3300005564 Bacteria 3027
260 Ga0070664_100074605 3300005564 Bacteria 2911
261 Ga0070664_100077189 3300005564 Bacteria 2864
262 Ga0070664_100154844 3300005564 Bacteria 2025
263 Ga0070664_100262440 3300005564 Bacteria 1554
264 Ga0068857_100006033 3300005577 Bacteria 10347
265 Ga0068857_100028208 3300005577 Bacteria 4953
266 Ga0068857_100069566 3300005577 Bacteria 3134
267 Ga0068857_100129439 3300005577 Bacteria 2276
268 Ga0068857_100129805 3300005577 Bacteria 2273
269 Ga0068857_100373783 3300005577 Bacteria 1322
270 Ga0068857_100477879 3300005577 Bacteria 1167
271 Ga0068854_100009959 3300005578 Bacteria 6153
272 Ga0068854_100014285 3300005578 Bacteria 5233
273 Ga0068854_100098101 3300005578 Bacteria 2192
274 Ga0068854_100103766 3300005578 Bacteria 2135
275 Ga0068854_100109292 3300005578 Bacteria 2083
276 Ga0068854_100260763 3300005578 Bacteria 1388
277 Ga0068854_100438827 3300005578 Bacteria 1088
278 Ga0068856_100001266 3300005614 Bacteria 26611
279 Ga0068856_100003646 3300005614 Bacteria 15472
280 Ga0068856_100016308 3300005614 Bacteria 7191
281 Ga0068856_100068410 3300005614 Bacteria 3510
282 Ga0068856_100079001 3300005614 Bacteria 3262
283 Ga0070702_100004306 3300005615 Bacteria 6487
284 Ga0070702_100356431 3300005615 Bacteria 1032
285 Ga0068852_100004179 3300005616 Bacteria 10173
286 Ga0068852_100011696 3300005616 Bacteria 6620
287 Ga0068852_100079975 3300005616 Bacteria 2897
288 Ga0068852_100100899 3300005616 Bacteria 2605
289 Ga0068852_100147816 3300005616 Bacteria 2182
290 Ga0068852_100280143 3300005616 Bacteria 1607
291 Ga0068852_100352466 3300005616 Bacteria 1437
292 Ga0068852_100352863 3300005616 Bacteria 1437
293 Ga0068852_100526480 3300005616 Bacteria 1180
294 Ga0068859_100000330 3300005617 Bacteria 47242
295 Ga0068859_100009872 3300005617 Bacteria 9638
296 Ga0068859_100015176 3300005617 Bacteria 7733
297 Ga0068859_100066746 3300005617 Bacteria 3633
298 Ga0068859_100076872 3300005617 Bacteria 3379
299 Ga0068859_100171940 3300005617 Bacteria 2248
300 Ga0068864_100001097 3300005618 Bacteria 22692
301 Ga0068864_100001602 3300005618 Bacteria 18660
302 Ga0068864_100013666 3300005618 Bacteria 6732
303 Ga0068864_100026760 3300005618 Bacteria 4865
304 Ga0068864_100044736 3300005618 Bacteria 3796
305 Ga0068864_100240884 3300005618 Bacteria 1676
306 Ga0068864_100454367 3300005618 Bacteria 1225
307 Ga0068866_10001640 3300005718 Bacteria 9428
308 Ga0068866_10013071 3300005718 Bacteria 3632
309 Ga0068866_10046855 3300005718 Bacteria 2176
310 Ga0068866_10050693 3300005718 Bacteria 2109
311 Ga0068866_10319087 3300005718 Bacteria 977
312 Ga0068861_100000777 3300005719 Bacteria 19173
313 Ga0068861_100045684 3300005719 Bacteria 3299
314 Ga0068861_100054316 3300005719 Bacteria 3051
315 Ga0068851_10000909 3300005834 Bacteria 12750
316 Ga0068851_10024227 3300005834 Bacteria 2971
317 Ga0068851_10032728 3300005834 Bacteria 2587
318 Ga0068870_10007190 3300005840 Bacteria 4956
319 Ga0068863_100007466 3300005841 Bacteria 10703
320 Ga0068863_100008731 3300005841 Bacteria 9898
321 Ga0068863_100011572 3300005841 Bacteria 8535
322 Ga0068863_100014770 3300005841 Bacteria 7510
323 Ga0068863_100017663 3300005841 Bacteria 6831
324 Ga0068863_100024838 3300005841 Bacteria 5715
325 Ga0068863_100077681 3300005841 Bacteria 3142
326 Ga0068863_100098731 3300005841 Bacteria 2773
327 Ga0068863_100106172 3300005841 Bacteria 2672
328 Ga0068863_100211307 3300005841 Bacteria 1869
329 Ga0068863_100429825 3300005841 Bacteria 1294
330 Ga0068858_100002918 3300005842 Bacteria 17202
331 Ga0068858_100003252 3300005842 Bacteria 16188
332 Ga0068858_100020003 3300005842 Bacteria 6261
333 Ga0068858_100045449 3300005842 Bacteria 4070
334 Ga0068858_100098145 3300005842 Bacteria 2731
335 Ga0068858_100211325 3300005842 Bacteria 1836
336 Ga0068858_100275284 3300005842 Bacteria 1602
337 Ga0068858_100450033 3300005842 Bacteria 1241
338 Ga0068858_100830905 3300005842 Bacteria 902
339 Ga0068860_100002326 3300005843 Bacteria 19958
340 Ga0068860_100009369 3300005843 Bacteria 9734
341 Ga0068860_100010280 3300005843 Bacteria 9261
342 Ga0068860_100033550 3300005843 Bacteria 4925
343 Ga0068860_100062347 3300005843 Bacteria 3542
344 Ga0068860_100062829 3300005843 Bacteria 3529
345 Ga0068860_100082654 3300005843 Bacteria 3054
346 Ga0068860_100104936 3300005843 Bacteria 2698
347 Ga0068860_100109242 3300005843 Bacteria 2643
348 Ga0068862_100004250 3300005844 Bacteria 12129
349 Ga0068862_100012225 3300005844 Bacteria 7097
350 Ga0068862_100015279 3300005844 Bacteria 6376
351 Ga0068862_100027115 3300005844 Bacteria 4821
352 Ga0068862_100030079 3300005844 Bacteria 4576
353 Ga0068862_100116372 3300005844 Bacteria 2352
354 Ga0068862_100253579 3300005844 Bacteria 1604
355 Ga0070717_10234551 3300006028 Bacteria 1616
356 Ga0070716_100003191 3300006173 Bacteria 7685
357 Ga0070716_100044370 3300006173 Bacteria 2490
358 Ga0070712_100004141 3300006175 Bacteria 8909
359 Ga0070712_100408059 3300006175 Bacteria 1123
360 Ga0070712_100531322 3300006175 Bacteria 989
361 Ga0075366_10000623 3300006195 Bacteria 16637
362 Ga0075366_10193065 3300006195 Bacteria 1238
363 Ga0097621_100006157 3300006237 Bacteria 8500
364 Ga0097621_100025823 3300006237 Bacteria 4600
365 Ga0097621_100039082 3300006237 Bacteria 3810
366 Ga0097621_100072641 3300006237 Bacteria 2846
367 Ga0097621_100086946 3300006237 Bacteria 2609
368 Ga0097621_100384355 3300006237 Bacteria 1254
369 Ga0075370_10019195 3300006353 Bacteria 3720
370 Ga0068871_100004264 3300006358 Bacteria 9919
371 Ga0068871_100018370 3300006358 Bacteria 5313
372 Ga0068871_100019218 3300006358 Bacteria 5215
373 Ga0068871_100051726 3300006358 Bacteria 3326
374 Ga0068871_100216861 3300006358 Bacteria 1657
375 Ga0068871_100446184 3300006358 Bacteria 1159
376 Ga0075428_100021950 3300006844 Bacteria 7070
377 Ga0075428_100101621 3300006844 Bacteria 3134
378 Ga0075428_100176629 3300006844 Unclassified 2313
379 Ga0075430_100051389 3300006846 Bacteria 3474
380 Ga0075430_100111129 3300006846 Bacteria 2285
381 Ga0075430_100217225 3300006846 Bacteria 1586
382 Ga0075431_100007923 3300006847 Bacteria 10588
383 Ga0075431_100095755 3300006847 Bacteria 3065
384 Ga0075431_100244468 3300006847 Bacteria 1824
385 Ga0075429_100164802 3300006880 Bacteria 1941
386 Ga0068865_100012084 3300006881 Bacteria 5426
387 Ga0068865_100032864 3300006881 Bacteria 3470
388 Ga0068865_100039737 3300006881 Bacteria 3193
389 Ga0068865_100114673 3300006881 Bacteria 1993
390 Ga0075436_100396254 3300006914 Bacteria 1000
391 Ga0097620_100000330 3300006931 Bacteria 47242
392 Ga0097620_100009872 3300006931 Bacteria 9638
393 Ga0097620_100015177 3300006931 Bacteria 7733
394 Ga0097620_100066744 3300006931 Bacteria 3633
395 Ga0097620_100076874 3300006931 Bacteria 3379
396 Ga0097620_100171933 3300006931 Bacteria 2248
397 Ga0075435_100334123 3300007076 Bacteria 1298
398 Ga0105240_10000332 3300009093 Bacteria 88613
399 Ga0105240_10000346 3300009093 Bacteria 86815
400 Ga0105240_10171210 3300009093 Bacteria 2572
401 Ga0111539_10003105 3300009094 Bacteria 22008
402 Ga0111539_10047219 3300009094 Bacteria 5148
403 Ga0111539_10060708 3300009094 Bacteria 4480
404 Ga0111539_10167683 3300009094 Bacteria 2566
405 Ga0105245_10008704 3300009098 Bacteria 8848
406 Ga0105245_10039630 3300009098 Bacteria 4193
407 Ga0105245_10534752 3300009098 Bacteria 1192
408 Ga0105245_10688833 3300009098 Bacteria 1054
409 Ga0105247_10003604 3300009101 Bacteria 10056
410 Ga0105247_10013560 3300009101 Bacteria 4887
411 Ga0105247_10029345 3300009101 Bacteria 3332
412 Ga0114129_10006954 3300009147 Bacteria 16098
413 Ga0114129_10081956 3300009147 Bacteria 4484
414 Ga0114129_10296203 3300009147 Bacteria 2158
415 Ga0105243_10286607 3300009148 Bacteria 1486
416 Ga0105243_10705343 3300009148 Bacteria 984
417 Ga0105241_10134563 3300009174 Bacteria 2005
418 Ga0105241_10371541 3300009174 Bacteria 1247
419 Ga0105242_10019291 3300009176 Bacteria 5342
420 Ga0105242_10043990 3300009176 Bacteria 3614
421 Ga0105242_10063605 3300009176 Bacteria 3039
422 Ga0105248_10024911 3300009177 Bacteria 6650
423 Ga0105248_10042678 3300009177 Bacteria 5086
424 Ga0105248_10060710 3300009177 Bacteria 4244
425 Ga0105248_10106388 3300009177 Bacteria 3163
426 Ga0105248_10114526 3300009177 Bacteria 3041
427 Ga0105248_10163213 3300009177 Bacteria 2512
428 Ga0105248_10697375 3300009177 Bacteria 1145
429 Ga0105237_10053937 3300009545 Bacteria 4030
430 Ga0105237_10098809 3300009545 Bacteria 2910
431 Ga0105237_10119375 3300009545 Bacteria 2631
432 Ga0105237_10130895 3300009545 Bacteria 2503
433 Ga0105238_10001058 3300009551 Bacteria 27802
434 Ga0105238_10055926 3300009551 Bacteria 3959
435 Ga0105238_10085022 3300009551 Bacteria 3153
436 Ga0105238_10355153 3300009551 Bacteria 1455
437 Ga0105238_10478036 3300009551 Bacteria 1245
438 Ga0105238_10732215 3300009551 Bacteria 1002
439 Ga0105249_10081063 3300009553 Bacteria 3016
440 Ga0105249_10421280 3300009553 Bacteria 1369
441 Ga0105239_10000273 3300010375 Bacteria 75974
442 Ga0105239_10098913 3300010375 Bacteria 3225
443 Ga0105239_10108211 3300010375 Bacteria 3080
444 Ga0105239_10181138 3300010375 Bacteria 2357
445 Ga0105239_10600815 3300010375 Bacteria 1255
446 Ga0157373_10001173 3300013100 Bacteria 20060
447 Ga0157373_10004676 3300013100 Bacteria 10292
448 Ga0157373_10008730 3300013100 Bacteria 7512
449 Ga0157373_10047366 3300013100 Bacteria 3066
450 Ga0157371_10059352 3300013102 Bacteria 2712
451 Ga0157370_10016519 3300013104 Bacteria 7468
452 Ga0157370_10021796 3300013104 Bacteria 6382
453 Ga0157370_10051627 3300013104 Bacteria 3928
454 Ga0157370_10053342 3300013104 Bacteria 3856
455 Ga0157370_10072589 3300013104 Bacteria 3247
456 Ga0157370_10434012 3300013104 Bacteria 1208
457 Ga0157369_10002942 3300013105 Bacteria 20368
458 Ga0157369_10011173 3300013105 Bacteria 10204
459 Ga0157369_10023324 3300013105 Bacteria 6893
460 Ga0157369_10094508 3300013105 Bacteria 3191
461 Ga0157369_10095005 3300013105 Bacteria 3182
462 Ga0157369_10211915 3300013105 Bacteria 2030
463 Ga0157369_10337053 3300013105 Bacteria 1567
464 Ga0157369_10372009 3300013105 Bacteria 1483
465 Ga0157369_10387769 3300013105 Bacteria 1450
466 Ga0157369_10404970 3300013105 Bacteria 1415
467 Ga0157374_10000720 3300013296 Bacteria 28871
468 Ga0157374_10008122 3300013296 Bacteria 8969
469 Ga0157374_10183144 3300013296 Bacteria 2047
470 Ga0157378_10014979 3300013297 Bacteria 6790
471 Ga0157378_10016325 3300013297 Bacteria 6503
472 Ga0157378_10018354 3300013297 Bacteria 6143
473 Ga0157378_10031519 3300013297 Bacteria 4682
474 Ga0157378_10172120 3300013297 Bacteria 2031
475 Ga0157378_10216584 3300013297 Bacteria 1818
476 Ga0163162_10003105 3300013306 Bacteria 15858
477 Ga0163162_10006113 3300013306 Bacteria 11652
478 Ga0163162_10019549 3300013306 Bacteria 6648
479 Ga0163162_10031701 3300013306 Bacteria 5244
480 Ga0163162_10033583 3300013306 Bacteria 5099
481 Ga0163162_10097485 3300013306 Bacteria 3028
482 Ga0163162_10203427 3300013306 Bacteria 2109
483 Ga0163162_10399134 3300013306 Bacteria 1508
484 Ga0163162_10527316 3300013306 Bacteria 1310
485 Ga0157372_10001478 3300013307 Bacteria 25520
486 Ga0157372_10007660 3300013307 Bacteria 11483
487 Ga0157372_10011518 3300013307 Bacteria 9407
488 Ga0157372_10034097 3300013307 Bacteria 5594
489 Ga0157372_10038458 3300013307 Bacteria 5280
490 Ga0157372_10038657 3300013307 Bacteria 5265
491 Ga0157372_10045721 3300013307 Bacteria 4858
492 Ga0157375_10002056 3300013308 Bacteria 17374
493 Ga0157375_10007671 3300013308 Bacteria 9442
494 Ga0157375_10009192 3300013308 Bacteria 8664
495 Ga0157375_10011037 3300013308 Bacteria 7965
496 Ga0157375_10055031 3300013308 Bacteria 3921
497 Ga0157375_10064518 3300013308 Bacteria 3647
498 Ga0157375_10065262 3300013308 Bacteria 3629
499 Ga0157375_10080781 3300013308 Bacteria 3290
500 Ga0157375_10150043 3300013308 Bacteria 2466
501 Ga0163163_10001050 3300014325 Bacteria 23390
502 Ga0163163_10012528 3300014325 Bacteria 7732
503 Ga0163163_10014354 3300014325 Bacteria 7282
504 Ga0163163_10259800 3300014325 Bacteria 1788
505 Ga0163163_10388928 3300014325 Bacteria 1452
506 Ga0157380_10067687 3300014326 Bacteria 2877
507 Ga0157380_10135107 3300014326 Bacteria 2110
508 Ga0157380_10275197 3300014326 Bacteria 1537
509 Ga0182008_10007068 3300014497 Bacteria 6222
510 Ga0182008_10059028 3300014497 Bacteria 1893
511 Ga0182008_10142331 3300014497 Bacteria 1200
512 Ga0157377_10015910 3300014745 Bacteria 3858
513 Ga0157379_10000522 3300014968 Bacteria 31120
514 Ga0157379_10003838 3300014968 Bacteria 12812
515 Ga0157379_10004446 3300014968 Bacteria 12020
516 Ga0157379_10007323 3300014968 Bacteria 9550
517 Ga0157379_10083757 3300014968 Bacteria 2858
518 Ga0157379_10494611 3300014968 Bacteria 1133
519 Ga0157376_10003508 3300014969 Bacteria 10818
520 Ga0157376_10005949 3300014969 Bacteria 8568
521 Ga0157376_10011958 3300014969 Bacteria 6419
522 Ga0157376_10013021 3300014969 Bacteria 6195
523 Ga0157376_10015126 3300014969 Bacteria 5817
524 Ga0157376_10023451 3300014969 Bacteria 4829
525 Ga0157376_10039324 3300014969 Bacteria 3857
526 Ga0157376_10098711 3300014969 Bacteria 2546
527 Ga0157376_10166601 3300014969 Bacteria 2003
528 Ga0157376_10442954 3300014969 Bacteria 1265
529 Ga0182006_1000058 3300015261 Bacteria 167164
530 Ga0182006_1001653 3300015261 Bacteria 13145
531 Ga0182007_10005116 3300015262 Bacteria 5812
532 Ga0182005_1000015 3300015265 Bacteria 387565
533 Ga0182005_1006185 3300015265 Bacteria 3679
534 Ga0182005_1007259 3300015265 Bacteria 3332
535 Ga0182005_1008891 3300015265 Bacteria 2945
536 Ga0163161_10012216 3300017792 Bacteria 5957
537 Ga0163161_10164879 3300017792 Bacteria 1691
538 Ga0163161_10342434 3300017792 Bacteria 1186
539 Ga0206354_10975298 3300020081 Bacteria 2664
540 Ga0209674_100375 3300025226 Bacteria 24206
541 Ga0209437_101785 3300025233 Bacteria 4642
542 Ga0209148_1001446 3300025254 Bacteria 12072
543 Ga0209129_1001704 3300025258 Bacteria 11869
544 Ga0207673_1009665 3300025290 Bacteria 1235
545 Ga0209051_1006973 3300025303 Bacteria 6266
546 Ga0207697_10000008 3300025315 Bacteria 71181
547 Ga0207656_10004598 3300025321 Bacteria 4831
548 Ga0207656_10026491 3300025321 Bacteria 2364
549 Ga0207682_10000078 3300025893 Bacteria 43151
550 Ga0207682_10000117 3300025893 Bacteria 36804
551 Ga0207682_10041221 3300025893 Bacteria 1884
552 Ga0207692_10014813 3300025898 Bacteria 3415
553 Ga0207692_10052105 3300025898 Bacteria 2078
554 Ga0207692_10174532 3300025898 Bacteria 1248
555 Ga0207692_10374242 3300025898 Bacteria 883
556 Ga0207642_10001022 3300025899 Bacteria 8740
557 Ga0207642_10062269 3300025899 Bacteria 1739
558 Ga0207642_10063965 3300025899 Bacteria 1723
559 Ga0207642_10071757 3300025899 Bacteria 1650
560 Ga0207642_10086296 3300025899 Bacteria 1538
561 Ga0207642_10117410 3300025899 Bacteria 1366
562 Ga0207710_10006031 3300025900 Bacteria 5192
563 Ga0207710_10015842 3300025900 Bacteria 3189
564 Ga0207710_10105344 3300025900 Bacteria 1334
565 Ga0207688_10001307 3300025901 Bacteria 12927
566 Ga0207688_10019057 3300025901 Bacteria 3734
567 Ga0207688_10074420 3300025901 Bacteria 1931
568 Ga0207688_10283775 3300025901 Bacteria 1009
569 Ga0207680_10000776 3300025903 Bacteria 15088
570 Ga0207680_10020973 3300025903 Bacteria 3528
