F491683
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1208 | 411 | 2416 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10804158|Ga0105238_108041582 |
| Length | 165 |
| Sequence | MPTRTARTAWNGTLEQGSGQVELTSSGVGTYEVSFPKRAADEAGGTTSPEELIAAAHSSCYAMQFSALIAQEGGTPQSLDVQADVTLGPDPAGGFAISGIKITVRGEVEGMDEAKFKEVADAAKAGCPVSKALTGTTITLDAGEMMGCTGNGRPPEPPQPRPNGR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 87 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 88 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 115 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 116 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 117 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 118 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 119 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 137 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 142 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 143 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 210 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 211 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 224 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 225 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 226 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 229 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 232 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 257 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 258 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 261 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 268 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 269 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 270 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 271 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 272 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 273 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 274 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 275 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 276 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 277 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 278 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 279 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 280 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 281 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 282 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 283 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 284 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 285 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 286 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 287 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 288 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 344 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 345 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 346 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 347 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 348 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 349 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 350 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 352 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 353 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 354 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 355 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 356 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 357 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 358 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 359 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 360 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 361 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 362 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 363 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 364 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 385 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 395 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 396 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 397 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 400 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 401 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 402 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 403 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 404 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 405 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 406 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 407 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 408 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 409 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 410 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 411 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.02 |
| Metatranscriptomes | 2.07 |
| Isolates | 0.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.08 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 7.2 |
| Rhizosphere | 88.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105238_10804158 | 3300009551 | Bacteria | 956 |
| 2 | JGI24746J21847_1013548 | 3300001977 | Bacteria | 1185 |
| 3 | JGI24737J22298_10039524 | 3300001990 | Bacteria | 1450 |
| 4 | JGI24737J22298_10078850 | 3300001990 | Bacteria | 981 |
| 5 | JGI24737J22298_10240644 | 3300001990 | Bacteria | 534 |
| 6 | JGI24743J22301_10019798 | 3300001991 | Bacteria | 1279 |
| 7 | JGI24743J22301_10115525 | 3300001991 | Bacteria | 585 |
| 8 | JGI24735J21928_10078215 | 3300002067 | Bacteria | 947 |
| 9 | JGI24745J21846_1001491 | 3300002073 | Bacteria | 2276 |
| 10 | JGI24738J21930_10009655 | 3300002075 | Bacteria | 2166 |
| 11 | JGI24749J21850_1003410 | 3300002076 | Bacteria | 2224 |
| 12 | JGI24744J21845_10007601 | 3300002077 | Bacteria | 2240 |
| 13 | JGI24033J26618_1010355 | 3300002155 | Bacteria | 1098 |
| 14 | JGI24742J22300_10067248 | 3300002244 | Bacteria | 664 |
| 15 | Ga0006778J45830_1044288 | 3300003162 | Bacteria | 514 |
| 16 | JGI25406J46586_10002391 | 3300003203 | Bacteria | 8870 |
| 17 | Ga0007429J51699_1047141 | 3300003579 | Bacteria | 550 |
| 18 | JGI25404J52841_10011303 | 3300003659 | Bacteria | 1923 |
| 19 | Ga0070658_10001334 | 3300005327 | Bacteria | 21041 |
| 20 | Ga0070658_10464077 | 3300005327 | Bacteria | 1092 |
| 21 | Ga0070676_10085328 | 3300005328 | Bacteria | 1924 |
| 22 | Ga0070683_100177406 | 3300005329 | Bacteria | 2022 |
| 23 | Ga0070683_100204454 | 3300005329 | Bacteria | 1876 |
| 24 | Ga0070690_100109719 | 3300005330 | Bacteria | 1840 |
| 25 | Ga0070690_100413224 | 3300005330 | Bacteria | 993 |
| 26 | Ga0068869_100290372 | 3300005334 | Bacteria | 1317 |
| 27 | Ga0070666_10018299 | 3300005335 | Bacteria | 4502 |
| 28 | Ga0070666_10178697 | 3300005335 | Bacteria | 1488 |
| 29 | Ga0070680_100246607 | 3300005336 | Bacteria | 1510 |
| 30 | Ga0070682_100058203 | 3300005337 | Bacteria | 2437 |
| 31 | Ga0070682_100272843 | 3300005337 | Bacteria | 1229 |
| 32 | Ga0070682_100484551 | 3300005337 | Bacteria | 955 |
| 33 | Ga0068868_100202855 | 3300005338 | Bacteria | 1654 |
| 34 | Ga0070660_100446377 | 3300005339 | Bacteria | 1073 |
| 35 | Ga0070689_100393802 | 3300005340 | Bacteria | 1170 |
| 36 | Ga0070691_10010169 | 3300005341 | Bacteria | 4288 |
| 37 | Ga0070691_10145861 | 3300005341 | Bacteria | 1210 |
| 38 | Ga0070687_100002082 | 3300005343 | Bacteria | 7368 |
| 39 | Ga0070661_100006268 | 3300005344 | Bacteria | 8206 |
| 40 | Ga0070661_100466744 | 3300005344 | Bacteria | 1006 |
| 41 | Ga0070692_10009092 | 3300005345 | Bacteria | 4464 |
| 42 | Ga0070692_10043539 | 3300005345 | Bacteria | 2309 |
| 43 | Ga0070692_10154244 | 3300005345 | Bacteria | 1311 |
| 44 | Ga0070668_100081589 | 3300005347 | Bacteria | 2535 |
| 45 | Ga0070668_100097032 | 3300005347 | Bacteria | 2331 |
| 46 | Ga0070668_100279476 | 3300005347 | Bacteria | 1394 |
| 47 | Ga0070668_101367960 | 3300005347 | Bacteria | 645 |
