F491683

General Info

Members Datasets Scaffolds Average Seq Length
1208 411 2416 146

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10804158|Ga0105238_108041582
Length 165
Sequence MPTRTARTAWNGTLEQGSGQVELTSSGVGTYEVSFPKRAADEAGGTTSPEELIAAAHSSCYAMQFSALIAQEGGTPQSLDVQADVTLGPDPAGGFAISGIKITVRGEVEGMDEAKFKEVADAAKAGCPVSKALTGTTITLDAGEMMGCTGNGRPPEPPQPRPNGR

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
88 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
115 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
116 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
117 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
118 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
119 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
137 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
142 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
143 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
210 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
224 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
225 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
226 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
229 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
231 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
232 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
238 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
261 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
262 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
263 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
264 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
265 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
266 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
267 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
268 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
269 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
270 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
271 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
272 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
273 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
274 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
275 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
276 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
277 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
278 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
279 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
280 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
281 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
282 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
283 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
286 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
287 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
288 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
291 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
294 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
298 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
299 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
300 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
301 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
302 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
303 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
304 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
305 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
306 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
307 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
311 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
312 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
313 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
314 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
315 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
316 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
317 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
318 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
321 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
322 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
323 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
324 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
325 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
338 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
339 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
340 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
343 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
344 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
345 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
346 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
347 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
348 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
349 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
350 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
351 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
352 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
353 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
354 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
355 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
356 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
357 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
360 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
361 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
362 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
363 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
364 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
370 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
378 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
379 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
387 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
388 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
389 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
390 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
391 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
392 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
393 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
394 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
395 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
396 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
397 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
398 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
399 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
400 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
401 2643221604 Nocardioides sp. Root190 Isolate Unclassified
402 2643221613 Oerskovia sp. Root22 Isolate Unclassified
403 2643221721 Oerskovia sp. Root918 Isolate Unclassified
404 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
405 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
406 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
407 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
408 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
409 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
410 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
411 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.02
Metatranscriptomes 2.07
Isolates 0.91

Biome Distribution

Category Percentage (%)
Aerial Root 0.08
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 7.2
Rhizosphere 88.08
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10804158 3300009551 Bacteria 956
2 JGI24746J21847_1013548 3300001977 Bacteria 1185
3 JGI24737J22298_10039524 3300001990 Bacteria 1450
4 JGI24737J22298_10078850 3300001990 Bacteria 981
5 JGI24737J22298_10240644 3300001990 Bacteria 534
6 JGI24743J22301_10019798 3300001991 Bacteria 1279
7 JGI24743J22301_10115525 3300001991 Bacteria 585
8 JGI24735J21928_10078215 3300002067 Bacteria 947
9 JGI24745J21846_1001491 3300002073 Bacteria 2276
10 JGI24738J21930_10009655 3300002075 Bacteria 2166
11 JGI24749J21850_1003410 3300002076 Bacteria 2224
12 JGI24744J21845_10007601 3300002077 Bacteria 2240
13 JGI24033J26618_1010355 3300002155 Bacteria 1098
14 JGI24742J22300_10067248 3300002244 Bacteria 664
15 Ga0006778J45830_1044288 3300003162 Bacteria 514
16 JGI25406J46586_10002391 3300003203 Bacteria 8870
17 Ga0007429J51699_1047141 3300003579 Bacteria 550
18 JGI25404J52841_10011303 3300003659 Bacteria 1923
19 Ga0070658_10001334 3300005327 Bacteria 21041
20 Ga0070658_10464077 3300005327 Bacteria 1092
21 Ga0070676_10085328 3300005328 Bacteria 1924
22 Ga0070683_100177406 3300005329 Bacteria 2022
23 Ga0070683_100204454 3300005329 Bacteria 1876
24 Ga0070690_100109719 3300005330 Bacteria 1840
25 Ga0070690_100413224 3300005330 Bacteria 993
26 Ga0068869_100290372 3300005334 Bacteria 1317
27 Ga0070666_10018299 3300005335 Bacteria 4502
28 Ga0070666_10178697 3300005335 Bacteria 1488
29 Ga0070680_100246607 3300005336 Bacteria 1510
30 Ga0070682_100058203 3300005337 Bacteria 2437
31 Ga0070682_100272843 3300005337 Bacteria 1229
32 Ga0070682_100484551 3300005337 Bacteria 955
33 Ga0068868_100202855 3300005338 Bacteria 1654
34 Ga0070660_100446377 3300005339 Bacteria 1073
35 Ga0070689_100393802 3300005340 Bacteria 1170
36 Ga0070691_10010169 3300005341 Bacteria 4288
37 Ga0070691_10145861 3300005341 Bacteria 1210
38 Ga0070687_100002082 3300005343 Bacteria 7368
39 Ga0070661_100006268 3300005344 Bacteria 8206
40 Ga0070661_100466744 3300005344 Bacteria 1006
41 Ga0070692_10009092 3300005345 Bacteria 4464
42 Ga0070692_10043539 3300005345 Bacteria 2309
43 Ga0070692_10154244 3300005345 Bacteria 1311
44 Ga0070668_100081589 3300005347 Bacteria 2535
45 Ga0070668_100097032 3300005347 Bacteria 2331
46 Ga0070668_100279476 3300005347 Bacteria 1394
47 Ga0070668_101367960 3300005347 Bacteria 645
48 Ga0070669_100098984 3300005353 Bacteria 2197
49 Ga0070669_100309009 3300005353 Bacteria 1274
50 Ga0070669_101185950 3300005353 Bacteria 659
51 Ga0070675_100021579 3300005354 Bacteria 5146
52 Ga0070675_100025886 3300005354 Bacteria 4705
53 Ga0070671_100130792 3300005355 Bacteria 2114
54 Ga0070674_100071023 3300005356 Bacteria 2461
55 Ga0070674_100130095 3300005356 Bacteria 1875
56 Ga0070674_100150958 3300005356 Bacteria 1753
57 Ga0070673_100049541 3300005364 Bacteria 3280
58 Ga0070673_100773630 3300005364 Bacteria 885
59 Ga0070673_100857848 3300005364 Bacteria 840
60 Ga0070659_100026681 3300005366 Bacteria 4446
61 Ga0070659_100081814 3300005366 Bacteria 2579
62 Ga0070659_100617344 3300005366 Bacteria 933
63 Ga0070667_100176437 3300005367 Bacteria 1889
64 Ga0070667_100840872 3300005367 Bacteria 853
65 Ga0070703_10013561 3300005406 Bacteria 2316
66 Ga0070709_10069886 3300005434 Bacteria 2262
67 Ga0070709_10136634 3300005434 Bacteria 1680
68 Ga0070709_10384348 3300005434 Bacteria 1044
69 Ga0070709_10610528 3300005434 Bacteria 841
70 Ga0070709_10625097 3300005434 Bacteria 831
71 Ga0070714_100001005 3300005435 Bacteria 20110
72 Ga0070714_100010667 3300005435 Bacteria 7270
73 Ga0070714_100029966 3300005435 Bacteria 4527
74 Ga0070714_100108336 3300005435 Bacteria 2456
75 Ga0070714_100148840 3300005435 Bacteria 2107
76 Ga0070714_100283197 3300005435 Bacteria 1541
77 Ga0070714_100357625 3300005435 Bacteria 1372
78 Ga0070714_101209753 3300005435 Bacteria 737
79 Ga0070714_101548794 3300005435 Bacteria 647
80 Ga0070713_100000980 3300005436 Bacteria 18279
81 Ga0070713_100016714 3300005436 Bacteria 5524
82 Ga0070713_100031859 3300005436 Bacteria 4204
83 Ga0070713_100081557 3300005436 Bacteria 2760
84 Ga0070713_100151629 3300005436 Bacteria 2062
85 Ga0070713_100159598 3300005436 Bacteria 2012
86 Ga0070713_100238177 3300005436 Bacteria 1656
87 Ga0070713_100410352 3300005436 Bacteria 1266
88 Ga0070713_100899245 3300005436 Bacteria 851
89 Ga0070713_101080159 3300005436 Bacteria 775
90 Ga0070710_10000603 3300005437 Bacteria 17140