571 Ga0207680_10076944 3300025903 Bacteria 2085
572 Ga0207680_10099030 3300025903 Bacteria 1870
573 Ga0207647_10000005 3300025904 Bacteria 223490
574 Ga0207699_10128221 3300025906 Bacteria 1651
575 Ga0207645_10000139 3300025907 Bacteria 55848
576 Ga0207645_10000552 3300025907 Bacteria 31081
577 Ga0207645_10001815 3300025907 Bacteria 17220
578 Ga0207645_10016972 3300025907 Bacteria 4810
579 Ga0207645_10065457 3300025907 Bacteria 2323
580 Ga0207645_10119584 3300025907 Bacteria 1709
581 Ga0207643_10000089 3300025908 Bacteria 61020
582 Ga0207643_10003046 3300025908 Bacteria 9010
583 Ga0207643_10010575 3300025908 Bacteria 4968
584 Ga0207643_10042770 3300025908 Bacteria 2554
585 Ga0207705_10015510 3300025909 Bacteria 5468
586 Ga0207705_10108935 3300025909 Bacteria 2045
587 Ga0207705_10183077 3300025909 Bacteria 1582
588 Ga0207705_10299515 3300025909 Bacteria 1233
589 Ga0207684_10490801 3300025910 Bacteria 1053
590 Ga0207654_10008661 3300025911 Bacteria 5156
591 Ga0207654_10016603 3300025911 Bacteria 3836
592 Ga0207654_10024223 3300025911 Bacteria 3261
593 Ga0207654_10089753 3300025911 Bacteria 1870
594 Ga0207654_10307311 3300025911 Bacteria 1080
595 Ga0207707_10014263 3300025912 Bacteria 6923
596 Ga0207707_10019764 3300025912 Bacteria 5880
597 Ga0207707_10031871 3300025912 Bacteria 4615
598 Ga0207707_10054275 3300025912 Bacteria 3488
599 Ga0207695_10000100 3300025913 Bacteria 258626
600 Ga0207695_10031562 3300025913 Bacteria 5807
601 Ga0207695_10500029 3300025913 Bacteria 1098
602 Ga0207671_10021761 3300025914 Bacteria 4860
603 Ga0207671_10109227 3300025914 Bacteria 2103
604 Ga0207693_10000485 3300025915 Bacteria 36061
605 Ga0207693_10114123 3300025915 Bacteria 2120
606 Ga0207663_10006208 3300025916 Bacteria 6091
607 Ga0207663_10130130 3300025916 Bacteria 1738
608 Ga0207660_10408462 3300025917 Bacteria 1094
609 Ga0207662_10009347 3300025918 Bacteria 5390
610 Ga0207657_10000240 3300025919 Bacteria 58053
611 Ga0207657_10000803 3300025919 Bacteria 33281
612 Ga0207657_10003754 3300025919 Bacteria 16143
613 Ga0207657_10012140 3300025919 Bacteria 8511
614 Ga0207657_10023861 3300025919 Bacteria 5683
615 Ga0207657_10024594 3300025919 Bacteria 5572
616 Ga0207657_10031867 3300025919 Bacteria 4768
617 Ga0207657_10178676 3300025919 Bacteria 1716
618 Ga0207649_10006252 3300025920 Bacteria 6469
619 Ga0207649_10059205 3300025920 Bacteria 2402
620 Ga0207649_10068515 3300025920 Bacteria 2256
621 Ga0207649_10069637 3300025920 Bacteria 2241
622 Ga0207649_10140207 3300025920 Bacteria 1653
623 Ga0207652_10003594 3300025921 Bacteria 12774
624 Ga0207652_10040328 3300025921 Bacteria 3965
625 Ga0207652_10077479 3300025921 Bacteria 2901
626 Ga0207652_10142150 3300025921 Bacteria 2147
627 Ga0207652_10211674 3300025921 Bacteria 1745
628 Ga0207652_10459887 3300025921 Bacteria 1147
629 Ga0207652_10507120 3300025921 Bacteria 1086
630 Ga0207681_10006422 3300025923 Bacteria 7218
631 Ga0207681_10028269 3300025923 Bacteria 3631
632 Ga0207681_10029520 3300025923 Bacteria 3563
633 Ga0207681_10080877 3300025923 Bacteria 2293
634 Ga0207681_10093417 3300025923 Bacteria 2153
635 Ga0207681_10167478 3300025923 Bacteria 1662
636 Ga0207681_10304014 3300025923 Bacteria 1263
637 Ga0207694_10002852 3300025924 Bacteria 13942
638 Ga0207694_10015161 3300025924 Bacteria 5813
639 Ga0207694_10189591 3300025924 Bacteria 1670
640 Ga0207650_10004137 3300025925 Bacteria 9917
641 Ga0207650_10005921 3300025925 Bacteria 8343
642 Ga0207650_10017824 3300025925 Bacteria 4974
643 Ga0207650_10017879 3300025925 Bacteria 4967
644 Ga0207650_10087748 3300025925 Bacteria 2371
645 Ga0207650_10095463 3300025925 Bacteria 2279
646 Ga0207650_10097254 3300025925 Bacteria 2260
647 Ga0207650_10174706 3300025925 Bacteria 1709
648 Ga0207650_10266228 3300025925 Bacteria 1392
649 Ga0207650_10531018 3300025925 Bacteria 985
650 Ga0207659_10001052 3300025926 Bacteria 16360
651 Ga0207659_10003711 3300025926 Bacteria 9209
652 Ga0207659_10010158 3300025926 Bacteria 5904
653 Ga0207659_10012602 3300025926 Bacteria 5387
654 Ga0207659_10015203 3300025926 Bacteria 4981
655 Ga0207687_10001187 3300025927 Bacteria 17803
656 Ga0207687_10007628 3300025927 Bacteria 7115
657 Ga0207687_10050209 3300025927 Bacteria 2903
658 Ga0207700_10000045 3300025928 Bacteria 88536
659 Ga0207700_10001822 3300025928 Bacteria 12116
660 Ga0207700_10048113 3300025928 Bacteria 3165
661 Ga0207700_10061742 3300025928 Bacteria 2843
662 Ga0207700_10377454 3300025928 Bacteria 1239
663 Ga0207700_10407474 3300025928 Bacteria 1192
664 Ga0207664_10003746 3300025929 Bacteria 10210
665 Ga0207664_10020854 3300025929 Bacteria 4863
666 Ga0207644_10005257 3300025931 Bacteria 8449
667 Ga0207644_10005479 3300025931 Bacteria 8266
668 Ga0207644_10008951 3300025931 Bacteria 6558
669 Ga0207644_10013067 3300025931 Bacteria 5527
670 Ga0207644_10027283 3300025931 Bacteria 3944
671 Ga0207644_10044328 3300025931 Bacteria 3160
672 Ga0207644_10045725 3300025931 Bacteria 3115
673 Ga0207644_10152480 3300025931 Bacteria 1789
674 Ga0207690_10004965 3300025932 Bacteria 7853
675 Ga0207690_10008762 3300025932 Bacteria 6005
676 Ga0207690_10010248 3300025932 Bacteria 5566
677 Ga0207690_10070081 3300025932 Bacteria 2414
678 Ga0207690_10166987 3300025932 Bacteria 1646
679 Ga0207690_10180440 3300025932 Bacteria 1589
680 Ga0207690_10274353 3300025932 Bacteria 1311
681 Ga0207706_10000002 3300025933 Bacteria 360309
682 Ga0207706_10000456 3300025933 Bacteria 43575
683 Ga0207706_10002935 3300025933 Bacteria 16483
684 Ga0207706_10038532 3300025933 Bacteria 4239
685 Ga0207706_10663598 3300025933 Bacteria 892
686 Ga0207686_10000309 3300025934 Bacteria 35241
687 Ga0207709_10428445 3300025935 Bacteria 1018
688 Ga0207670_10033503 3300025936 Bacteria 3311
689 Ga0207670_10078568 3300025936 Bacteria 2301
690 Ga0207670_10146680 3300025936 Bacteria 1746
691 Ga0207670_10201005 3300025936 Bacteria 1514
692 Ga0207670_10226588 3300025936 Bacteria 1433
693 Ga0207669_10003245 3300025937 Bacteria 7026
694 Ga0207669_10012184 3300025937 Bacteria 4220
695 Ga0207669_10020734 3300025937 Bacteria 3453
696 Ga0207669_10054120 3300025937 Bacteria 2422
697 Ga0207669_10088175 3300025937 Bacteria 2011
698 Ga0207704_10042897 3300025938 Bacteria 2667
699 Ga0207704_10171885 3300025938 Bacteria 1555
700 Ga0207665_10004200 3300025939 Bacteria 9583
701 Ga0207665_10032651 3300025939 Bacteria 3447
702 Ga0207691_10000040 3300025940 Bacteria 106561
703 Ga0207691_10001760 3300025940 Bacteria 21320
704 Ga0207691_10002356 3300025940 Bacteria 18498
705 Ga0207691_10003578 3300025940 Bacteria 15125
706 Ga0207691_10009315 3300025940 Bacteria 9423
707 Ga0207691_10011361 3300025940 Bacteria 8545
708 Ga0207691_10041209 3300025940 Bacteria 4264
709 Ga0207691_10053674 3300025940 Bacteria 3679
710 Ga0207691_10054416 3300025940 Bacteria 3650
711 Ga0207691_10170206 3300025940 Bacteria 1908
712 Ga0207691_10224159 3300025940 Bacteria 1629
713 Ga0207711_10000115 3300025941 Bacteria 83472
714 Ga0207711_10010215 3300025941 Bacteria 7794
715 Ga0207711_10016534 3300025941 Bacteria 6128
716 Ga0207711_10027119 3300025941 Bacteria 4810
717 Ga0207711_10057720 3300025941 Bacteria 3337
718 Ga0207711_10224383 3300025941 Bacteria 1719
719 Ga0207689_10000072 3300025942 Bacteria 82171
720 Ga0207689_10001313 3300025942 Bacteria 23952
721 Ga0207689_10010191 3300025942 Bacteria 8099
722 Ga0207689_10010686 3300025942 Bacteria 7898
723 Ga0207689_10054482 3300025942 Bacteria 3293
724 Ga0207689_10060809 3300025942 Bacteria 3106
725 Ga0207689_10126536 3300025942 Bacteria 2102
726 Ga0207661_10069396 3300025944 Bacteria 2873
727 Ga0207661_10270483 3300025944 Bacteria 1516
728 Ga0207661_10367864 3300025944 Bacteria 1300
729 Ga0207679_10009685 3300025945 Bacteria 6177
730 Ga0207679_10022604 3300025945 Bacteria 4285
731 Ga0207679_10023248 3300025945 Bacteria 4235
732 Ga0207679_10057864 3300025945 Bacteria 2869
733 Ga0207679_10076010 3300025945 Bacteria 2550
734 Ga0207679_10156928 3300025945 Bacteria 1859
735 Ga0207667_10011280 3300025949 Bacteria 10393
736 Ga0207667_10012910 3300025949 Bacteria 9596
737 Ga0207667_10048176 3300025949 Bacteria 4507
738 Ga0207667_10099615 3300025949 Bacteria 2998
739 Ga0207667_10113614 3300025949 Bacteria 2792
740 Ga0207667_10129834 3300025949 Bacteria 2595
741 Ga0207651_10000966 3300025960 Bacteria 12704
742 Ga0207651_10003025 3300025960 Bacteria 8151
743 Ga0207651_10013398 3300025960 Bacteria 4692
744 Ga0207651_10025367 3300025960 Bacteria 3683
745 Ga0207651_10044588 3300025960 Bacteria 2969
746 Ga0207651_10107295 3300025960 Bacteria 2087
747 Ga0207651_10237075 3300025960 Bacteria 1485
748 Ga0207651_10258797 3300025960 Bacteria 1427
749 Ga0207651_10384321 3300025960 Bacteria 1190
750 Ga0207712_10085127 3300025961 Bacteria 2312
751 Ga0207712_10099208 3300025961 Bacteria 2162
752 Ga0207668_10001913 3300025972 Bacteria 12186
753 Ga0207668_10003096 3300025972 Bacteria 9751
754 Ga0207668_10008843 3300025972 Bacteria 6021
755 Ga0207668_10012420 3300025972 Bacteria 5214
756 Ga0207668_10099301 3300025972 Bacteria 2159
757 Ga0207668_10116648 3300025972 Bacteria 2014
758 Ga0207668_10198448 3300025972 Bacteria 1596
759 Ga0207668_10239164 3300025972 Bacteria 1468
760 Ga0207640_10005098 3300025981 Bacteria 7142
761 Ga0207640_10011411 3300025981 Bacteria 5031
762 Ga0207640_10042045 3300025981 Bacteria 2911
763 Ga0207640_10043464 3300025981 Bacteria 2872
764 Ga0207640_10079625 3300025981 Bacteria 2234
765 Ga0207640_10086941 3300025981 Bacteria 2154
766 Ga0207640_10090431 3300025981 Bacteria 2118
767 Ga0207640_10133266 3300025981 Bacteria 1799
768 Ga0207640_10210657 3300025981 Bacteria 1480
769 Ga0207658_10004416 3300025986 Bacteria 9784
770 Ga0207658_10008367 3300025986 Bacteria 7042
771 Ga0207658_10009624 3300025986 Bacteria 6559
772 Ga0207658_10042973 3300025986 Bacteria 3282
773 Ga0207658_10174219 3300025986 Bacteria 1775
774 Ga0207658_10299031 3300025986 Bacteria 1386
775 Ga0207658_10506933 3300025986 Bacteria 1075
776 Ga0207658_10583619 3300025986 Bacteria 1003
777 Ga0207677_10000395 3300026023 Bacteria 30050
778 Ga0207677_10010308 3300026023 Bacteria 5285
779 Ga0207677_10089229 3300026023 Bacteria 2238
780 Ga0207677_10193016 3300026023 Bacteria 1612
781 Ga0207677_10731588 3300026023 Bacteria 880
782 Ga0207703_10000588 3300026035 Bacteria 36998
783 Ga0207703_10001041 3300026035 Bacteria 26557
784 Ga0207703_10078964 3300026035 Bacteria 2736
785 Ga0207703_10082897 3300026035 Bacteria 2678
786 Ga0207703_10241514 3300026035 Bacteria 1624
787 Ga0207703_10549871 3300026035 Bacteria 1088
788 Ga0207703_10729703 3300026035 Bacteria 943
789 Ga0207639_10009669 3300026041 Bacteria 6661
790 Ga0207639_10012594 3300026041 Bacteria 5894
791 Ga0207639_10035788 3300026041 Bacteria 3675
792 Ga0207639_10146472 3300026041 Bacteria 1973
793 Ga0207678_10001320 3300026067 Bacteria 22902
794 Ga0207678_10002147 3300026067 Bacteria 17862
795 Ga0207678_10028719 3300026067 Bacteria 4855
796 Ga0207678_10044821 3300026067 Bacteria 3825
797 Ga0207678_10063354 3300026067 Bacteria 3177
798 Ga0207678_10070349 3300026067 Bacteria 3000
799 Ga0207708_10001784 3300026075 Bacteria 15881
800 Ga0207708_10158934 3300026075 Bacteria 1784
801 Ga0207702_10019215 3300026078 Bacteria 5652
802 Ga0207702_10064859 3300026078 Bacteria 3126
803 Ga0207702_10073413 3300026078 Bacteria 2949
804 Ga0207702_10074687 3300026078 Bacteria 2926
805 Ga0207702_10192747 3300026078 Bacteria 1884
806 Ga0207702_10199433 3300026078 Bacteria 1854
807 Ga0207702_10342908 3300026078 Bacteria 1427
808 Ga0207641_10004458 3300026088 Bacteria 12123
809 Ga0207641_10005320 3300026088 Bacteria 10990
810 Ga0207641_10005586 3300026088 Bacteria 10717
811 Ga0207641_10006323 3300026088 Bacteria 10011
812 Ga0207641_10009256 3300026088 Bacteria 8122
813 Ga0207641_10046301 3300026088 Bacteria 3665
814 Ga0207641_10082119 3300026088 Bacteria 2800
815 Ga0207641_10095698 3300026088 Bacteria 2607
816 Ga0207641_10106756 3300026088 Bacteria 2476
817 Ga0207648_10000869 3300026089 Bacteria 34031
818 Ga0207648_10003505 3300026089 Bacteria 16438
819 Ga0207648_10004136 3300026089 Bacteria 15010
820 Ga0207648_10011065 3300026089 Bacteria 8513
821 Ga0207648_10019772 3300026089 Bacteria 6076
822 Ga0207648_10021921 3300026089 Bacteria 5739
823 Ga0207648_10036416 3300026089 Bacteria 4335
824 Ga0207648_10241524 3300026089 Bacteria 1608
825 Ga0207648_10370262 3300026089 Bacteria 1294
826 Ga0207676_10000415 3300026095 Bacteria 36094
827 Ga0207676_10010062 3300026095 Bacteria 6729
828 Ga0207676_10023745 3300026095 Bacteria 4529
829 Ga0207676_10027348 3300026095 Bacteria 4247
830 Ga0207676_10034726 3300026095 Bacteria 3819
831 Ga0207676_10047817 3300026095 Bacteria 3317
832 Ga0207674_10000064 3300026116 Bacteria 109914
833 Ga0207674_10000237 3300026116 Bacteria 68721
834 Ga0207674_10002009 3300026116 Bacteria 25831
835 Ga0207674_10009820 3300026116 Bacteria 10898
836 Ga0207674_10017265 3300026116 Bacteria 7874
837 Ga0207674_10149452 3300026116 Bacteria 2293
838 Ga0207674_10271687 3300026116 Bacteria 1643
839 Ga0207674_10323826 3300026116 Bacteria 1491
840 Ga0207675_100001565 3300026118 Bacteria 22938
841 Ga0207675_100003198 3300026118 Bacteria 16070
842 Ga0207675_100004543 3300026118 Bacteria 13388
843 Ga0207675_100019899 3300026118 Bacteria 6265
844 Ga0207675_100039312 3300026118 Bacteria 4415
845 Ga0207675_100071076 3300026118 Bacteria 3253
846 Ga0207683_10000059 3300026121 Bacteria 83666
847 Ga0207683_10003115 3300026121 Bacteria 14487
848 Ga0207683_10016179 3300026121 Bacteria 6349
849 Ga0207683_10028011 3300026121 Bacteria 4870
850 Ga0207683_10035577 3300026121 Bacteria 4332
851 Ga0207683_10227164 3300026121 Bacteria 1702
852 Ga0207698_10010565 3300026142 Bacteria 5942
853 Ga0207698_10013561 3300026142 Bacteria 5384
854 Ga0207698_10124483 3300026142 Bacteria 2189
855 Ga0207698_10138812 3300026142 Bacteria 2090
856 Ga0209984_1001661 3300027424 Bacteria 2425
857 Ga0210000_1016516 3300027462 Bacteria 1115
858 Ga0209995_1011546 3300027471 Bacteria 1436
859 Ga0209982_1004436 3300027552 Bacteria 2008
860 Ga0209983_1001303 3300027665 Bacteria 5555
861 Ga0209983_1001468 3300027665 Bacteria 5233
862 Ga0209971_1000324 3300027682 Bacteria 13183
863 Ga0209971_1007478 3300027682 Bacteria 2592
864 Ga0209966_1011852 3300027695 Bacteria 1594
865 Ga0209998_10004521 3300027717 Bacteria 2952
866 Ga0209974_10000203 3300027876 Bacteria 19088
867 Ga0209974_10004990 3300027876 Bacteria 4693
868 Ga0209974_10032510 3300027876 Bacteria 1729
869 Ga0268266_10003868 3300028379 Bacteria 14601
870 Ga0268266_10006174 3300028379 Bacteria 11014
871 Ga0268266_10021420 3300028379 Bacteria 5506
872 Ga0268266_10046196 3300028379 Bacteria 3728
873 Ga0268266_10113545 3300028379 Bacteria 2402
874 Ga0268266_10134112 3300028379 Bacteria 2217
875 Ga0268266_10415006 3300028379 Bacteria 1275
876 Ga0268265_10018742 3300028380 Bacteria 4801
877 Ga0268265_10037284 3300028380 Bacteria 3567
878 Ga0268265_10040680 3300028380 Bacteria 3435
879 Ga0268265_10083898 3300028380 Bacteria 2524
880 Ga0268265_10248017 3300028380 Bacteria 1575
881 Ga0268264_10000593 3300028381 Bacteria 43940
882 Ga0268264_10008945 3300028381 Bacteria 8312
883 Ga0268264_10037315 3300028381 Bacteria 4006
884 Ga0268264_10059085 3300028381 Bacteria 3212