| 48 | Ga0070669_100098984 | 3300005353 | Bacteria | 2197 |
| 49 | Ga0070669_100309009 | 3300005353 | Bacteria | 1274 |
| 50 | Ga0070669_101185950 | 3300005353 | Bacteria | 659 |
| 51 | Ga0070675_100021579 | 3300005354 | Bacteria | 5146 |
| 52 | Ga0070675_100025886 | 3300005354 | Bacteria | 4705 |
| 53 | Ga0070671_100130792 | 3300005355 | Bacteria | 2114 |
| 54 | Ga0070674_100071023 | 3300005356 | Bacteria | 2461 |
| 55 | Ga0070674_100130095 | 3300005356 | Bacteria | 1875 |
| 56 | Ga0070674_100150958 | 3300005356 | Bacteria | 1753 |
| 57 | Ga0070673_100049541 | 3300005364 | Bacteria | 3280 |
| 58 | Ga0070673_100773630 | 3300005364 | Bacteria | 885 |
| 59 | Ga0070673_100857848 | 3300005364 | Bacteria | 840 |
| 60 | Ga0070659_100026681 | 3300005366 | Bacteria | 4446 |
| 61 | Ga0070659_100081814 | 3300005366 | Bacteria | 2579 |
| 62 | Ga0070659_100617344 | 3300005366 | Bacteria | 933 |
| 63 | Ga0070667_100176437 | 3300005367 | Bacteria | 1889 |
| 64 | Ga0070667_100840872 | 3300005367 | Bacteria | 853 |
| 65 | Ga0070703_10013561 | 3300005406 | Bacteria | 2316 |
| 66 | Ga0070709_10069886 | 3300005434 | Bacteria | 2262 |
| 67 | Ga0070709_10136634 | 3300005434 | Bacteria | 1680 |
| 68 | Ga0070709_10384348 | 3300005434 | Bacteria | 1044 |
| 69 | Ga0070709_10610528 | 3300005434 | Bacteria | 841 |
| 70 | Ga0070709_10625097 | 3300005434 | Bacteria | 831 |
| 71 | Ga0070714_100001005 | 3300005435 | Bacteria | 20110 |
| 72 | Ga0070714_100010667 | 3300005435 | Bacteria | 7270 |
| 73 | Ga0070714_100029966 | 3300005435 | Bacteria | 4527 |
| 74 | Ga0070714_100108336 | 3300005435 | Bacteria | 2456 |
| 75 | Ga0070714_100148840 | 3300005435 | Bacteria | 2107 |
| 76 | Ga0070714_100283197 | 3300005435 | Bacteria | 1541 |
| 77 | Ga0070714_100357625 | 3300005435 | Bacteria | 1372 |
| 78 | Ga0070714_101209753 | 3300005435 | Bacteria | 737 |
| 79 | Ga0070714_101548794 | 3300005435 | Bacteria | 647 |
| 80 | Ga0070713_100000980 | 3300005436 | Bacteria | 18279 |
| 81 | Ga0070713_100016714 | 3300005436 | Bacteria | 5524 |
| 82 | Ga0070713_100031859 | 3300005436 | Bacteria | 4204 |
| 83 | Ga0070713_100081557 | 3300005436 | Bacteria | 2760 |
| 84 | Ga0070713_100151629 | 3300005436 | Bacteria | 2062 |
| 85 | Ga0070713_100159598 | 3300005436 | Bacteria | 2012 |
| 86 | Ga0070713_100238177 | 3300005436 | Bacteria | 1656 |
| 87 | Ga0070713_100410352 | 3300005436 | Bacteria | 1266 |
| 88 | Ga0070713_100899245 | 3300005436 | Bacteria | 851 |
| 89 | Ga0070713_101080159 | 3300005436 | Bacteria | 775 |
| 90 | Ga0070710_10000603 | 3300005437 | Bacteria | 17140 |
| 91 | Ga0070710_10029778 | 3300005437 | Bacteria | 2931 |
| 92 | Ga0070710_10070485 | 3300005437 | Bacteria | 2013 |
| 93 | Ga0070710_10190414 | 3300005437 | Bacteria | 1290 |
| 94 | Ga0070710_10321441 | 3300005437 | Bacteria | 1016 |
| 95 | Ga0070710_10427196 | 3300005437 | Bacteria | 893 |
| 96 | Ga0070701_10011409 | 3300005438 | Bacteria | 3971 |
| 97 | Ga0070701_10163401 | 3300005438 | Bacteria | 1291 |
| 98 | Ga0070711_100019460 | 3300005439 | Bacteria | 4356 |
| 99 | Ga0070711_100025744 | 3300005439 | Bacteria | 3851 |
| 100 | Ga0070711_100032188 | 3300005439 | Bacteria | 3485 |
| 101 | Ga0070711_100081106 | 3300005439 | Bacteria | 2311 |
| 102 | Ga0070711_100314026 | 3300005439 | Bacteria | 1250 |
| 103 | Ga0070711_100316936 | 3300005439 | Bacteria | 1245 |
| 104 | Ga0070711_100402370 | 3300005439 | Bacteria | 1111 |
| 105 | Ga0070700_100023955 | 3300005441 | Bacteria | 3577 |
| 106 | Ga0070700_100516188 | 3300005441 | Bacteria | 922 |
| 107 | Ga0070694_100552815 | 3300005444 | Bacteria | 922 |
| 108 | Ga0070708_100000689 | 3300005445 | Bacteria | 25705 |
| 109 | Ga0070708_100153080 | 3300005445 | Bacteria | 2146 |
| 110 | Ga0070708_100165877 | 3300005445 | Bacteria | 2060 |
| 111 | Ga0070663_100365905 | 3300005455 | Bacteria | 1171 |
| 112 | Ga0070678_100031596 | 3300005456 | Bacteria | 3655 |
| 113 | Ga0070681_10535103 | 3300005458 | Bacteria | 1085 |
| 114 | Ga0068867_100021638 | 3300005459 | Bacteria | 4590 |
| 115 | Ga0068867_100142992 | 3300005459 | Bacteria | 1872 |
| 116 | Ga0068867_100246913 | 3300005459 | Bacteria | 1450 |
| 117 | Ga0070685_10005567 | 3300005466 | Bacteria | 6390 |
| 118 | Ga0070685_10061040 | 3300005466 | Bacteria | 2206 |
| 119 | Ga0070706_100043596 | 3300005467 | Bacteria | 4146 |
| 120 | Ga0070706_100062230 | 3300005467 | Bacteria | 3448 |
| 121 | Ga0070706_100176904 | 3300005467 | Bacteria | 1992 |
| 122 | Ga0070706_100656209 | 3300005467 | Bacteria | 974 |
| 123 | Ga0070706_100909176 | 3300005467 | Bacteria | 813 |
| 124 | Ga0070706_101256552 | 3300005467 | Bacteria | 680 |
| 125 | Ga0070707_100068631 | 3300005468 | Bacteria | 3413 |
| 126 | Ga0070707_100071847 | 3300005468 | Bacteria | 3334 |
| 127 | Ga0070707_100225567 | 3300005468 | Bacteria | 1824 |
| 128 | Ga0070707_100701923 | 3300005468 | Bacteria | 974 |
| 129 | Ga0070707_100853199 | 3300005468 | Bacteria | 875 |
| 130 | Ga0070698_100008291 | 3300005471 | Bacteria | 11233 |
| 131 | Ga0070698_100127386 | 3300005471 | Bacteria | 2503 |
| 132 | Ga0070698_100299881 | 3300005471 | Bacteria | 1538 |
| 133 | Ga0070698_100566646 | 3300005471 | Bacteria | 1075 |
| 134 | Ga0070698_101099057 | 3300005471 | Bacteria | 744 |
| 135 | Ga0070699_100000598 | 3300005518 | Bacteria | 33972 |
| 136 | Ga0070699_100616569 | 3300005518 | Bacteria | 990 |
| 137 | Ga0070699_101126584 | 3300005518 | Bacteria | 720 |
| 138 | Ga0070679_100192520 | 3300005530 | Bacteria | 2008 |
| 139 | Ga0070679_100241362 | 3300005530 | Bacteria | 1764 |
| 140 | Ga0070679_101220756 | 3300005530 | Bacteria | 697 |
| 141 | Ga0070684_100176846 | 3300005535 | Bacteria | 1939 |
| 142 | Ga0070684_101203255 | 3300005535 | Bacteria | 713 |
| 143 | Ga0070697_100020176 | 3300005536 | Bacteria | 5269 |
| 144 | Ga0070697_100048802 | 3300005536 | Bacteria | 3433 |
| 145 | Ga0068853_100059745 | 3300005539 | Bacteria | 3294 |
| 146 | Ga0068853_100545927 | 3300005539 | Bacteria | 1097 |
| 147 | Ga0070672_100017922 | 3300005543 | Bacteria | 5107 |
| 148 | Ga0070672_100155987 | 3300005543 | Bacteria | 1891 |
| 149 | Ga0070686_100133122 | 3300005544 | Bacteria | 1722 |
| 150 | Ga0070686_100283100 | 3300005544 | Bacteria | 1223 |
| 151 | Ga0070686_101119967 | 3300005544 | Bacteria | 651 |
| 152 | Ga0070695_100081322 | 3300005545 | Bacteria | 2143 |
| 153 | Ga0070665_100232955 | 3300005548 | Bacteria | 1842 |
| 154 | Ga0070665_100464189 | 3300005548 | Bacteria | 1276 |
| 155 | Ga0070665_100580474 | 3300005548 | Bacteria | 1134 |
| 156 | Ga0070704_100131820 | 3300005549 | Bacteria | 1938 |
| 157 | Ga0070704_100581480 | 3300005549 | Bacteria | 982 |
| 158 | Ga0068855_100376944 | 3300005563 | Bacteria | 1558 |
| 159 | Ga0068855_100772716 | 3300005563 | Bacteria | 1023 |
| 160 | Ga0068855_101929810 | 3300005563 | Bacteria | 598 |
| 161 | Ga0070664_100052167 | 3300005564 | Bacteria | 3463 |
| 162 | Ga0070664_100419259 | 3300005564 | Bacteria | 1226 |
| 163 | Ga0070664_100760209 | 3300005564 | Bacteria | 905 |
| 164 | Ga0068857_100260488 | 3300005577 | Bacteria | 1591 |
| 165 | Ga0068857_100448452 | 3300005577 | Bacteria | 1206 |
| 166 | Ga0068854_100229499 | 3300005578 | Bacteria | 1473 |
| 167 | Ga0068854_100764063 | 3300005578 | Bacteria | 839 |
| 168 | Ga0068856_100052348 | 3300005614 | Bacteria | 4025 |
| 169 | Ga0068856_102094204 | 3300005614 | Bacteria | 575 |
| 170 | Ga0070702_100018849 | 3300005615 | Bacteria | 3587 |
| 171 | Ga0070702_100042485 | 3300005615 | Bacteria | 2556 |
| 172 | Ga0068852_100023223 | 3300005616 | Bacteria | 4988 |
| 173 | Ga0068852_100180961 | 3300005616 | Bacteria | 1982 |
| 174 | Ga0068852_100305460 | 3300005616 | Bacteria | 1541 |
| 175 | Ga0068852_100764183 | 3300005616 | Bacteria | 979 |
| 176 | Ga0068852_101453038 | 3300005616 | Bacteria | 708 |
| 177 | Ga0068864_100036842 | 3300005618 | Bacteria | 4171 |
| 178 | Ga0068864_100453331 | 3300005618 | Bacteria | 1227 |