91 Ga0070710_10029778 3300005437 Bacteria 2931
92 Ga0070710_10070485 3300005437 Bacteria 2013
93 Ga0070710_10190414 3300005437 Bacteria 1290
94 Ga0070710_10321441 3300005437 Bacteria 1016
95 Ga0070710_10427196 3300005437 Bacteria 893
96 Ga0070701_10011409 3300005438 Bacteria 3971
97 Ga0070701_10163401 3300005438 Bacteria 1291
98 Ga0070711_100019460 3300005439 Bacteria 4356
99 Ga0070711_100025744 3300005439 Bacteria 3851
100 Ga0070711_100032188 3300005439 Bacteria 3485
101 Ga0070711_100081106 3300005439 Bacteria 2311
102 Ga0070711_100314026 3300005439 Bacteria 1250
103 Ga0070711_100316936 3300005439 Bacteria 1245
104 Ga0070711_100402370 3300005439 Bacteria 1111
105 Ga0070700_100023955 3300005441 Bacteria 3577
106 Ga0070700_100516188 3300005441 Bacteria 922
107 Ga0070694_100552815 3300005444 Bacteria 922
108 Ga0070708_100000689 3300005445 Bacteria 25705
109 Ga0070708_100153080 3300005445 Bacteria 2146
110 Ga0070708_100165877 3300005445 Bacteria 2060
111 Ga0070663_100365905 3300005455 Bacteria 1171
112 Ga0070678_100031596 3300005456 Bacteria 3655
113 Ga0070681_10535103 3300005458 Bacteria 1085
114 Ga0068867_100021638 3300005459 Bacteria 4590
115 Ga0068867_100142992 3300005459 Bacteria 1872
116 Ga0068867_100246913 3300005459 Bacteria 1450
117 Ga0070685_10005567 3300005466 Bacteria 6390
118 Ga0070685_10061040 3300005466 Bacteria 2206
119 Ga0070706_100043596 3300005467 Bacteria 4146
120 Ga0070706_100062230 3300005467 Bacteria 3448
121 Ga0070706_100176904 3300005467 Bacteria 1992
122 Ga0070706_100656209 3300005467 Bacteria 974
123 Ga0070706_100909176 3300005467 Bacteria 813
124 Ga0070706_101256552 3300005467 Bacteria 680
125 Ga0070707_100068631 3300005468 Bacteria 3413
126 Ga0070707_100071847 3300005468 Bacteria 3334
127 Ga0070707_100225567 3300005468 Bacteria 1824
128 Ga0070707_100701923 3300005468 Bacteria 974
129 Ga0070707_100853199 3300005468 Bacteria 875
130 Ga0070698_100008291 3300005471 Bacteria 11233
131 Ga0070698_100127386 3300005471 Bacteria 2503
132 Ga0070698_100299881 3300005471 Bacteria 1538
133 Ga0070698_100566646 3300005471 Bacteria 1075
134 Ga0070698_101099057 3300005471 Bacteria 744
135 Ga0070699_100000598 3300005518 Bacteria 33972
136 Ga0070699_100616569 3300005518 Bacteria 990
137 Ga0070699_101126584 3300005518 Bacteria 720
138 Ga0070679_100192520 3300005530 Bacteria 2008
139 Ga0070679_100241362 3300005530 Bacteria 1764
140 Ga0070679_101220756 3300005530 Bacteria 697
141 Ga0070684_100176846 3300005535 Bacteria 1939
142 Ga0070684_101203255 3300005535 Bacteria 713
143 Ga0070697_100020176 3300005536 Bacteria 5269
144 Ga0070697_100048802 3300005536 Bacteria 3433
145 Ga0068853_100059745 3300005539 Bacteria 3294
146 Ga0068853_100545927 3300005539 Bacteria 1097
147 Ga0070672_100017922 3300005543 Bacteria 5107
148 Ga0070672_100155987 3300005543 Bacteria 1891
149 Ga0070686_100133122 3300005544 Bacteria 1722
150 Ga0070686_100283100 3300005544 Bacteria 1223
151 Ga0070686_101119967 3300005544 Bacteria 651
152 Ga0070695_100081322 3300005545 Bacteria 2143
153 Ga0070665_100232955 3300005548 Bacteria 1842
154 Ga0070665_100464189 3300005548 Bacteria 1276
155 Ga0070665_100580474 3300005548 Bacteria 1134
156 Ga0070704_100131820 3300005549 Bacteria 1938
157 Ga0070704_100581480 3300005549 Bacteria 982
158 Ga0068855_100376944 3300005563 Bacteria 1558
159 Ga0068855_100772716 3300005563 Bacteria 1023
160 Ga0068855_101929810 3300005563 Bacteria 598
161 Ga0070664_100052167 3300005564 Bacteria 3463
162 Ga0070664_100419259 3300005564 Bacteria 1226
163 Ga0070664_100760209 3300005564 Bacteria 905
164 Ga0068857_100260488 3300005577 Bacteria 1591
165 Ga0068857_100448452 3300005577 Bacteria 1206
166 Ga0068854_100229499 3300005578 Bacteria 1473
167 Ga0068854_100764063 3300005578 Bacteria 839
168 Ga0068856_100052348 3300005614 Bacteria 4025
169 Ga0068856_102094204 3300005614 Bacteria 575
170 Ga0070702_100018849 3300005615 Bacteria 3587
171 Ga0070702_100042485 3300005615 Bacteria 2556
172 Ga0068852_100023223 3300005616 Bacteria 4988
173 Ga0068852_100180961 3300005616 Bacteria 1982
174 Ga0068852_100305460 3300005616 Bacteria 1541
175 Ga0068852_100764183 3300005616 Bacteria 979
176 Ga0068852_101453038 3300005616 Bacteria 708
177 Ga0068864_100036842 3300005618 Bacteria 4171
178 Ga0068864_100453331 3300005618 Bacteria 1227
179 Ga0068864_101864698 3300005618 Bacteria 607
180 Ga0068866_10131775 3300005718 Bacteria 1423
181 Ga0068861_100016968 3300005719 Bacteria 5163
182 Ga0068861_100058479 3300005719 Bacteria 2948
183 Ga0068861_100544226 3300005719 Bacteria 1057
184 Ga0068861_101296068 3300005719 Bacteria 708
185 Ga0068851_10115374 3300005834 Bacteria 1438
186 Ga0068870_10006468 3300005840 Bacteria 5168
187 Ga0068870_10146217 3300005840 Bacteria 1388
188 Ga0068863_100802788 3300005841 Bacteria 939
189 Ga0068863_100909255 3300005841 Bacteria 881
190 Ga0068858_100333310 3300005842 Bacteria 1451
191 Ga0068858_100477516 3300005842 Bacteria 1203
192 Ga0068858_100719564 3300005842 Bacteria 972
193 Ga0068858_101927015 3300005842 Bacteria 584
194 Ga0068860_100118000 3300005843 Bacteria 2539
195 Ga0068860_101861056 3300005843 Bacteria 623
196 Ga0081455_10001042 3300005937 Bacteria 34961
197 Ga0081540_1000155 3300005983 Bacteria 70266
198 Ga0081539_10000182 3300005985 Bacteria 148133
199 Ga0081539_10015694 3300005985 Bacteria 5483
200 Ga0081539_10048728 3300005985 Bacteria 2408
201 Ga0081539_10078950 3300005985 Bacteria 1736
202 Ga0070717_10014112 3300006028 Bacteria 6140
203 Ga0070717_10023465 3300006028 Bacteria 4888
204 Ga0070717_10025511 3300006028 Bacteria 4702
205 Ga0070717_10113142 3300006028 Bacteria 2317
206 Ga0070717_10173693 3300006028 Bacteria 1875
207 Ga0070717_10196325 3300006028 Bacteria 1765
208 Ga0070717_10235643 3300006028 Bacteria 1612
209 Ga0070717_10396267 3300006028 Bacteria 1240
210 Ga0070717_10457716 3300006028 Bacteria 1150
211 Ga0070717_10634596 3300006028 Bacteria 969
212 Ga0070717_10775984 3300006028 Bacteria 871
213 Ga0070717_10861528 3300006028 Bacteria 825
214 Ga0070717_10928106 3300006028 Bacteria 792
215 Ga0075365_10935736 3300006038 Bacteria 611
216 Ga0075364_10279144 3300006051 Bacteria 1136
217 Ga0075432_10137706 3300006058 Bacteria 929
218 Ga0070715_10244523 3300006163 Bacteria 935
219 Ga0070715_10299384 3300006163 Bacteria 860
220 Ga0070715_10299591 3300006163 Bacteria 860
221 Ga0070715_10523725 3300006163 Bacteria 682
222 Ga0070715_10608017 3300006163 Bacteria 642
223 Ga0070716_100000609 3300006173 Bacteria 15132
224 Ga0070716_100025893 3300006173 Bacteria 3136
225 Ga0070716_100392330 3300006173 Bacteria 996
226 Ga0070716_100501181 3300006173 Bacteria 896
227 Ga0070712_100013755 3300006175 Bacteria 5177
228 Ga0070712_100082193 3300006175 Bacteria 2336
229 Ga0070712_100133654 3300006175 Bacteria 1883
230 Ga0070712_100221006 3300006175 Bacteria 1500
231 Ga0070712_100224884 3300006175 Bacteria 1487
232 Ga0070712_100375282 3300006175 Bacteria 1169
233 Ga0070712_100406524 3300006175 Bacteria 1125
234 Ga0070712_100518902 3300006175 Bacteria 1000
235 Ga0070712_100713948 3300006175 Bacteria 855
236 Ga0070712_100714242 3300006175 Bacteria 855
237 Ga0075367_10378267 3300006178 Bacteria 895
238 Ga0097621_100080443 3300006237 Bacteria 2710
239 Ga0075370_10400925 3300006353 Bacteria 823
240 Ga0075428_100370093 3300006844 Bacteria 1537
241 Ga0075428_100505329 3300006844 Bacteria 1293
242 Ga0075428_100523460 3300006844 Bacteria 1268
243 Ga0075430_100403872 3300006846 Bacteria 1128
244 Ga0075433_10150008 3300006852 Bacteria 2074
245 Ga0075434_101178146 3300006871 Bacteria 778
246 Ga0075434_102212997 3300006871 Bacteria 553
247 Ga0068865_100048531 3300006881 Bacteria 2922
248 Ga0068865_100099173 3300006881 Bacteria 2129
249 Ga0075436_100398779 3300006914 Bacteria 997
250 Ga0075436_100410951 3300006914 Bacteria 981
251 Ga0075435_100514271 3300007076 Bacteria 1035
252 Ga0075435_101313102 3300007076 Bacteria 634
253 Ga0099795_10171914 3300007788 Bacteria 900
254 Ga0105240_10168832 3300009093 Bacteria 2593
255 Ga0105240_10494076 3300009093 Bacteria 1362
256 Ga0111539_11143479 3300009094 Bacteria 905
257 Ga0105245_10044818 3300009098 Bacteria 3948
258 Ga0105245_10184743 3300009098 Bacteria 1994
259 Ga0105245_10909394 3300009098 Bacteria 922
260 Ga0105247_10260883 3300009101 Bacteria 1188
261 Ga0105247_11138636 3300009101 Bacteria 618
262 Ga0105243_10008770 3300009148 Bacteria 7744
263 Ga0105243_10213376 3300009148 Bacteria 1701
264 Ga0105242_10084985 3300009176 Bacteria 2653
265 Ga0105242_10311109 3300009176 Bacteria 1441
266 Ga0105248_10026802 3300009177 Bacteria 6410
267 Ga0105248_11563572 3300009177 Bacteria 747
268 Ga0105248_12275657 3300009177 Bacteria 617
269 Ga0105237_11389034 3300009545 Bacteria 708
270 Ga0105238_10536529 3300009551 Bacteria 1173
271 Ga0105238_11115682 3300009551 Bacteria 812
272 Ga0105249_10020433 3300009553 Bacteria 5919
273 Ga0105249_13110612 3300009553 Bacteria 533
274 Ga0105239_10038166 3300010375 Bacteria 5264
275 Ga0105239_10206724 3300010375 Bacteria 2200
276 Ga0105239_10979084 3300010375 Bacteria 972
277 Ga0105246_10186261 3300011119 Bacteria 1603
278 Ga0157346_1006344 3300012480 Bacteria 759
279 Ga0157341_1014422 3300012494 Bacteria 717
280 Ga0157345_1006121 3300012498 Bacteria 949
281 Ga0157339_1002908 3300012505 Bacteria 1195
282 Ga0157342_1025667 3300012507 Bacteria 713
283 Ga0157338_1009154 3300012515 Bacteria 975
284 Ga0157371_10270031 3300013102 Bacteria 1227
285 Ga0157370_10195802 3300013104 Bacteria 1876
286 Ga0157370_10206041 3300013104 Bacteria 1823
287 Ga0157369_10005983 3300013105 Bacteria 14130
288 Ga0157369_10287479 3300013105 Bacteria 1712
289 Ga0157369_10384656 3300013105 Bacteria 1456
290 Ga0157369_10476015 3300013105 Bacteria 1292
291 Ga0157369_10740358 3300013105 Bacteria 1012
292 Ga0157369_10740414 3300013105 Bacteria 1012
293 Ga0157374_10090784 3300013296 Bacteria 2912
294 Ga0157374_10606988 3300013296 Bacteria 1104
295 Ga0157374_10670058 3300013296 Bacteria 1050
296 Ga0157374_10719302 3300013296 Bacteria 1012
297 Ga0157374_10747764 3300013296 Bacteria 992
298 Ga0157378_10177599 3300013297 Bacteria 2001
299 Ga0157378_12290282 3300013297 Bacteria 592
300 Ga0163162_10151792 3300013306 Bacteria 2435
301 Ga0163162_10163961 3300013306 Bacteria 2346
302 Ga0157372_10024275 3300013307 Bacteria 6583
303 Ga0157372_10346614 3300013307 Bacteria 1730
304 Ga0157372_10624214 3300013307 Bacteria 1256
305 Ga0157372_10899177 3300013307 Bacteria 1027
306 Ga0157372_12202267 3300013307 Bacteria 633
307 Ga0157375_10027776 3300013308 Bacteria 5294
308 Ga0157375_11047718 3300013308 Bacteria 953
309 Ga0157375_11581704 3300013308 Bacteria 775
310 Ga0157375_12461602 3300013308 Bacteria 621
311 Ga0163163_10051454 3300014325 Bacteria 4062
312 Ga0163163_10279240 3300014325 Bacteria 1722
313 Ga0163163_12199884 3300014325 Bacteria 611
314 Ga0157380_10071193 3300014326 Bacteria 2812
315 Ga0157380_10244361 3300014326 Bacteria 1620
316 Ga0157380_10365665 3300014326 Bacteria 1355
317 Ga0157380_11435823 3300014326 Bacteria 741
318 Ga0182008_10206569 3300014497 Bacteria 1001
319 Ga0182008_10491442 3300014497 Bacteria 673
320 Ga0157377_10006429 3300014745 Bacteria 5607
321 Ga0157377_10102607 3300014745 Bacteria 1707
322 Ga0157377_10370711 3300014745 Bacteria 966
323 Ga0157379_10139721 3300014968 Bacteria 2183
324 Ga0157379_10163456 3300014968 Bacteria 2009
325 Ga0197907_10508658 3300020069 Bacteria 4002
326 Ga0197907_10622865 3300020069 Bacteria 1776
327 Ga0197907_11109172 3300020069 Bacteria 506
328 Ga0206356_11565027 3300020070 Bacteria 709
329 Ga0206356_11660410 3300020070 Bacteria 1763
330 Ga0206356_11707227 3300020070 Bacteria 517
331 Ga0206349_1207593 3300020075 Bacteria 524
332 Ga0206349_1275547 3300020075 Bacteria 502
333 Ga0206355_1328187 3300020076 Bacteria 3694
334 Ga0206351_10280240 3300020077 Bacteria 1334
335 Ga0206350_10940578 3300020080 Bacteria 1157
336 Ga0206354_10091345 3300020081 Unclassified 599