885 Ga0268264_10062357 3300028381 Bacteria 3130
886 Ga0268264_10064355 3300028381 Bacteria 3086
887 Ga0268264_10074028 3300028381 Bacteria 2892
888 Ga0268264_10174588 3300028381 Bacteria 1946
889 Ga0265332_10000724 3300031238 Bacteria 20828
890 Ga0265328_10061595 3300031239 Bacteria 1377
891 Ga0265325_10005874 3300031241 Bacteria 7522
892 Ga0265331_10000579 3300031250 Bacteria 32817
893 Ga0265327_10004776 3300031251 Bacteria 11795
894 Ga0265327_10058377 3300031251 Bacteria 1980
895 Ga0265316_10018674 3300031344 Bacteria 5955
896 Ga0307408_100005146 3300031548 Bacteria 8769
897 Ga0307408_100088245 3300031548 Bacteria 2335
898 Ga0307408_100428774 3300031548 Bacteria 1142
899 Ga0265314_10065902 3300031711 Bacteria 2444
900 Ga0265342_10018197 3300031712 Bacteria 4558
901 Ga0307405_10033592 3300031731 Bacteria 3044
902 Ga0307413_10001213 3300031824 Bacteria 9546
903 Ga0307413_10062358 3300031824 Bacteria 2305
904 Ga0307413_10402313 3300031824 Bacteria 1073
905 Ga0307413_10408242 3300031824 Bacteria 1066
906 Ga0307410_10005008 3300031852 Bacteria 6949
907 Ga0307410_10071058 3300031852 Bacteria 2413
908 Ga0307406_10022869 3300031901 Bacteria 3713
909 Ga0307407_10002420 3300031903 Bacteria 7303
910 Ga0307407_10057378 3300031903 Bacteria 2258
911 Ga0307407_10306386 3300031903 Bacteria 1109
912 Ga0307412_10000360 3300031911 Bacteria 28351
913 Ga0307412_10019072 3300031911 Bacteria 4143
914 Ga0307409_100046791 3300031995 Bacteria 3278
915 Ga0307409_100049819 3300031995 Bacteria 3196
916 Ga0307409_100727344 3300031995 Bacteria 994
917 Ga0307416_100004301 3300032002 Bacteria 8551
918 Ga0307416_100130886 3300032002 Bacteria 2258
919 Ga0307414_10033117 3300032004 Bacteria 3412
920 Ga0307414_10136418 3300032004 Bacteria 1914
921 Ga0307411_10002192 3300032005 Bacteria 8488
922 Ga0307411_10006419 3300032005 Bacteria 5882
923 Ga0307415_100002398 3300032126 Bacteria 9345
924 Ga0307415_100177906 3300032126 Bacteria 1666
925 Ga0307415_100437721 3300032126 Bacteria 1127
926 Ga0373934_0003073 3300035086 Bacteria 6092
927 Ga0373934_0092635 3300035086 Bacteria 1219
928 Ga0373934_0111850 3300035086 Bacteria 1108
929 Ga0373944_0020064 3300035089 Bacteria 1921
930 Ga0373923_0006925 3300035111 Bacteria 3951
931 Ga0373939_0039080 3300035114 Bacteria 1419
932 Ga0373945_0007088 3300035116 Bacteria 3627
933 Ga0373953_0022998 3300035117 Bacteria 2356
934 Ga0373954_0004673 3300035118 Bacteria 5904
935 Ga0373954_0166136 3300035118 Bacteria 1080
936 Ga0373957_0008055 3300035120 Bacteria 3398
937 Ga0373943_0133185 3300035170 Bacteria 1332
938 Ga0373943_0146415 3300035170 Bacteria 1276
939 Ga0373955_0012467 3300035172 Bacteria 4084
940 Ga0373955_0262477 3300035172 Bacteria 1037
941 Ga0373924_0002983 3300035410 Bacteria 5755
942 Ga0373924_0030665 3300035410 Bacteria 2156
943 Ga0373931_0023391 3300035691 Bacteria 3119
944 Ga0373931_0045785 3300035691 Bacteria 2311
945 Ga0373931_0096626 3300035691 Bacteria 1655
946 Ga0373935_0063532 3300035692 Bacteria 2366
947 Ga0373933_0069583 3300035724 Bacteria 2139
948 Ga0373933_0198300 3300035724 Bacteria 1284
949 Ga0373933_0201823 3300035724 Bacteria 1273
950 Ga0373933_0297293 3300035724 Bacteria 1045
951 Ga0373947_0095928 3300035725 Bacteria 1856
952 Ga0373947_0175018 3300035725 Bacteria 1394
953 Ga0373947_0317506 3300035725 Bacteria 1041
954 Ga0373937_0020352 3300036401 Bacteria 5949
955 Ga0373937_0029640 3300036401 Bacteria 4957
956 Ga0373937_0043770 3300036401 Bacteria 4089
957 Ga0373937_0093496 3300036401 Bacteria 2788
958 Ga0373937_0437932 3300036401 Bacteria 1241
959 Ga0373937_1041854 3300036401 Bacteria 767
960 Ga0373925_0016949 3300037068 Bacteria 5273
961 Ga0373925_0027601 3300037068 Bacteria 4155
962 Ga0373925_0046710 3300037068 Bacteria 3220
963 Ga0395900_0076921 3300037418 Bacteria 3429
964 Ga0395900_0128863 3300037418 Bacteria 2594
965 Ga0395898_0116153 3300037466 Bacteria 2564
966 Ga0395901_0109151 3300038443 Bacteria 2905
967 Ga0439436_0000003 3300041404 Bacteria 186684
968 Ga0439465_0000970 3300041413 Bacteria 9128
969 Ga0451791_0643963 3300041451 Bacteria 4938
970 Ga0451797_1001905 3300041453 Bacteria 1327
971 Ga0450896_011054 3300042133 Bacteria 1269
972 Ga0450908_000002 3300042184 Bacteria 94473
973 Ga0451577_0018546 3300042876 Bacteria 6407
974 Ga0451577_0158422 3300042876 Bacteria 2038
975 Ga0451577_0167805 3300042876 Bacteria 1978
976 Ga0466982_0000024 3300044672 Bacteria 76608
977 Ga0453683_0007345 3300044673 Bacteria 7486
978 Ga0453683_0011900 3300044673 Bacteria 5721
979 Ga0453683_0037736 3300044673 Bacteria 3038
980 Ga0453683_0103550 3300044673 Bacteria 1787
981 Ga0453684_0002059 3300044712 Bacteria 51091
982 Ga0453684_0004796 3300044712 Bacteria 27835
983 Ga0453684_0015609 3300044712 Bacteria 11985
984 Ga0453684_0049444 3300044712 Bacteria 5545
985 Ga0453684_0075435 3300044712 Bacteria 4238
986 Ga0453684_0078799 3300044712 Bacteria 4121
987 Ga0453684_0079490 3300044712 Bacteria 4099
988 Ga0453684_0153407 3300044712 Unclassified 2734
989 Ga0453684_0207402 3300044712 Bacteria 2280
990 Ga0453684_0304304 3300044712 Bacteria 1811
991 Ga0453684_0534190 3300044712 Bacteria 1294
992 Ga0453684_0758294 3300044712 Bacteria 1050
993 Ga0453684_0991007 3300044712 Bacteria 894
994 Ga0466957_0014798 3300044842 Bacteria 4546
995 Ga0451576_0000009 3300045051 Bacteria 712666
996 Ga0451576_0031940 3300045051 Bacteria 5611
997 Ga0451576_0069345 3300045051 Bacteria 3669
998 Ga0451576_0104499 3300045051 Bacteria 2946
999 Ga0451576_0332591 3300045051 Bacteria 1590
1000 Ga0451576_0487576 3300045051 Bacteria 1295
1001 Ga0495617_000119 3300046452 Bacteria 52294
1002 Ga0495617_000919 3300046452 Bacteria 13702
1003 Ga0495603_0066384 3300046455 Bacteria 2125
1004 Ga0495629_0032915 3300046459 Bacteria 3668
1005 Ga0495629_0106984 3300046459 Bacteria 1951
1006 Ga0495629_0236737 3300046459 Bacteria 1257
1007 Ga0495638_0000089 3300046460 Bacteria 151067
1008 Ga0495638_0007444 3300046460 Bacteria 7847
1009 Ga0495653_0098106 3300046463 Bacteria 2128
1010 Ga0495650_0007177 3300046471 Bacteria 6756
1011 Ga0495650_0024479 3300046471 Bacteria 2849
1012 Ga0495580_0071148 3300046472 Bacteria 2430
1013 Ga0495580_0083568 3300046472 Bacteria 2224
1014 Ga0495580_0129016 3300046472 Bacteria 1754
1015 Ga0495605_0032441 3300046474 Bacteria 2659
1016 Ga0495664_0026281 3300046477 Bacteria 3390
1017 Ga0495664_0181128 3300046477 Bacteria 1277
1018 Ga0495585_0003201 3300046492 Bacteria 11171
1019 Ga0495594_0143059 3300046499 Bacteria 1357
1020 Ga0495607_0000228 3300046501 Bacteria 59878
1021 Ga0495606_0001070 3300046507 Bacteria 39542
1022 Ga0495606_0001334 3300046507 Bacteria 33605
1023 Ga0495606_0029010 3300046507 Bacteria 3892
1024 Ga0495606_0285393 3300046507 Bacteria 900
1025 Ga0495606_0285403 3300046507 Bacteria 900
1026 Ga0495610_0000312 3300046512 Bacteria 51562
1027 Ga0495616_0000345 3300046513 Bacteria 36848
1028 Ga0495616_0001053 3300046513 Bacteria 19712
1029 Ga0495620_0000186 3300046515 Bacteria 47973
1030 Ga0495620_0003002 3300046515 Bacteria 9703
1031 Ga0495628_0098145 3300046516 Bacteria 2263
1032 Ga0495631_0000147 3300046518 Bacteria 48184
1033 Ga0495631_0000159 3300046518 Bacteria 45657
1034 Ga0495632_0000005 3300046519 Bacteria 362872
1035 Ga0495632_0014655 3300046519 Bacteria 4426
1036 Ga0495632_0021981 3300046519 Bacteria 3428
1037 Ga0495632_0027807 3300046519 Bacteria 2957
1038 Ga0495648_0000506 3300046524 Bacteria 41982
1039 Ga0495648_0015176 3300046524 Bacteria 5608
1040 Ga0495665_0024840 3300046531 Bacteria 3219
1041 Ga0495586_0293341 3300046535 Bacteria 931
1042 Ga0495609_0006311 3300046538 Bacteria 6064
1043 Ga0495645_0060238 3300046543 Bacteria 2752
1044 Ga0495668_0003695 3300046616 Bacteria 11292
1045 Ga0495611_0000005 3300046648 Bacteria 284271
1046 Ga0495611_0000039 3300046648 Bacteria 100068
1047 Ga0495625_0000066 3300046660 Bacteria 172144
1048 Ga0495625_0008087 3300046660 Bacteria 9020
1049 Ga0495625_0068697 3300046660 Bacteria 2490
1050 Ga0495635_0072661 3300046663 Bacteria 2356
1051 Ga0495659_0016871 3300046664 Bacteria 2413
1052 Ga0495661_0001911 3300046665 Bacteria 16578
1053 Ga0495661_0071168 3300046665 Bacteria 2033
1054 Ga0495657_0137876 3300046675 Bacteria 1523
1055 Ga0495623_0030308 3300046679 Bacteria 3480
1056 Ga0495647_0037990 3300046681 Bacteria 1819
1057 Ga0495658_0022264 3300046683 Bacteria 3348
1058 Ga0495658_0266481 3300046683 Bacteria 1079
1059 Ga0495613_0022386 3300046689 Bacteria 4709
1060 Ga0495670_0000607 3300046691 Bacteria 17108
1061 Ga0495670_0006362 3300046691 Bacteria 5801
1062 Ga0495670_0027019 3300046691 Bacteria 2841
1063 Ga0495671_0000247 3300046692 Bacteria 46575
1064 Ga0495649_0012074 3300046694 Bacteria 5040
1065 Ga0495589_0000026 3300046794 Bacteria 184723
1066 Ga0495660_0000605 3300046810 Bacteria 28275
1067 Ga0495660_0000748 3300046810 Bacteria 24559
1068 Ga0495581_0045122 3300047315 Bacteria 2548
1069 Ga0495581_0269757 3300047315 Bacteria 995
1070 Ga0495604_0103758 3300047317 Bacteria 2085
1071 Ga0495680_0206112 3300047322 Bacteria 1409
1072 Ga0495683_0002757 3300047323 Bacteria 10462
1073 Ga0495679_000010 3300047446 Bacteria 337760
1074 Ga0495673_0000038 3300047469 Bacteria 303785
1075 Ga0495673_0000045 3300047469 Bacteria 280765
1076 Ga0495673_0001129 3300047469 Bacteria 22892
1077 Ga0495673_0017209 3300047469 Bacteria 3678
1078 Ga0495684_0021682 3300047471 Bacteria 4946
1079 Ga0495686_0000050 3300047472 Bacteria 269010
1080 Ga0495686_0000297 3300047472 Bacteria 85762
1081 Ga0495686_0002123 3300047472 Bacteria 19416
1082 Ga0495686_0012433 3300047472 Bacteria 5953
1083 Ga0495602_0333019 3300048088 Bacteria 1100
1084 Ga0496100_0002665 3300048903 Bacteria 9100
1085 Ga0496100_0099125 3300048903 Bacteria 2004
1086 Ga0496101_0005294 3300048904 Bacteria 8218
1087 Ga0496101_0051276 3300048904 Bacteria 2973
1088 Ga0496102_0006283 3300048905 Bacteria 10129
1089 Ga0496102_0097772 3300048905 Bacteria 2723
1090 Ga0496102_0113585 3300048905 Bacteria 2527
1091 Ga0496102_0442871 3300048905 Bacteria 1219
1092 Ga0496103_0019524 3300048906 Bacteria 4070
1093 Ga0496104_0012370 3300048907 Bacteria 7672
1094 Ga0496104_0150937 3300048907 Bacteria 2230
1095 Ga0496105_0003430 3300048908 Bacteria 11732
1096 Ga0496105_0026605 3300048908 Bacteria 4721
1097 Ga0496105_0047122 3300048908 Bacteria 3557
1098 Ga0496105_0298086 3300048908 Bacteria 1296
1099 Ga0496106_0044865 3300048909 Bacteria 3319
1100 Ga0496106_0088215 3300048909 Bacteria 2391
1101 Ga0496106_0182477 3300048909 Bacteria 1666
1102 Ga0496106_0237060 3300048909 Bacteria 1457
1103 Ga0496107_0030858 3300048910 Bacteria 3822
1104 Ga0496107_0470685 3300048910 Bacteria 933
1105 Ga0496108_0016030 3300048911 Bacteria 6110
1106 Ga0496108_0088745 3300048911 Bacteria 2627
1107 Ga0496108_0136144 3300048911 Bacteria 2113
1108 Ga0496108_0139007 3300048911 Bacteria 2092
1109 Ga0496109_0014325 3300048912 Bacteria 6899
1110 Ga0496109_0015834 3300048912 Bacteria 6583
1111 Ga0496109_0172951 3300048912 Bacteria 2027
1112 Ga0496110_0055420 3300048913 Bacteria 3488
1113 Ga0496110_0132686 3300048913 Bacteria 2250
1114 Ga0496110_0426959 3300048913 Bacteria 1208
1115 Ga0496111_0152063 3300048914 Bacteria 1717
1116 Ga0496112_0001102 3300048915 Bacteria 20017
1117 Ga0496112_0024159 3300048915 Bacteria 5817
1118 Ga0496112_0097958 3300048915 Bacteria 2902
1119 Ga0496112_0124194 3300048915 Bacteria 2552
1120 Ga0496112_0422302 3300048915 Bacteria 1272
1121 Ga0496113_0118116 3300048916 Bacteria 2071
1122 Ga0496113_0247399 3300048916 Bacteria 1423
1123 Ga0496113_0351621 3300048916 Bacteria 1182
1124 Ga0496113_0421466 3300048916 Bacteria 1072
1125 Ga0496114_0406712 3300048917 Bacteria 1205
1126 Ga0496116_0194831 3300048919 Bacteria 1068
1127 Ga0496117_0013045 3300048920 Bacteria 7275
1128 Ga0496117_0089920 3300048920 Bacteria 1981
1129 Ga0496118_0001315 3300048921 Bacteria 37765
1130 Ga0496118_0002666 3300048921 Bacteria 23595
1131 Ga0496118_0007583 3300048921 Bacteria 11443
1132 Ga0496119_0000135 3300048922 Bacteria 103577
1133 Ga0496120_0000013 3300048923 Bacteria 331109
1134 Ga0496121_0000449 3300048924 Bacteria 81130
1135 Ga0496121_0001465 3300048924 Bacteria 39770
1136 Ga0496121_0002510 3300048924 Bacteria 27888
1137 Ga0496122_0010417 3300048925 Bacteria 9590
1138 Ga0496122_0060193 3300048925 Bacteria 2798
1139 Ga0496122_0060860 3300048925 Bacteria 2777
1140 Ga0496123_0046717 3300048926 Bacteria 2933
1141 Ga0495678_000253 3300049459 Bacteria 60057
1142 Ga0495682_0001785 3300049460 Bacteria 10845
1143 Ga0495682_0005080 3300049460 Bacteria 5519
1144 Ga0501034_0108629 3300049571 Bacteria 2765
1145 Ga0501036_0173372 3300049572 Bacteria 1817
1146 Ga0501036_0402934 3300049572 Bacteria 1141
1147 Ga0501037_0312033 3300049573 Bacteria 1090
1148 Ga0501039_0074523 3300049575 Bacteria 2638
1149 Ga0501040_0157943 3300049576 Bacteria 1602
1150 Ga0501042_0115478 3300049578 Bacteria 1933
1151 Ga0501046_0050980 3300049580 Bacteria 3268
1152 Ga0501047_0001630 3300049581 Bacteria 21895
1153 Ga0501047_0281365 3300049581 Bacteria 1508
1154 Ga0501067_0015409 3300049583 Bacteria 4232
1155 Ga0501067_0155699 3300049583 Bacteria 1273
1156 Ga0501068_0491811 3300049584 Bacteria 795
1157 Ga0501069_0017575 3300049585 Bacteria 3852
1158 Ga0501069_0112973 3300049585 Bacteria 1548
1159 Ga0501070_0000947 3300049586 Bacteria 26194
1160 Ga0501070_0011092 3300049586 Bacteria 7608
1161 Ga0501072_0009471 3300049588 Bacteria 7405
1162 Ga0501072_0587782 3300049588 Bacteria 878
1163 Ga0501073_0001073 3300049589 Bacteria 19760
1164 Ga0501073_0007473 3300049589 Bacteria 8122
1165 Ga0501074_0017850 3300049590 Bacteria 5155
1166 Ga0501074_0020548 3300049590 Bacteria 4799
1167 Ga0501074_0068110 3300049590 Bacteria 2559
1168 Ga0501075_0009543 3300049591 Bacteria 6793
1169 Ga0501076_0112368 3300049592 Bacteria 2203
1170 Ga0501076_0145129 3300049592 Bacteria 1929
1171 Ga0501079_0005110 3300049741 Bacteria 9744
1172 Ga0501080_0001528 3300049742 Bacteria 19555
1173 Ga0501080_0002422 3300049742 Bacteria 16280
1174 Ga0501080_0017176 3300049742 Bacteria 6685
1175 Ga0501080_0432376 3300049742 Bacteria 1181
1176 Ga0501080_0540967 3300049742 Bacteria 1038
1177 Ga0501081_0359172 3300049743 Bacteria 1074
1178 Ga0501083_0000323 3300049744 Bacteria 30331
1179 Ga0501083_0051807 3300049744 Bacteria 2759
1180 Ga0501035_0057311 3300049822 Bacteria 3474
1181 Ga0501035_0251451 3300049822 Bacteria 1501
1182 Ga0501044_0061166 3300049823 Bacteria 3853
1183 Ga0501045_0289554 3300049824 Bacteria 1219
1184 nmdc:mga0k408_5835_c1 3300050493 Bacteria 6559
1185 nmdc:mga07m45_111449_c1 3300050496 Bacteria 1576
1186 nmdc:mga05p37_89900_c1 3300050507 Bacteria 3390
1187 nmdc:mga09592_30624_c1 3300050508 Bacteria 4478
1188 nmdc:mga0qj67_16450_c1 3300050509 Bacteria 5611
1189 nmdc:mga0qj67_25770_c1 3300050509 Bacteria 4547
1190 nmdc:mga08y16_17531_c1 3300050511 Bacteria 7541
1191 nmdc:mga08y16_353414_c1 3300050511 Bacteria 1509
1192 nmdc:mga0n895_111959_c1 3300050512 Bacteria 2746
1193 nmdc:mga0n895_129754_c1 3300050512 Bacteria 2545
1194 nmdc:mga0rr50_286349_c1 3300050513 Bacteria 1376
1195 nmdc:mga0sz30_75335_c1 3300050516 Bacteria 1456
1196 Ga0495601_0145807 3300053077 Bacteria 1545
1197 Ga0495619_0082621 3300053085 Bacteria 2165
1198 Ga0495619_0166254 3300053085 Bacteria 1525