| 179 | Ga0068864_101864698 | 3300005618 | Bacteria | 607 |
| 180 | Ga0068866_10131775 | 3300005718 | Bacteria | 1423 |
| 181 | Ga0068861_100016968 | 3300005719 | Bacteria | 5163 |
| 182 | Ga0068861_100058479 | 3300005719 | Bacteria | 2948 |
| 183 | Ga0068861_100544226 | 3300005719 | Bacteria | 1057 |
| 184 | Ga0068861_101296068 | 3300005719 | Bacteria | 708 |
| 185 | Ga0068851_10115374 | 3300005834 | Bacteria | 1438 |
| 186 | Ga0068870_10006468 | 3300005840 | Bacteria | 5168 |
| 187 | Ga0068870_10146217 | 3300005840 | Bacteria | 1388 |
| 188 | Ga0068863_100802788 | 3300005841 | Bacteria | 939 |
| 189 | Ga0068863_100909255 | 3300005841 | Bacteria | 881 |
| 190 | Ga0068858_100333310 | 3300005842 | Bacteria | 1451 |
| 191 | Ga0068858_100477516 | 3300005842 | Bacteria | 1203 |
| 192 | Ga0068858_100719564 | 3300005842 | Bacteria | 972 |
| 193 | Ga0068858_101927015 | 3300005842 | Bacteria | 584 |
| 194 | Ga0068860_100118000 | 3300005843 | Bacteria | 2539 |
| 195 | Ga0068860_101861056 | 3300005843 | Bacteria | 623 |
| 196 | Ga0081455_10001042 | 3300005937 | Bacteria | 34961 |
| 197 | Ga0081540_1000155 | 3300005983 | Bacteria | 70266 |
| 198 | Ga0081539_10000182 | 3300005985 | Bacteria | 148133 |
| 199 | Ga0081539_10015694 | 3300005985 | Bacteria | 5483 |
| 200 | Ga0081539_10048728 | 3300005985 | Bacteria | 2408 |
| 201 | Ga0081539_10078950 | 3300005985 | Bacteria | 1736 |
| 202 | Ga0070717_10014112 | 3300006028 | Bacteria | 6140 |
| 203 | Ga0070717_10023465 | 3300006028 | Bacteria | 4888 |
| 204 | Ga0070717_10025511 | 3300006028 | Bacteria | 4702 |
| 205 | Ga0070717_10113142 | 3300006028 | Bacteria | 2317 |
| 206 | Ga0070717_10173693 | 3300006028 | Bacteria | 1875 |
| 207 | Ga0070717_10196325 | 3300006028 | Bacteria | 1765 |
| 208 | Ga0070717_10235643 | 3300006028 | Bacteria | 1612 |
| 209 | Ga0070717_10396267 | 3300006028 | Bacteria | 1240 |
| 210 | Ga0070717_10457716 | 3300006028 | Bacteria | 1150 |
| 211 | Ga0070717_10634596 | 3300006028 | Bacteria | 969 |
| 212 | Ga0070717_10775984 | 3300006028 | Bacteria | 871 |
| 213 | Ga0070717_10861528 | 3300006028 | Bacteria | 825 |
| 214 | Ga0070717_10928106 | 3300006028 | Bacteria | 792 |
| 215 | Ga0075365_10935736 | 3300006038 | Bacteria | 611 |
| 216 | Ga0075364_10279144 | 3300006051 | Bacteria | 1136 |
| 217 | Ga0075432_10137706 | 3300006058 | Bacteria | 929 |
| 218 | Ga0070715_10244523 | 3300006163 | Bacteria | 935 |
| 219 | Ga0070715_10299384 | 3300006163 | Bacteria | 860 |
| 220 | Ga0070715_10299591 | 3300006163 | Bacteria | 860 |
| 221 | Ga0070715_10523725 | 3300006163 | Bacteria | 682 |
| 222 | Ga0070715_10608017 | 3300006163 | Bacteria | 642 |
| 223 | Ga0070716_100000609 | 3300006173 | Bacteria | 15132 |
| 224 | Ga0070716_100025893 | 3300006173 | Bacteria | 3136 |
| 225 | Ga0070716_100392330 | 3300006173 | Bacteria | 996 |
| 226 | Ga0070716_100501181 | 3300006173 | Bacteria | 896 |
| 227 | Ga0070712_100013755 | 3300006175 | Bacteria | 5177 |
| 228 | Ga0070712_100082193 | 3300006175 | Bacteria | 2336 |
| 229 | Ga0070712_100133654 | 3300006175 | Bacteria | 1883 |
| 230 | Ga0070712_100221006 | 3300006175 | Bacteria | 1500 |
| 231 | Ga0070712_100224884 | 3300006175 | Bacteria | 1487 |
| 232 | Ga0070712_100375282 | 3300006175 | Bacteria | 1169 |
| 233 | Ga0070712_100406524 | 3300006175 | Bacteria | 1125 |
| 234 | Ga0070712_100518902 | 3300006175 | Bacteria | 1000 |
| 235 | Ga0070712_100713948 | 3300006175 | Bacteria | 855 |
| 236 | Ga0070712_100714242 | 3300006175 | Bacteria | 855 |
| 237 | Ga0075367_10378267 | 3300006178 | Bacteria | 895 |
| 238 | Ga0097621_100080443 | 3300006237 | Bacteria | 2710 |
| 239 | Ga0075370_10400925 | 3300006353 | Bacteria | 823 |
| 240 | Ga0075428_100370093 | 3300006844 | Bacteria | 1537 |
| 241 | Ga0075428_100505329 | 3300006844 | Bacteria | 1293 |
| 242 | Ga0075428_100523460 | 3300006844 | Bacteria | 1268 |
| 243 | Ga0075430_100403872 | 3300006846 | Bacteria | 1128 |
| 244 | Ga0075433_10150008 | 3300006852 | Bacteria | 2074 |
| 245 | Ga0075434_101178146 | 3300006871 | Bacteria | 778 |
| 246 | Ga0075434_102212997 | 3300006871 | Bacteria | 553 |
| 247 | Ga0068865_100048531 | 3300006881 | Bacteria | 2922 |
| 248 | Ga0068865_100099173 | 3300006881 | Bacteria | 2129 |
| 249 | Ga0075436_100398779 | 3300006914 | Bacteria | 997 |
| 250 | Ga0075436_100410951 | 3300006914 | Bacteria | 981 |
| 251 | Ga0075435_100514271 | 3300007076 | Bacteria | 1035 |
| 252 | Ga0075435_101313102 | 3300007076 | Bacteria | 634 |
| 253 | Ga0099795_10171914 | 3300007788 | Bacteria | 900 |
| 254 | Ga0105240_10168832 | 3300009093 | Bacteria | 2593 |
| 255 | Ga0105240_10494076 | 3300009093 | Bacteria | 1362 |
| 256 | Ga0111539_11143479 | 3300009094 | Bacteria | 905 |
| 257 | Ga0105245_10044818 | 3300009098 | Bacteria | 3948 |
| 258 | Ga0105245_10184743 | 3300009098 | Bacteria | 1994 |
| 259 | Ga0105245_10909394 | 3300009098 | Bacteria | 922 |
| 260 | Ga0105247_10260883 | 3300009101 | Bacteria | 1188 |
| 261 | Ga0105247_11138636 | 3300009101 | Bacteria | 618 |
| 262 | Ga0105243_10008770 | 3300009148 | Bacteria | 7744 |
| 263 | Ga0105243_10213376 | 3300009148 | Bacteria | 1701 |
| 264 | Ga0105242_10084985 | 3300009176 | Bacteria | 2653 |
| 265 | Ga0105242_10311109 | 3300009176 | Bacteria | 1441 |
| 266 | Ga0105248_10026802 | 3300009177 | Bacteria | 6410 |
| 267 | Ga0105248_11563572 | 3300009177 | Bacteria | 747 |
| 268 | Ga0105248_12275657 | 3300009177 | Bacteria | 617 |
| 269 | Ga0105237_11389034 | 3300009545 | Bacteria | 708 |
| 270 | Ga0105238_10536529 | 3300009551 | Bacteria | 1173 |
| 271 | Ga0105238_11115682 | 3300009551 | Bacteria | 812 |
| 272 | Ga0105249_10020433 | 3300009553 | Bacteria | 5919 |
| 273 | Ga0105249_13110612 | 3300009553 | Bacteria | 533 |
| 274 | Ga0105239_10038166 | 3300010375 | Bacteria | 5264 |
| 275 | Ga0105239_10206724 | 3300010375 | Bacteria | 2200 |
| 276 | Ga0105239_10979084 | 3300010375 | Bacteria | 972 |
| 277 | Ga0105246_10186261 | 3300011119 | Bacteria | 1603 |
| 278 | Ga0157346_1006344 | 3300012480 | Bacteria | 759 |
| 279 | Ga0157341_1014422 | 3300012494 | Bacteria | 717 |
| 280 | Ga0157345_1006121 | 3300012498 | Bacteria | 949 |
| 281 | Ga0157339_1002908 | 3300012505 | Bacteria | 1195 |
| 282 | Ga0157342_1025667 | 3300012507 | Bacteria | 713 |
| 283 | Ga0157338_1009154 | 3300012515 | Bacteria | 975 |
| 284 | Ga0157371_10270031 | 3300013102 | Bacteria | 1227 |
| 285 | Ga0157370_10195802 | 3300013104 | Bacteria | 1876 |
| 286 | Ga0157370_10206041 | 3300013104 | Bacteria | 1823 |
| 287 | Ga0157369_10005983 | 3300013105 | Bacteria | 14130 |
| 288 | Ga0157369_10287479 | 3300013105 | Bacteria | 1712 |
| 289 | Ga0157369_10384656 | 3300013105 | Bacteria | 1456 |
| 290 | Ga0157369_10476015 | 3300013105 | Bacteria | 1292 |
| 291 | Ga0157369_10740358 | 3300013105 | Bacteria | 1012 |
| 292 | Ga0157369_10740414 | 3300013105 | Bacteria | 1012 |
| 293 | Ga0157374_10090784 | 3300013296 | Bacteria | 2912 |
| 294 | Ga0157374_10606988 | 3300013296 | Bacteria | 1104 |
| 295 | Ga0157374_10670058 | 3300013296 | Bacteria | 1050 |
| 296 | Ga0157374_10719302 | 3300013296 | Bacteria | 1012 |
| 297 | Ga0157374_10747764 | 3300013296 | Bacteria | 992 |
| 298 | Ga0157378_10177599 | 3300013297 | Bacteria | 2001 |
| 299 | Ga0157378_12290282 | 3300013297 | Bacteria | 592 |
| 300 | Ga0163162_10151792 | 3300013306 | Bacteria | 2435 |
| 301 | Ga0163162_10163961 | 3300013306 | Bacteria | 2346 |
| 302 | Ga0157372_10024275 | 3300013307 | Bacteria | 6583 |
| 303 | Ga0157372_10346614 | 3300013307 | Bacteria | 1730 |
| 304 | Ga0157372_10624214 | 3300013307 | Bacteria | 1256 |
| 305 | Ga0157372_10899177 | 3300013307 | Bacteria | 1027 |
| 306 | Ga0157372_12202267 | 3300013307 | Bacteria | 633 |
| 307 | Ga0157375_10027776 | 3300013308 | Bacteria | 5294 |
| 308 | Ga0157375_11047718 | 3300013308 | Bacteria | 953 |
| 309 | Ga0157375_11581704 | 3300013308 | Bacteria | 775 |
| 310 | Ga0157375_12461602 | 3300013308 | Bacteria | 621 |
| 311 | Ga0163163_10051454 | 3300014325 | Bacteria | 4062 |