337 Ga0206354_11716454 3300020081 Bacteria 2858
338 Ga0206353_10052697 3300020082 Bacteria 1878
339 Ga0206353_11007125 3300020082 Bacteria 739
340 Ga0206353_11153682 3300020082 Bacteria 966
341 Ga0206353_11908304 3300020082 Bacteria 4604
342 Ga0213876_10488631 3300021384 Bacteria 655
343 Ga0213875_10001023 3300021388 Bacteria 19832
344 Ga0213875_10061756 3300021388 Bacteria 1753
345 Ga0224712_10218296 3300022467 Bacteria 872
346 Ga0224712_10267560 3300022467 Bacteria 793
347 Ga0224712_10553542 3300022467 Bacteria 559
348 Ga0224712_10689319 3300022467 Bacteria 502
349 Ga0207656_10497837 3300025321 Bacteria 618
350 Ga0207653_10006126 3300025885 Bacteria 3749
351 Ga0207692_10003642 3300025898 Bacteria 6034
352 Ga0207692_10030932 3300025898 Bacteria 2558
353 Ga0207692_10185365 3300025898 Bacteria 1215
354 Ga0207692_10393963 3300025898 Bacteria 862
355 Ga0207642_10073959 3300025899 Bacteria 1631
356 Ga0207710_10598489 3300025900 Bacteria 576
357 Ga0207688_10313444 3300025901 Bacteria 961
358 Ga0207680_10068305 3300025903 Bacteria 2192
359 Ga0207647_10316269 3300025904 Bacteria 887
360 Ga0207647_10526590 3300025904 Bacteria 657
361 Ga0207685_10265100 3300025905 Bacteria 837
362 Ga0207685_10392355 3300025905 Bacteria 710
363 Ga0207699_10005541 3300025906 Bacteria 6055
364 Ga0207699_10010766 3300025906 Bacteria 4601
365 Ga0207699_10015437 3300025906 Bacteria 3967
366 Ga0207699_10018303 3300025906 Bacteria 3709
367 Ga0207699_10136664 3300025906 Bacteria 1606
368 Ga0207699_10291591 3300025906 Bacteria 1137
369 Ga0207699_10463688 3300025906 Bacteria 910
370 Ga0207645_10134402 3300025907 Bacteria 1611
371 Ga0207643_10007384 3300025908 Bacteria 5897
372 Ga0207643_10050196 3300025908 Bacteria 2365
373 Ga0207705_10000348 3300025909 Bacteria 41776
374 Ga0207705_10394779 3300025909 Bacteria 1069
375 Ga0207705_11406801 3300025909 Bacteria 530
376 Ga0207684_10028586 3300025910 Bacteria 4750
377 Ga0207684_10033261 3300025910 Bacteria 4384
378 Ga0207684_10100342 3300025910 Bacteria 2474
379 Ga0207684_10217379 3300025910 Bacteria 1649
380 Ga0207707_10355858 3300025912 Bacteria 1261
381 Ga0207671_11086843 3300025914 Bacteria 629
382 Ga0207693_10020749 3300025915 Bacteria 5225
383 Ga0207693_10026732 3300025915 Bacteria 4566
384 Ga0207693_10063429 3300025915 Bacteria 2894
385 Ga0207693_10126083 3300025915 Bacteria 2012
386 Ga0207693_10473256 3300025915 Bacteria 978
387 Ga0207693_10620939 3300025915 Bacteria 841
388 Ga0207663_10022954 3300025916 Bacteria 3573
389 Ga0207663_10129192 3300025916 Bacteria 1743
390 Ga0207663_10190431 3300025916 Bacteria 1472
391 Ga0207663_10235018 3300025916 Bacteria 1341
392 Ga0207663_10289353 3300025916 Bacteria 1220
393 Ga0207663_10600969 3300025916 Bacteria 864
394 Ga0207660_10200988 3300025917 Bacteria 1557
395 Ga0207660_10501004 3300025917 Bacteria 985
396 Ga0207662_10020778 3300025918 Bacteria 3747
397 Ga0207662_10042221 3300025918 Bacteria 2688
398 Ga0207662_10055325 3300025918 Bacteria 2368
399 Ga0207649_10046176 3300025920 Bacteria 2674
400 Ga0207649_10835734 3300025920 Bacteria 720
401 Ga0207652_10101526 3300025921 Bacteria 2541
402 Ga0207652_10290539 3300025921 Bacteria 1475
403 Ga0207646_10000455 3300025922 Bacteria 54634
404 Ga0207646_10047539 3300025922 Bacteria 3849
405 Ga0207646_10060714 3300025922 Bacteria 3375
406 Ga0207646_10072140 3300025922 Bacteria 3084
407 Ga0207646_11222156 3300025922 Bacteria 658
408 Ga0207646_11264748 3300025922 Bacteria 645
409 Ga0207646_11273317 3300025922 Bacteria 643
410 Ga0207681_10162550 3300025923 Bacteria 1685
411 Ga0207681_10211856 3300025923 Bacteria 1494
412 Ga0207694_10198116 3300025924 Bacteria 1633
413 Ga0207694_10688840 3300025924 Bacteria 862
414 Ga0207694_11502000 3300025924 Bacteria 569
415 Ga0207659_10048286 3300025926 Bacteria 3015
416 Ga0207687_10090470 3300025927 Bacteria 2230
417 Ga0207687_10203536 3300025927 Bacteria 1549
418 Ga0207687_10301569 3300025927 Bacteria 1291
419 Ga0207687_10752475 3300025927 Bacteria 829
420 Ga0207687_11427047 3300025927 Bacteria 595
421 Ga0207700_10003128 3300025928 Bacteria 9556
422 Ga0207700_10032514 3300025928 Bacteria 3722
423 Ga0207700_10041231 3300025928 Bacteria 3376
424 Ga0207700_10095506 3300025928 Bacteria 2358
425 Ga0207700_10127550 3300025928 Bacteria 2072
426 Ga0207700_10141530 3300025928 Bacteria 1977
427 Ga0207700_10459867 3300025928 Bacteria 1123
428 Ga0207700_10919010 3300025928 Bacteria 783
429 Ga0207700_10968530 3300025928 Bacteria 761
430 Ga0207700_11014012 3300025928 Bacteria 743
431 Ga0207664_10000750 3300025929 Bacteria 22079
432 Ga0207664_10008250 3300025929 Bacteria 7254
433 Ga0207664_10011323 3300025929 Bacteria 6330
434 Ga0207664_10025821 3300025929 Bacteria 4432
435 Ga0207664_10091634 3300025929 Bacteria 2493
436 Ga0207664_10107229 3300025929 Bacteria 2317
437 Ga0207664_10146802 3300025929 Bacteria 2001
438 Ga0207664_10219706 3300025929 Bacteria 1647
439 Ga0207664_10352815 3300025929 Bacteria 1302
440 Ga0207664_10427580 3300025929 Bacteria 1180
441 Ga0207664_10666644 3300025929 Bacteria 935
442 Ga0207644_10385746 3300025931 Bacteria 1143
443 Ga0207644_10480077 3300025931 Bacteria 1024
444 Ga0207644_10518686 3300025931 Bacteria 984
445 Ga0207690_10035623 3300025932 Bacteria 3217
446 Ga0207690_10376563 3300025932 Bacteria 1127
447 Ga0207690_10701253 3300025932 Bacteria 832
448 Ga0207706_10109079 3300025933 Bacteria 2436
449 Ga0207686_10230814 3300025934 Bacteria 1342
450 Ga0207709_10017782 3300025935 Bacteria 3973
451 Ga0207709_10097539 3300025935 Bacteria 1936
452 Ga0207709_10556548 3300025935 Bacteria 903
453 Ga0207670_10078997 3300025936 Bacteria 2296
454 Ga0207670_10401797 3300025936 Bacteria 1095
455 Ga0207669_10036897 3300025937 Bacteria 2798
456 Ga0207669_10042551 3300025937 Bacteria 2653
457 Ga0207669_10070384 3300025937 Bacteria 2193
458 Ga0207704_10100709 3300025938 Bacteria 1925
459 Ga0207665_10000630 3300025939 Bacteria 23660
460 Ga0207665_10029520 3300025939 Bacteria 3624
461 Ga0207665_10154284 3300025939 Bacteria 1647
462 Ga0207665_11158101 3300025939 Bacteria 617
463 Ga0207691_10001822 3300025940 Bacteria 20843
464 Ga0207691_10076277 3300025940 Bacteria 3021
465 Ga0207711_10546925 3300025941 Bacteria 1080
466 Ga0207689_10006073 3300025942 Bacteria 10682
467 Ga0207661_10129498 3300025944 Bacteria 2159
468 Ga0207661_10164855 3300025944 Bacteria 1925
469 Ga0207661_10183917 3300025944 Bacteria 1828
470 Ga0207661_10737401 3300025944 Bacteria 906
471 Ga0207679_11329400 3300025945 Bacteria 659
472 Ga0207679_11560748 3300025945 Bacteria 605
473 Ga0207667_10149859 3300025949 Bacteria 2401
474 Ga0207712_10142042 3300025961 Bacteria 1844
475 Ga0207668_10147559 3300025972 Bacteria 1817
476 Ga0207668_10208508 3300025972 Bacteria 1561
477 Ga0207668_10427646 3300025972 Bacteria 1125
478 Ga0207640_10048321 3300025981 Bacteria 2749
479 Ga0207658_10022818 3300025986 Bacteria 4360
480 Ga0207677_10224393 3300026023 Bacteria 1509
481 Ga0207677_10910673 3300026023 Bacteria 793
482 Ga0207677_11191571 3300026023 Bacteria 697
483 Ga0207703_10241442 3300026035 Bacteria 1624
484 Ga0207703_11125464 3300026035 Bacteria 754
485 Ga0207639_10173103 3300026041 Bacteria 1830
486 Ga0207639_10550514 3300026041 Bacteria 1059
487 Ga0207678_10012292 3300026067 Bacteria 7517
488 Ga0207678_10070567 3300026067 Bacteria 2995
489 Ga0207678_10376098 3300026067 Bacteria 1228
490 Ga0207708_10000897 3300026075 Bacteria 22343
491 Ga0207708_10012149 3300026075 Bacteria 6421
492 Ga0207708_10426919 3300026075 Bacteria 1100
493 Ga0207702_10083312 3300026078 Bacteria 2782
494 Ga0207702_10173515 3300026078 Bacteria 1979
495 Ga0207702_10835202 3300026078 Bacteria 911
496 Ga0207702_11432338 3300026078 Bacteria 685
497 Ga0207641_10155375 3300026088 Bacteria 2075
498 Ga0207641_10912701 3300026088 Bacteria 872
499 Ga0207641_11237625 3300026088 Bacteria 746
500 Ga0207648_10001889 3300026089 Bacteria 22892
501 Ga0207648_10075562 3300026089 Bacteria 2937
502 Ga0207676_10036206 3300026095 Bacteria 3753
503 Ga0207676_10157805 3300026095 Bacteria 1962
504 Ga0207676_10707540 3300026095 Bacteria 976
505 Ga0207676_11345777 3300026095 Bacteria 709
506 Ga0207674_10003194 3300026116 Bacteria 20180
507 Ga0207674_10098142 3300026116 Bacteria 2913
508 Ga0207674_10684699 3300026116 Bacteria 990
509 Ga0207675_100009052 3300026118 Bacteria 9345
510 Ga0207675_100010850 3300026118 Bacteria 8535
511 Ga0207675_100025134 3300026118 Bacteria 5542
512 Ga0207675_101113697 3300026118 Bacteria 809
513 Ga0207683_10003299 3300026121 Bacteria 14067
514 Ga0207683_10101369 3300026121 Bacteria 2570
515 Ga0207698_10091294 3300026142 Bacteria 2493
516 Ga0207698_10125713 3300026142 Bacteria 2180
517 Ga0207698_10180545 3300026142 Bacteria 1869
518 Ga0207698_10193095 3300026142 Bacteria 1816
519 Ga0207698_10611778 3300026142 Bacteria 1075
520 Ga0207698_11374801 3300026142 Bacteria 721
521 Ga0207428_10087100 3300027907 Bacteria 2430
522 Ga0268266_10070591 3300028379 Bacteria 3026
523 Ga0268266_10101036 3300028379 Bacteria 2542
524 Ga0268266_10299978 3300028379 Bacteria 1498
525 Ga0268266_11365424 3300028379 Bacteria 684
526 Ga0268265_10128290 3300028380 Bacteria 2103
527 Ga0268265_10452277 3300028380 Bacteria 1200
528 Ga0268264_11676015 3300028381 Bacteria 646
529 Ga0268264_11686365 3300028381 Bacteria 644
530 Ga0265340_10026184 3300031247 Bacteria 2949
531 Ga0307513_10000509 3300031456 Bacteria 56039
532 Ga0307513_10004140 3300031456 Bacteria 19423
533 Ga0307408_101110897 3300031548 Bacteria 734
534 Ga0307508_10318598 3300031616 Bacteria 1147
535 Ga0307405_10278048 3300031731 Bacteria 1259
536 Ga0307405_10437318 3300031731 Bacteria 1034
537 Ga0307405_11009927 3300031731 Bacteria 710
538 Ga0307405_11445021 3300031731 Bacteria 603
539 Ga0307518_10018934 3300031838 Bacteria 4943
540 Ga0307410_10083351 3300031852 Bacteria 2251
541 Ga0307406_10367514 3300031901 Bacteria 1130
542 Ga0307407_10561997 3300031903 Bacteria 845
543 Ga0307409_100217341 3300031995 Bacteria 1723
544 Ga0307409_100298104 3300031995 Bacteria 1498
545 Ga0307409_100547679 3300031995 Bacteria 1135
546 Ga0307409_100942870 3300031995 Bacteria 879
547 Ga0307409_100974573 3300031995 Bacteria 865
548 Ga0307416_100662092 3300032002 Bacteria 1130
549 Ga0307416_101254651 3300032002 Bacteria 847
550 Ga0307416_101602618 3300032002 Bacteria 756
551 Ga0307414_11310602 3300032004 Bacteria 672
552 Ga0307411_10874916 3300032005 Bacteria 797
553 Ga0307415_100599783 3300032126 Bacteria 980
554 Ga0307415_101669454 3300032126 Bacteria 614
555 Ga0373926_0003088 3300035083 Bacteria 5346
556 Ga0373926_0018529 3300035083 Bacteria 2395
557 Ga0373928_0040255 3300035084 Bacteria 1071
558 Ga0373929_0048758 3300035085 Bacteria 963
559 Ga0373934_0011984 3300035086 Bacteria 3270
560 Ga0373934_0111726 3300035086 Bacteria 1108
561 Ga0373944_0001169 3300035089 Bacteria 6549
562 Ga0373944_0039146 3300035089 Bacteria 1459
563 Ga0373944_0057873 3300035089 Bacteria 1236
564 Ga0373952_0059096 3300035092 Bacteria 933
565 Ga0373923_0008579 3300035111 Bacteria 3653
566 Ga0373923_0009259 3300035111 Bacteria 3549
567 Ga0373923_0094860 3300035111 Bacteria 1309
568 Ga0373923_0389044 3300035111 Bacteria 670
569 Ga0373923_0584409 3300035111 Bacteria 549
570 Ga0373932_0314182 3300035112 Bacteria 588
571 Ga0373936_0000677 3300035113 Bacteria 11853
572 Ga0373936_0003020 3300035113 Bacteria 6288
573 Ga0373936_0039068 3300035113 Bacteria 1898
574 Ga0373936_0164175 3300035113 Bacteria 969
575 Ga0373936_0185196 3300035113 Bacteria 914
576 Ga0373941_0010718 3300035115 Bacteria 2350
577 Ga0373945_0000575 3300035116 Bacteria 10515
578 Ga0373945_0004809 3300035116 Bacteria 4301
579 Ga0373945_0359806 3300035116 Bacteria 632
580 Ga0373953_0053563 3300035117 Bacteria 1635
581 Ga0373953_0175439 3300035117 Bacteria 923
582 Ga0373953_0191267 3300035117 Bacteria 884
583 Ga0373954_0052602 3300035118 Bacteria 1914
584 Ga0373954_0177958 3300035118 Bacteria 1043
585 Ga0373954_0232887 3300035118 Bacteria 906