1199 Ga0500643_000074 3300053087 Bacteria 111502
1200 Ga0500583_0167530 3300053092 Bacteria 1094
1201 Ga0500555_000398 3300053103 Bacteria 18141
1202 Ga0500645_000429 3300053730 Bacteria 28987
1203 Ga0501084_0049321 3300054114 Bacteria 3525
1204 Ga0501082_0134028 3300060353 Bacteria 2149
1205 Ga0501082_0268671 3300060353 Bacteria 1484
1206 Ga0501082_0765581 3300060353 Bacteria 845
1207 Ga0530510_0120447 3300061734 Bacteria 1926

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048909 Ga0496106_0237060 Ga0496106_0237060_746_1441 231
2 3300005543 Ga0070672_100219123 Ga0070672_1002191232 233
3 3300013308 Ga0157375_10150043 Ga0157375_101500433 233
4 3300005434 Ga0070709_10171104 Ga0070709_101711042 239
5 3300005436 Ga0070713_100001230 Ga0070713_10000123017 239
6 3300006195 Ga0075366_10193065 Ga0075366_101930651 239
7 3300025906 Ga0207699_10128221 Ga0207699_101282212 239
8 3300025928 Ga0207700_10377454 Ga0207700_103774542 239
9 3300026078 Ga0207702_10199433 Ga0207702_101994332 239
10 3300005327 Ga0070658_10119416 Ga0070658_101194162 240
11 3300005338 Ga0068868_100036191 Ga0068868_1000361913 240
12 3300005340 Ga0070689_100016777 Ga0070689_1000167773 240
13 3300005340 Ga0070689_100159990 Ga0070689_1001599902 240
14 3300005354 Ga0070675_100003551 Ga0070675_1000035519 240
15 3300005355 Ga0070671_100018218 Ga0070671_1000182186 240
16 3300005356 Ga0070674_100046826 Ga0070674_1000468262 240
17 3300005364 Ga0070673_100228697 Ga0070673_1002286971 240
18 3300005365 Ga0070688_100044733 Ga0070688_1000447332 240
19 3300005458 Ga0070681_10029801 Ga0070681_100298014 240
20 3300005530 Ga0070679_100060397 Ga0070679_1000603971 240
21 3300005530 Ga0070679_100152994 Ga0070679_1001529942 240
22 3300005543 Ga0070672_100114215 Ga0070672_1001142152 240
23 3300005577 Ga0068857_100373783 Ga0068857_1003737832 240
24 3300005616 Ga0068852_100100899 Ga0068852_1001008992 240
25 3300005617 Ga0068859_100076872 Ga0068859_1000768722 240
26 3300005841 Ga0068863_100077681 Ga0068863_1000776814 240
27 3300005842 Ga0068858_100098145 Ga0068858_1000981452 240
28 3300005843 Ga0068860_100062347 Ga0068860_1000623473 240
29 3300006195 Ga0075366_10000623 Ga0075366_1000062315 240
30 3300006353 Ga0075370_10019195 Ga0075370_100191954 240
31 3300006931 Ga0097620_100076874 Ga0097620_1000768744 240
32 3300009098 Ga0105245_10008704 Ga0105245_100087048 240
33 3300009147 Ga0114129_10296203 Ga0114129_102962032 240
34 3300009177 Ga0105248_10042678 Ga0105248_100426782 240
35 3300009177 Ga0105248_10114526 Ga0105248_101145262 240
36 3300009551 Ga0105238_10355153 Ga0105238_103551532 240
37 3300009551 Ga0105238_10732215 Ga0105238_107322152 240
38 3300013105 Ga0157369_10404970 Ga0157369_104049702 240
39 3300013306 Ga0163162_10031701 Ga0163162_100317014 240
40 3300013306 Ga0163162_10097485 Ga0163162_100974853 240
41 3300013308 Ga0157375_10011037 Ga0157375_100110372 240
42 3300014325 Ga0163163_10012528 Ga0163163_100125283 240
43 3300014968 Ga0157379_10003838 Ga0157379_100038389 240
44 3300014969 Ga0157376_10005949 Ga0157376_100059492 240
45 3300025903 Ga0207680_10076944 Ga0207680_100769442 240
46 3300025909 Ga0207705_10015510 Ga0207705_100155102 240
47 3300025912 Ga0207707_10031871 Ga0207707_100318713 240
48 3300025921 Ga0207652_10077479 Ga0207652_100774792 240
49 3300025921 Ga0207652_10507120 Ga0207652_105071201 240
50 3300025926 Ga0207659_10003711 Ga0207659_100037117 240
51 3300025927 Ga0207687_10050209 Ga0207687_100502093 240
52 3300025936 Ga0207670_10033503 Ga0207670_100335034 240
53 3300025936 Ga0207670_10226588 Ga0207670_102265882 240
54 3300025940 Ga0207691_10053674 Ga0207691_100536743 240
55 3300025941 Ga0207711_10027119 Ga0207711_100271192 240
56 3300025942 Ga0207689_10060809 Ga0207689_100608093 240
57 3300025960 Ga0207651_10107295 Ga0207651_101072952 240
58 3300025981 Ga0207640_10210657 Ga0207640_102106572 240
59 3300025986 Ga0207658_10009624 Ga0207658_100096248 240
60 3300026023 Ga0207677_10731588 Ga0207677_107315881 240
61 3300026035 Ga0207703_10078964 Ga0207703_100789642 240
62 3300026116 Ga0207674_10149452 Ga0207674_101494522 240
63 3300027876 Ga0209974_10032510 Ga0209974_100325102 240
64 3300028379 Ga0268266_10134112 Ga0268266_101341122 240
65 3300036401 Ga0373937_1041854 Ga0373937_1041854_11_748 240
66 3300048907 Ga0496104_0150937 Ga0496104_0150937_1116_1853 240
67 3300048908 Ga0496105_0298086 Ga0496105_0298086_451_1188 240
68 3300048911 Ga0496108_0088745 Ga0496108_0088745_1334_2071 240
69 3300048912 Ga0496109_0015834 Ga0496109_0015834_1636_2373 240
70 3300048913 Ga0496110_0055420 Ga0496110_0055420_1037_1774 240
71 3300048917 Ga0496114_0406712 Ga0496114_0406712_38_775 240
72 3300049580 Ga0501046_0050980 Ga0501046_0050980_2264_2992 240
73 3300049581 Ga0501047_0001630 Ga0501047_0001630_2980_3708 240
74 3300049581 Ga0501047_0281365 Ga0501047_0281365_160_888 240
75 3300049583 Ga0501067_0155699 Ga0501067_0155699_383_1111 240
76 3300049585 Ga0501069_0017575 Ga0501069_0017575_16_744 240
77 3300049586 Ga0501070_0000947 Ga0501070_0000947_12747_13475 240
78 3300049589 Ga0501073_0001073 Ga0501073_0001073_1369_2097 240
79 3300049590 Ga0501074_0017850 Ga0501074_0017850_4177_4905 240
80 3300049741 Ga0501079_0005110 Ga0501079_0005110_5778_6506 240
81 3300049742 Ga0501080_0002422 Ga0501080_0002422_133_861 240
82 3300049742 Ga0501080_0432376 Ga0501080_0432376_321_1049 240
83 3300049742 Ga0501080_0540967 Ga0501080_0540967_96_824 240
84 3300049744 Ga0501083_0000323 Ga0501083_0000323_10646_11374 240
85 3300049822 Ga0501035_0057311 Ga0501035_0057311_2013_2741 240
86 3300049823 Ga0501044_0061166 Ga0501044_0061166_282_1010 240
87 3300050493 nmdc:mga0k408_5835_c1 nmdc:mga0k408_5835_c1_4266_4994 240
88 3300050496 nmdc:mga07m45_111449_c1 nmdc:mga07m45_111449_c1_231_959 240
89 iso_pu_bacteria 2593339238 2595449180 240
90 iso_pu_bacteria 2718218334 2721029201 240
91 iso_pu_bacteria 2734482264 2735835215 240
92 iso_pu_bacteria 2738543009 2739229059 240
93 iso_pu_bacteria 2842918807 2842922364 240
94 iso_pu_bacteria 2884338543 2884342395 240
95 iso_pu_bacteria 2919085039 2919088062 240
96 iso_pu_bacteria 2919404418 2919407015 240
97 iso_pu_bacteria 2941471342 2941474953 240
98 iso_pu_bacteria 2953994433 2953996825 240
99 3300005340 Ga0070689_100061132 Ga0070689_1000611323 241
100 3300005466 Ga0070685_10125412 Ga0070685_101254122 241
101 3300005578 Ga0068854_100103766 Ga0068854_1001037662 241
102 3300025893 Ga0207682_10041221 Ga0207682_100412213 241
103 3300025981 Ga0207640_10133266 Ga0207640_101332661 241
104 3300005441 Ga0070700_100288232 Ga0070700_1002882322 242
105 3300005544 Ga0070686_100089345 Ga0070686_1000893452 242
106 3300005544 Ga0070686_100328420 Ga0070686_1003284202 242
107 3300013297 Ga0157378_10031519 Ga0157378_100315191 242
108 3300026075 Ga0207708_10158934 Ga0207708_101589342 242
109 3300035086 Ga0373934_0092635 Ga0373934_0092635_445_1185 242
110 3300035172 Ga0373955_0262477 Ga0373955_0262477_68_808 242
111 3300035724 Ga0373933_0201823 Ga0373933_0201823_49_789 242
112 3300036401 Ga0373937_0029640 Ga0373937_0029640_613_1353 242
113 3300048088 Ga0495602_0333019 Ga0495602_0333019_342_1082 242
114 3300005327 Ga0070658_10248886 Ga0070658_102488862 243
115 3300005329 Ga0070683_100088115 Ga0070683_1000881153 243
116 3300005339 Ga0070660_100025523 Ga0070660_1000255234 243
117 3300005344 Ga0070661_100002686 Ga0070661_1000026862 243
118 3300005364 Ga0070673_100586787 Ga0070673_1005867872 243
119 3300005435 Ga0070714_100018781 Ga0070714_1000187813 243
120 3300005458 Ga0070681_10018775 Ga0070681_100187752 243
121 3300005518 Ga0070699_100006205 Ga0070699_1000062054 243
122 3300005535 Ga0070684_100012934 Ga0070684_1000129344 243
123 3300005539 Ga0068853_100002699 Ga0068853_1000026998 243
124 3300005543 Ga0070672_100342847 Ga0070672_1003428472 243
125 3300005563 Ga0068855_100006879 Ga0068855_10000687912 243
126 3300005564 Ga0070664_100002258 Ga0070664_10000225816 243
127 3300005577 Ga0068857_100006033 Ga0068857_1000060334 243
128 3300005614 Ga0068856_100003646 Ga0068856_1000036462 243
129 3300005616 Ga0068852_100011696 Ga0068852_1000116964 243
130 3300009093 Ga0105240_10000332 Ga0105240_1000033243 243
131 3300009094 Ga0111539_10003105 Ga0111539_1000310515 243
132 3300009545 Ga0105237_10098809 Ga0105237_100988092 243
133 3300009551 Ga0105238_10001058 Ga0105238_1000105818 243
134 3300013100 Ga0157373_10047366 Ga0157373_100473662 243
135 3300013104 Ga0157370_10021796 Ga0157370_100217963 243
136 3300013105 Ga0157369_10011173 Ga0157369_100111732 243
137 3300013307 Ga0157372_10011518 Ga0157372_100115188 243
138 3300025909 Ga0207705_10299515 Ga0207705_102995152 243
139 3300025912 Ga0207707_10054275 Ga0207707_100542753 243
140 3300025913 Ga0207695_10031562 Ga0207695_100315624 243
141 3300025919 Ga0207657_10024594 Ga0207657_100245943 243
142 3300025920 Ga0207649_10006252 Ga0207649_100062524 243
143 3300025924 Ga0207694_10002852 Ga0207694_100028528 243
144 3300025928 Ga0207700_10407474 Ga0207700_104074742 243
145 3300025929 Ga0207664_10020854 Ga0207664_100208545 243
146 3300025932 Ga0207690_10010248 Ga0207690_100102485 243
147 3300025933 Ga0207706_10663598 Ga0207706_106635982 243
148 3300025944 Ga0207661_10270483 Ga0207661_102704832 243
149 3300025945 Ga0207679_10156928 Ga0207679_101569282 243
150 3300025949 Ga0207667_10129834 Ga0207667_101298342 243
151 3300025981 Ga0207640_10011411 Ga0207640_100114114 243
152 3300026041 Ga0207639_10146472 Ga0207639_101464722 243
153 3300026078 Ga0207702_10192747 Ga0207702_101927472 243
154 3300026116 Ga0207674_10000064 Ga0207674_1000006435 243
155 3300026142 Ga0207698_10013561 Ga0207698_100135614 243
156 3300031251 Ga0265327_10004776 Ga0265327_100047763 243
157 3300031548 Ga0307408_100005146 Ga0307408_1000051463 243
158 3300031548 Ga0307408_100428774 Ga0307408_1004287742 243
159 3300031731 Ga0307405_10033592 Ga0307405_100335924 243
160 3300031824 Ga0307413_10001213 Ga0307413_100012139 243
161 3300031824 Ga0307413_10402313 Ga0307413_104023132 243
162 3300031824 Ga0307413_10408242 Ga0307413_104082421 243
163 3300031852 Ga0307410_10005008 Ga0307410_100050085 243
164 3300031852 Ga0307410_10071058 Ga0307410_100710582 243
165 3300031901 Ga0307406_10022869 Ga0307406_100228692 243
166 3300031903 Ga0307407_10002420 Ga0307407_100024202 243
167 3300031903 Ga0307407_10306386 Ga0307407_103063862 243
168 3300031911 Ga0307412_10019072 Ga0307412_100190722 243
169 3300031995 Ga0307409_100049819 Ga0307409_1000498192 243
170 3300031995 Ga0307409_100727344 Ga0307409_1007273441 243
171 3300032002 Ga0307416_100004301 Ga0307416_1000043013 243
172 3300032002 Ga0307416_100130886 Ga0307416_1001308862 243
173 3300032004 Ga0307414_10033117 Ga0307414_100331173 243
174 3300032004 Ga0307414_10136418 Ga0307414_101364182 243
175 3300032005 Ga0307411_10002192 Ga0307411_100021925 243
176 3300032126 Ga0307415_100002398 Ga0307415_1000023985 243
177 3300032126 Ga0307415_100177906 Ga0307415_1001779062 243
178 3300032126 Ga0307415_100437721 Ga0307415_1004377212 243
179 3300042876 Ga0451577_0018546 Ga0451577_0018546_4806_5537 243
180 3300044673 Ga0453683_0007345 Ga0453683_0007345_2890_3621 243
181 3300044673 Ga0453683_0037736 Ga0453683_0037736_296_1027 243
182 3300044712 Ga0453684_0015609 Ga0453684_0015609_10647_11378 243
183 3300044712 Ga0453684_0075435 Ga0453684_0075435_2149_2880 243
184 3300044712 Ga0453684_0078799 Ga0453684_0078799_350_1081 243
185 3300044712 Ga0453684_0207402 Ga0453684_0207402_629_1360 243
186 3300045051 Ga0451576_0031940 Ga0451576_0031940_2008_2739 243
187 3300045051 Ga0451576_0104499 Ga0451576_0104499_157_888 243
188 3300049572 Ga0501036_0173372 Ga0501036_0173372_1061_1801 243
189 3300049576 Ga0501040_0157943 Ga0501040_0157943_388_1119 243
190 3300049578 Ga0501042_0115478 Ga0501042_0115478_731_1471 243
191 3300049588 Ga0501072_0587782 Ga0501072_0587782_136_867 243
192 3300049590 Ga0501074_0068110 Ga0501074_0068110_1571_2302 243
193 3300049591 Ga0501075_0009543 Ga0501075_0009543_5010_5741 243
194 3300049592 Ga0501076_0145129 Ga0501076_0145129_1020_1751 243
195 3300049743 Ga0501081_0359172 Ga0501081_0359172_148_879 243
196 3300049824 Ga0501045_0289554 Ga0501045_0289554_104_844 243
197 3300050511 nmdc:mga08y16_17531_c1 nmdc:mga08y16_17531_c1_5149_5880 243
198 3300054114 Ga0501084_0049321 Ga0501084_0049321_1370_2101 243
199 3300060353 Ga0501082_0134028 Ga0501082_0134028_693_1424 243
200 3300060353 Ga0501082_0765581 Ga0501082_0765581_46_777 243
201 3300061734 Ga0530510_0120447 Ga0530510_0120447_481_1212 243
202 3300002737 JGI25162J39368_1005354 JGI25162J39368_10053542 244
203 3300002773 JGI25152J39213_1029203 JGI25152J39213_10292031 244
204 3300003316 rootH1_10020837 rootH1_100208372 244
205 3300003578 Ga0006562J51391_1019682 Ga0006562J51391_10196827 244
206 3300003578 Ga0006562J51391_1019685 Ga0006562J51391_10196852 244
207 3300004625 Ga0055543_1013036 Ga0055543_10130362 244
208 3300005262 Ga0065165_1000199 Ga0065165_100019926 244
209 3300005293 Ga0065715_10098761 Ga0065715_100987613 244
210 3300005293 Ga0065715_10154764 Ga0065715_101547642 244
211 3300005293 Ga0065715_10171010 Ga0065715_101710102 244
212 3300005328 Ga0070676_10001385 Ga0070676_100013853 244
213 3300005328 Ga0070676_10002180 Ga0070676_100021807 244
214 3300005328 Ga0070676_10099424 Ga0070676_100994242 244
215 3300005329 Ga0070683_100048441 Ga0070683_1000484412 244
216 3300005330 Ga0070690_100022957 Ga0070690_1000229572 244
217 3300005330 Ga0070690_100377022 Ga0070690_1003770221 244
218 3300005331 Ga0070670_100007729 Ga0070670_1000077296 244
219 3300005331 Ga0070670_100025717 Ga0070670_1000257174 244
220 3300005331 Ga0070670_100031990 Ga0070670_1000319902 244
221 3300005331 Ga0070670_100041936 Ga0070670_1000419362 244
222 3300005331 Ga0070670_100048785 Ga0070670_1000487854 244
223 3300005331 Ga0070670_100111199 Ga0070670_1001111992 244
224 3300005331 Ga0070670_100213541 Ga0070670_1002135412 244
225 3300005331 Ga0070670_100449433 Ga0070670_1004494332 244
226 3300005333 Ga0070677_10000279 Ga0070677_100002799 244
227 3300005333 Ga0070677_10022211 Ga0070677_100222112 244
228 3300005334 Ga0068869_100000025 Ga0068869_10000002537 244
229 3300005334 Ga0068869_100017152 Ga0068869_1000171524 244
230 3300005334 Ga0068869_100083250 Ga0068869_1000832502 244
231 3300005334 Ga0068869_100237800 Ga0068869_1002378001 244
232 3300005334 Ga0068869_100421180 Ga0068869_1004211801 244
233 3300005335 Ga0070666_10000909 Ga0070666_100009097 244
234 3300005335 Ga0070666_10003744 Ga0070666_100037449 244
235 3300005335 Ga0070666_10015249 Ga0070666_100152493 244
236 3300005335 Ga0070666_10304641 Ga0070666_103046412 244
237 3300005336 Ga0070680_100053810 Ga0070680_1000538103 244
238 3300005336 Ga0070680_100077960 Ga0070680_1000779602 244
239 3300005336 Ga0070680_100101907 Ga0070680_1001019072 244
240 3300005336 Ga0070680_100372458 Ga0070680_1003724582 244
241 3300005337 Ga0070682_100072548 Ga0070682_1000725482 244
242 3300005338 Ga0068868_100005951 Ga0068868_1000059519 244
243 3300005338 Ga0068868_100014717 Ga0068868_1000147173 244
244 3300005338 Ga0068868_100024536 Ga0068868_1000245364 244
245 3300005338 Ga0068868_100078556 Ga0068868_1000785562 244
246 3300005338 Ga0068868_100101680 Ga0068868_1001016802 244
247 3300005338 Ga0068868_100230687 Ga0068868_1002306872 244