| 312 | Ga0163163_10279240 | 3300014325 | Bacteria | 1722 |
| 313 | Ga0163163_12199884 | 3300014325 | Bacteria | 611 |
| 314 | Ga0157380_10071193 | 3300014326 | Bacteria | 2812 |
| 315 | Ga0157380_10244361 | 3300014326 | Bacteria | 1620 |
| 316 | Ga0157380_10365665 | 3300014326 | Bacteria | 1355 |
| 317 | Ga0157380_11435823 | 3300014326 | Bacteria | 741 |
| 318 | Ga0182008_10206569 | 3300014497 | Bacteria | 1001 |
| 319 | Ga0182008_10491442 | 3300014497 | Bacteria | 673 |
| 320 | Ga0157377_10006429 | 3300014745 | Bacteria | 5607 |
| 321 | Ga0157377_10102607 | 3300014745 | Bacteria | 1707 |
| 322 | Ga0157377_10370711 | 3300014745 | Bacteria | 966 |
| 323 | Ga0157379_10139721 | 3300014968 | Bacteria | 2183 |
| 324 | Ga0157379_10163456 | 3300014968 | Bacteria | 2009 |
| 325 | Ga0197907_10508658 | 3300020069 | Bacteria | 4002 |
| 326 | Ga0197907_10622865 | 3300020069 | Bacteria | 1776 |
| 327 | Ga0197907_11109172 | 3300020069 | Bacteria | 506 |
| 328 | Ga0206356_11565027 | 3300020070 | Bacteria | 709 |
| 329 | Ga0206356_11660410 | 3300020070 | Bacteria | 1763 |
| 330 | Ga0206356_11707227 | 3300020070 | Bacteria | 517 |
| 331 | Ga0206349_1207593 | 3300020075 | Bacteria | 524 |
| 332 | Ga0206349_1275547 | 3300020075 | Bacteria | 502 |
| 333 | Ga0206355_1328187 | 3300020076 | Bacteria | 3694 |
| 334 | Ga0206351_10280240 | 3300020077 | Bacteria | 1334 |
| 335 | Ga0206350_10940578 | 3300020080 | Bacteria | 1157 |
| 336 | Ga0206354_10091345 | 3300020081 | Unclassified | 599 |
| 337 | Ga0206354_11716454 | 3300020081 | Bacteria | 2858 |
| 338 | Ga0206353_10052697 | 3300020082 | Bacteria | 1878 |
| 339 | Ga0206353_11007125 | 3300020082 | Bacteria | 739 |
| 340 | Ga0206353_11153682 | 3300020082 | Bacteria | 966 |
| 341 | Ga0206353_11908304 | 3300020082 | Bacteria | 4604 |
| 342 | Ga0213876_10488631 | 3300021384 | Bacteria | 655 |
| 343 | Ga0213875_10001023 | 3300021388 | Bacteria | 19832 |
| 344 | Ga0213875_10061756 | 3300021388 | Bacteria | 1753 |
| 345 | Ga0224712_10218296 | 3300022467 | Bacteria | 872 |
| 346 | Ga0224712_10267560 | 3300022467 | Bacteria | 793 |
| 347 | Ga0224712_10553542 | 3300022467 | Bacteria | 559 |
| 348 | Ga0224712_10689319 | 3300022467 | Bacteria | 502 |
| 349 | Ga0207656_10497837 | 3300025321 | Bacteria | 618 |
| 350 | Ga0207653_10006126 | 3300025885 | Bacteria | 3749 |
| 351 | Ga0207692_10003642 | 3300025898 | Bacteria | 6034 |
| 352 | Ga0207692_10030932 | 3300025898 | Bacteria | 2558 |
| 353 | Ga0207692_10185365 | 3300025898 | Bacteria | 1215 |
| 354 | Ga0207692_10393963 | 3300025898 | Bacteria | 862 |
| 355 | Ga0207642_10073959 | 3300025899 | Bacteria | 1631 |
| 356 | Ga0207710_10598489 | 3300025900 | Bacteria | 576 |
| 357 | Ga0207688_10313444 | 3300025901 | Bacteria | 961 |
| 358 | Ga0207680_10068305 | 3300025903 | Bacteria | 2192 |
| 359 | Ga0207647_10316269 | 3300025904 | Bacteria | 887 |
| 360 | Ga0207647_10526590 | 3300025904 | Bacteria | 657 |
| 361 | Ga0207685_10265100 | 3300025905 | Bacteria | 837 |
| 362 | Ga0207685_10392355 | 3300025905 | Bacteria | 710 |
| 363 | Ga0207699_10005541 | 3300025906 | Bacteria | 6055 |
| 364 | Ga0207699_10010766 | 3300025906 | Bacteria | 4601 |
| 365 | Ga0207699_10015437 | 3300025906 | Bacteria | 3967 |
| 366 | Ga0207699_10018303 | 3300025906 | Bacteria | 3709 |
| 367 | Ga0207699_10136664 | 3300025906 | Bacteria | 1606 |
| 368 | Ga0207699_10291591 | 3300025906 | Bacteria | 1137 |
| 369 | Ga0207699_10463688 | 3300025906 | Bacteria | 910 |
| 370 | Ga0207645_10134402 | 3300025907 | Bacteria | 1611 |
| 371 | Ga0207643_10007384 | 3300025908 | Bacteria | 5897 |
| 372 | Ga0207643_10050196 | 3300025908 | Bacteria | 2365 |
| 373 | Ga0207705_10000348 | 3300025909 | Bacteria | 41776 |
| 374 | Ga0207705_10394779 | 3300025909 | Bacteria | 1069 |
| 375 | Ga0207705_11406801 | 3300025909 | Bacteria | 530 |
| 376 | Ga0207684_10028586 | 3300025910 | Bacteria | 4750 |
| 377 | Ga0207684_10033261 | 3300025910 | Bacteria | 4384 |
| 378 | Ga0207684_10100342 | 3300025910 | Bacteria | 2474 |
| 379 | Ga0207684_10217379 | 3300025910 | Bacteria | 1649 |
| 380 | Ga0207707_10355858 | 3300025912 | Bacteria | 1261 |
| 381 | Ga0207671_11086843 | 3300025914 | Bacteria | 629 |
| 382 | Ga0207693_10020749 | 3300025915 | Bacteria | 5225 |
| 383 | Ga0207693_10026732 | 3300025915 | Bacteria | 4566 |
| 384 | Ga0207693_10063429 | 3300025915 | Bacteria | 2894 |
| 385 | Ga0207693_10126083 | 3300025915 | Bacteria | 2012 |
| 386 | Ga0207693_10473256 | 3300025915 | Bacteria | 978 |
| 387 | Ga0207693_10620939 | 3300025915 | Bacteria | 841 |
| 388 | Ga0207663_10022954 | 3300025916 | Bacteria | 3573 |
| 389 | Ga0207663_10129192 | 3300025916 | Bacteria | 1743 |
| 390 | Ga0207663_10190431 | 3300025916 | Bacteria | 1472 |
| 391 | Ga0207663_10235018 | 3300025916 | Bacteria | 1341 |
| 392 | Ga0207663_10289353 | 3300025916 | Bacteria | 1220 |
| 393 | Ga0207663_10600969 | 3300025916 | Bacteria | 864 |
| 394 | Ga0207660_10200988 | 3300025917 | Bacteria | 1557 |
| 395 | Ga0207660_10501004 | 3300025917 | Bacteria | 985 |
| 396 | Ga0207662_10020778 | 3300025918 | Bacteria | 3747 |
| 397 | Ga0207662_10042221 | 3300025918 | Bacteria | 2688 |
| 398 | Ga0207662_10055325 | 3300025918 | Bacteria | 2368 |
| 399 | Ga0207649_10046176 | 3300025920 | Bacteria | 2674 |
| 400 | Ga0207649_10835734 | 3300025920 | Bacteria | 720 |
| 401 | Ga0207652_10101526 | 3300025921 | Bacteria | 2541 |
| 402 | Ga0207652_10290539 | 3300025921 | Bacteria | 1475 |
| 403 | Ga0207646_10000455 | 3300025922 | Bacteria | 54634 |
| 404 | Ga0207646_10047539 | 3300025922 | Bacteria | 3849 |
| 405 | Ga0207646_10060714 | 3300025922 | Bacteria | 3375 |
| 406 | Ga0207646_10072140 | 3300025922 | Bacteria | 3084 |
| 407 | Ga0207646_11222156 | 3300025922 | Bacteria | 658 |
| 408 | Ga0207646_11264748 | 3300025922 | Bacteria | 645 |
| 409 | Ga0207646_11273317 | 3300025922 | Bacteria | 643 |
| 410 | Ga0207681_10162550 | 3300025923 | Bacteria | 1685 |
| 411 | Ga0207681_10211856 | 3300025923 | Bacteria | 1494 |
| 412 | Ga0207694_10198116 | 3300025924 | Bacteria | 1633 |
| 413 | Ga0207694_10688840 | 3300025924 | Bacteria | 862 |
| 414 | Ga0207694_11502000 | 3300025924 | Bacteria | 569 |
| 415 | Ga0207659_10048286 | 3300025926 | Bacteria | 3015 |
| 416 | Ga0207687_10090470 | 3300025927 | Bacteria | 2230 |
| 417 | Ga0207687_10203536 | 3300025927 | Bacteria | 1549 |
| 418 | Ga0207687_10301569 | 3300025927 | Bacteria | 1291 |
| 419 | Ga0207687_10752475 | 3300025927 | Bacteria | 829 |
| 420 | Ga0207687_11427047 | 3300025927 | Bacteria | 595 |
| 421 | Ga0207700_10003128 | 3300025928 | Bacteria | 9556 |
| 422 | Ga0207700_10032514 | 3300025928 | Bacteria | 3722 |
| 423 | Ga0207700_10041231 | 3300025928 | Bacteria | 3376 |
| 424 | Ga0207700_10095506 | 3300025928 | Bacteria | 2358 |
| 425 | Ga0207700_10127550 | 3300025928 | Bacteria | 2072 |
| 426 | Ga0207700_10141530 | 3300025928 | Bacteria | 1977 |
| 427 | Ga0207700_10459867 | 3300025928 | Bacteria | 1123 |
| 428 | Ga0207700_10919010 | 3300025928 | Bacteria | 783 |
| 429 | Ga0207700_10968530 | 3300025928 | Bacteria | 761 |
| 430 | Ga0207700_11014012 | 3300025928 | Bacteria | 743 |
| 431 | Ga0207664_10000750 | 3300025929 | Bacteria | 22079 |
| 432 | Ga0207664_10008250 | 3300025929 | Bacteria | 7254 |
| 433 | Ga0207664_10011323 | 3300025929 | Bacteria | 6330 |
| 434 | Ga0207664_10025821 | 3300025929 | Bacteria | 4432 |
| 435 | Ga0207664_10091634 | 3300025929 | Bacteria | 2493 |
| 436 | Ga0207664_10107229 | 3300025929 | Bacteria | 2317 |
| 437 | Ga0207664_10146802 | 3300025929 | Bacteria | 2001 |
| 438 | Ga0207664_10219706 | 3300025929 | Bacteria | 1647 |
| 439 | Ga0207664_10352815 | 3300025929 | Bacteria | 1302 |
| 440 | Ga0207664_10427580 | 3300025929 | Bacteria | 1180 |
| 441 | Ga0207664_10666644 | 3300025929 | Bacteria | 935 |
| 442 | Ga0207644_10385746 | 3300025931 | Bacteria | 1143 |
| 443 | Ga0207644_10480077 | 3300025931 | Bacteria | 1024 |
| 444 | Ga0207644_10518686 | 3300025931 | Bacteria | 984 |