586 Ga0373954_0302834 3300035118 Bacteria 788
587 Ga0373956_0089161 3300035119 Bacteria 1421
588 Ga0373956_0149317 3300035119 Bacteria 1099
589 Ga0373957_0016530 3300035120 Bacteria 2554
590 Ga0373957_0085801 3300035120 Bacteria 1246
591 Ga0373960_0201097 3300035121 Bacteria 704
592 Ga0373943_0000379 3300035170 Bacteria 18695
593 Ga0373943_0045289 3300035170 Bacteria 2143
594 Ga0373943_0166765 3300035170 Bacteria 1202
595 Ga0373946_0000071 3300035171 Bacteria 27082
596 Ga0373946_0281200 3300035171 Bacteria 818
597 Ga0373955_0029111 3300035172 Bacteria 2869
598 Ga0373955_0067910 3300035172 Bacteria 1985
599 Ga0373955_0097976 3300035172 Bacteria 1679
600 Ga0373942_0007491 3300035207 Bacteria 2532
601 Ga0373924_0006965 3300035410 Bacteria 4068
602 Ga0373924_0018685 3300035410 Bacteria 2675
603 Ga0373924_0058735 3300035410 Bacteria 1605
604 Ga0373924_0120167 3300035410 Bacteria 1139
605 Ga0373931_0276252 3300035691 Bacteria 1030
606 Ga0373931_0458854 3300035691 Bacteria 816
607 Ga0373935_0007539 3300035692 Bacteria 6515
608 Ga0373935_0090545 3300035692 Bacteria 2002
609 Ga0373935_0104188 3300035692 Bacteria 1874
610 Ga0373935_0267929 3300035692 Bacteria 1199
611 Ga0373935_0302717 3300035692 Bacteria 1130
612 Ga0373935_0809744 3300035692 Bacteria 692
613 Ga0373935_0985295 3300035692 Bacteria 626
614 Ga0373927_0003532 3300035695 Bacteria 11185
615 Ga0373927_1144894 3300035695 Bacteria 513
616 Ga0373933_0041762 3300035724 Bacteria 2708
617 Ga0373933_0118650 3300035724 Bacteria 1655
618 Ga0373933_0150942 3300035724 Bacteria 1471
619 Ga0373933_0292473 3300035724 Bacteria 1054
620 Ga0373947_0004135 3300035725 Bacteria 8532
621 Ga0373947_0077962 3300035725 Bacteria 2044
622 Ga0373947_0120772 3300035725 Bacteria 1664
623 Ga0373947_0177916 3300035725 Bacteria 1383
624 Ga0373947_0447689 3300035725 Bacteria 874
625 Ga0373947_0634397 3300035725 Bacteria 728
626 Ga0373947_0657328 3300035725 Bacteria 715
627 Ga0373947_1130273 3300035725 Bacteria 534
628 Ga0373937_0017044 3300036401 Bacteria 6461
629 Ga0373937_0080932 3300036401 Bacteria 3004
630 Ga0373937_0322147 3300036401 Bacteria 1462
631 Ga0373937_0367143 3300036401 Bacteria 1364
632 Ga0373937_0411295 3300036401 Bacteria 1283
633 Ga0373937_0447516 3300036401 Bacteria 1226
634 Ga0373937_0935843 3300036401 Bacteria 815
635 Ga0373937_1226550 3300036401 Bacteria 698
636 Ga0373937_1440201 3300036401 Bacteria 636
637 Ga0373925_0003272 3300037068 Bacteria 12614
638 Ga0373925_0016415 3300037068 Bacteria 5364
639 Ga0373925_0244303 3300037068 Bacteria 1438
640 Ga0373925_0306716 3300037068 Bacteria 1282
641 Ga0373925_0423874 3300037068 Bacteria 1087
642 Ga0373925_1379853 3300037068 Bacteria 577
643 Ga0395900_0082652 3300037418 Bacteria 3300
644 Ga0395900_0370668 3300037418 Bacteria 1401
645 Ga0395898_0126350 3300037466 Bacteria 2450
646 Ga0395905_1558331 3300037471 Bacteria 565
647 Ga0436364_0066527 3300037853 Bacteria 806
648 Ga0436364_0093190 3300037853 Bacteria 2488
649 Ga0436364_0661034 3300037853 Bacteria 87629
650 Ga0436364_0750168 3300037853 Bacteria 1620
651 Ga0436364_1052723 3300037853 Bacteria 4095
652 Ga0395901_0005587 3300038443 Bacteria 12732
653 Ga0436365_0478561 3300039437 Bacteria 1211
654 Ga0436360_0719369 3300039438 Bacteria 1775
655 Ga0436361_1034955 3300039447 Bacteria 763
656 Ga0436363_0347872 3300039450 Bacteria 1221
657 Ga0436363_0387018 3300039450 Bacteria 1716
658 Ga0436363_0416526 3300039450 Bacteria 1562
659 Ga0436363_0531864 3300039450 Bacteria 652
660 Ga0436363_1356157 3300039450 Bacteria 1595
661 Ga0436362_0081924 3300039453 Bacteria 641
662 Ga0436362_1229093 3300039453 Bacteria 754
663 Ga0451789_0173773 3300041443 Bacteria 518
664 Ga0451789_0179690 3300041443 Bacteria 679
665 Ga0451789_1346882 3300041443 Bacteria 1572
666 Ga0451791_0631542 3300041451 Bacteria 886
667 Ga0451791_0830000 3300041451 Bacteria 579
668 Ga0451791_1727689 3300041451 Bacteria 1778
669 Ga0451793_0554836 3300041452 Bacteria 852
670 Ga0451793_1331298 3300041452 Bacteria 845
671 Ga0451797_1036889 3300041453 Bacteria 585
672 Ga0451802_0186256 3300041460 Bacteria 678
673 Ga0451807_2461803 3300041486 Bacteria 1155
674 Ga0451833_0950911 3300041491 Bacteria 1882
675 Ga0451837_0986391 3300041494 Bacteria 770
676 Ga0451841_0284230 3300041498 Bacteria 1842
677 Ga0451849_1443282 3300041505 Unclassified 895
678 Ga0451851_0190844 3300041507 Bacteria 931
679 Ga0451851_0920371 3300041507 Bacteria 603
680 Ga0451843_0186394 3300041509 Bacteria 947
681 Ga0451843_0610637 3300041509 Bacteria 1220
682 Ga0451855_1237994 3300041511 Bacteria 588
683 Ga0451853_3336502 3300041512 Bacteria 647
684 Ga0466969_0082340 3300044656 Bacteria 1534
685 Ga0466969_0115265 3300044656 Bacteria 1255
686 Ga0466972_0113475 3300044658 Bacteria 1280
687 Ga0466965_0095583 3300044683 Bacteria 1515
688 Ga0466965_0230525 3300044683 Bacteria 989
689 Ga0466965_0357054 3300044683 Bacteria 801
690 Ga0466965_0687028 3300044683 Bacteria 586
691 Ga0466965_0704093 3300044683 Bacteria 580
692 Ga0466966_0004582 3300044684 Bacteria 9103
693 Ga0466966_0031654 3300044684 Bacteria 3430
694 Ga0466966_0040811 3300044684 Bacteria 2985
695 Ga0466966_0161108 3300044684 Bacteria 1366
696 Ga0466966_0166643 3300044684 Bacteria 1340
697 Ga0466966_0256498 3300044684 Bacteria 1053
698 Ga0466966_0312027 3300044684 Bacteria 945
699 Ga0466961_0002635 3300044693 Bacteria 11143
700 Ga0466961_0014664 3300044693 Bacteria 5035
701 Ga0466961_0034766 3300044693 Bacteria 3235
702 Ga0466961_0088021 3300044693 Bacteria 1962
703 Ga0466961_0182537 3300044693 Bacteria 1302
704 Ga0466961_0223855 3300044693 Bacteria 1159
705 Ga0466961_0468997 3300044693 Bacteria 761
706 Ga0466961_0515465 3300044693 Bacteria 721
707 Ga0466961_0971579 3300044693 Bacteria 505
708 Ga0466963_0010924 3300044694 Bacteria 5516
709 Ga0466963_0099678 3300044694 Bacteria 1987
710 Ga0466963_0130745 3300044694 Bacteria 1734
711 Ga0466963_0268246 3300044694 Bacteria 1199
712 Ga0466963_0268445 3300044694 Bacteria 1199
713 Ga0466963_0300769 3300044694 Bacteria 1128
714 Ga0466963_0355707 3300044694 Bacteria 1031
715 Ga0466963_0391680 3300044694 Bacteria 979
716 Ga0466963_0424871 3300044694 Bacteria 937
717 Ga0466963_0466830 3300044694 Bacteria 891
718 Ga0466963_0593198 3300044694 Bacteria 782
719 Ga0466963_0601025 3300044694 Bacteria 777
720 Ga0466963_0667425 3300044694 Bacteria 734
721 Ga0466963_0953918 3300044694 Bacteria 604
722 Ga0466963_0987304 3300044694 Bacteria 593
723 Ga0466963_1047609 3300044694 Bacteria 574
724 Ga0466963_1329301 3300044694 Bacteria 504
725 Ga0466964_0166221 3300044706 Bacteria 1035
726 Ga0466964_0174688 3300044706 Bacteria 1014
727 Ga0466964_0457525 3300044706 Bacteria 678
728 Ga0466964_0510045 3300044706 Bacteria 647
729 Ga0466971_0072623 3300044719 Bacteria 1563
730 Ga0466971_0084801 3300044719 Bacteria 1447
731 Ga0466971_0090062 3300044719 Bacteria 1404
732 Ga0466971_0403250 3300044719 Bacteria 667
733 Ga0466968_0168159 3300044735 Bacteria 1015
734 Ga0466970_0020493 3300044765 Bacteria 3436
735 Ga0466970_0022917 3300044765 Bacteria 3258
736 Ga0466970_0024598 3300044765 Bacteria 3150
737 Ga0466970_0026247 3300044765 Bacteria 3053
738 Ga0466970_0157949 3300044765 Bacteria 1254
739 Ga0466970_0376147 3300044765 Bacteria 808
740 Ga0466970_0446076 3300044765 Bacteria 741
741 Ga0466970_0473526 3300044765 Bacteria 719
742 Ga0466970_0478969 3300044765 Bacteria 715
743 Ga0466970_0508907 3300044765 Bacteria 694
744 Ga0466970_0760667 3300044765 Bacteria 566
745 Ga0466957_0022629 3300044842 Bacteria 3710
746 Ga0466957_0073280 3300044842 Bacteria 2122
747 Ga0466957_0075396 3300044842 Bacteria 2093
748 Ga0466957_0119843 3300044842 Bacteria 1676
749 Ga0466957_0149285 3300044842 Bacteria 1510
750 Ga0466957_0268841 3300044842 Bacteria 1138
751 Ga0466957_0328331 3300044842 Bacteria 1033
752 Ga0466957_0518162 3300044842 Bacteria 828
753 Ga0466960_0011523 3300044901 Bacteria 3703
754 Ga0466960_0011688 3300044901 Bacteria 3683
755 Ga0466960_0066500 3300044901 Bacteria 1783
756 Ga0466960_0084184 3300044901 Bacteria 1609
757 Ga0466960_0117392 3300044901 Bacteria 1390
758 Ga0466960_0129251 3300044901 Bacteria 1331
759 Ga0466960_0193951 3300044901 Bacteria 1107
760 Ga0466960_0262719 3300044901 Bacteria 962
761 Ga0466960_0299737 3300044901 Bacteria 905
762 Ga0466960_0737375 3300044901 Bacteria 593
763 Ga0466959_0009566 3300045049 Bacteria 6896
764 Ga0466959_0057534 3300045049 Bacteria 2834
765 Ga0466959_0077706 3300045049 Bacteria 2395
766 Ga0466959_0112410 3300045049 Bacteria 1943
767 Ga0466959_0126441 3300045049 Bacteria 1814
768 Ga0466959_0319455 3300045049 Bacteria 1062
769 Ga0466959_0437251 3300045049 Bacteria 887
770 Ga0466959_0473689 3300045049 Bacteria 848
771 Ga0466958_0004678 3300045836 Bacteria 7262
772 Ga0466958_0014999 3300045836 Bacteria 4434
773 Ga0466958_0021002 3300045836 Bacteria 3812
774 Ga0466958_0027972 3300045836 Bacteria 3340
775 Ga0466958_0031381 3300045836 Bacteria 3158
776 Ga0466958_0099491 3300045836 Bacteria 1807
777 Ga0466958_0117316 3300045836 Bacteria 1664
778 Ga0466958_0179457 3300045836 Bacteria 1343
779 Ga0466958_0234118 3300045836 Bacteria 1173
780 Ga0466958_0390254 3300045836 Bacteria 898
781 Ga0466958_0414975 3300045836 Bacteria 870
782 Ga0466958_0426275 3300045836 Bacteria 858
783 Ga0466967_0003013 3300045976 Bacteria 10805
784 Ga0466967_0027192 3300045976 Bacteria 4756
785 Ga0466967_0032279 3300045976 Bacteria 4420
786 Ga0466967_0036020 3300045976 Bacteria 4220
787 Ga0466967_0056346 3300045976 Bacteria 3465
788 Ga0466967_0069355 3300045976 Bacteria 3151
789 Ga0466967_0106320 3300045976 Bacteria 2572
790 Ga0466967_0150483 3300045976 Bacteria 2175
791 Ga0466967_0169692 3300045976 Bacteria 2052
792 Ga0466967_0198562 3300045976 Bacteria 1899
793 Ga0466967_0212215 3300045976 Bacteria 1836
794 Ga0466967_0286030 3300045976 Bacteria 1583
795 Ga0466967_0456031 3300045976 Bacteria 1250
796 Ga0466967_0635184 3300045976 Bacteria 1055
797 Ga0466967_0670050 3300045976 Bacteria 1027
798 Ga0466967_1775412 3300045976 Bacteria 614
799 Ga0495592_0012147 3300046454 Bacteria 6534
800 Ga0495592_0064131 3300046454 Bacteria 2693
801 Ga0495592_0121109 3300046454 Bacteria 1840
802 Ga0495592_0157132 3300046454 Bacteria 1567
803 Ga0495592_0210064 3300046454 Bacteria 1308
804 Ga0495603_0391585 3300046455 Bacteria 796
805 Ga0495629_0007539 3300046459 Bacteria 8020
806 Ga0495629_0054132 3300046459 Bacteria 2806
807 Ga0495629_0176774 3300046459 Bacteria 1480
808 Ga0495629_0261621 3300046459 Bacteria 1189
809 Ga0495638_0039800 3300046460 Bacteria 2982
810 Ga0495641_0004087 3300046461 Bacteria 10528
811 Ga0495641_0016540 3300046461 Bacteria 3883
812 Ga0495641_0091403 3300046461 Bacteria 1360
813 Ga0495641_0152930 3300046461 Bacteria 1031
814 Ga0495651_0002693 3300046462 Bacteria 13786
815 Ga0495651_0025710 3300046462 Bacteria 4584
816 Ga0495651_0093048 3300046462 Bacteria 2257
817 Ga0495651_0180870 3300046462 Bacteria 1492
818 Ga0495651_0266062 3300046462 Bacteria 1164
819 Ga0495651_0533487 3300046462 Bacteria 747
820 Ga0495653_0000555 3300046463 Bacteria 28569
821 Ga0495653_0004451 3300046463 Bacteria 11316
822 Ga0495653_0056273 3300046463 Bacteria 2998
823 Ga0495653_0070817 3300046463 Bacteria 2608
824 Ga0495653_0116414 3300046463 Bacteria 1911
825 Ga0495653_0256418 3300046463 Bacteria 1158
826 Ga0495653_0296624 3300046463 Bacteria 1055
827 Ga0495653_0531748 3300046463 Bacteria 729
828 Ga0495650_0074459 3300046471 Bacteria 1324
829 Ga0495580_0023984 3300046472 Bacteria 4471
830 Ga0495580_0945142 3300046472 Bacteria 552
831 Ga0495582_0001326 3300046473 Bacteria 13878
832 Ga0495582_0272416 3300046473 Bacteria 971
833 Ga0495639_0045159 3300046475 Bacteria 1993
834 Ga0495639_0152156 3300046475 Bacteria 1116
835 Ga0495639_0187853 3300046475 Bacteria 1008
836 Ga0495639_0434700 3300046475 Bacteria 665
837 Ga0495662_0030003 3300046476 Bacteria 2625
838 Ga0495662_0040261 3300046476 Bacteria 2256