248 3300005339 Ga0070660_100011071 Ga0070660_1000110712 244
249 3300005339 Ga0070660_100028351 Ga0070660_1000283513 244
250 3300005339 Ga0070660_100032425 Ga0070660_1000324252 244
251 3300005339 Ga0070660_100215447 Ga0070660_1002154472 244
252 3300005339 Ga0070660_100305155 Ga0070660_1003051552 244
253 3300005339 Ga0070660_100397046 Ga0070660_1003970462 244
254 3300005340 Ga0070689_100015809 Ga0070689_1000158093 244
255 3300005340 Ga0070689_100072967 Ga0070689_1000729672 244
256 3300005340 Ga0070689_100212728 Ga0070689_1002127282 244
257 3300005344 Ga0070661_100032678 Ga0070661_1000326784 244
258 3300005344 Ga0070661_100077790 Ga0070661_1000777902 244
259 3300005344 Ga0070661_100080157 Ga0070661_1000801572 244
260 3300005344 Ga0070661_100172771 Ga0070661_1001727712 244
261 3300005344 Ga0070661_100231159 Ga0070661_1002311592 244
262 3300005345 Ga0070692_10047011 Ga0070692_100470112 244
263 3300005345 Ga0070692_10137675 Ga0070692_101376752 244
264 3300005347 Ga0070668_100001156 Ga0070668_1000011565 244
265 3300005347 Ga0070668_100002498 Ga0070668_1000024987 244
266 3300005347 Ga0070668_100004641 Ga0070668_10000464111 244
267 3300005347 Ga0070668_100006984 Ga0070668_1000069847 244
268 3300005347 Ga0070668_100017618 Ga0070668_1000176186 244
269 3300005347 Ga0070668_100052567 Ga0070668_1000525672 244
270 3300005347 Ga0070668_100145908 Ga0070668_1001459082 244
271 3300005347 Ga0070668_100156596 Ga0070668_1001565962 244
272 3300005347 Ga0070668_100272483 Ga0070668_1002724832 244
273 3300005347 Ga0070668_100359563 Ga0070668_1003595632 244
274 3300005347 Ga0070668_100416703 Ga0070668_1004167031 244
275 3300005347 Ga0070668_100688593 Ga0070668_1006885932 244
276 3300005353 Ga0070669_100004372 Ga0070669_1000043724 244
277 3300005353 Ga0070669_100012003 Ga0070669_1000120033 244
278 3300005353 Ga0070669_100015460 Ga0070669_1000154603 244
279 3300005353 Ga0070669_100023178 Ga0070669_1000231782 244
280 3300005353 Ga0070669_100081409 Ga0070669_1000814092 244
281 3300005353 Ga0070669_100095561 Ga0070669_1000955612 244
282 3300005353 Ga0070669_100148465 Ga0070669_1001484652 244
283 3300005354 Ga0070675_100020708 Ga0070675_1000207082 244
284 3300005354 Ga0070675_100026173 Ga0070675_1000261732 244
285 3300005354 Ga0070675_100089649 Ga0070675_1000896492 244
286 3300005354 Ga0070675_100302823 Ga0070675_1003028231 244
287 3300005355 Ga0070671_100006391 Ga0070671_1000063919 244
288 3300005355 Ga0070671_100007760 Ga0070671_1000077607 244
289 3300005355 Ga0070671_100007805 Ga0070671_1000078052 244
290 3300005355 Ga0070671_100017414 Ga0070671_1000174143 244
291 3300005355 Ga0070671_100024580 Ga0070671_1000245803 244
292 3300005355 Ga0070671_100084928 Ga0070671_1000849282 244
293 3300005356 Ga0070674_100004021 Ga0070674_1000040212 244
294 3300005356 Ga0070674_100032314 Ga0070674_1000323143 244
295 3300005356 Ga0070674_100033913 Ga0070674_1000339132 244
296 3300005356 Ga0070674_100040581 Ga0070674_1000405812 244
297 3300005356 Ga0070674_100059560 Ga0070674_1000595602 244
298 3300005356 Ga0070674_100187251 Ga0070674_1001872512 244
299 3300005364 Ga0070673_100000900 Ga0070673_1000009006 244
300 3300005364 Ga0070673_100001846 Ga0070673_1000018468 244
301 3300005364 Ga0070673_100012649 Ga0070673_1000126494 244
302 3300005364 Ga0070673_100016258 Ga0070673_1000162583 244
303 3300005364 Ga0070673_100016379 Ga0070673_1000163793 244
304 3300005364 Ga0070673_100073403 Ga0070673_1000734033 244
305 3300005364 Ga0070673_100148597 Ga0070673_1001485972 244
306 3300005364 Ga0070673_100158709 Ga0070673_1001587092 244
307 3300005364 Ga0070673_100181902 Ga0070673_1001819022 244
308 3300005365 Ga0070688_100000350 Ga0070688_10000035010 244
309 3300005365 Ga0070688_100028177 Ga0070688_1000281773 244
310 3300005365 Ga0070688_100033867 Ga0070688_1000338672 244
311 3300005365 Ga0070688_100052937 Ga0070688_1000529373 244
312 3300005366 Ga0070659_100014022 Ga0070659_1000140223 244
313 3300005366 Ga0070659_100024162 Ga0070659_1000241623 244
314 3300005366 Ga0070659_100035797 Ga0070659_1000357972 244
315 3300005366 Ga0070659_100063046 Ga0070659_1000630461 244
316 3300005366 Ga0070659_100084577 Ga0070659_1000845772 244
317 3300005366 Ga0070659_100096984 Ga0070659_1000969842 244
318 3300005366 Ga0070659_100141123 Ga0070659_1001411232 244
319 3300005367 Ga0070667_100001812 Ga0070667_10000181212 244
320 3300005367 Ga0070667_100007579 Ga0070667_1000075793 244
321 3300005367 Ga0070667_100018152 Ga0070667_1000181524 244
322 3300005367 Ga0070667_100025860 Ga0070667_1000258602 244
323 3300005367 Ga0070667_100080490 Ga0070667_1000804902 244
324 3300005367 Ga0070667_100088214 Ga0070667_1000882142 244
325 3300005367 Ga0070667_100110975 Ga0070667_1001109752 244
326 3300005367 Ga0070667_100155852 Ga0070667_1001558522 244
327 3300005367 Ga0070667_100589033 Ga0070667_1005890331 244
328 3300005434 Ga0070709_10063339 Ga0070709_100633392 244
329 3300005434 Ga0070709_10174932 Ga0070709_101749321 244
330 3300005434 Ga0070709_10359504 Ga0070709_103595041 244
331 3300005435 Ga0070714_100005054 Ga0070714_1000050545 244
332 3300005435 Ga0070714_100020847 Ga0070714_1000208473 244
333 3300005436 Ga0070713_100000028 Ga0070713_100000028102 244
334 3300005436 Ga0070713_100005285 Ga0070713_1000052853 244
335 3300005436 Ga0070713_100016855 Ga0070713_1000168553 244
336 3300005436 Ga0070713_100043939 Ga0070713_1000439392 244
337 3300005437 Ga0070710_10001633 Ga0070710_100016339 244
338 3300005437 Ga0070710_10234899 Ga0070710_102348992 244
339 3300005438 Ga0070701_10011100 Ga0070701_100111002 244
340 3300005439 Ga0070711_100009917 Ga0070711_1000099174 244
341 3300005439 Ga0070711_100273402 Ga0070711_1002734022 244
342 3300005439 Ga0070711_100345745 Ga0070711_1003457452 244
343 3300005439 Ga0070711_100580580 Ga0070711_1005805801 244
344 3300005440 Ga0070705_100013150 Ga0070705_1000131502 244
345 3300005440 Ga0070705_100057870 Ga0070705_1000578702 244
346 3300005441 Ga0070700_100127158 Ga0070700_1001271581 244
347 3300005444 Ga0070694_100085054 Ga0070694_1000850542 244
348 3300005444 Ga0070694_100137443 Ga0070694_1001374432 244
349 3300005445 Ga0070708_100000284 Ga0070708_10000028420 244
350 3300005445 Ga0070708_100114295 Ga0070708_1001142952 244
351 3300005455 Ga0070663_100006202 Ga0070663_1000062022 244
352 3300005455 Ga0070663_100009504 Ga0070663_1000095042 244
353 3300005455 Ga0070663_100010536 Ga0070663_1000105364 244
354 3300005455 Ga0070663_100039613 Ga0070663_1000396133 244
355 3300005456 Ga0070678_100000351 Ga0070678_10000035119 244
356 3300005456 Ga0070678_100001685 Ga0070678_10000168513 244
357 3300005456 Ga0070678_100002700 Ga0070678_1000027003 244
358 3300005456 Ga0070678_100010478 Ga0070678_1000104784 244
359 3300005456 Ga0070678_100356400 Ga0070678_1003564001 244
360 3300005456 Ga0070678_100473655 Ga0070678_1004736551 244
361 3300005457 Ga0070662_100000176 Ga0070662_1000001766 244
362 3300005457 Ga0070662_100007365 Ga0070662_1000073653 244
363 3300005457 Ga0070662_100011700 Ga0070662_1000117004 244
364 3300005457 Ga0070662_100106806 Ga0070662_1001068062 244
365 3300005457 Ga0070662_100302031 Ga0070662_1003020312 244
366 3300005458 Ga0070681_10006305 Ga0070681_100063053 244
367 3300005458 Ga0070681_10010101 Ga0070681_100101012 244
368 3300005458 Ga0070681_10015448 Ga0070681_100154483 244
369 3300005458 Ga0070681_10043733 Ga0070681_100437333 244
370 3300005458 Ga0070681_10045147 Ga0070681_100451472 244
371 3300005458 Ga0070681_10317073 Ga0070681_103170732 244
372 3300005459 Ga0068867_100002727 Ga0068867_10000272712 244
373 3300005459 Ga0068867_100004173 Ga0068867_1000041737 244
374 3300005459 Ga0068867_100012504 Ga0068867_1000125044 244
375 3300005459 Ga0068867_100019471 Ga0068867_1000194712 244
376 3300005459 Ga0068867_100064362 Ga0068867_1000643622 244
377 3300005459 Ga0068867_100090250 Ga0068867_1000902502 244
378 3300005459 Ga0068867_100187395 Ga0068867_1001873952 244
379 3300005466 Ga0070685_10001662 Ga0070685_100016629 244
380 3300005466 Ga0070685_10003062 Ga0070685_100030628 244
381 3300005518 Ga0070699_100028657 Ga0070699_1000286573 244
382 3300005518 Ga0070699_100151213 Ga0070699_1001512132 244
383 3300005530 Ga0070679_100004523 Ga0070679_10000452311 244
384 3300005530 Ga0070679_100070962 Ga0070679_1000709622 244
385 3300005530 Ga0070679_100082668 Ga0070679_1000826683 244
386 3300005530 Ga0070679_100115832 Ga0070679_1001158322 244
387 3300005530 Ga0070679_100183376 Ga0070679_1001833762 244
388 3300005530 Ga0070679_100187515 Ga0070679_1001875152 244
389 3300005535 Ga0070684_100137293 Ga0070684_1001372932 244
390 3300005535 Ga0070684_100337807 Ga0070684_1003378072 244
391 3300005539 Ga0068853_100006766 Ga0068853_1000067668 244
392 3300005539 Ga0068853_100067140 Ga0068853_1000671402 244
393 3300005539 Ga0068853_100105520 Ga0068853_1001055203 244
394 3300005543 Ga0070672_100004215 Ga0070672_10000421511 244
395 3300005543 Ga0070672_100010540 Ga0070672_1000105403 244
396 3300005543 Ga0070672_100011727 Ga0070672_1000117273 244
397 3300005543 Ga0070672_100015217 Ga0070672_1000152174 244
398 3300005543 Ga0070672_100029407 Ga0070672_1000294073 244
399 3300005543 Ga0070672_100029637 Ga0070672_1000296372 244
400 3300005543 Ga0070672_100031336 Ga0070672_1000313362 244
401 3300005543 Ga0070672_100080302 Ga0070672_1000803022 244
402 3300005543 Ga0070672_100111935 Ga0070672_1001119351 244
403 3300005543 Ga0070672_100151754 Ga0070672_1001517542 244
404 3300005543 Ga0070672_100235669 Ga0070672_1002356692 244
405 3300005544 Ga0070686_100013508 Ga0070686_1000135081 244
406 3300005545 Ga0070695_100425206 Ga0070695_1004252061 244
407 3300005546 Ga0070696_100132746 Ga0070696_1001327462 244
408 3300005547 Ga0070693_100000424 Ga0070693_10000042415 244
409 3300005547 Ga0070693_100147426 Ga0070693_1001474262 244
410 3300005548 Ga0070665_100006557 Ga0070665_10000655711 244
411 3300005548 Ga0070665_100018643 Ga0070665_1000186433 244
412 3300005548 Ga0070665_100030226 Ga0070665_1000302262 244
413 3300005548 Ga0070665_100032953 Ga0070665_1000329532 244
414 3300005548 Ga0070665_100227358 Ga0070665_1002273582 244
415 3300005548 Ga0070665_100280487 Ga0070665_1002804872 244
416 3300005563 Ga0068855_100000851 Ga0068855_10000085138 244
417 3300005563 Ga0068855_100084517 Ga0068855_1000845172 244
418 3300005563 Ga0068855_100098206 Ga0068855_1000982062 244
419 3300005563 Ga0068855_100177821 Ga0068855_1001778212 244
420 3300005563 Ga0068855_100180326 Ga0068855_1001803262 244
421 3300005563 Ga0068855_100254567 Ga0068855_1002545672 244
422 3300005564 Ga0070664_100017540 Ga0070664_1000175405 244
423 3300005564 Ga0070664_100019173 Ga0070664_1000191732 244
424 3300005564 Ga0070664_100028860 Ga0070664_1000288604 244
425 3300005564 Ga0070664_100068818 Ga0070664_1000688183 244
426 3300005564 Ga0070664_100074605 Ga0070664_1000746053 244
427 3300005564 Ga0070664_100077189 Ga0070664_1000771892 244
428 3300005564 Ga0070664_100154844 Ga0070664_1001548441 244
429 3300005564 Ga0070664_100262440 Ga0070664_1002624402 244
430 3300005577 Ga0068857_100028208 Ga0068857_1000282084 244
431 3300005577 Ga0068857_100069566 Ga0068857_1000695663 244
432 3300005577 Ga0068857_100129439 Ga0068857_1001294392 244
433 3300005577 Ga0068857_100129805 Ga0068857_1001298053 244
434 3300005577 Ga0068857_100477879 Ga0068857_1004778791 244
435 3300005578 Ga0068854_100009959 Ga0068854_1000099595 244
436 3300005578 Ga0068854_100014285 Ga0068854_1000142853 244
437 3300005578 Ga0068854_100098101 Ga0068854_1000981012 244
438 3300005578 Ga0068854_100109292 Ga0068854_1001092922 244
439 3300005578 Ga0068854_100260763 Ga0068854_1002607632 244
440 3300005578 Ga0068854_100438827 Ga0068854_1004388272 244
441 3300005614 Ga0068856_100001266 Ga0068856_10000126628 244
442 3300005614 Ga0068856_100016308 Ga0068856_1000163085 244
443 3300005614 Ga0068856_100068410 Ga0068856_1000684102 244
444 3300005614 Ga0068856_100079001 Ga0068856_1000790012 244
445 3300005615 Ga0070702_100004306 Ga0070702_1000043064 244
446 3300005615 Ga0070702_100356431 Ga0070702_1003564312 244
447 3300005616 Ga0068852_100004179 Ga0068852_1000041794 244
448 3300005616 Ga0068852_100079975 Ga0068852_1000799753 244
449 3300005616 Ga0068852_100147816 Ga0068852_1001478162 244
450 3300005616 Ga0068852_100280143 Ga0068852_1002801432 244
451 3300005616 Ga0068852_100352466 Ga0068852_1003524661 244
452 3300005616 Ga0068852_100352863 Ga0068852_1003528632 244
453 3300005616 Ga0068852_100526480 Ga0068852_1005264801 244
454 3300005617 Ga0068859_100000330 Ga0068859_10000033026 244
455 3300005617 Ga0068859_100009872 Ga0068859_1000098722 244
456 3300005617 Ga0068859_100015176 Ga0068859_1000151763 244
457 3300005617 Ga0068859_100066746 Ga0068859_1000667463 244
458 3300005617 Ga0068859_100171940 Ga0068859_1001719402 244
459 3300005618 Ga0068864_100001097 Ga0068864_10000109715 244
460 3300005618 Ga0068864_100001602 Ga0068864_10000160212 244
461 3300005618 Ga0068864_100013666 Ga0068864_1000136662 244
462 3300005618 Ga0068864_100026760 Ga0068864_1000267603 244
463 3300005618 Ga0068864_100044736 Ga0068864_1000447364 244
464 3300005618 Ga0068864_100240884 Ga0068864_1002408842 244
465 3300005618 Ga0068864_100454367 Ga0068864_1004543672 244
466 3300005718 Ga0068866_10001640 Ga0068866_100016403 244
467 3300005718 Ga0068866_10013071 Ga0068866_100130712 244
468 3300005718 Ga0068866_10046855 Ga0068866_100468552 244
469 3300005718 Ga0068866_10050693 Ga0068866_100506932 244
470 3300005718 Ga0068866_10319087 Ga0068866_103190872 244
471 3300005719 Ga0068861_100000777 Ga0068861_10000077711 244
472 3300005719 Ga0068861_100045684 Ga0068861_1000456842 244
473 3300005719 Ga0068861_100054316 Ga0068861_1000543162 244
474 3300005834 Ga0068851_10000909 Ga0068851_100009098 244
475 3300005834 Ga0068851_10024227 Ga0068851_100242272 244
476 3300005834 Ga0068851_10032728 Ga0068851_100327282 244
477 3300005840 Ga0068870_10007190 Ga0068870_100071903 244
478 3300005841 Ga0068863_100007466 Ga0068863_1000074666 244
479 3300005841 Ga0068863_100008731 Ga0068863_1000087314 244
480 3300005841 Ga0068863_100011572 Ga0068863_1000115727 244
481 3300005841 Ga0068863_100014770 Ga0068863_1000147702 244
482 3300005841 Ga0068863_100017663 Ga0068863_1000176635 244
483 3300005841 Ga0068863_100024838 Ga0068863_1000248381 244
484 3300005841 Ga0068863_100098731 Ga0068863_1000987312 244
485 3300005841 Ga0068863_100106172 Ga0068863_1001061723 244
486 3300005841 Ga0068863_100211307 Ga0068863_1002113072 244
487 3300005841 Ga0068863_100429825 Ga0068863_1004298252 244
488 3300005842 Ga0068858_100002918 Ga0068858_10000291811 244
489 3300005842 Ga0068858_100003252 Ga0068858_10000325211 244
490 3300005842 Ga0068858_100020003 Ga0068858_1000200037 244
491 3300005842 Ga0068858_100045449 Ga0068858_1000454492 244
492 3300005842 Ga0068858_100211325 Ga0068858_1002113252 244
493 3300005842 Ga0068858_100275284 Ga0068858_1002752842 244
494 3300005842 Ga0068858_100450033 Ga0068858_1004500331 244
495 3300005842 Ga0068858_100830905 Ga0068858_1008309051 244
496 3300005843 Ga0068860_100002326 Ga0068860_10000232617 244
497 3300005843 Ga0068860_100009369 Ga0068860_1000093694 244
498 3300005843 Ga0068860_100010280 Ga0068860_1000102805 244
499 3300005843 Ga0068860_100033550 Ga0068860_1000335502 244