| 445 | Ga0207690_10035623 | 3300025932 | Bacteria | 3217 |
| 446 | Ga0207690_10376563 | 3300025932 | Bacteria | 1127 |
| 447 | Ga0207690_10701253 | 3300025932 | Bacteria | 832 |
| 448 | Ga0207706_10109079 | 3300025933 | Bacteria | 2436 |
| 449 | Ga0207686_10230814 | 3300025934 | Bacteria | 1342 |
| 450 | Ga0207709_10017782 | 3300025935 | Bacteria | 3973 |
| 451 | Ga0207709_10097539 | 3300025935 | Bacteria | 1936 |
| 452 | Ga0207709_10556548 | 3300025935 | Bacteria | 903 |
| 453 | Ga0207670_10078997 | 3300025936 | Bacteria | 2296 |
| 454 | Ga0207670_10401797 | 3300025936 | Bacteria | 1095 |
| 455 | Ga0207669_10036897 | 3300025937 | Bacteria | 2798 |
| 456 | Ga0207669_10042551 | 3300025937 | Bacteria | 2653 |
| 457 | Ga0207669_10070384 | 3300025937 | Bacteria | 2193 |
| 458 | Ga0207704_10100709 | 3300025938 | Bacteria | 1925 |
| 459 | Ga0207665_10000630 | 3300025939 | Bacteria | 23660 |
| 460 | Ga0207665_10029520 | 3300025939 | Bacteria | 3624 |
| 461 | Ga0207665_10154284 | 3300025939 | Bacteria | 1647 |
| 462 | Ga0207665_11158101 | 3300025939 | Bacteria | 617 |
| 463 | Ga0207691_10001822 | 3300025940 | Bacteria | 20843 |
| 464 | Ga0207691_10076277 | 3300025940 | Bacteria | 3021 |
| 465 | Ga0207711_10546925 | 3300025941 | Bacteria | 1080 |
| 466 | Ga0207689_10006073 | 3300025942 | Bacteria | 10682 |
| 467 | Ga0207661_10129498 | 3300025944 | Bacteria | 2159 |
| 468 | Ga0207661_10164855 | 3300025944 | Bacteria | 1925 |
| 469 | Ga0207661_10183917 | 3300025944 | Bacteria | 1828 |
| 470 | Ga0207661_10737401 | 3300025944 | Bacteria | 906 |
| 471 | Ga0207679_11329400 | 3300025945 | Bacteria | 659 |
| 472 | Ga0207679_11560748 | 3300025945 | Bacteria | 605 |
| 473 | Ga0207667_10149859 | 3300025949 | Bacteria | 2401 |
| 474 | Ga0207712_10142042 | 3300025961 | Bacteria | 1844 |
| 475 | Ga0207668_10147559 | 3300025972 | Bacteria | 1817 |
| 476 | Ga0207668_10208508 | 3300025972 | Bacteria | 1561 |
| 477 | Ga0207668_10427646 | 3300025972 | Bacteria | 1125 |
| 478 | Ga0207640_10048321 | 3300025981 | Bacteria | 2749 |
| 479 | Ga0207658_10022818 | 3300025986 | Bacteria | 4360 |
| 480 | Ga0207677_10224393 | 3300026023 | Bacteria | 1509 |
| 481 | Ga0207677_10910673 | 3300026023 | Bacteria | 793 |
| 482 | Ga0207677_11191571 | 3300026023 | Bacteria | 697 |
| 483 | Ga0207703_10241442 | 3300026035 | Bacteria | 1624 |
| 484 | Ga0207703_11125464 | 3300026035 | Bacteria | 754 |
| 485 | Ga0207639_10173103 | 3300026041 | Bacteria | 1830 |
| 486 | Ga0207639_10550514 | 3300026041 | Bacteria | 1059 |
| 487 | Ga0207678_10012292 | 3300026067 | Bacteria | 7517 |
| 488 | Ga0207678_10070567 | 3300026067 | Bacteria | 2995 |
| 489 | Ga0207678_10376098 | 3300026067 | Bacteria | 1228 |
| 490 | Ga0207708_10000897 | 3300026075 | Bacteria | 22343 |
| 491 | Ga0207708_10012149 | 3300026075 | Bacteria | 6421 |
| 492 | Ga0207708_10426919 | 3300026075 | Bacteria | 1100 |
| 493 | Ga0207702_10083312 | 3300026078 | Bacteria | 2782 |
| 494 | Ga0207702_10173515 | 3300026078 | Bacteria | 1979 |
| 495 | Ga0207702_10835202 | 3300026078 | Bacteria | 911 |
| 496 | Ga0207702_11432338 | 3300026078 | Bacteria | 685 |
| 497 | Ga0207641_10155375 | 3300026088 | Bacteria | 2075 |
| 498 | Ga0207641_10912701 | 3300026088 | Bacteria | 872 |
| 499 | Ga0207641_11237625 | 3300026088 | Bacteria | 746 |
| 500 | Ga0207648_10001889 | 3300026089 | Bacteria | 22892 |
| 501 | Ga0207648_10075562 | 3300026089 | Bacteria | 2937 |
| 502 | Ga0207676_10036206 | 3300026095 | Bacteria | 3753 |
| 503 | Ga0207676_10157805 | 3300026095 | Bacteria | 1962 |
| 504 | Ga0207676_10707540 | 3300026095 | Bacteria | 976 |
| 505 | Ga0207676_11345777 | 3300026095 | Bacteria | 709 |
| 506 | Ga0207674_10003194 | 3300026116 | Bacteria | 20180 |
| 507 | Ga0207674_10098142 | 3300026116 | Bacteria | 2913 |
| 508 | Ga0207674_10684699 | 3300026116 | Bacteria | 990 |
| 509 | Ga0207675_100009052 | 3300026118 | Bacteria | 9345 |
| 510 | Ga0207675_100010850 | 3300026118 | Bacteria | 8535 |
| 511 | Ga0207675_100025134 | 3300026118 | Bacteria | 5542 |
| 512 | Ga0207675_101113697 | 3300026118 | Bacteria | 809 |
| 513 | Ga0207683_10003299 | 3300026121 | Bacteria | 14067 |
| 514 | Ga0207683_10101369 | 3300026121 | Bacteria | 2570 |
| 515 | Ga0207698_10091294 | 3300026142 | Bacteria | 2493 |
| 516 | Ga0207698_10125713 | 3300026142 | Bacteria | 2180 |
| 517 | Ga0207698_10180545 | 3300026142 | Bacteria | 1869 |
| 518 | Ga0207698_10193095 | 3300026142 | Bacteria | 1816 |
| 519 | Ga0207698_10611778 | 3300026142 | Bacteria | 1075 |
| 520 | Ga0207698_11374801 | 3300026142 | Bacteria | 721 |
| 521 | Ga0207428_10087100 | 3300027907 | Bacteria | 2430 |
| 522 | Ga0268266_10070591 | 3300028379 | Bacteria | 3026 |
| 523 | Ga0268266_10101036 | 3300028379 | Bacteria | 2542 |
| 524 | Ga0268266_10299978 | 3300028379 | Bacteria | 1498 |
| 525 | Ga0268266_11365424 | 3300028379 | Bacteria | 684 |
| 526 | Ga0268265_10128290 | 3300028380 | Bacteria | 2103 |
| 527 | Ga0268265_10452277 | 3300028380 | Bacteria | 1200 |
| 528 | Ga0268264_11676015 | 3300028381 | Bacteria | 646 |
| 529 | Ga0268264_11686365 | 3300028381 | Bacteria | 644 |
| 530 | Ga0265340_10026184 | 3300031247 | Bacteria | 2949 |
| 531 | Ga0307513_10000509 | 3300031456 | Bacteria | 56039 |
| 532 | Ga0307513_10004140 | 3300031456 | Bacteria | 19423 |
| 533 | Ga0307408_101110897 | 3300031548 | Bacteria | 734 |
| 534 | Ga0307508_10318598 | 3300031616 | Bacteria | 1147 |
| 535 | Ga0307405_10278048 | 3300031731 | Bacteria | 1259 |
| 536 | Ga0307405_10437318 | 3300031731 | Bacteria | 1034 |
| 537 | Ga0307405_11009927 | 3300031731 | Bacteria | 710 |
| 538 | Ga0307405_11445021 | 3300031731 | Bacteria | 603 |
| 539 | Ga0307518_10018934 | 3300031838 | Bacteria | 4943 |
| 540 | Ga0307410_10083351 | 3300031852 | Bacteria | 2251 |
| 541 | Ga0307406_10367514 | 3300031901 | Bacteria | 1130 |
| 542 | Ga0307407_10561997 | 3300031903 | Bacteria | 845 |
| 543 | Ga0307409_100217341 | 3300031995 | Bacteria | 1723 |
| 544 | Ga0307409_100298104 | 3300031995 | Bacteria | 1498 |
| 545 | Ga0307409_100547679 | 3300031995 | Bacteria | 1135 |
| 546 | Ga0307409_100942870 | 3300031995 | Bacteria | 879 |
| 547 | Ga0307409_100974573 | 3300031995 | Bacteria | 865 |
| 548 | Ga0307416_100662092 | 3300032002 | Bacteria | 1130 |
| 549 | Ga0307416_101254651 | 3300032002 | Bacteria | 847 |
| 550 | Ga0307416_101602618 | 3300032002 | Bacteria | 756 |
| 551 | Ga0307414_11310602 | 3300032004 | Bacteria | 672 |
| 552 | Ga0307411_10874916 | 3300032005 | Bacteria | 797 |
| 553 | Ga0307415_100599783 | 3300032126 | Bacteria | 980 |
| 554 | Ga0307415_101669454 | 3300032126 | Bacteria | 614 |
| 555 | Ga0373926_0003088 | 3300035083 | Bacteria | 5346 |
| 556 | Ga0373926_0018529 | 3300035083 | Bacteria | 2395 |
| 557 | Ga0373928_0040255 | 3300035084 | Bacteria | 1071 |
| 558 | Ga0373929_0048758 | 3300035085 | Bacteria | 963 |
| 559 | Ga0373934_0011984 | 3300035086 | Bacteria | 3270 |
| 560 | Ga0373934_0111726 | 3300035086 | Bacteria | 1108 |
| 561 | Ga0373944_0001169 | 3300035089 | Bacteria | 6549 |
| 562 | Ga0373944_0039146 | 3300035089 | Bacteria | 1459 |
| 563 | Ga0373944_0057873 | 3300035089 | Bacteria | 1236 |
| 564 | Ga0373952_0059096 | 3300035092 | Bacteria | 933 |
| 565 | Ga0373923_0008579 | 3300035111 | Bacteria | 3653 |
| 566 | Ga0373923_0009259 | 3300035111 | Bacteria | 3549 |
| 567 | Ga0373923_0094860 | 3300035111 | Bacteria | 1309 |
| 568 | Ga0373923_0389044 | 3300035111 | Bacteria | 670 |
| 569 | Ga0373923_0584409 | 3300035111 | Bacteria | 549 |
| 570 | Ga0373932_0314182 | 3300035112 | Bacteria | 588 |
| 571 | Ga0373936_0000677 | 3300035113 | Bacteria | 11853 |
| 572 | Ga0373936_0003020 | 3300035113 | Bacteria | 6288 |
| 573 | Ga0373936_0039068 | 3300035113 | Bacteria | 1898 |
| 574 | Ga0373936_0164175 | 3300035113 | Bacteria | 969 |
| 575 | Ga0373936_0185196 | 3300035113 | Bacteria | 914 |
| 576 | Ga0373941_0010718 | 3300035115 | Bacteria | 2350 |
| 577 | Ga0373945_0000575 | 3300035116 | Bacteria | 10515 |