839 Ga0495662_0040872 3300046476 Bacteria 2239
840 Ga0495662_0181721 3300046476 Bacteria 1036
841 Ga0495664_0002276 3300046477 Bacteria 10292
842 Ga0495664_0025865 3300046477 Bacteria 3417
843 Ga0495664_0050670 3300046477 Bacteria 2465
844 Ga0495664_0056926 3300046477 Bacteria 2326
845 Ga0495664_0061739 3300046477 Bacteria 2231
846 Ga0495664_0110198 3300046477 Bacteria 1661
847 Ga0495664_0298062 3300046477 Bacteria 973
848 Ga0495594_0096590 3300046499 Bacteria 1660
849 Ga0495606_0611867 3300046507 Bacteria 533
850 Ga0495608_0002283 3300046511 Bacteria 13836
851 Ga0495608_0023903 3300046511 Bacteria 4180
852 Ga0495608_0072276 3300046511 Bacteria 2250
853 Ga0495608_0079951 3300046511 Bacteria 2125
854 Ga0495608_0373038 3300046511 Bacteria 875
855 Ga0495608_0651081 3300046511 Bacteria 629
856 Ga0495618_0008622 3300046514 Bacteria 6160
857 Ga0495618_0015094 3300046514 Bacteria 4712
858 Ga0495618_0160321 3300046514 Bacteria 1434
859 Ga0495618_0182874 3300046514 Bacteria 1332
860 Ga0495618_0272059 3300046514 Bacteria 1058
861 Ga0495618_0285082 3300046514 Bacteria 1029
862 Ga0495618_0605899 3300046514 Bacteria 651
863 Ga0495618_0620368 3300046514 Bacteria 642
864 Ga0495620_0254784 3300046515 Bacteria 669
865 Ga0495628_0023224 3300046516 Bacteria 5092
866 Ga0495628_0069750 3300046516 Bacteria 2741
867 Ga0495628_0112169 3300046516 Bacteria 2096
868 Ga0495628_0141224 3300046516 Bacteria 1838
869 Ga0495628_0400517 3300046516 Bacteria 1002
870 Ga0495628_0710779 3300046516 Bacteria 709
871 Ga0495628_0923894 3300046516 Bacteria 604
872 Ga0495630_0012644 3300046517 Bacteria 6133
873 Ga0495630_0330586 3300046517 Bacteria 1165
874 Ga0495630_0412742 3300046517 Bacteria 1034
875 Ga0495630_0510650 3300046517 Bacteria 921
876 Ga0495630_0777146 3300046517 Bacteria 731
877 Ga0495666_0070539 3300046526 Bacteria 1661
878 Ga0495666_0150971 3300046526 Bacteria 1080
879 Ga0495652_0005885 3300046529 Bacteria 11469
880 Ga0495652_0015768 3300046529 Bacteria 6764
881 Ga0495652_0015906 3300046529 Bacteria 6733
882 Ga0495652_0091885 3300046529 Bacteria 2480
883 Ga0495652_0181514 3300046529 Bacteria 1614
884 Ga0495652_0214283 3300046529 Bacteria 1451
885 Ga0495652_0287520 3300046529 Bacteria 1201
886 Ga0495652_0603296 3300046529 Bacteria 748
887 Ga0495665_0001105 3300046531 Bacteria 14262
888 Ga0495665_0005956 3300046531 Bacteria 6566
889 Ga0495665_0011749 3300046531 Bacteria 4744
890 Ga0495665_0028168 3300046531 Bacteria 3014
891 Ga0495665_0219232 3300046531 Bacteria 984
892 Ga0495640_0021019 3300046533 Bacteria 4797
893 Ga0495640_0028229 3300046533 Bacteria 4041
894 Ga0495640_0034299 3300046533 Bacteria 3600
895 Ga0495640_0060998 3300046533 Bacteria 2563
896 Ga0495640_0257905 3300046533 Bacteria 1090
897 Ga0495586_0013464 3300046535 Bacteria 4338
898 Ga0495586_0051987 3300046535 Bacteria 2217
899 Ga0495586_0121218 3300046535 Bacteria 1461
900 Ga0495586_0252002 3300046535 Bacteria 1007
901 Ga0495586_0654110 3300046535 Bacteria 607
902 Ga0495587_0001390 3300046536 Bacteria 16094
903 Ga0495587_0008890 3300046536 Bacteria 6446
904 Ga0495587_0042153 3300046536 Bacteria 2722
905 Ga0495587_0136420 3300046536 Bacteria 1401
906 Ga0495587_0242754 3300046536 Bacteria 1013
907 Ga0495587_0246155 3300046536 Bacteria 1005
908 Ga0495587_0606671 3300046536 Bacteria 602
909 Ga0495645_0030802 3300046543 Bacteria 3909
910 Ga0495645_0056752 3300046543 Bacteria 2843
911 Ga0495645_0075578 3300046543 Bacteria 2424
912 Ga0495645_0131739 3300046543 Bacteria 1751
913 Ga0495645_0156696 3300046543 Bacteria 1577
914 Ga0495645_0281383 3300046543 Bacteria 1093
915 Ga0495645_0437175 3300046543 Bacteria 827
916 Ga0495645_0540414 3300046543 Bacteria 723
917 Ga0495645_0751174 3300046543 Bacteria 588
918 Ga0495622_0186733 3300046557 Bacteria 928
919 Ga0495667_0002120 3300046559 Bacteria 13196
920 Ga0495667_0002955 3300046559 Bacteria 11403
921 Ga0495667_0004432 3300046559 Bacteria 9476
922 Ga0495667_0010816 3300046559 Bacteria 6170
923 Ga0495667_0035285 3300046559 Bacteria 3342
924 Ga0495667_0228526 3300046559 Bacteria 1186
925 Ga0495667_0236019 3300046559 Bacteria 1165
926 Ga0495667_0261540 3300046559 Bacteria 1100
927 Ga0495634_0002716 3300046642 Bacteria 14552
928 Ga0495634_0035660 3300046642 Bacteria 3404
929 Ga0495634_0053645 3300046642 Bacteria 2700
930 Ga0495634_0088275 3300046642 Bacteria 2017
931 Ga0495634_0112701 3300046642 Bacteria 1748
932 Ga0495634_0168524 3300046642 Bacteria 1377
933 Ga0495634_0294504 3300046642 Bacteria 982
934 Ga0495635_0000206 3300046663 Bacteria 37472
935 Ga0495635_0004637 3300046663 Bacteria 9538
936 Ga0495635_0025183 3300046663 Bacteria 4144
937 Ga0495635_0027150 3300046663 Bacteria 3983
938 Ga0495635_0037851 3300046663 Bacteria 3339
939 Ga0495635_0070027 3300046663 Bacteria 2404
940 Ga0495635_0264441 3300046663 Bacteria 1158
941 Ga0495635_0751015 3300046663 Bacteria 630
942 Ga0495588_0063477 3300046674 Bacteria 1915
943 Ga0495657_0005327 3300046675 Bacteria 10177
944 Ga0495657_0006178 3300046675 Bacteria 9390
945 Ga0495657_0025528 3300046675 Bacteria 4194
946 Ga0495657_0078212 3300046675 Bacteria 2144
947 Ga0495657_0083957 3300046675 Bacteria 2055
948 Ga0495657_0206135 3300046675 Bacteria 1196
949 Ga0495657_0546905 3300046675 Bacteria 673
950 Ga0495599_0003203 3300046678 Bacteria 9537
951 Ga0495599_0008033 3300046678 Bacteria 6406
952 Ga0495599_0023527 3300046678 Bacteria 3852
953 Ga0495599_0055067 3300046678 Bacteria 2491
954 Ga0495599_0227155 3300046678 Bacteria 1140
955 Ga0495599_0240286 3300046678 Bacteria 1104
956 Ga0495599_0383123 3300046678 Bacteria 839
957 Ga0495599_0410107 3300046678 Bacteria 806
958 Ga0495623_0068791 3300046679 Bacteria 2207
959 Ga0495623_0101438 3300046679 Bacteria 1753
960 Ga0495623_0102080 3300046679 Bacteria 1747
961 Ga0495646_0004430 3300046680 Bacteria 8841
962 Ga0495646_0482747 3300046680 Bacteria 637
963 Ga0495646_0609280 3300046680 Bacteria 554
964 Ga0495647_0008248 3300046681 Bacteria 3500
965 Ga0495647_0205825 3300046681 Bacteria 864
966 Ga0495658_0755560 3300046683 Bacteria 623
967 Ga0495658_1032777 3300046683 Bacteria 525
968 Ga0495613_0005536 3300046689 Bacteria 9481
969 Ga0495613_0583225 3300046689 Bacteria 745
970 Ga0495624_0013940 3300046690 Bacteria 5473
971 Ga0495624_0026895 3300046690 Bacteria 3768
972 Ga0495624_0030396 3300046690 Bacteria 3519
973 Ga0495624_0558560 3300046690 Bacteria 683
974 Ga0495600_0007781 3300046809 Bacteria 6561
975 Ga0495600_0057493 3300046809 Bacteria 2540
976 Ga0495600_0137932 3300046809 Bacteria 1583
977 Ga0495600_0243117 3300046809 Bacteria 1146
978 Ga0495600_0313518 3300046809 Bacteria 987
979 Ga0495600_0357743 3300046809 Bacteria 913
980 Ga0495600_0482558 3300046809 Bacteria 764
981 Ga0495600_0617640 3300046809 Bacteria 657
982 Ga0495600_0619627 3300046809 Bacteria 656
983 Ga0495581_0003087 3300047315 Bacteria 9528
984 Ga0495581_0010887 3300047315 Bacteria 5259
985 Ga0495581_0361105 3300047315 Bacteria 848
986 Ga0495604_0011387 3300047317 Bacteria 7057
987 Ga0495604_0012674 3300047317 Bacteria 6708
988 Ga0495604_0024157 3300047317 Bacteria 4851
989 Ga0495604_0052856 3300047317 Bacteria 3143
990 Ga0495604_0227417 3300047317 Bacteria 1281
991 Ga0495604_0742885 3300047317 Bacteria 621
992 Ga0495604_1003370 3300047317 Bacteria 517
993 Ga0495674_0001394 3300047319 Bacteria 23617
994 Ga0495674_0006864 3300047319 Bacteria 10895
995 Ga0495674_0017919 3300047319 Bacteria 6593
996 Ga0495674_0070670 3300047319 Bacteria 3016
997 Ga0495674_0152280 3300047319 Bacteria 1938
998 Ga0495674_0211608 3300047319 Bacteria 1605
999 Ga0495674_0554372 3300047319 Bacteria 914
1000 Ga0495674_0679948 3300047319 Bacteria 809
1001 Ga0495674_0827682 3300047319 Bacteria 718
1002 Ga0495676_0017719 3300047321 Bacteria 6290
1003 Ga0495676_0175595 3300047321 Bacteria 1504
1004 Ga0495680_0000651 3300047322 Bacteria 38967
1005 Ga0495680_0004782 3300047322 Bacteria 12853
1006 Ga0495680_0014670 3300047322 Bacteria 6777
1007 Ga0495680_0031209 3300047322 Bacteria 4340
1008 Ga0495680_0046767 3300047322 Bacteria 3409
1009 Ga0495680_0076951 3300047322 Bacteria 2528
1010 Ga0495680_0734250 3300047322 Bacteria 649
1011 Ga0495675_0007195 3300047444 Bacteria 6852
1012 Ga0495675_0021063 3300047444 Bacteria 4150
1013 Ga0495675_0050183 3300047444 Bacteria 2652
1014 Ga0495675_0123260 3300047444 Bacteria 1613
1015 Ga0495675_0628370 3300047444 Bacteria 607
1016 Ga0495684_0001154 3300047471 Bacteria 21211
1017 Ga0495684_0015298 3300047471 Bacteria 5909
1018 Ga0495684_0021721 3300047471 Bacteria 4942
1019 Ga0495684_0048006 3300047471 Bacteria 3264
1020 Ga0495684_0239095 3300047471 Bacteria 1325
1021 Ga0495684_0376399 3300047471 Bacteria 1002
1022 Ga0495684_0565109 3300047471 Bacteria 772
1023 Ga0495593_0003431 3300047673 Bacteria 9489
1024 Ga0495593_0033418 3300047673 Bacteria 2800
1025 Ga0495593_0338321 3300047673 Bacteria 752
1026 Ga0495602_0018126 3300048088 Bacteria 7042
1027 Ga0495602_0058485 3300048088 Bacteria 3373
1028 Ga0495602_0081183 3300048088 Bacteria 2727
1029 Ga0495602_0168882 3300048088 Bacteria 1699
1030 Ga0495602_0217814 3300048088 Bacteria 1443
1031 Ga0495614_0113347 3300048089 Bacteria 1191
1032 Ga0496100_0107198 3300048903 Bacteria 1935
1033 Ga0496100_0199013 3300048903 Bacteria 1459
1034 Ga0496100_0508561 3300048903 Bacteria 929
1035 Ga0496101_0062360 3300048904 Bacteria 2710
1036 Ga0496101_0301945 3300048904 Bacteria 1254
1037 Ga0496101_0457601 3300048904 Bacteria 1007
1038 Ga0496102_0027320 3300048905 Bacteria 5096
1039 Ga0496102_0091693 3300048905 Bacteria 2813
1040 Ga0496102_0239598 3300048905 Bacteria 1711
1041 Ga0496102_0311180 3300048905 Bacteria 1484
1042 Ga0496102_0409682 3300048905 Bacteria 1274
1043 Ga0496102_1046365 3300048905 Bacteria 736
1044 Ga0496103_0047613 3300048906 Bacteria 2649
1045 Ga0496103_0089585 3300048906 Bacteria 1941
1046 Ga0496104_0015955 3300048907 Bacteria 6818
1047 Ga0496104_0061826 3300048907 Bacteria 3551
1048 Ga0496104_0141493 3300048907 Bacteria 2311
1049 Ga0496104_0270991 3300048907 Bacteria 1610
1050 Ga0496104_0628703 3300048907 Bacteria 983
1051 Ga0496104_1793335 3300048907 Bacteria 516
1052 Ga0496105_0018946 3300048908 Bacteria 5544
1053 Ga0496105_0121278 3300048908 Bacteria 2155
1054 Ga0496105_0153020 3300048908 Bacteria 1895
1055 Ga0496105_0203353 3300048908 Bacteria 1616
1056 Ga0496105_0213899 3300048908 Bacteria 1571
1057 Ga0496105_0637291 3300048908 Bacteria 824
1058 Ga0496106_1403938 3300048909 Bacteria 539
1059 Ga0496107_0010224 3300048910 Bacteria 6511
1060 Ga0496107_0074178 3300048910 Bacteria 2475
1061 Ga0496107_0528634 3300048910 Bacteria 874
1062 Ga0496108_0014150 3300048911 Bacteria 6510
1063 Ga0496108_0054254 3300048911 Bacteria 3364
1064 Ga0496108_0069497 3300048911 Bacteria 2972
1065 Ga0496108_0099967 3300048911 Bacteria 2473
1066 Ga0496108_0271197 3300048911 Bacteria 1477
1067 Ga0496108_0368207 3300048911 Bacteria 1254
1068 Ga0496108_1217409 3300048911 Bacteria 636
1069 Ga0496109_0011196 3300048912 Bacteria 7698
1070 Ga0496109_0067691 3300048912 Bacteria 3272
1071 Ga0496109_0076279 3300048912 Bacteria 3083
1072 Ga0496109_0135737 3300048912 Bacteria 2298
1073 Ga0496109_0146641 3300048912 Bacteria 2208
1074 Ga0496109_0389591 3300048912 Bacteria 1316
1075 Ga0496109_0389621 3300048912 Bacteria 1316
1076 Ga0496109_0525402 3300048912 Bacteria 1117
1077 Ga0496109_0606077 3300048912 Bacteria 1031
1078 Ga0496109_0658909 3300048912 Bacteria 984
1079 Ga0496109_0879501 3300048912 Bacteria 834
1080 Ga0496109_1963097 3300048912 Bacteria 517
1081 Ga0496110_0223570 3300048913 Bacteria 1712
1082 Ga0496110_0367153 3300048913 Bacteria 1311
1083 Ga0496110_0425503 3300048913 Bacteria 1210
1084 Ga0496110_0444673 3300048913 Bacteria 1181
1085 Ga0496110_1014147 3300048913 Bacteria 737
1086 Ga0496111_0014907 3300048914 Bacteria 5321
1087 Ga0496111_0124085 3300048914 Bacteria 1908
1088 Ga0496111_0212254 3300048914 Bacteria 1438
1089 Ga0496111_0446004 3300048914 Bacteria 955