500 3300005843 Ga0068860_100062829 Ga0068860_1000628292 244
501 3300005843 Ga0068860_100082654 Ga0068860_1000826542 244
502 3300005843 Ga0068860_100104936 Ga0068860_1001049362 244
503 3300005843 Ga0068860_100109242 Ga0068860_1001092422 244
504 3300005844 Ga0068862_100004250 Ga0068862_10000425011 244
505 3300005844 Ga0068862_100012225 Ga0068862_1000122256 244
506 3300005844 Ga0068862_100015279 Ga0068862_1000152795 244
507 3300005844 Ga0068862_100027115 Ga0068862_1000271153 244
508 3300005844 Ga0068862_100030079 Ga0068862_1000300794 244
509 3300005844 Ga0068862_100116372 Ga0068862_1001163722 244
510 3300005844 Ga0068862_100253579 Ga0068862_1002535792 244
511 3300006028 Ga0070717_10234551 Ga0070717_102345512 244
512 3300006173 Ga0070716_100003191 Ga0070716_1000031912 244
513 3300006173 Ga0070716_100044370 Ga0070716_1000443702 244
514 3300006175 Ga0070712_100004141 Ga0070712_1000041412 244
515 3300006175 Ga0070712_100408059 Ga0070712_1004080592 244
516 3300006175 Ga0070712_100531322 Ga0070712_1005313222 244
517 3300006237 Ga0097621_100006157 Ga0097621_1000061578 244
518 3300006237 Ga0097621_100025823 Ga0097621_1000258233 244
519 3300006237 Ga0097621_100039082 Ga0097621_1000390822 244
520 3300006237 Ga0097621_100072641 Ga0097621_1000726413 244
521 3300006237 Ga0097621_100086946 Ga0097621_1000869462 244
522 3300006237 Ga0097621_100384355 Ga0097621_1003843552 244
523 3300006358 Ga0068871_100004264 Ga0068871_1000042649 244
524 3300006358 Ga0068871_100018370 Ga0068871_1000183702 244
525 3300006358 Ga0068871_100019218 Ga0068871_1000192184 244
526 3300006358 Ga0068871_100051726 Ga0068871_1000517262 244
527 3300006358 Ga0068871_100216861 Ga0068871_1002168612 244
528 3300006358 Ga0068871_100446184 Ga0068871_1004461841 244
529 3300006844 Ga0075428_100021950 Ga0075428_1000219506 244
530 3300006844 Ga0075428_100101621 Ga0075428_1001016213 244
531 3300006844 Ga0075428_100176629 Ga0075428_1001766292 244
532 3300006846 Ga0075430_100051389 Ga0075430_1000513892 244
533 3300006846 Ga0075430_100111129 Ga0075430_1001111292 244
534 3300006846 Ga0075430_100217225 Ga0075430_1002172252 244
535 3300006847 Ga0075431_100007923 Ga0075431_1000079238 244
536 3300006847 Ga0075431_100095755 Ga0075431_1000957553 244
537 3300006847 Ga0075431_100244468 Ga0075431_1002444682 244
538 3300006880 Ga0075429_100164802 Ga0075429_1001648022 244
539 3300006881 Ga0068865_100012084 Ga0068865_1000120844 244
540 3300006881 Ga0068865_100032864 Ga0068865_1000328642 244
541 3300006881 Ga0068865_100039737 Ga0068865_1000397372 244
542 3300006881 Ga0068865_100114673 Ga0068865_1001146732 244
543 3300006914 Ga0075436_100396254 Ga0075436_1003962541 244
544 3300006931 Ga0097620_100000330 Ga0097620_10000033026 244
545 3300006931 Ga0097620_100009872 Ga0097620_1000098722 244
546 3300006931 Ga0097620_100015177 Ga0097620_1000151774 244
547 3300006931 Ga0097620_100066744 Ga0097620_1000667442 244
548 3300006931 Ga0097620_100171933 Ga0097620_1001719332 244
549 3300007076 Ga0075435_100334123 Ga0075435_1003341232 244
550 3300009093 Ga0105240_10000346 Ga0105240_1000034669 244
551 3300009093 Ga0105240_10171210 Ga0105240_101712102 244
552 3300009094 Ga0111539_10047219 Ga0111539_100472192 244
553 3300009094 Ga0111539_10060708 Ga0111539_100607083 244
554 3300009094 Ga0111539_10167683 Ga0111539_101676832 244
555 3300009098 Ga0105245_10039630 Ga0105245_100396303 244
556 3300009098 Ga0105245_10534752 Ga0105245_105347521 244
557 3300009098 Ga0105245_10688833 Ga0105245_106888331 244
558 3300009101 Ga0105247_10003604 Ga0105247_100036049 244
559 3300009101 Ga0105247_10013560 Ga0105247_100135602 244
560 3300009101 Ga0105247_10029345 Ga0105247_100293453 244
561 3300009147 Ga0114129_10006954 Ga0114129_100069545 244
562 3300009147 Ga0114129_10081956 Ga0114129_100819563 244
563 3300009148 Ga0105243_10286607 Ga0105243_102866071 244
564 3300009148 Ga0105243_10705343 Ga0105243_107053432 244
565 3300009174 Ga0105241_10134563 Ga0105241_101345632 244
566 3300009174 Ga0105241_10371541 Ga0105241_103715412 244
567 3300009176 Ga0105242_10019291 Ga0105242_100192915 244
568 3300009176 Ga0105242_10043990 Ga0105242_100439903 244
569 3300009176 Ga0105242_10063605 Ga0105242_100636052 244
570 3300009177 Ga0105248_10024911 Ga0105248_100249115 244
571 3300009177 Ga0105248_10060710 Ga0105248_100607103 244
572 3300009177 Ga0105248_10106388 Ga0105248_101063882 244
573 3300009177 Ga0105248_10163213 Ga0105248_101632132 244
574 3300009177 Ga0105248_10697375 Ga0105248_106973752 244
575 3300009545 Ga0105237_10053937 Ga0105237_100539373 244
576 3300009545 Ga0105237_10119375 Ga0105237_101193752 244
577 3300009545 Ga0105237_10130895 Ga0105237_101308952 244
578 3300009551 Ga0105238_10055926 Ga0105238_100559263 244
579 3300009551 Ga0105238_10085022 Ga0105238_100850224 244
580 3300009551 Ga0105238_10478036 Ga0105238_104780362 244
581 3300009553 Ga0105249_10081063 Ga0105249_100810632 244
582 3300009553 Ga0105249_10421280 Ga0105249_104212802 244
583 3300010375 Ga0105239_10000273 Ga0105239_1000027328 244
584 3300010375 Ga0105239_10098913 Ga0105239_100989132 244
585 3300010375 Ga0105239_10108211 Ga0105239_101082112 244
586 3300010375 Ga0105239_10181138 Ga0105239_101811382 244
587 3300010375 Ga0105239_10600815 Ga0105239_106008151 244
588 3300013100 Ga0157373_10001173 Ga0157373_100011732 244
589 3300013100 Ga0157373_10004676 Ga0157373_100046767 244
590 3300013100 Ga0157373_10008730 Ga0157373_100087307 244
591 3300013102 Ga0157371_10059352 Ga0157371_100593522 244
592 3300013104 Ga0157370_10016519 Ga0157370_100165197 244
593 3300013104 Ga0157370_10051627 Ga0157370_100516272 244
594 3300013104 Ga0157370_10053342 Ga0157370_100533423 244
595 3300013104 Ga0157370_10072589 Ga0157370_100725892 244
596 3300013104 Ga0157370_10434012 Ga0157370_104340122 244
597 3300013105 Ga0157369_10002942 Ga0157369_100029426 244
598 3300013105 Ga0157369_10023324 Ga0157369_100233242 244
599 3300013105 Ga0157369_10094508 Ga0157369_100945082 244
600 3300013105 Ga0157369_10095005 Ga0157369_100950052 244
601 3300013105 Ga0157369_10211915 Ga0157369_102119152 244
602 3300013105 Ga0157369_10337053 Ga0157369_103370531 244
603 3300013105 Ga0157369_10372009 Ga0157369_103720092 244
604 3300013105 Ga0157369_10387769 Ga0157369_103877692 244
605 3300013296 Ga0157374_10000720 Ga0157374_1000072012 244
606 3300013296 Ga0157374_10008122 Ga0157374_100081229 244
607 3300013296 Ga0157374_10183144 Ga0157374_101831442 244
608 3300013297 Ga0157378_10014979 Ga0157378_100149794 244
609 3300013297 Ga0157378_10016325 Ga0157378_100163252 244
610 3300013297 Ga0157378_10018354 Ga0157378_100183544 244
611 3300013297 Ga0157378_10172120 Ga0157378_101721202 244
612 3300013297 Ga0157378_10216584 Ga0157378_102165842 244
613 3300013306 Ga0163162_10003105 Ga0163162_1000310513 244
614 3300013306 Ga0163162_10006113 Ga0163162_100061139 244
615 3300013306 Ga0163162_10019549 Ga0163162_100195495 244
616 3300013306 Ga0163162_10033583 Ga0163162_100335833 244
617 3300013306 Ga0163162_10203427 Ga0163162_102034273 244
618 3300013306 Ga0163162_10399134 Ga0163162_103991342 244
619 3300013306 Ga0163162_10527316 Ga0163162_105273162 244
620 3300013307 Ga0157372_10001478 Ga0157372_100014783 244
621 3300013307 Ga0157372_10007660 Ga0157372_100076606 244
622 3300013307 Ga0157372_10034097 Ga0157372_100340973 244
623 3300013307 Ga0157372_10038458 Ga0157372_100384582 244
624 3300013307 Ga0157372_10038657 Ga0157372_100386575 244
625 3300013307 Ga0157372_10045721 Ga0157372_100457212 244
626 3300013308 Ga0157375_10002056 Ga0157375_100020562 244
627 3300013308 Ga0157375_10007671 Ga0157375_100076714 244
628 3300013308 Ga0157375_10009192 Ga0157375_100091926 244
629 3300013308 Ga0157375_10055031 Ga0157375_100550312 244
630 3300013308 Ga0157375_10064518 Ga0157375_100645182 244
631 3300013308 Ga0157375_10065262 Ga0157375_100652622 244
632 3300013308 Ga0157375_10080781 Ga0157375_100807812 244
633 3300014325 Ga0163163_10001050 Ga0163163_100010508 244
634 3300014325 Ga0163163_10014354 Ga0163163_100143547 244
635 3300014325 Ga0163163_10259800 Ga0163163_102598002 244
636 3300014325 Ga0163163_10388928 Ga0163163_103889282 244
637 3300014326 Ga0157380_10067687 Ga0157380_100676872 244
638 3300014326 Ga0157380_10135107 Ga0157380_101351072 244
639 3300014326 Ga0157380_10275197 Ga0157380_102751972 244
640 3300014497 Ga0182008_10007068 Ga0182008_100070687 244
641 3300014497 Ga0182008_10059028 Ga0182008_100590282 244
642 3300014497 Ga0182008_10142331 Ga0182008_101423312 244
643 3300014745 Ga0157377_10015910 Ga0157377_100159102 244
644 3300014968 Ga0157379_10000522 Ga0157379_1000052228 244
645 3300014968 Ga0157379_10004446 Ga0157379_100044465 244
646 3300014968 Ga0157379_10007323 Ga0157379_100073236 244
647 3300014968 Ga0157379_10083757 Ga0157379_100837572 244
648 3300014968 Ga0157379_10494611 Ga0157379_104946112 244
649 3300014969 Ga0157376_10003508 Ga0157376_100035089 244
650 3300014969 Ga0157376_10011958 Ga0157376_100119585 244
651 3300014969 Ga0157376_10013021 Ga0157376_100130214 244
652 3300014969 Ga0157376_10015126 Ga0157376_100151263 244
653 3300014969 Ga0157376_10023451 Ga0157376_100234513 244
654 3300014969 Ga0157376_10039324 Ga0157376_100393244 244
655 3300014969 Ga0157376_10098711 Ga0157376_100987112 244
656 3300014969 Ga0157376_10166601 Ga0157376_101666012 244
657 3300014969 Ga0157376_10442954 Ga0157376_104429541 244
658 3300015261 Ga0182006_1000058 Ga0182006_100005846 244
659 3300015261 Ga0182006_1001653 Ga0182006_100165313 244
660 3300015262 Ga0182007_10005116 Ga0182007_100051167 244
661 3300015265 Ga0182005_1000015 Ga0182005_1000015167 244
662 3300015265 Ga0182005_1006185 Ga0182005_10061852 244
663 3300015265 Ga0182005_1007259 Ga0182005_10072592 244
664 3300015265 Ga0182005_1008891 Ga0182005_10088913 244
665 3300017792 Ga0163161_10012216 Ga0163161_100122163 244
666 3300017792 Ga0163161_10164879 Ga0163161_101648792 244
667 3300017792 Ga0163161_10342434 Ga0163161_103424341 244
668 3300020081 Ga0206354_10975298 Ga0206354_109752982 244
669 3300025226 Ga0209674_100375 Ga0209674_10037521 244
670 3300025233 Ga0209437_101785 Ga0209437_1017852 244
671 3300025254 Ga0209148_1001446 Ga0209148_10014463 244
672 3300025258 Ga0209129_1001704 Ga0209129_10017042 244
673 3300025290 Ga0207673_1009665 Ga0207673_10096652 244
674 3300025303 Ga0209051_1006973 Ga0209051_10069733 244
675 3300025315 Ga0207697_10000008 Ga0207697_1000000818 244
676 3300025321 Ga0207656_10004598 Ga0207656_100045983 244
677 3300025321 Ga0207656_10026491 Ga0207656_100264912 244
678 3300025893 Ga0207682_10000078 Ga0207682_1000007834 244
679 3300025893 Ga0207682_10000117 Ga0207682_1000011722 244
680 3300025898 Ga0207692_10014813 Ga0207692_100148134 244
681 3300025898 Ga0207692_10052105 Ga0207692_100521052 244
682 3300025898 Ga0207692_10174532 Ga0207692_101745322 244
683 3300025898 Ga0207692_10374242 Ga0207692_103742422 244
684 3300025899 Ga0207642_10001022 Ga0207642_100010223 244
685 3300025899 Ga0207642_10062269 Ga0207642_100622692 244
686 3300025899 Ga0207642_10063965 Ga0207642_100639652 244
687 3300025899 Ga0207642_10071757 Ga0207642_100717572 244
688 3300025899 Ga0207642_10086296 Ga0207642_100862962 244
689 3300025899 Ga0207642_10117410 Ga0207642_101174102 244
690 3300025900 Ga0207710_10006031 Ga0207710_100060312 244
691 3300025900 Ga0207710_10015842 Ga0207710_100158422 244
692 3300025900 Ga0207710_10105344 Ga0207710_101053442 244
693 3300025901 Ga0207688_10001307 Ga0207688_100013076 244
694 3300025901 Ga0207688_10019057 Ga0207688_100190574 244
695 3300025901 Ga0207688_10074420 Ga0207688_100744202 244
696 3300025901 Ga0207688_10283775 Ga0207688_102837751 244
697 3300025903 Ga0207680_10000776 Ga0207680_1000077611 244
698 3300025903 Ga0207680_10020973 Ga0207680_100209732 244
699 3300025903 Ga0207680_10099030 Ga0207680_100990302 244
700 3300025904 Ga0207647_10000005 Ga0207647_1000000567 244
701 3300025907 Ga0207645_10000139 Ga0207645_1000013922 244
702 3300025907 Ga0207645_10000552 Ga0207645_1000055232 244
703 3300025907 Ga0207645_10001815 Ga0207645_1000181515 244
704 3300025907 Ga0207645_10016972 Ga0207645_100169724 244
705 3300025907 Ga0207645_10065457 Ga0207645_100654571 244
706 3300025907 Ga0207645_10119584 Ga0207645_101195842 244
707 3300025908 Ga0207643_10000089 Ga0207643_1000008920 244
708 3300025908 Ga0207643_10003046 Ga0207643_100030463 244
709 3300025908 Ga0207643_10010575 Ga0207643_100105753 244
710 3300025908 Ga0207643_10042770 Ga0207643_100427702 244
711 3300025909 Ga0207705_10108935 Ga0207705_101089352 244
712 3300025909 Ga0207705_10183077 Ga0207705_101830772 244
713 3300025910 Ga0207684_10490801 Ga0207684_104908012 244
714 3300025911 Ga0207654_10008661 Ga0207654_100086613 244
715 3300025911 Ga0207654_10016603 Ga0207654_100166034 244
716 3300025911 Ga0207654_10024223 Ga0207654_100242233 244
717 3300025911 Ga0207654_10089753 Ga0207654_100897532 244
718 3300025911 Ga0207654_10307311 Ga0207654_103073111 244
719 3300025912 Ga0207707_10014263 Ga0207707_100142633 244
720 3300025912 Ga0207707_10019764 Ga0207707_100197643 244
721 3300025913 Ga0207695_10000100 Ga0207695_1000010028 244
722 3300025913 Ga0207695_10500029 Ga0207695_105000292 244
723 3300025914 Ga0207671_10021761 Ga0207671_100217612 244
724 3300025914 Ga0207671_10109227 Ga0207671_101092272 244
725 3300025915 Ga0207693_10000485 Ga0207693_1000048530 244
726 3300025915 Ga0207693_10114123 Ga0207693_101141233 244
727 3300025916 Ga0207663_10006208 Ga0207663_100062084 244
728 3300025916 Ga0207663_10130130 Ga0207663_101301302 244
729 3300025917 Ga0207660_10408462 Ga0207660_104084622 244
730 3300025918 Ga0207662_10009347 Ga0207662_100093473 244
731 3300025919 Ga0207657_10000240 Ga0207657_1000024024 244
732 3300025919 Ga0207657_10000803 Ga0207657_1000080336 244
733 3300025919 Ga0207657_10003754 Ga0207657_100037543 244
734 3300025919 Ga0207657_10012140 Ga0207657_100121407 244
735 3300025919 Ga0207657_10023861 Ga0207657_100238616 244
736 3300025919 Ga0207657_10031867 Ga0207657_100318673 244
737 3300025919 Ga0207657_10178676 Ga0207657_101786761 244
738 3300025920 Ga0207649_10059205 Ga0207649_100592053 244
739 3300025920 Ga0207649_10068515 Ga0207649_100685152 244
740 3300025920 Ga0207649_10069637 Ga0207649_100696372 244
741 3300025920 Ga0207649_10140207 Ga0207649_101402072 244
742 3300025921 Ga0207652_10003594 Ga0207652_1000359411 244
743 3300025921 Ga0207652_10040328 Ga0207652_100403282 244
744 3300025921 Ga0207652_10142150 Ga0207652_101421502 244
745 3300025921 Ga0207652_10211674 Ga0207652_102116742 244
746 3300025921 Ga0207652_10459887 Ga0207652_104598872 244
747 3300025923 Ga0207681_10006422 Ga0207681_100064223 244
748 3300025923 Ga0207681_10028269 Ga0207681_100282692 244
749 3300025923 Ga0207681_10029520 Ga0207681_100295203 244
750 3300025923 Ga0207681_10080877 Ga0207681_100808772 244
751 3300025923 Ga0207681_10093417 Ga0207681_100934172 244
752 3300025923 Ga0207681_10167478 Ga0207681_101674782 244
753 3300025923 Ga0207681_10304014 Ga0207681_103040141 244
754 3300025924 Ga0207694_10015161 Ga0207694_100151612 244
755 3300025924 Ga0207694_10189591 Ga0207694_101895912 244
756 3300025925 Ga0207650_10004137 Ga0207650_100041374 244
757 3300025925 Ga0207650_10005921 Ga0207650_100059215 244
758 3300025925 Ga0207650_10017824 Ga0207650_100178243 244