| 578 | Ga0373945_0004809 | 3300035116 | Bacteria | 4301 |
| 579 | Ga0373945_0359806 | 3300035116 | Bacteria | 632 |
| 580 | Ga0373953_0053563 | 3300035117 | Bacteria | 1635 |
| 581 | Ga0373953_0175439 | 3300035117 | Bacteria | 923 |
| 582 | Ga0373953_0191267 | 3300035117 | Bacteria | 884 |
| 583 | Ga0373954_0052602 | 3300035118 | Bacteria | 1914 |
| 584 | Ga0373954_0177958 | 3300035118 | Bacteria | 1043 |
| 585 | Ga0373954_0232887 | 3300035118 | Bacteria | 906 |
| 586 | Ga0373954_0302834 | 3300035118 | Bacteria | 788 |
| 587 | Ga0373956_0089161 | 3300035119 | Bacteria | 1421 |
| 588 | Ga0373956_0149317 | 3300035119 | Bacteria | 1099 |
| 589 | Ga0373957_0016530 | 3300035120 | Bacteria | 2554 |
| 590 | Ga0373957_0085801 | 3300035120 | Bacteria | 1246 |
| 591 | Ga0373960_0201097 | 3300035121 | Bacteria | 704 |
| 592 | Ga0373943_0000379 | 3300035170 | Bacteria | 18695 |
| 593 | Ga0373943_0045289 | 3300035170 | Bacteria | 2143 |
| 594 | Ga0373943_0166765 | 3300035170 | Bacteria | 1202 |
| 595 | Ga0373946_0000071 | 3300035171 | Bacteria | 27082 |
| 596 | Ga0373946_0281200 | 3300035171 | Bacteria | 818 |
| 597 | Ga0373955_0029111 | 3300035172 | Bacteria | 2869 |
| 598 | Ga0373955_0067910 | 3300035172 | Bacteria | 1985 |
| 599 | Ga0373955_0097976 | 3300035172 | Bacteria | 1679 |
| 600 | Ga0373942_0007491 | 3300035207 | Bacteria | 2532 |
| 601 | Ga0373924_0006965 | 3300035410 | Bacteria | 4068 |
| 602 | Ga0373924_0018685 | 3300035410 | Bacteria | 2675 |
| 603 | Ga0373924_0058735 | 3300035410 | Bacteria | 1605 |
| 604 | Ga0373924_0120167 | 3300035410 | Bacteria | 1139 |
| 605 | Ga0373931_0276252 | 3300035691 | Bacteria | 1030 |
| 606 | Ga0373931_0458854 | 3300035691 | Bacteria | 816 |
| 607 | Ga0373935_0007539 | 3300035692 | Bacteria | 6515 |
| 608 | Ga0373935_0090545 | 3300035692 | Bacteria | 2002 |
| 609 | Ga0373935_0104188 | 3300035692 | Bacteria | 1874 |
| 610 | Ga0373935_0267929 | 3300035692 | Bacteria | 1199 |
| 611 | Ga0373935_0302717 | 3300035692 | Bacteria | 1130 |
| 612 | Ga0373935_0809744 | 3300035692 | Bacteria | 692 |
| 613 | Ga0373935_0985295 | 3300035692 | Bacteria | 626 |
| 614 | Ga0373927_0003532 | 3300035695 | Bacteria | 11185 |
| 615 | Ga0373927_1144894 | 3300035695 | Bacteria | 513 |
| 616 | Ga0373933_0041762 | 3300035724 | Bacteria | 2708 |
| 617 | Ga0373933_0118650 | 3300035724 | Bacteria | 1655 |
| 618 | Ga0373933_0150942 | 3300035724 | Bacteria | 1471 |
| 619 | Ga0373933_0292473 | 3300035724 | Bacteria | 1054 |
| 620 | Ga0373947_0004135 | 3300035725 | Bacteria | 8532 |
| 621 | Ga0373947_0077962 | 3300035725 | Bacteria | 2044 |
| 622 | Ga0373947_0120772 | 3300035725 | Bacteria | 1664 |
| 623 | Ga0373947_0177916 | 3300035725 | Bacteria | 1383 |
| 624 | Ga0373947_0447689 | 3300035725 | Bacteria | 874 |
| 625 | Ga0373947_0634397 | 3300035725 | Bacteria | 728 |
| 626 | Ga0373947_0657328 | 3300035725 | Bacteria | 715 |
| 627 | Ga0373947_1130273 | 3300035725 | Bacteria | 534 |
| 628 | Ga0373937_0017044 | 3300036401 | Bacteria | 6461 |
| 629 | Ga0373937_0080932 | 3300036401 | Bacteria | 3004 |
| 630 | Ga0373937_0322147 | 3300036401 | Bacteria | 1462 |
| 631 | Ga0373937_0367143 | 3300036401 | Bacteria | 1364 |
| 632 | Ga0373937_0411295 | 3300036401 | Bacteria | 1283 |
| 633 | Ga0373937_0447516 | 3300036401 | Bacteria | 1226 |
| 634 | Ga0373937_0935843 | 3300036401 | Bacteria | 815 |
| 635 | Ga0373937_1226550 | 3300036401 | Bacteria | 698 |
| 636 | Ga0373937_1440201 | 3300036401 | Bacteria | 636 |
| 637 | Ga0373925_0003272 | 3300037068 | Bacteria | 12614 |
| 638 | Ga0373925_0016415 | 3300037068 | Bacteria | 5364 |
| 639 | Ga0373925_0244303 | 3300037068 | Bacteria | 1438 |
| 640 | Ga0373925_0306716 | 3300037068 | Bacteria | 1282 |
| 641 | Ga0373925_0423874 | 3300037068 | Bacteria | 1087 |
| 642 | Ga0373925_1379853 | 3300037068 | Bacteria | 577 |
| 643 | Ga0395900_0082652 | 3300037418 | Bacteria | 3300 |
| 644 | Ga0395900_0370668 | 3300037418 | Bacteria | 1401 |
| 645 | Ga0395898_0126350 | 3300037466 | Bacteria | 2450 |
| 646 | Ga0395905_1558331 | 3300037471 | Bacteria | 565 |
| 647 | Ga0436364_0066527 | 3300037853 | Bacteria | 806 |
| 648 | Ga0436364_0093190 | 3300037853 | Bacteria | 2488 |
| 649 | Ga0436364_0661034 | 3300037853 | Bacteria | 87629 |
| 650 | Ga0436364_0750168 | 3300037853 | Bacteria | 1620 |
| 651 | Ga0436364_1052723 | 3300037853 | Bacteria | 4095 |
| 652 | Ga0395901_0005587 | 3300038443 | Bacteria | 12732 |
| 653 | Ga0436365_0478561 | 3300039437 | Bacteria | 1211 |
| 654 | Ga0436360_0719369 | 3300039438 | Bacteria | 1775 |
| 655 | Ga0436361_1034955 | 3300039447 | Bacteria | 763 |
| 656 | Ga0436363_0347872 | 3300039450 | Bacteria | 1221 |
| 657 | Ga0436363_0387018 | 3300039450 | Bacteria | 1716 |
| 658 | Ga0436363_0416526 | 3300039450 | Bacteria | 1562 |
| 659 | Ga0436363_0531864 | 3300039450 | Bacteria | 652 |
| 660 | Ga0436363_1356157 | 3300039450 | Bacteria | 1595 |
| 661 | Ga0436362_0081924 | 3300039453 | Bacteria | 641 |
| 662 | Ga0436362_1229093 | 3300039453 | Bacteria | 754 |
| 663 | Ga0451789_0173773 | 3300041443 | Bacteria | 518 |
| 664 | Ga0451789_0179690 | 3300041443 | Bacteria | 679 |
| 665 | Ga0451789_1346882 | 3300041443 | Bacteria | 1572 |
| 666 | Ga0451791_0631542 | 3300041451 | Bacteria | 886 |
| 667 | Ga0451791_0830000 | 3300041451 | Bacteria | 579 |
| 668 | Ga0451791_1727689 | 3300041451 | Bacteria | 1778 |
| 669 | Ga0451793_0554836 | 3300041452 | Bacteria | 852 |
| 670 | Ga0451793_1331298 | 3300041452 | Bacteria | 845 |
| 671 | Ga0451797_1036889 | 3300041453 | Bacteria | 585 |
| 672 | Ga0451802_0186256 | 3300041460 | Bacteria | 678 |
| 673 | Ga0451807_2461803 | 3300041486 | Bacteria | 1155 |
| 674 | Ga0451833_0950911 | 3300041491 | Bacteria | 1882 |
| 675 | Ga0451837_0986391 | 3300041494 | Bacteria | 770 |
| 676 | Ga0451841_0284230 | 3300041498 | Bacteria | 1842 |
| 677 | Ga0451849_1443282 | 3300041505 | Unclassified | 895 |
| 678 | Ga0451851_0190844 | 3300041507 | Bacteria | 931 |
| 679 | Ga0451851_0920371 | 3300041507 | Bacteria | 603 |
| 680 | Ga0451843_0186394 | 3300041509 | Bacteria | 947 |
| 681 | Ga0451843_0610637 | 3300041509 | Bacteria | 1220 |
| 682 | Ga0451855_1237994 | 3300041511 | Bacteria | 588 |
| 683 | Ga0451853_3336502 | 3300041512 | Bacteria | 647 |
| 684 | Ga0466969_0082340 | 3300044656 | Bacteria | 1534 |
| 685 | Ga0466969_0115265 | 3300044656 | Bacteria | 1255 |
| 686 | Ga0466972_0113475 | 3300044658 | Bacteria | 1280 |
| 687 | Ga0466965_0095583 | 3300044683 | Bacteria | 1515 |
| 688 | Ga0466965_0230525 | 3300044683 | Bacteria | 989 |
| 689 | Ga0466965_0357054 | 3300044683 | Bacteria | 801 |
| 690 | Ga0466965_0687028 | 3300044683 | Bacteria | 586 |
| 691 | Ga0466965_0704093 | 3300044683 | Bacteria | 580 |
| 692 | Ga0466966_0004582 | 3300044684 | Bacteria | 9103 |
| 693 | Ga0466966_0031654 | 3300044684 | Bacteria | 3430 |
| 694 | Ga0466966_0040811 | 3300044684 | Bacteria | 2985 |
| 695 | Ga0466966_0161108 | 3300044684 | Bacteria | 1366 |
| 696 | Ga0466966_0166643 | 3300044684 | Bacteria | 1340 |
| 697 | Ga0466966_0256498 | 3300044684 | Bacteria | 1053 |
| 698 | Ga0466966_0312027 | 3300044684 | Bacteria | 945 |
| 699 | Ga0466961_0002635 | 3300044693 | Bacteria | 11143 |
| 700 | Ga0466961_0014664 | 3300044693 | Bacteria | 5035 |
| 701 | Ga0466961_0034766 | 3300044693 | Bacteria | 3235 |
| 702 | Ga0466961_0088021 | 3300044693 | Bacteria | 1962 |
| 703 | Ga0466961_0182537 | 3300044693 | Bacteria | 1302 |
| 704 | Ga0466961_0223855 | 3300044693 | Bacteria | 1159 |
| 705 | Ga0466961_0468997 | 3300044693 | Bacteria | 761 |
| 706 | Ga0466961_0515465 | 3300044693 | Bacteria | 721 |
| 707 | Ga0466961_0971579 | 3300044693 | Bacteria | 505 |
| 708 | Ga0466963_0010924 | 3300044694 | Bacteria | 5516 |
| 709 | Ga0466963_0099678 | 3300044694 | Bacteria | 1987 |
| 710 | Ga0466963_0130745 | 3300044694 | Bacteria | 1734 |
| 711 | Ga0466963_0268246 | 3300044694 | Bacteria | 1199 |
| 712 | Ga0466963_0268445 | 3300044694 | Bacteria | 1199 |