1090 Ga0496112_0204288 3300048915 Bacteria 1934
1091 Ga0496112_0539445 3300048915 Bacteria 1101
1092 Ga0496113_0010456 3300048916 Bacteria 6136
1093 Ga0496113_0069328 3300048916 Bacteria 2678
1094 Ga0496113_0633864 3300048916 Bacteria 855
1095 Ga0496113_1251254 3300048916 Bacteria 578
1096 Ga0496114_0064230 3300048917 Bacteria 3074
1097 Ga0496114_0081630 3300048917 Bacteria 2731
1098 Ga0496114_0310318 3300048917 Bacteria 1393
1099 Ga0496114_0429297 3300048917 Bacteria 1170
1100 Ga0496114_1221534 3300048917 Bacteria 638
1101 Ga0496114_1280263 3300048917 Bacteria 620
1102 Ga0496114_1800105 3300048917 Bacteria 500
1103 Ga0496115_0004348 3300048918 Bacteria 10250
1104 Ga0496115_0149349 3300048918 Bacteria 1929
1105 Ga0496115_0274481 3300048918 Bacteria 1385
1106 Ga0496115_0761295 3300048918 Bacteria 756
1107 Ga0496115_0910353 3300048918 Bacteria 678
1108 Ga0496117_0049331 3300048920 Bacteria 2995
1109 Ga0496118_0062966 3300048921 Bacteria 2732
1110 Ga0496118_0132657 3300048921 Bacteria 1596
1111 Ga0496122_0000583 3300048925 Bacteria 74712
1112 Ga0496122_0001054 3300048925 Bacteria 48096
1113 Ga0496123_0003034 3300048926 Bacteria 19353
1114 Ga0496124_0001569 3300048927 Bacteria 33052
1115 Ga0496124_0597899 3300048927 Bacteria 718
1116 Ga0496125_0000069 3300048928 Bacteria 246981
1117 Ga0496126_0146238 3300048929 Bacteria 2030
1118 Ga0496126_0428152 3300048929 Bacteria 1069
1119 Ga0496126_0493710 3300048929 Bacteria 979
1120 Ga0501321_062720 3300049537 Bacteria 565
1121 Ga0501321_064043 3300049537 Bacteria 561
1122 Ga0501032_0285140 3300049569 Bacteria 1069
1123 Ga0501032_0442259 3300049569 Bacteria 833
1124 Ga0501034_0233334 3300049571 Bacteria 1788
1125 Ga0501036_0348777 3300049572 Bacteria 1236
1126 Ga0501037_0041530 3300049573 Bacteria 3383
1127 Ga0501037_0247879 3300049573 Bacteria 1247
1128 Ga0501038_0199662 3300049574 Bacteria 1606
1129 Ga0501038_0959271 3300049574 Bacteria 629
1130 Ga0501039_1229646 3300049575 Bacteria 579
1131 Ga0501040_1292022 3300049576 Bacteria 529
1132 Ga0501047_0263628 3300049581 Bacteria 1570
1133 Ga0501047_0472989 3300049581 Bacteria 1081
1134 Ga0501047_0713849 3300049581 Bacteria 820
1135 Ga0501067_0286748 3300049583 Bacteria 917
1136 Ga0501070_0000870 3300049586 Bacteria 27482
1137 Ga0501070_0002439 3300049586 Bacteria 16306
1138 Ga0501070_0008387 3300049586 Bacteria 8729
1139 Ga0501070_0119798 3300049586 Bacteria 2175
1140 Ga0501071_0074886 3300049587 Bacteria 2471
1141 Ga0501072_0115703 3300049588 Bacteria 2135
1142 Ga0501073_0010141 3300049589 Bacteria 6923
1143 Ga0501074_0000165 3300049590 Bacteria 35249
1144 Ga0501076_0015578 3300049592 Bacteria 5751
1145 Ga0501079_0000028 3300049741 Bacteria 60671
1146 Ga0501079_0106786 3300049741 Bacteria 2173
1147 Ga0501079_0827233 3300049741 Bacteria 729
1148 Ga0501080_0000294 3300049742 Bacteria 37892
1149 Ga0501080_0123710 3300049742 Bacteria 2396
1150 Ga0501080_0245239 3300049742 Bacteria 1634
1151 Ga0501080_1612952 3300049742 Bacteria 549
1152 Ga0501035_0938581 3300049822 Bacteria 683
1153 Ga0501035_1027947 3300049822 Bacteria 647
1154 Ga0501044_0047605 3300049823 Bacteria 4435
1155 Ga0501044_0106545 3300049823 Bacteria 2815
1156 Ga0501044_0622133 3300049823 Bacteria 971
1157 nmdc:mga03n38_196994_c1 3300050490 Bacteria 1040
1158 nmdc:mga0qj67_254350_c1 3300050509 Bacteria 1425
1159 nmdc:mga0n895_1106466_c1 3300050512 Bacteria 769
1160 nmdc:mga0n895_1443160_c1 3300050512 Bacteria 656
1161 nmdc:mga0n895_649741_c1 3300050512 Bacteria 1054
1162 nmdc:mga0rr50_466932_c1 3300050513 Bacteria 1071
1163 nmdc:mga08x19_412551_c1 3300050514 Bacteria 948
1164 nmdc:mga08x19_531065_c1 3300050514 Bacteria 832
1165 nmdc:mga0a205_343328_c1 3300050515 Bacteria 1361
1166 Ga0495601_0046075 3300053077 Bacteria 2744
1167 Ga0495601_0065334 3300053077 Bacteria 2315
1168 Ga0495601_0097862 3300053077 Bacteria 1893
1169 Ga0495601_0603446 3300053077 Bacteria 704
1170 Ga0495601_0784920 3300053077 Bacteria 605
1171 Ga0495612_0005449 3300053078 Bacteria 5260
1172 Ga0495612_0019602 3300053078 Bacteria 2709
1173 Ga0495612_0053775 3300053078 Bacteria 1658
1174 Ga0495612_0115923 3300053078 Bacteria 1150
1175 Ga0495595_0000695 3300053084 Bacteria 12852
1176 Ga0495595_0003978 3300053084 Bacteria 5907
1177 Ga0495595_0031873 3300053084 Bacteria 2371
1178 Ga0495595_0132347 3300053084 Bacteria 1220
1179 Ga0495595_0175118 3300053084 Bacteria 1063
1180 Ga0495619_0070377 3300053085 Bacteria 2339
1181 Ga0495619_0211476 3300053085 Bacteria 1343
1182 Ga0495619_0225921 3300053085 Bacteria 1297
1183 Ga0495619_0409132 3300053085 Bacteria 936
1184 Ga0495619_0513577 3300053085 Bacteria 823
1185 Ga0500604_0021036 3300053151 Bacteria 1841
1186 Ga0500616_0005761 3300053153 Bacteria 8323
1187 Ga0500616_0027666 3300053153 Bacteria 3129
1188 Ga0500627_0431834 3300053158 Bacteria 557
1189 Ga0501084_0073828 3300054114 Bacteria 2856
1190 Ga0501082_0258393 3300060353 Bacteria 1515
1191 Ga0466962_0094382 3300061719 Bacteria 1434
1192 Ga0466962_0206295 3300061719 Bacteria 961
1193 Ga0466962_0211969 3300061719 Bacteria 948
1194 Ga0466962_0401100 3300061719 Bacteria 687
1195 Ga0466962_0735411 3300061719 Bacteria 507
1196 Ga0530510_0064626 3300061734 Bacteria 2650
1197 Ga0530510_0881200 3300061734 Bacteria 684
1198 2644035741 2643221604 Bacteria 5014917
1199 2644080909 2643221613 Bacteria 4622396
1200 2644663774 2643221721 Bacteria 4486924
1201 2729909339 2728369276 Bacteria 5610032
1202 2812362696 2811994880 Bacteria 4147780
1203 2857482231 2857481737 Bacteria 4761446
1204 2915360294 2915358134 Bacteria 6050864
1205 2935892405 2935890801 Bacteria 4593001
1206 2974319383 2974315732 Bacteria 4602776
1207 2984527591 2984523437 Bacteria 4508481
1208 8054478914 8054472261 Bacteria 7464355
1209 Ga0105238_10804158
1210 JGI24746J21847_1013548
1211 JGI24737J22298_10039524
1212 JGI24737J22298_10078850
1213 JGI24737J22298_10240644
1214 JGI24743J22301_10019798
1215 JGI24743J22301_10115525
1216 JGI24735J21928_10078215
1217 JGI24745J21846_1001491
1218 JGI24738J21930_10009655
1219 JGI24749J21850_1003410
1220 JGI24744J21845_10007601
1221 JGI24033J26618_1010355
1222 JGI24742J22300_10067248
1223 Ga0006778J45830_1044288
1224 JGI25406J46586_10002391
1225 Ga0007429J51699_1047141
1226 JGI25404J52841_10011303
1227 Ga0070658_10001334
1228 Ga0070658_10464077
1229 Ga0070676_10085328
1230 Ga0070683_100177406
1231 Ga0070683_100204454
1232 Ga0070690_100109719
1233 Ga0070690_100413224
1234 Ga0068869_100290372
1235 Ga0070666_10018299
1236 Ga0070666_10178697
1237 Ga0070680_100246607
1238 Ga0070682_100058203
1239 Ga0070682_100272843
1240 Ga0070682_100484551
1241 Ga0068868_100202855
1242 Ga0070660_100446377
1243 Ga0070689_100393802
1244 Ga0070691_10010169
1245 Ga0070691_10145861
1246 Ga0070687_100002082
1247 Ga0070661_100006268
1248 Ga0070661_100466744
1249 Ga0070692_10009092
1250 Ga0070692_10043539
1251 Ga0070692_10154244
1252 Ga0070668_100081589
1253 Ga0070668_100097032
1254 Ga0070668_100279476
1255 Ga0070668_101367960
1256 Ga0070669_100098984
1257 Ga0070669_100309009
1258 Ga0070669_101185950
1259 Ga0070675_100021579
1260 Ga0070675_100025886
1261 Ga0070671_100130792
1262 Ga0070674_100071023
1263 Ga0070674_100130095
1264 Ga0070674_100150958
1265 Ga0070673_100049541
1266 Ga0070673_100773630
1267 Ga0070673_100857848
1268 Ga0070659_100026681
1269 Ga0070659_100081814
1270 Ga0070659_100617344
1271 Ga0070667_100176437
1272 Ga0070667_100840872
1273 Ga0070703_10013561
1274 Ga0070709_10069886
1275 Ga0070709_10136634
1276 Ga0070709_10384348
1277 Ga0070709_10610528
1278 Ga0070709_10625097
1279 Ga0070714_100001005
1280 Ga0070714_100010667
1281 Ga0070714_100029966
1282 Ga0070714_100108336
1283 Ga0070714_100148840
1284 Ga0070714_100283197
1285 Ga0070714_100357625
1286 Ga0070714_101209753
1287 Ga0070714_101548794
1288 Ga0070713_100000980
1289 Ga0070713_100016714
1290 Ga0070713_100031859
1291 Ga0070713_100081557
1292 Ga0070713_100151629
1293 Ga0070713_100159598
1294 Ga0070713_100238177
1295 Ga0070713_100410352
1296 Ga0070713_100899245
1297 Ga0070713_101080159
1298 Ga0070710_10000603
1299 Ga0070710_10029778
1300 Ga0070710_10070485
1301 Ga0070710_10190414
1302 Ga0070710_10321441
1303 Ga0070710_10427196
1304 Ga0070701_10011409
1305 Ga0070701_10163401
1306 Ga0070711_100019460
1307 Ga0070711_100025744
1308 Ga0070711_100032188
1309 Ga0070711_100081106
1310 Ga0070711_100314026
1311 Ga0070711_100316936
1312 Ga0070711_100402370
1313 Ga0070700_100023955
1314 Ga0070700_100516188
1315 Ga0070694_100552815
1316 Ga0070708_100000689
1317 Ga0070708_100153080
1318 Ga0070708_100165877
1319 Ga0070663_100365905
1320 Ga0070678_100031596
1321 Ga0070681_10535103
1322 Ga0068867_100021638
1323 Ga0068867_100142992
1324 Ga0068867_100246913
1325 Ga0070685_10005567
1326 Ga0070685_10061040
1327 Ga0070706_100043596
1328 Ga0070706_100062230
1329 Ga0070706_100176904
1330 Ga0070706_100656209
1331 Ga0070706_100909176
1332 Ga0070706_101256552
1333 Ga0070707_100068631
1334 Ga0070707_100071847
1335 Ga0070707_100225567
1336 Ga0070707_100701923
1337 Ga0070707_100853199
1338 Ga0070698_100008291
1339 Ga0070698_100127386
1340 Ga0070698_100299881
1341 Ga0070698_100566646
1342 Ga0070698_101099057
1343 Ga0070699_100000598
1344 Ga0070699_100616569
1345 Ga0070699_101126584
1346 Ga0070679_100192520
1347 Ga0070679_100241362
1348 Ga0070679_101220756
1349 Ga0070684_100176846
1350 Ga0070684_101203255
1351 Ga0070697_100020176
1352 Ga0070697_100048802
1353 Ga0068853_100059745
1354 Ga0068853_100545927
1355 Ga0070672_100017922
1356 Ga0070672_100155987
1357 Ga0070686_100133122
1358 Ga0070686_100283100
1359 Ga0070686_101119967
1360 Ga0070695_100081322
1361 Ga0070665_100232955
1362 Ga0070665_100464189
1363 Ga0070665_100580474
1364 Ga0070704_100131820
1365 Ga0070704_100581480
1366 Ga0068855_100376944
1367 Ga0068855_100772716
1368 Ga0068855_101929810
1369 Ga0070664_100052167
1370 Ga0070664_100419259
1371 Ga0070664_100760209
1372 Ga0068857_100260488
1373 Ga0068857_100448452
1374 Ga0068854_100229499
1375 Ga0068854_100764063
1376 Ga0068856_100052348
1377 Ga0068856_102094204
1378 Ga0070702_100018849
1379 Ga0070702_100042485
1380 Ga0068852_100023223
1381 Ga0068852_100180961
1382 Ga0068852_100305460
1383 Ga0068852_100764183
1384 Ga0068852_101453038
1385 Ga0068864_100036842
1386 Ga0068864_100453331
1387 Ga0068864_101864698
1388 Ga0068866_10131775
1389 Ga0068861_100016968
1390 Ga0068861_100058479
1391 Ga0068861_100544226
1392 Ga0068861_101296068
1393 Ga0068851_10115374
1394 Ga0068870_10006468
1395 Ga0068870_10146217
1396 Ga0068863_100802788
1397 Ga0068863_100909255
1398 Ga0068858_100333310
1399 Ga0068858_100477516
1400 Ga0068858_100719564
1401 Ga0068858_101927015
1402 Ga0068860_100118000
1403 Ga0068860_101861056
1404 Ga0081455_10001042
1405 Ga0081540_1000155
1406 Ga0081539_10000182
1407 Ga0081539_10015694
1408 Ga0081539_10048728
1409 Ga0081539_10078950
1410 Ga0070717_10014112
1411 Ga0070717_10023465
1412 Ga0070717_10025511
1413 Ga0070717_10113142
1414 Ga0070717_10173693
1415 Ga0070717_10196325
1416 Ga0070717_10235643
1417 Ga0070717_10396267
1418 Ga0070717_10457716
1419 Ga0070717_10634596
1420 Ga0070717_10775984
1421 Ga0070717_10861528
1422 Ga0070717_10928106
1423 Ga0075365_10935736
1424 Ga0075364_10279144
1425 Ga0075432_10137706
1426 Ga0070715_10244523
1427 Ga0070715_10299384
1428 Ga0070715_10299591
1429 Ga0070715_10523725
1430 Ga0070715_10608017
1431 Ga0070716_100000609
1432 Ga0070716_100025893
1433 Ga0070716_100392330
1434 Ga0070716_100501181
1435 Ga0070712_100013755
1436 Ga0070712_100082193
1437 Ga0070712_100133654
1438 Ga0070712_100221006
1439 Ga0070712_100224884
1440 Ga0070712_100375282
1441 Ga0070712_100406524
1442 Ga0070712_100518902
1443 Ga0070712_100713948
1444 Ga0070712_100714242
1445 Ga0075367_10378267
1446 Ga0097621_100080443
1447 Ga0075370_10400925
1448 Ga0075428_100370093
1449 Ga0075428_100505329
1450 Ga0075428_100523460
1451 Ga0075430_100403872
1452 Ga0075433_10150008
1453 Ga0075434_101178146
1454 Ga0075434_102212997
1455 Ga0068865_100048531