759 3300025925 Ga0207650_10017879 Ga0207650_100178794 244
760 3300025925 Ga0207650_10087748 Ga0207650_100877482 244
761 3300025925 Ga0207650_10095463 Ga0207650_100954632 244
762 3300025925 Ga0207650_10097254 Ga0207650_100972542 244
763 3300025925 Ga0207650_10174706 Ga0207650_101747062 244
764 3300025925 Ga0207650_10266228 Ga0207650_102662282 244
765 3300025925 Ga0207650_10531018 Ga0207650_105310182 244
766 3300025926 Ga0207659_10001052 Ga0207659_1000105214 244
767 3300025926 Ga0207659_10010158 Ga0207659_100101583 244
768 3300025926 Ga0207659_10012602 Ga0207659_100126024 244
769 3300025926 Ga0207659_10015203 Ga0207659_100152032 244
770 3300025927 Ga0207687_10001187 Ga0207687_100011873 244
771 3300025927 Ga0207687_10007628 Ga0207687_100076282 244
772 3300025928 Ga0207700_10000045 Ga0207700_1000004512 244
773 3300025928 Ga0207700_10001822 Ga0207700_100018223 244
774 3300025928 Ga0207700_10048113 Ga0207700_100481132 244
775 3300025928 Ga0207700_10061742 Ga0207700_100617422 244
776 3300025929 Ga0207664_10003746 Ga0207664_100037465 244
777 3300025931 Ga0207644_10005257 Ga0207644_100052572 244
778 3300025931 Ga0207644_10005479 Ga0207644_100054795 244
779 3300025931 Ga0207644_10008951 Ga0207644_100089514 244
780 3300025931 Ga0207644_10013067 Ga0207644_100130673 244
781 3300025931 Ga0207644_10027283 Ga0207644_100272833 244
782 3300025931 Ga0207644_10044328 Ga0207644_100443283 244
783 3300025931 Ga0207644_10045725 Ga0207644_100457252 244
784 3300025931 Ga0207644_10152480 Ga0207644_101524802 244
785 3300025932 Ga0207690_10004965 Ga0207690_100049657 244
786 3300025932 Ga0207690_10008762 Ga0207690_100087625 244
787 3300025932 Ga0207690_10070081 Ga0207690_100700812 244
788 3300025932 Ga0207690_10166987 Ga0207690_101669872 244
789 3300025932 Ga0207690_10180440 Ga0207690_101804402 244
790 3300025932 Ga0207690_10274353 Ga0207690_102743531 244
791 3300025933 Ga0207706_10000002 Ga0207706_10000002192 244
792 3300025933 Ga0207706_10000456 Ga0207706_1000045631 244
793 3300025933 Ga0207706_10002935 Ga0207706_1000293515 244
794 3300025933 Ga0207706_10038532 Ga0207706_100385322 244
795 3300025934 Ga0207686_10000309 Ga0207686_1000030924 244
796 3300025935 Ga0207709_10428445 Ga0207709_104284452 244
797 3300025936 Ga0207670_10078568 Ga0207670_100785682 244
798 3300025936 Ga0207670_10146680 Ga0207670_101466802 244
799 3300025936 Ga0207670_10201005 Ga0207670_102010052 244
800 3300025937 Ga0207669_10003245 Ga0207669_100032454 244
801 3300025937 Ga0207669_10012184 Ga0207669_100121842 244
802 3300025937 Ga0207669_10020734 Ga0207669_100207342 244
803 3300025937 Ga0207669_10054120 Ga0207669_100541201 244
804 3300025937 Ga0207669_10088175 Ga0207669_100881752 244
805 3300025938 Ga0207704_10042897 Ga0207704_100428972 244
806 3300025938 Ga0207704_10171885 Ga0207704_101718851 244
807 3300025939 Ga0207665_10004200 Ga0207665_100042002 244
808 3300025939 Ga0207665_10032651 Ga0207665_100326513 244
809 3300025940 Ga0207691_10000040 Ga0207691_1000004018 244
810 3300025940 Ga0207691_10001760 Ga0207691_1000176020 244
811 3300025940 Ga0207691_10002356 Ga0207691_1000235617 244
812 3300025940 Ga0207691_10003578 Ga0207691_100035786 244
813 3300025940 Ga0207691_10009315 Ga0207691_1000931511 244
814 3300025940 Ga0207691_10011361 Ga0207691_100113613 244
815 3300025940 Ga0207691_10041209 Ga0207691_100412092 244
816 3300025940 Ga0207691_10054416 Ga0207691_100544163 244
817 3300025940 Ga0207691_10170206 Ga0207691_101702062 244
818 3300025940 Ga0207691_10224159 Ga0207691_102241592 244
819 3300025941 Ga0207711_10000115 Ga0207711_1000011531 244
820 3300025941 Ga0207711_10010215 Ga0207711_100102152 244
821 3300025941 Ga0207711_10016534 Ga0207711_100165344 244
822 3300025941 Ga0207711_10057720 Ga0207711_100577203 244
823 3300025941 Ga0207711_10224383 Ga0207711_102243831 244
824 3300025942 Ga0207689_10000072 Ga0207689_1000007219 244
825 3300025942 Ga0207689_10001313 Ga0207689_1000131318 244
826 3300025942 Ga0207689_10010191 Ga0207689_100101917 244
827 3300025942 Ga0207689_10010686 Ga0207689_100106866 244
828 3300025942 Ga0207689_10054482 Ga0207689_100544822 244
829 3300025942 Ga0207689_10126536 Ga0207689_101265362 244
830 3300025944 Ga0207661_10069396 Ga0207661_100693962 244
831 3300025944 Ga0207661_10367864 Ga0207661_103678642 244
832 3300025945 Ga0207679_10009685 Ga0207679_100096856 244
833 3300025945 Ga0207679_10022604 Ga0207679_100226043 244
834 3300025945 Ga0207679_10023248 Ga0207679_100232482 244
835 3300025945 Ga0207679_10057864 Ga0207679_100578642 244
836 3300025945 Ga0207679_10076010 Ga0207679_100760102 244
837 3300025949 Ga0207667_10011280 Ga0207667_100112804 244
838 3300025949 Ga0207667_10012910 Ga0207667_100129109 244
839 3300025949 Ga0207667_10048176 Ga0207667_100481762 244
840 3300025949 Ga0207667_10099615 Ga0207667_100996152 244
841 3300025949 Ga0207667_10113614 Ga0207667_101136142 244
842 3300025960 Ga0207651_10000966 Ga0207651_100009666 244
843 3300025960 Ga0207651_10003025 Ga0207651_100030254 244
844 3300025960 Ga0207651_10013398 Ga0207651_100133982 244
845 3300025960 Ga0207651_10025367 Ga0207651_100253672 244
846 3300025960 Ga0207651_10044588 Ga0207651_100445882 244
847 3300025960 Ga0207651_10237075 Ga0207651_102370751 244
848 3300025960 Ga0207651_10258797 Ga0207651_102587972 244
849 3300025960 Ga0207651_10384321 Ga0207651_103843212 244
850 3300025961 Ga0207712_10085127 Ga0207712_100851272 244
851 3300025961 Ga0207712_10099208 Ga0207712_100992082 244
852 3300025972 Ga0207668_10001913 Ga0207668_1000191311 244
853 3300025972 Ga0207668_10003096 Ga0207668_100030967 244
854 3300025972 Ga0207668_10008843 Ga0207668_100088433 244
855 3300025972 Ga0207668_10012420 Ga0207668_100124202 244
856 3300025972 Ga0207668_10099301 Ga0207668_100993012 244
857 3300025972 Ga0207668_10116648 Ga0207668_101166482 244
858 3300025972 Ga0207668_10198448 Ga0207668_101984482 244
859 3300025972 Ga0207668_10239164 Ga0207668_102391642 244
860 3300025981 Ga0207640_10005098 Ga0207640_100050985 244
861 3300025981 Ga0207640_10042045 Ga0207640_100420452 244
862 3300025981 Ga0207640_10043464 Ga0207640_100434642 244
863 3300025981 Ga0207640_10079625 Ga0207640_100796252 244
864 3300025981 Ga0207640_10086941 Ga0207640_100869412 244
865 3300025981 Ga0207640_10090431 Ga0207640_100904312 244
866 3300025986 Ga0207658_10004416 Ga0207658_100044167 244
867 3300025986 Ga0207658_10008367 Ga0207658_100083674 244
868 3300025986 Ga0207658_10042973 Ga0207658_100429733 244
869 3300025986 Ga0207658_10174219 Ga0207658_101742192 244
870 3300025986 Ga0207658_10299031 Ga0207658_102990312 244
871 3300025986 Ga0207658_10506933 Ga0207658_105069332 244
872 3300025986 Ga0207658_10583619 Ga0207658_105836191 244
873 3300026023 Ga0207677_10000395 Ga0207677_1000039529 244
874 3300026023 Ga0207677_10010308 Ga0207677_100103083 244
875 3300026023 Ga0207677_10089229 Ga0207677_100892292 244
876 3300026023 Ga0207677_10193016 Ga0207677_101930162 244
877 3300026035 Ga0207703_10000588 Ga0207703_1000058838 244
878 3300026035 Ga0207703_10001041 Ga0207703_1000104120 244
879 3300026035 Ga0207703_10082897 Ga0207703_100828972 244
880 3300026035 Ga0207703_10241514 Ga0207703_102415142 244
881 3300026035 Ga0207703_10549871 Ga0207703_105498712 244
882 3300026035 Ga0207703_10729703 Ga0207703_107297032 244
883 3300026041 Ga0207639_10009669 Ga0207639_100096692 244
884 3300026041 Ga0207639_10012594 Ga0207639_100125943 244
885 3300026041 Ga0207639_10035788 Ga0207639_100357882 244
886 3300026067 Ga0207678_10001320 Ga0207678_1000132022 244
887 3300026067 Ga0207678_10002147 Ga0207678_1000214713 244
888 3300026067 Ga0207678_10028719 Ga0207678_100287193 244
889 3300026067 Ga0207678_10044821 Ga0207678_100448212 244
890 3300026067 Ga0207678_10063354 Ga0207678_100633541 244
891 3300026067 Ga0207678_10070349 Ga0207678_100703493 244
892 3300026075 Ga0207708_10001784 Ga0207708_100017846 244
893 3300026078 Ga0207702_10019215 Ga0207702_100192153 244
894 3300026078 Ga0207702_10064859 Ga0207702_100648593 244
895 3300026078 Ga0207702_10073413 Ga0207702_100734132 244
896 3300026078 Ga0207702_10074687 Ga0207702_100746871 244
897 3300026078 Ga0207702_10342908 Ga0207702_103429082 244
898 3300026088 Ga0207641_10004458 Ga0207641_100044588 244
899 3300026088 Ga0207641_10005320 Ga0207641_1000532011 244
900 3300026088 Ga0207641_10005586 Ga0207641_100055866 244
901 3300026088 Ga0207641_10006323 Ga0207641_100063239 244
902 3300026088 Ga0207641_10009256 Ga0207641_100092565 244
903 3300026088 Ga0207641_10046301 Ga0207641_100463013 244
904 3300026088 Ga0207641_10082119 Ga0207641_100821193 244
905 3300026088 Ga0207641_10095698 Ga0207641_100956982 244
906 3300026088 Ga0207641_10106756 Ga0207641_101067562 244
907 3300026089 Ga0207648_10000869 Ga0207648_1000086911 244
908 3300026089 Ga0207648_10003505 Ga0207648_100035055 244
909 3300026089 Ga0207648_10004136 Ga0207648_1000413613 244
910 3300026089 Ga0207648_10011065 Ga0207648_100110652 244
911 3300026089 Ga0207648_10019772 Ga0207648_100197725 244
912 3300026089 Ga0207648_10021921 Ga0207648_100219212 244
913 3300026089 Ga0207648_10036416 Ga0207648_100364162 244
914 3300026089 Ga0207648_10241524 Ga0207648_102415242 244
915 3300026089 Ga0207648_10370262 Ga0207648_103702622 244
916 3300026095 Ga0207676_10000415 Ga0207676_100004155 244
917 3300026095 Ga0207676_10010062 Ga0207676_100100623 244
918 3300026095 Ga0207676_10023745 Ga0207676_100237452 244
919 3300026095 Ga0207676_10027348 Ga0207676_100273482 244
920 3300026095 Ga0207676_10034726 Ga0207676_100347262 244
921 3300026095 Ga0207676_10047817 Ga0207676_100478172 244
922 3300026116 Ga0207674_10000237 Ga0207674_100002374 244
923 3300026116 Ga0207674_10002009 Ga0207674_100020093 244
924 3300026116 Ga0207674_10009820 Ga0207674_1000982010 244
925 3300026116 Ga0207674_10017265 Ga0207674_100172654 244
926 3300026116 Ga0207674_10271687 Ga0207674_102716872 244
927 3300026116 Ga0207674_10323826 Ga0207674_103238262 244
928 3300026118 Ga0207675_100001565 Ga0207675_10000156513 244
929 3300026118 Ga0207675_100003198 Ga0207675_1000031988 244
930 3300026118 Ga0207675_100004543 Ga0207675_10000454314 244
931 3300026118 Ga0207675_100019899 Ga0207675_1000198992 244
932 3300026118 Ga0207675_100039312 Ga0207675_1000393122 244
933 3300026118 Ga0207675_100071076 Ga0207675_1000710763 244
934 3300026121 Ga0207683_10000059 Ga0207683_1000005953 244
935 3300026121 Ga0207683_10003115 Ga0207683_100031154 244
936 3300026121 Ga0207683_10016179 Ga0207683_100161792 244
937 3300026121 Ga0207683_10028011 Ga0207683_100280112 244
938 3300026121 Ga0207683_10035577 Ga0207683_100355773 244
939 3300026121 Ga0207683_10227164 Ga0207683_102271642 244
940 3300026142 Ga0207698_10010565 Ga0207698_100105654 244
941 3300026142 Ga0207698_10124483 Ga0207698_101244832 244
942 3300026142 Ga0207698_10138812 Ga0207698_101388122 244
943 3300027424 Ga0209984_1001661 Ga0209984_10016612 244
944 3300027462 Ga0210000_1016516 Ga0210000_10165161 244
945 3300027471 Ga0209995_1011546 Ga0209995_10115462 244
946 3300027552 Ga0209982_1004436 Ga0209982_10044362 244
947 3300027665 Ga0209983_1001303 Ga0209983_10013035 244
948 3300027665 Ga0209983_1001468 Ga0209983_10014683 244
949 3300027682 Ga0209971_1000324 Ga0209971_100032411 244
950 3300027682 Ga0209971_1007478 Ga0209971_10074782 244
951 3300027695 Ga0209966_1011852 Ga0209966_10118522 244
952 3300027717 Ga0209998_10004521 Ga0209998_100045211 244
953 3300027876 Ga0209974_10000203 Ga0209974_1000020319 244
954 3300027876 Ga0209974_10004990 Ga0209974_100049902 244
955 3300028379 Ga0268266_10003868 Ga0268266_1000386810 244
956 3300028379 Ga0268266_10006174 Ga0268266_100061744 244
957 3300028379 Ga0268266_10021420 Ga0268266_100214203 244
958 3300028379 Ga0268266_10046196 Ga0268266_100461961 244
959 3300028379 Ga0268266_10113545 Ga0268266_101135452 244
960 3300028379 Ga0268266_10415006 Ga0268266_104150061 244
961 3300028380 Ga0268265_10018742 Ga0268265_100187423 244
962 3300028380 Ga0268265_10037284 Ga0268265_100372842 244
963 3300028380 Ga0268265_10040680 Ga0268265_100406802 244
964 3300028380 Ga0268265_10083898 Ga0268265_100838982 244
965 3300028380 Ga0268265_10248017 Ga0268265_102480172 244
966 3300028381 Ga0268264_10000593 Ga0268264_100005938 244
967 3300028381 Ga0268264_10008945 Ga0268264_100089459 244
968 3300028381 Ga0268264_10037315 Ga0268264_100373153 244
969 3300028381 Ga0268264_10059085 Ga0268264_100590852 244
970 3300028381 Ga0268264_10062357 Ga0268264_100623572 244
971 3300028381 Ga0268264_10064355 Ga0268264_100643553 244
972 3300028381 Ga0268264_10074028 Ga0268264_100740283 244
973 3300028381 Ga0268264_10174588 Ga0268264_101745882 244
974 3300031238 Ga0265332_10000724 Ga0265332_1000072415 244
975 3300031239 Ga0265328_10061595 Ga0265328_100615952 244
976 3300031241 Ga0265325_10005874 Ga0265325_100058743 244
977 3300031250 Ga0265331_10000579 Ga0265331_1000057916 244
978 3300031251 Ga0265327_10058377 Ga0265327_100583772 244
979 3300031344 Ga0265316_10018674 Ga0265316_100186743 244
980 3300031548 Ga0307408_100088245 Ga0307408_1000882453 244
981 3300031711 Ga0265314_10065902 Ga0265314_100659022 244
982 3300031712 Ga0265342_10018197 Ga0265342_100181973 244
983 3300031824 Ga0307413_10062358 Ga0307413_100623583 244
984 3300031903 Ga0307407_10057378 Ga0307407_100573782 244
985 3300031911 Ga0307412_10000360 Ga0307412_1000036010 244
986 3300031995 Ga0307409_100046791 Ga0307409_1000467913 244
987 3300032005 Ga0307411_10006419 Ga0307411_100064192 244
988 3300035086 Ga0373934_0003073 Ga0373934_0003073_3236_3979 244
989 3300035086 Ga0373934_0111850 Ga0373934_0111850_116_859 244
990 3300035089 Ga0373944_0020064 Ga0373944_0020064_1146_1889 244
991 3300035111 Ga0373923_0006925 Ga0373923_0006925_2916_3659 244
992 3300035114 Ga0373939_0039080 Ga0373939_0039080_475_1218 244
993 3300035116 Ga0373945_0007088 Ga0373945_0007088_1198_1941 244
994 3300035117 Ga0373953_0022998 Ga0373953_0022998_948_1691 244
995 3300035118 Ga0373954_0004673 Ga0373954_0004673_2209_2952 244
996 3300035118 Ga0373954_0166136 Ga0373954_0166136_37_780 244
997 3300035120 Ga0373957_0008055 Ga0373957_0008055_2159_2902 244
998 3300035170 Ga0373943_0133185 Ga0373943_0133185_51_794 244
999 3300035170 Ga0373943_0146415 Ga0373943_0146415_223_966 244
1000 3300035172 Ga0373955_0012467 Ga0373955_0012467_891_1634 244
1001 3300035410 Ga0373924_0002983 Ga0373924_0002983_4052_4795 244
1002 3300035410 Ga0373924_0030665 Ga0373924_0030665_148_891 244
1003 3300035691 Ga0373931_0023391 Ga0373931_0023391_1342_2085 244
1004 3300035691 Ga0373931_0045785 Ga0373931_0045785_748_1491 244
1005 3300035691 Ga0373931_0096626 Ga0373931_0096626_746_1489 244
1006 3300035692 Ga0373935_0063532 Ga0373935_0063532_169_912 244
1007 3300035724 Ga0373933_0069583 Ga0373933_0069583_1124_1867 244
1008 3300035724 Ga0373933_0198300 Ga0373933_0198300_464_1198 244
1009 3300035724 Ga0373933_0297293 Ga0373933_0297293_178_921 244
1010 3300035725 Ga0373947_0095928 Ga0373947_0095928_473_1216 244
1011 3300035725 Ga0373947_0175018 Ga0373947_0175018_180_923 244
1012 3300035725 Ga0373947_0317506 Ga0373947_0317506_110_853 244
1013 3300036401 Ga0373937_0020352 Ga0373937_0020352_4558_5301 244
1014 3300036401 Ga0373937_0043770 Ga0373937_0043770_2521_3264 244
1015 3300036401 Ga0373937_0093496 Ga0373937_0093496_1675_2418 244