| 713 | Ga0466963_0300769 | 3300044694 | Bacteria | 1128 |
| 714 | Ga0466963_0355707 | 3300044694 | Bacteria | 1031 |
| 715 | Ga0466963_0391680 | 3300044694 | Bacteria | 979 |
| 716 | Ga0466963_0424871 | 3300044694 | Bacteria | 937 |
| 717 | Ga0466963_0466830 | 3300044694 | Bacteria | 891 |
| 718 | Ga0466963_0593198 | 3300044694 | Bacteria | 782 |
| 719 | Ga0466963_0601025 | 3300044694 | Bacteria | 777 |
| 720 | Ga0466963_0667425 | 3300044694 | Bacteria | 734 |
| 721 | Ga0466963_0953918 | 3300044694 | Bacteria | 604 |
| 722 | Ga0466963_0987304 | 3300044694 | Bacteria | 593 |
| 723 | Ga0466963_1047609 | 3300044694 | Bacteria | 574 |
| 724 | Ga0466963_1329301 | 3300044694 | Bacteria | 504 |
| 725 | Ga0466964_0166221 | 3300044706 | Bacteria | 1035 |
| 726 | Ga0466964_0174688 | 3300044706 | Bacteria | 1014 |
| 727 | Ga0466964_0457525 | 3300044706 | Bacteria | 678 |
| 728 | Ga0466964_0510045 | 3300044706 | Bacteria | 647 |
| 729 | Ga0466971_0072623 | 3300044719 | Bacteria | 1563 |
| 730 | Ga0466971_0084801 | 3300044719 | Bacteria | 1447 |
| 731 | Ga0466971_0090062 | 3300044719 | Bacteria | 1404 |
| 732 | Ga0466971_0403250 | 3300044719 | Bacteria | 667 |
| 733 | Ga0466968_0168159 | 3300044735 | Bacteria | 1015 |
| 734 | Ga0466970_0020493 | 3300044765 | Bacteria | 3436 |
| 735 | Ga0466970_0022917 | 3300044765 | Bacteria | 3258 |
| 736 | Ga0466970_0024598 | 3300044765 | Bacteria | 3150 |
| 737 | Ga0466970_0026247 | 3300044765 | Bacteria | 3053 |
| 738 | Ga0466970_0157949 | 3300044765 | Bacteria | 1254 |
| 739 | Ga0466970_0376147 | 3300044765 | Bacteria | 808 |
| 740 | Ga0466970_0446076 | 3300044765 | Bacteria | 741 |
| 741 | Ga0466970_0473526 | 3300044765 | Bacteria | 719 |
| 742 | Ga0466970_0478969 | 3300044765 | Bacteria | 715 |
| 743 | Ga0466970_0508907 | 3300044765 | Bacteria | 694 |
| 744 | Ga0466970_0760667 | 3300044765 | Bacteria | 566 |
| 745 | Ga0466957_0022629 | 3300044842 | Bacteria | 3710 |
| 746 | Ga0466957_0073280 | 3300044842 | Bacteria | 2122 |
| 747 | Ga0466957_0075396 | 3300044842 | Bacteria | 2093 |
| 748 | Ga0466957_0119843 | 3300044842 | Bacteria | 1676 |
| 749 | Ga0466957_0149285 | 3300044842 | Bacteria | 1510 |
| 750 | Ga0466957_0268841 | 3300044842 | Bacteria | 1138 |
| 751 | Ga0466957_0328331 | 3300044842 | Bacteria | 1033 |
| 752 | Ga0466957_0518162 | 3300044842 | Bacteria | 828 |
| 753 | Ga0466960_0011523 | 3300044901 | Bacteria | 3703 |
| 754 | Ga0466960_0011688 | 3300044901 | Bacteria | 3683 |
| 755 | Ga0466960_0066500 | 3300044901 | Bacteria | 1783 |
| 756 | Ga0466960_0084184 | 3300044901 | Bacteria | 1609 |
| 757 | Ga0466960_0117392 | 3300044901 | Bacteria | 1390 |
| 758 | Ga0466960_0129251 | 3300044901 | Bacteria | 1331 |
| 759 | Ga0466960_0193951 | 3300044901 | Bacteria | 1107 |
| 760 | Ga0466960_0262719 | 3300044901 | Bacteria | 962 |
| 761 | Ga0466960_0299737 | 3300044901 | Bacteria | 905 |
| 762 | Ga0466960_0737375 | 3300044901 | Bacteria | 593 |
| 763 | Ga0466959_0009566 | 3300045049 | Bacteria | 6896 |
| 764 | Ga0466959_0057534 | 3300045049 | Bacteria | 2834 |
| 765 | Ga0466959_0077706 | 3300045049 | Bacteria | 2395 |
| 766 | Ga0466959_0112410 | 3300045049 | Bacteria | 1943 |
| 767 | Ga0466959_0126441 | 3300045049 | Bacteria | 1814 |
| 768 | Ga0466959_0319455 | 3300045049 | Bacteria | 1062 |
| 769 | Ga0466959_0437251 | 3300045049 | Bacteria | 887 |
| 770 | Ga0466959_0473689 | 3300045049 | Bacteria | 848 |
| 771 | Ga0466958_0004678 | 3300045836 | Bacteria | 7262 |
| 772 | Ga0466958_0014999 | 3300045836 | Bacteria | 4434 |
| 773 | Ga0466958_0021002 | 3300045836 | Bacteria | 3812 |
| 774 | Ga0466958_0027972 | 3300045836 | Bacteria | 3340 |
| 775 | Ga0466958_0031381 | 3300045836 | Bacteria | 3158 |
| 776 | Ga0466958_0099491 | 3300045836 | Bacteria | 1807 |
| 777 | Ga0466958_0117316 | 3300045836 | Bacteria | 1664 |
| 778 | Ga0466958_0179457 | 3300045836 | Bacteria | 1343 |
| 779 | Ga0466958_0234118 | 3300045836 | Bacteria | 1173 |
| 780 | Ga0466958_0390254 | 3300045836 | Bacteria | 898 |
| 781 | Ga0466958_0414975 | 3300045836 | Bacteria | 870 |
| 782 | Ga0466958_0426275 | 3300045836 | Bacteria | 858 |
| 783 | Ga0466967_0003013 | 3300045976 | Bacteria | 10805 |
| 784 | Ga0466967_0027192 | 3300045976 | Bacteria | 4756 |
| 785 | Ga0466967_0032279 | 3300045976 | Bacteria | 4420 |
| 786 | Ga0466967_0036020 | 3300045976 | Bacteria | 4220 |
| 787 | Ga0466967_0056346 | 3300045976 | Bacteria | 3465 |
| 788 | Ga0466967_0069355 | 3300045976 | Bacteria | 3151 |
| 789 | Ga0466967_0106320 | 3300045976 | Bacteria | 2572 |
| 790 | Ga0466967_0150483 | 3300045976 | Bacteria | 2175 |
| 791 | Ga0466967_0169692 | 3300045976 | Bacteria | 2052 |
| 792 | Ga0466967_0198562 | 3300045976 | Bacteria | 1899 |
| 793 | Ga0466967_0212215 | 3300045976 | Bacteria | 1836 |
| 794 | Ga0466967_0286030 | 3300045976 | Bacteria | 1583 |
| 795 | Ga0466967_0456031 | 3300045976 | Bacteria | 1250 |
| 796 | Ga0466967_0635184 | 3300045976 | Bacteria | 1055 |
| 797 | Ga0466967_0670050 | 3300045976 | Bacteria | 1027 |
| 798 | Ga0466967_1775412 | 3300045976 | Bacteria | 614 |
| 799 | Ga0495592_0012147 | 3300046454 | Bacteria | 6534 |
| 800 | Ga0495592_0064131 | 3300046454 | Bacteria | 2693 |
| 801 | Ga0495592_0121109 | 3300046454 | Bacteria | 1840 |
| 802 | Ga0495592_0157132 | 3300046454 | Bacteria | 1567 |
| 803 | Ga0495592_0210064 | 3300046454 | Bacteria | 1308 |
| 804 | Ga0495603_0391585 | 3300046455 | Bacteria | 796 |
| 805 | Ga0495629_0007539 | 3300046459 | Bacteria | 8020 |
| 806 | Ga0495629_0054132 | 3300046459 | Bacteria | 2806 |
| 807 | Ga0495629_0176774 | 3300046459 | Bacteria | 1480 |
| 808 | Ga0495629_0261621 | 3300046459 | Bacteria | 1189 |
| 809 | Ga0495638_0039800 | 3300046460 | Bacteria | 2982 |
| 810 | Ga0495641_0004087 | 3300046461 | Bacteria | 10528 |
| 811 | Ga0495641_0016540 | 3300046461 | Bacteria | 3883 |
| 812 | Ga0495641_0091403 | 3300046461 | Bacteria | 1360 |
| 813 | Ga0495641_0152930 | 3300046461 | Bacteria | 1031 |
| 814 | Ga0495651_0002693 | 3300046462 | Bacteria | 13786 |
| 815 | Ga0495651_0025710 | 3300046462 | Bacteria | 4584 |
| 816 | Ga0495651_0093048 | 3300046462 | Bacteria | 2257 |
| 817 | Ga0495651_0180870 | 3300046462 | Bacteria | 1492 |
| 818 | Ga0495651_0266062 | 3300046462 | Bacteria | 1164 |
| 819 | Ga0495651_0533487 | 3300046462 | Bacteria | 747 |
| 820 | Ga0495653_0000555 | 3300046463 | Bacteria | 28569 |
| 821 | Ga0495653_0004451 | 3300046463 | Bacteria | 11316 |
| 822 | Ga0495653_0056273 | 3300046463 | Bacteria | 2998 |
| 823 | Ga0495653_0070817 | 3300046463 | Bacteria | 2608 |
| 824 | Ga0495653_0116414 | 3300046463 | Bacteria | 1911 |
| 825 | Ga0495653_0256418 | 3300046463 | Bacteria | 1158 |
| 826 | Ga0495653_0296624 | 3300046463 | Bacteria | 1055 |
| 827 | Ga0495653_0531748 | 3300046463 | Bacteria | 729 |
| 828 | Ga0495650_0074459 | 3300046471 | Bacteria | 1324 |
| 829 | Ga0495580_0023984 | 3300046472 | Bacteria | 4471 |
| 830 | Ga0495580_0945142 | 3300046472 | Bacteria | 552 |
| 831 | Ga0495582_0001326 | 3300046473 | Bacteria | 13878 |
| 832 | Ga0495582_0272416 | 3300046473 | Bacteria | 971 |
| 833 | Ga0495639_0045159 | 3300046475 | Bacteria | 1993 |
| 834 | Ga0495639_0152156 | 3300046475 | Bacteria | 1116 |
| 835 | Ga0495639_0187853 | 3300046475 | Bacteria | 1008 |
| 836 | Ga0495639_0434700 | 3300046475 | Bacteria | 665 |
| 837 | Ga0495662_0030003 | 3300046476 | Bacteria | 2625 |
| 838 | Ga0495662_0040261 | 3300046476 | Bacteria | 2256 |
| 839 | Ga0495662_0040872 | 3300046476 | Bacteria | 2239 |
| 840 | Ga0495662_0181721 | 3300046476 | Bacteria | 1036 |
| 841 | Ga0495664_0002276 | 3300046477 | Bacteria | 10292 |
| 842 | Ga0495664_0025865 | 3300046477 | Bacteria | 3417 |
| 843 | Ga0495664_0050670 | 3300046477 | Bacteria | 2465 |
| 844 | Ga0495664_0056926 | 3300046477 | Bacteria | 2326 |
| 845 | Ga0495664_0061739 | 3300046477 | Bacteria | 2231 |
| 846 | Ga0495664_0110198 | 3300046477 | Bacteria | 1661 |
| 847 | Ga0495664_0298062 | 3300046477 | Bacteria | 973 |