1456 Ga0068865_100099173
1457 Ga0075436_100398779
1458 Ga0075436_100410951
1459 Ga0075435_100514271
1460 Ga0075435_101313102
1461 Ga0099795_10171914
1462 Ga0105240_10168832
1463 Ga0105240_10494076
1464 Ga0111539_11143479
1465 Ga0105245_10044818
1466 Ga0105245_10184743
1467 Ga0105245_10909394
1468 Ga0105247_10260883
1469 Ga0105247_11138636
1470 Ga0105243_10008770
1471 Ga0105243_10213376
1472 Ga0105242_10084985
1473 Ga0105242_10311109
1474 Ga0105248_10026802
1475 Ga0105248_11563572
1476 Ga0105248_12275657
1477 Ga0105237_11389034
1478 Ga0105238_10536529
1479 Ga0105238_11115682
1480 Ga0105249_10020433
1481 Ga0105249_13110612
1482 Ga0105239_10038166
1483 Ga0105239_10206724
1484 Ga0105239_10979084
1485 Ga0105246_10186261
1486 Ga0157346_1006344
1487 Ga0157341_1014422
1488 Ga0157345_1006121
1489 Ga0157339_1002908
1490 Ga0157342_1025667
1491 Ga0157338_1009154
1492 Ga0157371_10270031
1493 Ga0157370_10195802
1494 Ga0157370_10206041
1495 Ga0157369_10005983
1496 Ga0157369_10287479
1497 Ga0157369_10384656
1498 Ga0157369_10476015
1499 Ga0157369_10740358
1500 Ga0157369_10740414
1501 Ga0157374_10090784
1502 Ga0157374_10606988
1503 Ga0157374_10670058
1504 Ga0157374_10719302
1505 Ga0157374_10747764
1506 Ga0157378_10177599
1507 Ga0157378_12290282
1508 Ga0163162_10151792
1509 Ga0163162_10163961
1510 Ga0157372_10024275
1511 Ga0157372_10346614
1512 Ga0157372_10624214
1513 Ga0157372_10899177
1514 Ga0157372_12202267
1515 Ga0157375_10027776
1516 Ga0157375_11047718
1517 Ga0157375_11581704
1518 Ga0157375_12461602
1519 Ga0163163_10051454
1520 Ga0163163_10279240
1521 Ga0163163_12199884
1522 Ga0157380_10071193
1523 Ga0157380_10244361
1524 Ga0157380_10365665
1525 Ga0157380_11435823
1526 Ga0182008_10206569
1527 Ga0182008_10491442
1528 Ga0157377_10006429
1529 Ga0157377_10102607
1530 Ga0157377_10370711
1531 Ga0157379_10139721
1532 Ga0157379_10163456
1533 Ga0197907_10508658
1534 Ga0197907_10622865
1535 Ga0197907_11109172
1536 Ga0206356_11565027
1537 Ga0206356_11660410
1538 Ga0206356_11707227
1539 Ga0206349_1207593
1540 Ga0206349_1275547
1541 Ga0206355_1328187
1542 Ga0206351_10280240
1543 Ga0206350_10940578
1544 Ga0206354_10091345
1545 Ga0206354_11716454
1546 Ga0206353_10052697
1547 Ga0206353_11007125
1548 Ga0206353_11153682
1549 Ga0206353_11908304
1550 Ga0213876_10488631
1551 Ga0213875_10001023
1552 Ga0213875_10061756
1553 Ga0224712_10218296
1554 Ga0224712_10267560
1555 Ga0224712_10553542
1556 Ga0224712_10689319
1557 Ga0207656_10497837
1558 Ga0207653_10006126
1559 Ga0207692_10003642
1560 Ga0207692_10030932
1561 Ga0207692_10185365
1562 Ga0207692_10393963
1563 Ga0207642_10073959
1564 Ga0207710_10598489
1565 Ga0207688_10313444
1566 Ga0207680_10068305
1567 Ga0207647_10316269
1568 Ga0207647_10526590
1569 Ga0207685_10265100
1570 Ga0207685_10392355
1571 Ga0207699_10005541
1572 Ga0207699_10010766
1573 Ga0207699_10015437
1574 Ga0207699_10018303
1575 Ga0207699_10136664
1576 Ga0207699_10291591
1577 Ga0207699_10463688
1578 Ga0207645_10134402
1579 Ga0207643_10007384
1580 Ga0207643_10050196
1581 Ga0207705_10000348
1582 Ga0207705_10394779
1583 Ga0207705_11406801
1584 Ga0207684_10028586
1585 Ga0207684_10033261
1586 Ga0207684_10100342
1587 Ga0207684_10217379
1588 Ga0207707_10355858
1589 Ga0207671_11086843
1590 Ga0207693_10020749
1591 Ga0207693_10026732
1592 Ga0207693_10063429
1593 Ga0207693_10126083
1594 Ga0207693_10473256
1595 Ga0207693_10620939
1596 Ga0207663_10022954
1597 Ga0207663_10129192
1598 Ga0207663_10190431
1599 Ga0207663_10235018
1600 Ga0207663_10289353
1601 Ga0207663_10600969
1602 Ga0207660_10200988
1603 Ga0207660_10501004
1604 Ga0207662_10020778
1605 Ga0207662_10042221
1606 Ga0207662_10055325
1607 Ga0207649_10046176
1608 Ga0207649_10835734
1609 Ga0207652_10101526
1610 Ga0207652_10290539
1611 Ga0207646_10000455
1612 Ga0207646_10047539
1613 Ga0207646_10060714
1614 Ga0207646_10072140
1615 Ga0207646_11222156
1616 Ga0207646_11264748
1617 Ga0207646_11273317
1618 Ga0207681_10162550
1619 Ga0207681_10211856
1620 Ga0207694_10198116
1621 Ga0207694_10688840
1622 Ga0207694_11502000
1623 Ga0207659_10048286
1624 Ga0207687_10090470
1625 Ga0207687_10203536
1626 Ga0207687_10301569
1627 Ga0207687_10752475
1628 Ga0207687_11427047
1629 Ga0207700_10003128
1630 Ga0207700_10032514
1631 Ga0207700_10041231
1632 Ga0207700_10095506
1633 Ga0207700_10127550
1634 Ga0207700_10141530
1635 Ga0207700_10459867
1636 Ga0207700_10919010
1637 Ga0207700_10968530
1638 Ga0207700_11014012
1639 Ga0207664_10000750
1640 Ga0207664_10008250
1641 Ga0207664_10011323
1642 Ga0207664_10025821
1643 Ga0207664_10091634
1644 Ga0207664_10107229
1645 Ga0207664_10146802
1646 Ga0207664_10219706
1647 Ga0207664_10352815
1648 Ga0207664_10427580
1649 Ga0207664_10666644
1650 Ga0207644_10385746
1651 Ga0207644_10480077
1652 Ga0207644_10518686
1653 Ga0207690_10035623
1654 Ga0207690_10376563
1655 Ga0207690_10701253
1656 Ga0207706_10109079
1657 Ga0207686_10230814
1658 Ga0207709_10017782
1659 Ga0207709_10097539
1660 Ga0207709_10556548
1661 Ga0207670_10078997
1662 Ga0207670_10401797
1663 Ga0207669_10036897
1664 Ga0207669_10042551
1665 Ga0207669_10070384
1666 Ga0207704_10100709
1667 Ga0207665_10000630
1668 Ga0207665_10029520
1669 Ga0207665_10154284
1670 Ga0207665_11158101
1671 Ga0207691_10001822
1672 Ga0207691_10076277
1673 Ga0207711_10546925
1674 Ga0207689_10006073
1675 Ga0207661_10129498
1676 Ga0207661_10164855
1677 Ga0207661_10183917
1678 Ga0207661_10737401
1679 Ga0207679_11329400
1680 Ga0207679_11560748
1681 Ga0207667_10149859
1682 Ga0207712_10142042
1683 Ga0207668_10147559
1684 Ga0207668_10208508
1685 Ga0207668_10427646
1686 Ga0207640_10048321
1687 Ga0207658_10022818
1688 Ga0207677_10224393
1689 Ga0207677_10910673
1690 Ga0207677_11191571
1691 Ga0207703_10241442
1692 Ga0207703_11125464
1693 Ga0207639_10173103
1694 Ga0207639_10550514
1695 Ga0207678_10012292
1696 Ga0207678_10070567
1697 Ga0207678_10376098
1698 Ga0207708_10000897
1699 Ga0207708_10012149
1700 Ga0207708_10426919
1701 Ga0207702_10083312
1702 Ga0207702_10173515
1703 Ga0207702_10835202
1704 Ga0207702_11432338
1705 Ga0207641_10155375
1706 Ga0207641_10912701
1707 Ga0207641_11237625
1708 Ga0207648_10001889
1709 Ga0207648_10075562
1710 Ga0207676_10036206
1711 Ga0207676_10157805
1712 Ga0207676_10707540
1713 Ga0207676_11345777
1714 Ga0207674_10003194
1715 Ga0207674_10098142
1716 Ga0207674_10684699
1717 Ga0207675_100009052
1718 Ga0207675_100010850
1719 Ga0207675_100025134
1720 Ga0207675_101113697
1721 Ga0207683_10003299
1722 Ga0207683_10101369
1723 Ga0207698_10091294
1724 Ga0207698_10125713
1725 Ga0207698_10180545
1726 Ga0207698_10193095
1727 Ga0207698_10611778
1728 Ga0207698_11374801
1729 Ga0207428_10087100
1730 Ga0268266_10070591
1731 Ga0268266_10101036
1732 Ga0268266_10299978
1733 Ga0268266_11365424
1734 Ga0268265_10128290
1735 Ga0268265_10452277
1736 Ga0268264_11676015
1737 Ga0268264_11686365
1738 Ga0265340_10026184
1739 Ga0307513_10000509
1740 Ga0307513_10004140
1741 Ga0307408_101110897
1742 Ga0307508_10318598
1743 Ga0307405_10278048
1744 Ga0307405_10437318
1745 Ga0307405_11009927
1746 Ga0307405_11445021
1747 Ga0307518_10018934
1748 Ga0307410_10083351
1749 Ga0307406_10367514
1750 Ga0307407_10561997
1751 Ga0307409_100217341
1752 Ga0307409_100298104
1753 Ga0307409_100547679
1754 Ga0307409_100942870
1755 Ga0307409_100974573
1756 Ga0307416_100662092
1757 Ga0307416_101254651
1758 Ga0307416_101602618
1759 Ga0307414_11310602
1760 Ga0307411_10874916
1761 Ga0307415_100599783
1762 Ga0307415_101669454
1763 Ga0373926_0003088
1764 Ga0373926_0018529
1765 Ga0373928_0040255
1766 Ga0373929_0048758
1767 Ga0373934_0011984
1768 Ga0373934_0111726
1769 Ga0373944_0001169
1770 Ga0373944_0039146
1771 Ga0373944_0057873
1772 Ga0373952_0059096
1773 Ga0373923_0008579
1774 Ga0373923_0009259
1775 Ga0373923_0094860
1776 Ga0373923_0389044
1777 Ga0373923_0584409
1778 Ga0373932_0314182
1779 Ga0373936_0000677
1780 Ga0373936_0003020
1781 Ga0373936_0039068
1782 Ga0373936_0164175
1783 Ga0373936_0185196
1784 Ga0373941_0010718
1785 Ga0373945_0000575
1786 Ga0373945_0004809
1787 Ga0373945_0359806
1788 Ga0373953_0053563
1789 Ga0373953_0175439
1790 Ga0373953_0191267
1791 Ga0373954_0052602
1792 Ga0373954_0177958
1793 Ga0373954_0232887
1794 Ga0373954_0302834
1795 Ga0373956_0089161
1796 Ga0373956_0149317
1797 Ga0373957_0016530
1798 Ga0373957_0085801
1799 Ga0373960_0201097
1800 Ga0373943_0000379
1801 Ga0373943_0045289
1802 Ga0373943_0166765
1803 Ga0373946_0000071
1804 Ga0373946_0281200
1805 Ga0373955_0029111
1806 Ga0373955_0067910
1807 Ga0373955_0097976
1808 Ga0373942_0007491
1809 Ga0373924_0006965
1810 Ga0373924_0018685
1811 Ga0373924_0058735
1812 Ga0373924_0120167
1813 Ga0373931_0276252
1814 Ga0373931_0458854
1815 Ga0373935_0007539
1816 Ga0373935_0090545
1817 Ga0373935_0104188
1818 Ga0373935_0267929
1819 Ga0373935_0302717
1820 Ga0373935_0809744
1821 Ga0373935_0985295
1822 Ga0373927_0003532
1823 Ga0373927_1144894
1824 Ga0373933_0041762
1825 Ga0373933_0118650
1826 Ga0373933_0150942
1827 Ga0373933_0292473
1828 Ga0373947_0004135
1829 Ga0373947_0077962
1830 Ga0373947_0120772
1831 Ga0373947_0177916
1832 Ga0373947_0447689
1833 Ga0373947_0634397
1834 Ga0373947_0657328
1835 Ga0373947_1130273
1836 Ga0373937_0017044
1837 Ga0373937_0080932
1838 Ga0373937_0322147
1839 Ga0373937_0367143
1840 Ga0373937_0411295
1841 Ga0373937_0447516
1842 Ga0373937_0935843
1843 Ga0373937_1226550
1844 Ga0373937_1440201
1845 Ga0373925_0003272
1846 Ga0373925_0016415
1847 Ga0373925_0244303
1848 Ga0373925_0306716
1849 Ga0373925_0423874
1850 Ga0373925_1379853
1851 Ga0395900_0082652
1852 Ga0395900_0370668
1853 Ga0395898_0126350
1854 Ga0395905_1558331
1855 Ga0436364_0066527
1856 Ga0436364_0093190
1857 Ga0436364_0661034
1858 Ga0436364_0750168
1859 Ga0436364_1052723
1860 Ga0395901_0005587
1861 Ga0436365_0478561
1862 Ga0436360_0719369
1863 Ga0436361_1034955
1864 Ga0436363_0347872
1865 Ga0436363_0387018
1866 Ga0436363_0416526
1867 Ga0436363_0531864
1868 Ga0436363_1356157
1869 Ga0436362_0081924
1870 Ga0436362_1229093
1871 Ga0451789_0173773
1872 Ga0451789_0179690
1873 Ga0451789_1346882
1874 Ga0451791_0631542
1875 Ga0451791_0830000
1876 Ga0451791_1727689
1877 Ga0451793_0554836
1878 Ga0451793_1331298
1879 Ga0451797_1036889
1880 Ga0451802_0186256
1881 Ga0451807_2461803
1882 Ga0451833_0950911
1883 Ga0451837_0986391
1884 Ga0451841_0284230
1885 Ga0451849_1443282
1886 Ga0451851_0190844
1887 Ga0451851_0920371
1888 Ga0451843_0186394
1889 Ga0451843_0610637
1890 Ga0451855_1237994
1891 Ga0451853_3336502
1892 Ga0466969_0082340
1893 Ga0466969_0115265
1894 Ga0466972_0113475
1895 Ga0466965_0095583
1896 Ga0466965_0230525
1897 Ga0466965_0357054
1898 Ga0466965_0687028
1899 Ga0466965_0704093
1900 Ga0466966_0004582
1901 Ga0466966_0031654
1902 Ga0466966_0040811
1903 Ga0466966_0161108
1904 Ga0466966_0166643
1905 Ga0466966_0256498
1906 Ga0466966_0312027
1907 Ga0466961_0002635
1908 Ga0466961_0014664
1909 Ga0466961_0034766
1910 Ga0466961_0088021
1911 Ga0466961_0182537
1912 Ga0466961_0223855
1913 Ga0466961_0468997
1914 Ga0466961_0515465
1915 Ga0466961_0971579
1916 Ga0466963_0010924
1917 Ga0466963_0099678
1918 Ga0466963_0130745
1919 Ga0466963_0268246
1920 Ga0466963_0268445
1921 Ga0466963_0300769
1922 Ga0466963_0355707
1923 Ga0466963_0391680
1924 Ga0466963_0424871
1925 Ga0466963_0466830
1926 Ga0466963_0593198
1927 Ga0466963_0601025
1928 Ga0466963_0667425
1929 Ga0466963_0953918
1930 Ga0466963_0987304
1931 Ga0466963_1047609
1932 Ga0466963_1329301
1933 Ga0466964_0166221
1934 Ga0466964_0174688
1935 Ga0466964_0457525
1936 Ga0466964_0510045
1937 Ga0466971_0072623
1938 Ga0466971_0084801
1939 Ga0466971_0090062
1940 Ga0466971_0403250
1941 Ga0466968_0168159
1942 Ga0466970_0020493
1943 Ga0466970_0022917
1944 Ga0466970_0024598
1945 Ga0466970_0026247
1946 Ga0466970_0157949
1947 Ga0466970_0376147
1948 Ga0466970_0446076
1949 Ga0466970_0473526
1950 Ga0466970_0478969
1951 Ga0466970_0508907
1952 Ga0466970_0760667
1953 Ga0466957_0022629
1954 Ga0466957_0073280
1955 Ga0466957_0075396
1956 Ga0466957_0119843
1957 Ga0466957_0149285