1016 3300036401 Ga0373937_0437932 Ga0373937_0437932_275_1018 244
1017 3300037068 Ga0373925_0016949 Ga0373925_0016949_884_1627 244
1018 3300037068 Ga0373925_0027601 Ga0373925_0027601_742_1485 244
1019 3300037068 Ga0373925_0046710 Ga0373925_0046710_2167_2910 244
1020 3300037418 Ga0395900_0076921 Ga0395900_0076921_1255_1998 244
1021 3300037418 Ga0395900_0128863 Ga0395900_0128863_1234_1977 244
1022 3300037466 Ga0395898_0116153 Ga0395898_0116153_242_985 244
1023 3300038443 Ga0395901_0109151 Ga0395901_0109151_286_1029 244
1024 3300041404 Ga0439436_0000003 Ga0439436_0000003_178875_179609 244
1025 3300041413 Ga0439465_0000970 Ga0439465_0000970_7545_8279 244
1026 3300041451 Ga0451791_0643963 Ga0451791_0643963_3666_4400 244
1027 3300041453 Ga0451797_1001905 Ga0451797_1001905_54_788 244
1028 3300042133 Ga0450896_011054 Ga0450896_011054_104_850 244
1029 3300042184 Ga0450908_000002 Ga0450908_000002_60657_61391 244
1030 3300042876 Ga0451577_0158422 Ga0451577_0158422_624_1367 244
1031 3300042876 Ga0451577_0167805 Ga0451577_0167805_1061_1795 244
1032 3300044672 Ga0466982_0000024 Ga0466982_0000024_4835_5569 244
1033 3300044673 Ga0453683_0011900 Ga0453683_0011900_28_774 244
1034 3300044673 Ga0453683_0103550 Ga0453683_0103550_795_1529 244
1035 3300044712 Ga0453684_0002059 Ga0453684_0002059_43358_44092 244
1036 3300044712 Ga0453684_0004796 Ga0453684_0004796_1756_2490 244
1037 3300044712 Ga0453684_0049444 Ga0453684_0049444_60_806 244
1038 3300044712 Ga0453684_0079490 Ga0453684_0079490_2565_3299 244
1039 3300044712 Ga0453684_0153407 Ga0453684_0153407_529_1263 244
1040 3300044712 Ga0453684_0304304 Ga0453684_0304304_333_1067 244
1041 3300044712 Ga0453684_0534190 Ga0453684_0534190_90_860 244
1042 3300044712 Ga0453684_0758294 Ga0453684_0758294_303_1037 244
1043 3300044712 Ga0453684_0991007 Ga0453684_0991007_86_820 244
1044 3300044842 Ga0466957_0014798 Ga0466957_0014798_76_810 244
1045 3300045051 Ga0451576_0000009 Ga0451576_0000009_71261_71995 244
1046 3300045051 Ga0451576_0069345 Ga0451576_0069345_826_1638 244
1047 3300045051 Ga0451576_0332591 Ga0451576_0332591_184_918 244
1048 3300045051 Ga0451576_0487576 Ga0451576_0487576_320_1063 244
1049 3300046452 Ga0495617_000119 Ga0495617_000119_14837_15571 244
1050 3300046452 Ga0495617_000919 Ga0495617_000919_7717_8451 244
1051 3300046455 Ga0495603_0066384 Ga0495603_0066384_298_1041 244
1052 3300046459 Ga0495629_0032915 Ga0495629_0032915_1499_2242 244
1053 3300046459 Ga0495629_0106984 Ga0495629_0106984_874_1617 244
1054 3300046459 Ga0495629_0236737 Ga0495629_0236737_217_960 244
1055 3300046460 Ga0495638_0000089 Ga0495638_0000089_32665_33399 244
1056 3300046460 Ga0495638_0007444 Ga0495638_0007444_7034_7768 244
1057 3300046463 Ga0495653_0098106 Ga0495653_0098106_580_1323 244
1058 3300046471 Ga0495650_0007177 Ga0495650_0007177_1913_2647 244
1059 3300046471 Ga0495650_0024479 Ga0495650_0024479_1084_1818 244
1060 3300046472 Ga0495580_0071148 Ga0495580_0071148_636_1379 244
1061 3300046472 Ga0495580_0083568 Ga0495580_0083568_636_1379 244
1062 3300046472 Ga0495580_0129016 Ga0495580_0129016_30_773 244
1063 3300046474 Ga0495605_0032441 Ga0495605_0032441_537_1271 244
1064 3300046477 Ga0495664_0026281 Ga0495664_0026281_1240_1983 244
1065 3300046477 Ga0495664_0181128 Ga0495664_0181128_241_984 244
1066 3300046492 Ga0495585_0003201 Ga0495585_0003201_5413_6147 244
1067 3300046499 Ga0495594_0143059 Ga0495594_0143059_531_1274 244
1068 3300046501 Ga0495607_0000228 Ga0495607_0000228_36650_37384 244
1069 3300046507 Ga0495606_0001070 Ga0495606_0001070_17508_18242 244
1070 3300046507 Ga0495606_0001334 Ga0495606_0001334_14335_15069 244
1071 3300046507 Ga0495606_0029010 Ga0495606_0029010_980_1714 244
1072 3300046507 Ga0495606_0285393 Ga0495606_0285393_77_811 244
1073 3300046507 Ga0495606_0285403 Ga0495606_0285403_77_811 244
1074 3300046512 Ga0495610_0000312 Ga0495610_0000312_45859_46593 244
1075 3300046513 Ga0495616_0000345 Ga0495616_0000345_14691_15425 244
1076 3300046513 Ga0495616_0001053 Ga0495616_0001053_14840_15574 244
1077 3300046515 Ga0495620_0000186 Ga0495620_0000186_35065_35799 244
1078 3300046515 Ga0495620_0003002 Ga0495620_0003002_4881_5615 244
1079 3300046516 Ga0495628_0098145 Ga0495628_0098145_719_1462 244
1080 3300046518 Ga0495631_0000147 Ga0495631_0000147_39516_40250 244
1081 3300046518 Ga0495631_0000159 Ga0495631_0000159_5016_5750 244
1082 3300046519 Ga0495632_0000005 Ga0495632_0000005_180729_181463 244
1083 3300046519 Ga0495632_0014655 Ga0495632_0014655_1095_1829 244
1084 3300046519 Ga0495632_0021981 Ga0495632_0021981_1625_2359 244
1085 3300046519 Ga0495632_0027807 Ga0495632_0027807_1852_2586 244
1086 3300046524 Ga0495648_0000506 Ga0495648_0000506_24306_25040 244
1087 3300046524 Ga0495648_0015176 Ga0495648_0015176_4755_5489 244
1088 3300046531 Ga0495665_0024840 Ga0495665_0024840_503_1246 244
1089 3300046535 Ga0495586_0293341 Ga0495586_0293341_165_908 244
1090 3300046538 Ga0495609_0006311 Ga0495609_0006311_3507_4241 244
1091 3300046543 Ga0495645_0060238 Ga0495645_0060238_1504_2247 244
1092 3300046616 Ga0495668_0003695 Ga0495668_0003695_4246_4980 244
1093 3300046648 Ga0495611_0000005 Ga0495611_0000005_99701_100435 244
1094 3300046648 Ga0495611_0000039 Ga0495611_0000039_53219_53953 244
1095 3300046660 Ga0495625_0000066 Ga0495625_0000066_149225_149959 244
1096 3300046660 Ga0495625_0008087 Ga0495625_0008087_3466_4200 244
1097 3300046660 Ga0495625_0068697 Ga0495625_0068697_867_1601 244
1098 3300046663 Ga0495635_0072661 Ga0495635_0072661_189_932 244
1099 3300046664 Ga0495659_0016871 Ga0495659_0016871_1404_2147 244
1100 3300046665 Ga0495661_0001911 Ga0495661_0001911_5014_5748 244
1101 3300046665 Ga0495661_0071168 Ga0495661_0071168_1075_1809 244
1102 3300046675 Ga0495657_0137876 Ga0495657_0137876_432_1175 244
1103 3300046679 Ga0495623_0030308 Ga0495623_0030308_483_1226 244
1104 3300046681 Ga0495647_0037990 Ga0495647_0037990_697_1440 244
1105 3300046683 Ga0495658_0022264 Ga0495658_0022264_1142_1885 244
1106 3300046683 Ga0495658_0266481 Ga0495658_0266481_44_787 244
1107 3300046689 Ga0495613_0022386 Ga0495613_0022386_3552_4295 244
1108 3300046691 Ga0495670_0000607 Ga0495670_0000607_5307_6041 244
1109 3300046691 Ga0495670_0006362 Ga0495670_0006362_3705_4439 244
1110 3300046691 Ga0495670_0027019 Ga0495670_0027019_1444_2178 244
1111 3300046692 Ga0495671_0000247 Ga0495671_0000247_27193_27927 244
1112 3300046694 Ga0495649_0012074 Ga0495649_0012074_1259_1993 244
1113 3300046794 Ga0495589_0000026 Ga0495589_0000026_56570_57304 244
1114 3300046810 Ga0495660_0000605 Ga0495660_0000605_10895_11629 244
1115 3300046810 Ga0495660_0000748 Ga0495660_0000748_10725_11459 244
1116 3300047315 Ga0495581_0045122 Ga0495581_0045122_372_1115 244
1117 3300047315 Ga0495581_0269757 Ga0495581_0269757_49_792 244
1118 3300047317 Ga0495604_0103758 Ga0495604_0103758_938_1681 244
1119 3300047322 Ga0495680_0206112 Ga0495680_0206112_647_1390 244
1120 3300047323 Ga0495683_0002757 Ga0495683_0002757_7845_8579 244
1121 3300047446 Ga0495679_000010 Ga0495679_000010_150048_150782 244
1122 3300047469 Ga0495673_0000038 Ga0495673_0000038_183666_184400 244
1123 3300047469 Ga0495673_0000045 Ga0495673_0000045_142068_142802 244
1124 3300047469 Ga0495673_0001129 Ga0495673_0001129_41_775 244
1125 3300047469 Ga0495673_0017209 Ga0495673_0017209_1341_2075 244
1126 3300047471 Ga0495684_0021682 Ga0495684_0021682_245_988 244
1127 3300047472 Ga0495686_0000050 Ga0495686_0000050_177394_178128 244
1128 3300047472 Ga0495686_0000297 Ga0495686_0000297_48587_49321 244
1129 3300047472 Ga0495686_0002123 Ga0495686_0002123_10931_11665 244
1130 3300047472 Ga0495686_0012433 Ga0495686_0012433_4739_5473 244
1131 3300048903 Ga0496100_0002665 Ga0496100_0002665_4309_5043 244
1132 3300048903 Ga0496100_0099125 Ga0496100_0099125_1201_1944 244
1133 3300048904 Ga0496101_0005294 Ga0496101_0005294_2082_2816 244
1134 3300048904 Ga0496101_0051276 Ga0496101_0051276_829_1572 244
1135 3300048905 Ga0496102_0006283 Ga0496102_0006283_2433_3182 244
1136 3300048905 Ga0496102_0097772 Ga0496102_0097772_771_1514 244
1137 3300048905 Ga0496102_0113585 Ga0496102_0113585_85_819 244
1138 3300048905 Ga0496102_0442871 Ga0496102_0442871_172_915 244
1139 3300048906 Ga0496103_0019524 Ga0496103_0019524_2182_2949 244
1140 3300048907 Ga0496104_0012370 Ga0496104_0012370_4845_5588 244
1141 3300048908 Ga0496105_0003430 Ga0496105_0003430_137_880 244
1142 3300048908 Ga0496105_0026605 Ga0496105_0026605_3587_4321 244
1143 3300048908 Ga0496105_0047122 Ga0496105_0047122_299_1042 244
1144 3300048909 Ga0496106_0044865 Ga0496106_0044865_1672_2406 244
1145 3300048909 Ga0496106_0088215 Ga0496106_0088215_1621_2355 244
1146 3300048909 Ga0496106_0182477 Ga0496106_0182477_455_1204 244
1147 3300048910 Ga0496107_0030858 Ga0496107_0030858_660_1403 244
1148 3300048910 Ga0496107_0470685 Ga0496107_0470685_148_891 244
1149 3300048911 Ga0496108_0016030 Ga0496108_0016030_4852_5595 244
1150 3300048911 Ga0496108_0136144 Ga0496108_0136144_1229_1972 244
1151 3300048911 Ga0496108_0139007 Ga0496108_0139007_1257_2006 244
1152 3300048912 Ga0496109_0014325 Ga0496109_0014325_5745_6488 244
1153 3300048912 Ga0496109_0172951 Ga0496109_0172951_1268_2011 244
1154 3300048913 Ga0496110_0132686 Ga0496110_0132686_898_1647 244
1155 3300048913 Ga0496110_0426959 Ga0496110_0426959_152_895 244
1156 3300048914 Ga0496111_0152063 Ga0496111_0152063_497_1240 244
1157 3300048915 Ga0496112_0001102 Ga0496112_0001102_10826_11569 244
1158 3300048915 Ga0496112_0024159 Ga0496112_0024159_1846_2589 244
1159 3300048915 Ga0496112_0097958 Ga0496112_0097958_24_767 244
1160 3300048915 Ga0496112_0124194 Ga0496112_0124194_169_912 244
1161 3300048915 Ga0496112_0422302 Ga0496112_0422302_144_887 244
1162 3300048916 Ga0496113_0118116 Ga0496113_0118116_671_1414 244
1163 3300048916 Ga0496113_0247399 Ga0496113_0247399_68_817 244
1164 3300048916 Ga0496113_0351621 Ga0496113_0351621_408_1151 244
1165 3300048916 Ga0496113_0421466 Ga0496113_0421466_225_968 244
1166 3300048919 Ga0496116_0194831 Ga0496116_0194831_11_745 244
1167 3300048920 Ga0496117_0013045 Ga0496117_0013045_5179_5913 244
1168 3300048920 Ga0496117_0089920 Ga0496117_0089920_998_1732 244
1169 3300048921 Ga0496118_0001315 Ga0496118_0001315_23119_23853 244
1170 3300048921 Ga0496118_0002666 Ga0496118_0002666_9393_10127 244
1171 3300048921 Ga0496118_0007583 Ga0496118_0007583_9348_10082 244
1172 3300048922 Ga0496119_0000135 Ga0496119_0000135_3594_4328 244
1173 3300048923 Ga0496120_0000013 Ga0496120_0000013_77189_77923 244
1174 3300048924 Ga0496121_0000449 Ga0496121_0000449_38853_39587 244
1175 3300048924 Ga0496121_0001465 Ga0496121_0001465_21344_22078 244
1176 3300048924 Ga0496121_0002510 Ga0496121_0002510_16256_16990 244
1177 3300048925 Ga0496122_0010417 Ga0496122_0010417_5883_6617 244
1178 3300048925 Ga0496122_0060193 Ga0496122_0060193_1886_2620 244
1179 3300048925 Ga0496122_0060860 Ga0496122_0060860_404_1138 244
1180 3300048926 Ga0496123_0046717 Ga0496123_0046717_2012_2746 244
1181 3300049459 Ga0495678_000253 Ga0495678_000253_22271_23005 244
1182 3300049460 Ga0495682_0001785 Ga0495682_0001785_5112_5846 244
1183 3300049460 Ga0495682_0005080 Ga0495682_0005080_1113_1847 244
1184 3300049571 Ga0501034_0108629 Ga0501034_0108629_1688_2431 244
1185 3300049572 Ga0501036_0402934 Ga0501036_0402934_187_933 244
1186 3300049573 Ga0501037_0312033 Ga0501037_0312033_109_855 244
1187 3300049575 Ga0501039_0074523 Ga0501039_0074523_1079_1825 244
1188 3300049583 Ga0501067_0015409 Ga0501067_0015409_2318_3061 244
1189 3300049584 Ga0501068_0491811 Ga0501068_0491811_30_773 244
1190 3300049585 Ga0501069_0112973 Ga0501069_0112973_173_916 244
1191 3300049586 Ga0501070_0011092 Ga0501070_0011092_1768_2511 244
1192 3300049588 Ga0501072_0009471 Ga0501072_0009471_1524_2267 244
1193 3300049589 Ga0501073_0007473 Ga0501073_0007473_3894_4637 244
1194 3300049590 Ga0501074_0020548 Ga0501074_0020548_484_1227 244
1195 3300049592 Ga0501076_0112368 Ga0501076_0112368_1122_1868 244
1196 3300049742 Ga0501080_0001528 Ga0501080_0001528_9667_10410 244
1197 3300049742 Ga0501080_0017176 Ga0501080_0017176_2018_2761 244
1198 3300049744 Ga0501083_0051807 Ga0501083_0051807_22_765 244
1199 3300049822 Ga0501035_0251451 Ga0501035_0251451_395_1141 244
1200 3300050507 nmdc:mga05p37_89900_c1 nmdc:mga05p37_89900_c1_2133_2867 244
1201 3300050508 nmdc:mga09592_30624_c1 nmdc:mga09592_30624_c1_120_866 244
1202 3300050509 nmdc:mga0qj67_16450_c1 nmdc:mga0qj67_16450_c1_4601_5347 244
1203 3300050509 nmdc:mga0qj67_25770_c1 nmdc:mga0qj67_25770_c1_1858_2661 244
1204 3300050511 nmdc:mga08y16_353414_c1 nmdc:mga08y16_353414_c1_539_1282 244
1205 3300050512 nmdc:mga0n895_111959_c1 nmdc:mga0n895_111959_c1_1515_2258 244
1206 3300050512 nmdc:mga0n895_129754_c1 nmdc:mga0n895_129754_c1_948_1691 244
1207 3300050513 nmdc:mga0rr50_286349_c1 nmdc:mga0rr50_286349_c1_207_950 244
1208 3300050516 nmdc:mga0sz30_75335_c1 nmdc:mga0sz30_75335_c1_507_1241 244
1209 3300053077 Ga0495601_0145807 Ga0495601_0145807_668_1411 244
1210 3300053085 Ga0495619_0082621 Ga0495619_0082621_118_861 244
1211 3300053085 Ga0495619_0166254 Ga0495619_0166254_745_1488 244
1212 3300053087 Ga0500643_000074 Ga0500643_000074_74250_74984 244
1213 3300053092 Ga0500583_0167530 Ga0500583_0167530_198_932 244
1214 3300053103 Ga0500555_000398 Ga0500555_000398_12872_13606 244
1215 3300053730 Ga0500645_000429 Ga0500645_000429_19224_19958 244
1216 3300060353 Ga0501082_0268671 Ga0501082_0268671_227_970 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

58

201

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lkp-assembly1.cif.gz_A structure of atp-free human abca4 0.9654 2 224
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9646 2 223
4yer-assembly1.cif.gz_B crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.96 2 237
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.9532 2 223
8edw-assembly1.cif.gz_A cryo-em structure of human abca7 in bpl/ch nanodiscs 0.9502 2 224
ID Description Score Start End Superfamily
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9699 1 222 3.40.50.300
af_P36879_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9688 2 222 3.40.50.300
af_P78363_1926_2175_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9669 2 224 3.40.50.300
af_Q9XW49_440_685_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9651 2 226 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9634 2 220 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7G9REB6-F1-model_v4 ATP-binding cassette domain-containing protein 0.9735 2 223 GO:0005524
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A139WBE8-F1-model_v4 ATP-binding cassette sub-family A member 3-like Protein 0.9721 22 223 GO:0005319
GO:0005524
GO:0006869
GO:0016020
GO:0016887
GO:0042626
GO:0043231
GO:0140359
AF-A0A7J8BN72-F1-model_v4 ATP binding cassette subfamily A member 7 0.972 2 221 GO:0005524
GO:0016020
GO:0016887
GO:0033344
GO:0033700
GO:0034188
GO:0043231
GO:0090554
GO:0090556
GO:0140359
AF-A0A6G9YJ44-F1-model_v4 ATP-binding cassette domain-containing protein 0.9695 2 224 GO:0005524
GO:0012505
GO:0016887
GO:0043215
GO:0046677
GO:1900753
AF-A0A351MGC7-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9682 2 222 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.14 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map