1958 Ga0466957_0268841
1959 Ga0466957_0328331
1960 Ga0466957_0518162
1961 Ga0466960_0011523
1962 Ga0466960_0011688
1963 Ga0466960_0066500
1964 Ga0466960_0084184
1965 Ga0466960_0117392
1966 Ga0466960_0129251
1967 Ga0466960_0193951
1968 Ga0466960_0262719
1969 Ga0466960_0299737
1970 Ga0466960_0737375
1971 Ga0466959_0009566
1972 Ga0466959_0057534
1973 Ga0466959_0077706
1974 Ga0466959_0112410
1975 Ga0466959_0126441
1976 Ga0466959_0319455
1977 Ga0466959_0437251
1978 Ga0466959_0473689
1979 Ga0466958_0004678
1980 Ga0466958_0014999
1981 Ga0466958_0021002
1982 Ga0466958_0027972
1983 Ga0466958_0031381
1984 Ga0466958_0099491
1985 Ga0466958_0117316
1986 Ga0466958_0179457
1987 Ga0466958_0234118
1988 Ga0466958_0390254
1989 Ga0466958_0414975
1990 Ga0466958_0426275
1991 Ga0466967_0003013
1992 Ga0466967_0027192
1993 Ga0466967_0032279
1994 Ga0466967_0036020
1995 Ga0466967_0056346
1996 Ga0466967_0069355
1997 Ga0466967_0106320
1998 Ga0466967_0150483
1999 Ga0466967_0169692
2000 Ga0466967_0198562
2001 Ga0466967_0212215
2002 Ga0466967_0286030
2003 Ga0466967_0456031
2004 Ga0466967_0635184
2005 Ga0466967_0670050
2006 Ga0466967_1775412
2007 Ga0495592_0012147
2008 Ga0495592_0064131
2009 Ga0495592_0121109
2010 Ga0495592_0157132
2011 Ga0495592_0210064
2012 Ga0495603_0391585
2013 Ga0495629_0007539
2014 Ga0495629_0054132
2015 Ga0495629_0176774
2016 Ga0495629_0261621
2017 Ga0495638_0039800
2018 Ga0495641_0004087
2019 Ga0495641_0016540
2020 Ga0495641_0091403
2021 Ga0495641_0152930
2022 Ga0495651_0002693
2023 Ga0495651_0025710
2024 Ga0495651_0093048
2025 Ga0495651_0180870
2026 Ga0495651_0266062
2027 Ga0495651_0533487
2028 Ga0495653_0000555
2029 Ga0495653_0004451
2030 Ga0495653_0056273
2031 Ga0495653_0070817
2032 Ga0495653_0116414
2033 Ga0495653_0256418
2034 Ga0495653_0296624
2035 Ga0495653_0531748
2036 Ga0495650_0074459
2037 Ga0495580_0023984
2038 Ga0495580_0945142
2039 Ga0495582_0001326
2040 Ga0495582_0272416
2041 Ga0495639_0045159
2042 Ga0495639_0152156
2043 Ga0495639_0187853
2044 Ga0495639_0434700
2045 Ga0495662_0030003
2046 Ga0495662_0040261
2047 Ga0495662_0040872
2048 Ga0495662_0181721
2049 Ga0495664_0002276
2050 Ga0495664_0025865
2051 Ga0495664_0050670
2052 Ga0495664_0056926
2053 Ga0495664_0061739
2054 Ga0495664_0110198
2055 Ga0495664_0298062
2056 Ga0495594_0096590
2057 Ga0495606_0611867
2058 Ga0495608_0002283
2059 Ga0495608_0023903
2060 Ga0495608_0072276
2061 Ga0495608_0079951
2062 Ga0495608_0373038
2063 Ga0495608_0651081
2064 Ga0495618_0008622
2065 Ga0495618_0015094
2066 Ga0495618_0160321
2067 Ga0495618_0182874
2068 Ga0495618_0272059
2069 Ga0495618_0285082
2070 Ga0495618_0605899
2071 Ga0495618_0620368
2072 Ga0495620_0254784
2073 Ga0495628_0023224
2074 Ga0495628_0069750
2075 Ga0495628_0112169
2076 Ga0495628_0141224
2077 Ga0495628_0400517
2078 Ga0495628_0710779
2079 Ga0495628_0923894
2080 Ga0495630_0012644
2081 Ga0495630_0330586
2082 Ga0495630_0412742
2083 Ga0495630_0510650
2084 Ga0495630_0777146
2085 Ga0495666_0070539
2086 Ga0495666_0150971
2087 Ga0495652_0005885
2088 Ga0495652_0015768
2089 Ga0495652_0015906
2090 Ga0495652_0091885
2091 Ga0495652_0181514
2092 Ga0495652_0214283
2093 Ga0495652_0287520
2094 Ga0495652_0603296
2095 Ga0495665_0001105
2096 Ga0495665_0005956
2097 Ga0495665_0011749
2098 Ga0495665_0028168
2099 Ga0495665_0219232
2100 Ga0495640_0021019
2101 Ga0495640_0028229
2102 Ga0495640_0034299
2103 Ga0495640_0060998
2104 Ga0495640_0257905
2105 Ga0495586_0013464
2106 Ga0495586_0051987
2107 Ga0495586_0121218
2108 Ga0495586_0252002
2109 Ga0495586_0654110
2110 Ga0495587_0001390
2111 Ga0495587_0008890
2112 Ga0495587_0042153
2113 Ga0495587_0136420
2114 Ga0495587_0242754
2115 Ga0495587_0246155
2116 Ga0495587_0606671
2117 Ga0495645_0030802
2118 Ga0495645_0056752
2119 Ga0495645_0075578
2120 Ga0495645_0131739
2121 Ga0495645_0156696
2122 Ga0495645_0281383
2123 Ga0495645_0437175
2124 Ga0495645_0540414
2125 Ga0495645_0751174
2126 Ga0495622_0186733
2127 Ga0495667_0002120
2128 Ga0495667_0002955
2129 Ga0495667_0004432
2130 Ga0495667_0010816
2131 Ga0495667_0035285
2132 Ga0495667_0228526
2133 Ga0495667_0236019
2134 Ga0495667_0261540
2135 Ga0495634_0002716
2136 Ga0495634_0035660
2137 Ga0495634_0053645
2138 Ga0495634_0088275
2139 Ga0495634_0112701
2140 Ga0495634_0168524
2141 Ga0495634_0294504
2142 Ga0495635_0000206
2143 Ga0495635_0004637
2144 Ga0495635_0025183
2145 Ga0495635_0027150
2146 Ga0495635_0037851
2147 Ga0495635_0070027
2148 Ga0495635_0264441
2149 Ga0495635_0751015
2150 Ga0495588_0063477
2151 Ga0495657_0005327
2152 Ga0495657_0006178
2153 Ga0495657_0025528
2154 Ga0495657_0078212
2155 Ga0495657_0083957
2156 Ga0495657_0206135
2157 Ga0495657_0546905
2158 Ga0495599_0003203
2159 Ga0495599_0008033
2160 Ga0495599_0023527
2161 Ga0495599_0055067
2162 Ga0495599_0227155
2163 Ga0495599_0240286
2164 Ga0495599_0383123
2165 Ga0495599_0410107
2166 Ga0495623_0068791
2167 Ga0495623_0101438
2168 Ga0495623_0102080
2169 Ga0495646_0004430
2170 Ga0495646_0482747
2171 Ga0495646_0609280
2172 Ga0495647_0008248
2173 Ga0495647_0205825
2174 Ga0495658_0755560
2175 Ga0495658_1032777
2176 Ga0495613_0005536
2177 Ga0495613_0583225
2178 Ga0495624_0013940
2179 Ga0495624_0026895
2180 Ga0495624_0030396
2181 Ga0495624_0558560
2182 Ga0495600_0007781
2183 Ga0495600_0057493
2184 Ga0495600_0137932
2185 Ga0495600_0243117
2186 Ga0495600_0313518
2187 Ga0495600_0357743
2188 Ga0495600_0482558
2189 Ga0495600_0617640
2190 Ga0495600_0619627
2191 Ga0495581_0003087
2192 Ga0495581_0010887
2193 Ga0495581_0361105
2194 Ga0495604_0011387
2195 Ga0495604_0012674
2196 Ga0495604_0024157
2197 Ga0495604_0052856
2198 Ga0495604_0227417
2199 Ga0495604_0742885
2200 Ga0495604_1003370
2201 Ga0495674_0001394
2202 Ga0495674_0006864
2203 Ga0495674_0017919
2204 Ga0495674_0070670
2205 Ga0495674_0152280
2206 Ga0495674_0211608
2207 Ga0495674_0554372
2208 Ga0495674_0679948
2209 Ga0495674_0827682
2210 Ga0495676_0017719
2211 Ga0495676_0175595
2212 Ga0495680_0000651
2213 Ga0495680_0004782
2214 Ga0495680_0014670
2215 Ga0495680_0031209
2216 Ga0495680_0046767
2217 Ga0495680_0076951
2218 Ga0495680_0734250
2219 Ga0495675_0007195
2220 Ga0495675_0021063
2221 Ga0495675_0050183
2222 Ga0495675_0123260
2223 Ga0495675_0628370
2224 Ga0495684_0001154
2225 Ga0495684_0015298
2226 Ga0495684_0021721
2227 Ga0495684_0048006
2228 Ga0495684_0239095
2229 Ga0495684_0376399
2230 Ga0495684_0565109
2231 Ga0495593_0003431
2232 Ga0495593_0033418
2233 Ga0495593_0338321
2234 Ga0495602_0018126
2235 Ga0495602_0058485
2236 Ga0495602_0081183
2237 Ga0495602_0168882
2238 Ga0495602_0217814
2239 Ga0495614_0113347
2240 Ga0496100_0107198
2241 Ga0496100_0199013
2242 Ga0496100_0508561
2243 Ga0496101_0062360
2244 Ga0496101_0301945
2245 Ga0496101_0457601
2246 Ga0496102_0027320
2247 Ga0496102_0091693
2248 Ga0496102_0239598
2249 Ga0496102_0311180
2250 Ga0496102_0409682
2251 Ga0496102_1046365
2252 Ga0496103_0047613
2253 Ga0496103_0089585
2254 Ga0496104_0015955
2255 Ga0496104_0061826
2256 Ga0496104_0141493
2257 Ga0496104_0270991
2258 Ga0496104_0628703
2259 Ga0496104_1793335
2260 Ga0496105_0018946
2261 Ga0496105_0121278
2262 Ga0496105_0153020
2263 Ga0496105_0203353
2264 Ga0496105_0213899
2265 Ga0496105_0637291
2266 Ga0496106_1403938
2267 Ga0496107_0010224
2268 Ga0496107_0074178
2269 Ga0496107_0528634
2270 Ga0496108_0014150
2271 Ga0496108_0054254
2272 Ga0496108_0069497
2273 Ga0496108_0099967
2274 Ga0496108_0271197
2275 Ga0496108_0368207
2276 Ga0496108_1217409
2277 Ga0496109_0011196
2278 Ga0496109_0067691
2279 Ga0496109_0076279
2280 Ga0496109_0135737
2281 Ga0496109_0146641
2282 Ga0496109_0389591
2283 Ga0496109_0389621
2284 Ga0496109_0525402
2285 Ga0496109_0606077
2286 Ga0496109_0658909
2287 Ga0496109_0879501
2288 Ga0496109_1963097
2289 Ga0496110_0223570
2290 Ga0496110_0367153
2291 Ga0496110_0425503
2292 Ga0496110_0444673
2293 Ga0496110_1014147
2294 Ga0496111_0014907
2295 Ga0496111_0124085
2296 Ga0496111_0212254
2297 Ga0496111_0446004
2298 Ga0496112_0204288
2299 Ga0496112_0539445
2300 Ga0496113_0010456
2301 Ga0496113_0069328
2302 Ga0496113_0633864
2303 Ga0496113_1251254
2304 Ga0496114_0064230
2305 Ga0496114_0081630
2306 Ga0496114_0310318
2307 Ga0496114_0429297
2308 Ga0496114_1221534
2309 Ga0496114_1280263
2310 Ga0496114_1800105
2311 Ga0496115_0004348
2312 Ga0496115_0149349
2313 Ga0496115_0274481
2314 Ga0496115_0761295
2315 Ga0496115_0910353
2316 Ga0496117_0049331
2317 Ga0496118_0062966
2318 Ga0496118_0132657
2319 Ga0496122_0000583
2320 Ga0496122_0001054
2321 Ga0496123_0003034
2322 Ga0496124_0001569
2323 Ga0496124_0597899
2324 Ga0496125_0000069
2325 Ga0496126_0146238
2326 Ga0496126_0428152
2327 Ga0496126_0493710
2328 Ga0501321_062720
2329 Ga0501321_064043
2330 Ga0501032_0285140
2331 Ga0501032_0442259
2332 Ga0501034_0233334
2333 Ga0501036_0348777
2334 Ga0501037_0041530
2335 Ga0501037_0247879
2336 Ga0501038_0199662
2337 Ga0501038_0959271
2338 Ga0501039_1229646
2339 Ga0501040_1292022
2340 Ga0501047_0263628
2341 Ga0501047_0472989
2342 Ga0501047_0713849
2343 Ga0501067_0286748
2344 Ga0501070_0000870
2345 Ga0501070_0002439
2346 Ga0501070_0008387
2347 Ga0501070_0119798
2348 Ga0501071_0074886
2349 Ga0501072_0115703
2350 Ga0501073_0010141
2351 Ga0501074_0000165
2352 Ga0501076_0015578
2353 Ga0501079_0000028
2354 Ga0501079_0106786
2355 Ga0501079_0827233
2356 Ga0501080_0000294
2357 Ga0501080_0123710
2358 Ga0501080_0245239
2359 Ga0501080_1612952
2360 Ga0501035_0938581
2361 Ga0501035_1027947
2362 Ga0501044_0047605
2363 Ga0501044_0106545
2364 Ga0501044_0622133
2365 nmdc:mga03n38_196994_c1
2366 nmdc:mga0qj67_254350_c1
2367 nmdc:mga0n895_1106466_c1
2368 nmdc:mga0n895_1443160_c1
2369 nmdc:mga0n895_649741_c1
2370 nmdc:mga0rr50_466932_c1
2371 nmdc:mga08x19_412551_c1
2372 nmdc:mga08x19_531065_c1
2373 nmdc:mga0a205_343328_c1
2374 Ga0495601_0046075
2375 Ga0495601_0065334
2376 Ga0495601_0097862
2377 Ga0495601_0603446
2378 Ga0495601_0784920
2379 Ga0495612_0005449
2380 Ga0495612_0019602
2381 Ga0495612_0053775
2382 Ga0495612_0115923
2383 Ga0495595_0000695
2384 Ga0495595_0003978
2385 Ga0495595_0031873
2386 Ga0495595_0132347
2387 Ga0495595_0175118
2388 Ga0495619_0070377
2389 Ga0495619_0211476
2390 Ga0495619_0225921
2391 Ga0495619_0409132
2392 Ga0495619_0513577
2393 Ga0500604_0021036
2394 Ga0500616_0005761
2395 Ga0500616_0027666
2396 Ga0500627_0431834
2397 Ga0501084_0073828
2398 Ga0501082_0258393
2399 Ga0466962_0094382
2400 Ga0466962_0206295
2401 Ga0466962_0211969
2402 Ga0466962_0401100
2403 Ga0466962_0735411
2404 Ga0530510_0064626
2405 Ga0530510_0881200
2406 2644035741
2407 2644080909
2408 2644663774
2409 2729909339
2410 2812362696
2411 2857482231
2412 2915360294
2413 2935892405
2414 2974319383
2415 2984527591
2416 8054478914

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

41

141

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9479 2 145
1ukk-assembly1.cif.gz_B structure of osmotically inducible protein c from thermus thermophilus 0.9414 2 145
1nye-assembly1.cif.gz_A crystal structure of osmc from e. coli 0.939 1 146
1nye-assembly2.cif.gz_D crystal structure of osmc from e. coli 0.936 1 146
1qwi-assembly1.cif.gz_B crystal structure of e. coli osmc 0.9314 1 146
ID Description Score Start End Superfamily
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9373 2 145 3.30.300.20
1ukkB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9308 2 145 3.30.300.20
1nyeE00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9295 1 146 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9085 48 145 3.30.300.20
6mjnB02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8998 48 145 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A4U3CIK3-F1-model_v4 Peroxiredoxin 0.9906 1 146 GO:0004601
GO:0006979
AF-E9T1M9-F1-model_v4 Peroxiredoxin, OsmC subfamily 0.9899 22 145 GO:0004601
GO:0006979
AF-A0A346BVL7-F1-model_v4 Peroxiredoxin 0.9877 1 146 GO:0004601
GO:0006979
AF-A0A0B8N4J9-F1-model_v4 Peroxiredoxin 0.9856 1 90 GO:0004601
GO:0006979
AF-A0A2W6DJ16-F1-model_v4 Peroxiredoxin 0.9844 18 146 GO:0004601
GO:0006979

Map