| 848 | Ga0495594_0096590 | 3300046499 | Bacteria | 1660 |
| 849 | Ga0495606_0611867 | 3300046507 | Bacteria | 533 |
| 850 | Ga0495608_0002283 | 3300046511 | Bacteria | 13836 |
| 851 | Ga0495608_0023903 | 3300046511 | Bacteria | 4180 |
| 852 | Ga0495608_0072276 | 3300046511 | Bacteria | 2250 |
| 853 | Ga0495608_0079951 | 3300046511 | Bacteria | 2125 |
| 854 | Ga0495608_0373038 | 3300046511 | Bacteria | 875 |
| 855 | Ga0495608_0651081 | 3300046511 | Bacteria | 629 |
| 856 | Ga0495618_0008622 | 3300046514 | Bacteria | 6160 |
| 857 | Ga0495618_0015094 | 3300046514 | Bacteria | 4712 |
| 858 | Ga0495618_0160321 | 3300046514 | Bacteria | 1434 |
| 859 | Ga0495618_0182874 | 3300046514 | Bacteria | 1332 |
| 860 | Ga0495618_0272059 | 3300046514 | Bacteria | 1058 |
| 861 | Ga0495618_0285082 | 3300046514 | Bacteria | 1029 |
| 862 | Ga0495618_0605899 | 3300046514 | Bacteria | 651 |
| 863 | Ga0495618_0620368 | 3300046514 | Bacteria | 642 |
| 864 | Ga0495620_0254784 | 3300046515 | Bacteria | 669 |
| 865 | Ga0495628_0023224 | 3300046516 | Bacteria | 5092 |
| 866 | Ga0495628_0069750 | 3300046516 | Bacteria | 2741 |
| 867 | Ga0495628_0112169 | 3300046516 | Bacteria | 2096 |
| 868 | Ga0495628_0141224 | 3300046516 | Bacteria | 1838 |
| 869 | Ga0495628_0400517 | 3300046516 | Bacteria | 1002 |
| 870 | Ga0495628_0710779 | 3300046516 | Bacteria | 709 |
| 871 | Ga0495628_0923894 | 3300046516 | Bacteria | 604 |
| 872 | Ga0495630_0012644 | 3300046517 | Bacteria | 6133 |
| 873 | Ga0495630_0330586 | 3300046517 | Bacteria | 1165 |
| 874 | Ga0495630_0412742 | 3300046517 | Bacteria | 1034 |
| 875 | Ga0495630_0510650 | 3300046517 | Bacteria | 921 |
| 876 | Ga0495630_0777146 | 3300046517 | Bacteria | 731 |
| 877 | Ga0495666_0070539 | 3300046526 | Bacteria | 1661 |
| 878 | Ga0495666_0150971 | 3300046526 | Bacteria | 1080 |
| 879 | Ga0495652_0005885 | 3300046529 | Bacteria | 11469 |
| 880 | Ga0495652_0015768 | 3300046529 | Bacteria | 6764 |
| 881 | Ga0495652_0015906 | 3300046529 | Bacteria | 6733 |
| 882 | Ga0495652_0091885 | 3300046529 | Bacteria | 2480 |
| 883 | Ga0495652_0181514 | 3300046529 | Bacteria | 1614 |
| 884 | Ga0495652_0214283 | 3300046529 | Bacteria | 1451 |
| 885 | Ga0495652_0287520 | 3300046529 | Bacteria | 1201 |
| 886 | Ga0495652_0603296 | 3300046529 | Bacteria | 748 |
| 887 | Ga0495665_0001105 | 3300046531 | Bacteria | 14262 |
| 888 | Ga0495665_0005956 | 3300046531 | Bacteria | 6566 |
| 889 | Ga0495665_0011749 | 3300046531 | Bacteria | 4744 |
| 890 | Ga0495665_0028168 | 3300046531 | Bacteria | 3014 |
| 891 | Ga0495665_0219232 | 3300046531 | Bacteria | 984 |
| 892 | Ga0495640_0021019 | 3300046533 | Bacteria | 4797 |
| 893 | Ga0495640_0028229 | 3300046533 | Bacteria | 4041 |
| 894 | Ga0495640_0034299 | 3300046533 | Bacteria | 3600 |
| 895 | Ga0495640_0060998 | 3300046533 | Bacteria | 2563 |
| 896 | Ga0495640_0257905 | 3300046533 | Bacteria | 1090 |
| 897 | Ga0495586_0013464 | 3300046535 | Bacteria | 4338 |
| 898 | Ga0495586_0051987 | 3300046535 | Bacteria | 2217 |
| 899 | Ga0495586_0121218 | 3300046535 | Bacteria | 1461 |
| 900 | Ga0495586_0252002 | 3300046535 | Bacteria | 1007 |
| 901 | Ga0495586_0654110 | 3300046535 | Bacteria | 607 |
| 902 | Ga0495587_0001390 | 3300046536 | Bacteria | 16094 |
| 903 | Ga0495587_0008890 | 3300046536 | Bacteria | 6446 |
| 904 | Ga0495587_0042153 | 3300046536 | Bacteria | 2722 |
| 905 | Ga0495587_0136420 | 3300046536 | Bacteria | 1401 |
| 906 | Ga0495587_0242754 | 3300046536 | Bacteria | 1013 |
| 907 | Ga0495587_0246155 | 3300046536 | Bacteria | 1005 |
| 908 | Ga0495587_0606671 | 3300046536 | Bacteria | 602 |
| 909 | Ga0495645_0030802 | 3300046543 | Bacteria | 3909 |
| 910 | Ga0495645_0056752 | 3300046543 | Bacteria | 2843 |
| 911 | Ga0495645_0075578 | 3300046543 | Bacteria | 2424 |
| 912 | Ga0495645_0131739 | 3300046543 | Bacteria | 1751 |
| 913 | Ga0495645_0156696 | 3300046543 | Bacteria | 1577 |
| 914 | Ga0495645_0281383 | 3300046543 | Bacteria | 1093 |
| 915 | Ga0495645_0437175 | 3300046543 | Bacteria | 827 |
| 916 | Ga0495645_0540414 | 3300046543 | Bacteria | 723 |
| 917 | Ga0495645_0751174 | 3300046543 | Bacteria | 588 |
| 918 | Ga0495622_0186733 | 3300046557 | Bacteria | 928 |
| 919 | Ga0495667_0002120 | 3300046559 | Bacteria | 13196 |
| 920 | Ga0495667_0002955 | 3300046559 | Bacteria | 11403 |
| 921 | Ga0495667_0004432 | 3300046559 | Bacteria | 9476 |
| 922 | Ga0495667_0010816 | 3300046559 | Bacteria | 6170 |
| 923 | Ga0495667_0035285 | 3300046559 | Bacteria | 3342 |
| 924 | Ga0495667_0228526 | 3300046559 | Bacteria | 1186 |
| 925 | Ga0495667_0236019 | 3300046559 | Bacteria | 1165 |
| 926 | Ga0495667_0261540 | 3300046559 | Bacteria | 1100 |
| 927 | Ga0495634_0002716 | 3300046642 | Bacteria | 14552 |
| 928 | Ga0495634_0035660 | 3300046642 | Bacteria | 3404 |
| 929 | Ga0495634_0053645 | 3300046642 | Bacteria | 2700 |
| 930 | Ga0495634_0088275 | 3300046642 | Bacteria | 2017 |
| 931 | Ga0495634_0112701 | 3300046642 | Bacteria | 1748 |
| 932 | Ga0495634_0168524 | 3300046642 | Bacteria | 1377 |
| 933 | Ga0495634_0294504 | 3300046642 | Bacteria | 982 |
| 934 | Ga0495635_0000206 | 3300046663 | Bacteria | 37472 |
| 935 | Ga0495635_0004637 | 3300046663 | Bacteria | 9538 |
| 936 | Ga0495635_0025183 | 3300046663 | Bacteria | 4144 |
| 937 | Ga0495635_0027150 | 3300046663 | Bacteria | 3983 |
| 938 | Ga0495635_0037851 | 3300046663 | Bacteria | 3339 |
| 939 | Ga0495635_0070027 | 3300046663 | Bacteria | 2404 |
| 940 | Ga0495635_0264441 | 3300046663 | Bacteria | 1158 |
| 941 | Ga0495635_0751015 | 3300046663 | Bacteria | 630 |
| 942 | Ga0495588_0063477 | 3300046674 | Bacteria | 1915 |
| 943 | Ga0495657_0005327 | 3300046675 | Bacteria | 10177 |
| 944 | Ga0495657_0006178 | 3300046675 | Bacteria | 9390 |
| 945 | Ga0495657_0025528 | 3300046675 | Bacteria | 4194 |
| 946 | Ga0495657_0078212 | 3300046675 | Bacteria | 2144 |
| 947 | Ga0495657_0083957 | 3300046675 | Bacteria | 2055 |
| 948 | Ga0495657_0206135 | 3300046675 | Bacteria | 1196 |
| 949 | Ga0495657_0546905 | 3300046675 | Bacteria | 673 |
| 950 | Ga0495599_0003203 | 3300046678 | Bacteria | 9537 |
| 951 | Ga0495599_0008033 | 3300046678 | Bacteria | 6406 |
| 952 | Ga0495599_0023527 | 3300046678 | Bacteria | 3852 |
| 953 | Ga0495599_0055067 | 3300046678 | Bacteria | 2491 |
| 954 | Ga0495599_0227155 | 3300046678 | Bacteria | 1140 |
| 955 | Ga0495599_0240286 | 3300046678 | Bacteria | 1104 |
| 956 | Ga0495599_0383123 | 3300046678 | Bacteria | 839 |
| 957 | Ga0495599_0410107 | 3300046678 | Bacteria | 806 |
| 958 | Ga0495623_0068791 | 3300046679 | Bacteria | 2207 |
| 959 | Ga0495623_0101438 | 3300046679 | Bacteria | 1753 |
| 960 | Ga0495623_0102080 | 3300046679 | Bacteria | 1747 |
| 961 | Ga0495646_0004430 | 3300046680 | Bacteria | 8841 |
| 962 | Ga0495646_0482747 | 3300046680 | Bacteria | 637 |
| 963 | Ga0495646_0609280 | 3300046680 | Bacteria | 554 |
| 964 | Ga0495647_0008248 | 3300046681 | Bacteria | 3500 |
| 965 | Ga0495647_0205825 | 3300046681 | Bacteria | 864 |
| 966 | Ga0495658_0755560 | 3300046683 | Bacteria | 623 |
| 967 | Ga0495658_1032777 | 3300046683 | Bacteria | 525 |
| 968 | Ga0495613_0005536 | 3300046689 | Bacteria | 9481 |
| 969 | Ga0495613_0583225 | 3300046689 | Bacteria | 745 |
| 970 | Ga0495624_0013940 | 3300046690 | Bacteria | 5473 |
| 971 | Ga0495624_0026895 | 3300046690 | Bacteria | 3768 |
| 972 | Ga0495624_0030396 | 3300046690 | Bacteria | 3519 |
| 973 | Ga0495624_0558560 | 3300046690 | Bacteria | 683 |
| 974 | Ga0495600_0007781 | 3300046809 | Bacteria | 6561 |
| 975 | Ga0495600_0057493 | 3300046809 | Bacteria | 2540 |
| 976 | Ga0495600_0137932 | 3300046809 | Bacteria | 1583 |
| 977 | Ga0495600_0243117 | 3300046809 | Bacteria | 1146 |
| 978 | Ga0495600_0313518 | 3300046809 | Bacteria | 987 |
| 979 | Ga0495600_0357743 | 3300046809 | Bacteria | 913 |
| 980 | Ga0495600_0482558 | 3300046809 | Bacteria | 764 |
| 981 | Ga0495600_0617640 | 3300046809 | Bacteria | 657 |
| 982 | Ga0495600_0619627 | 3300046809 | Bacteria | 656 |
| 983 | Ga0495581_0003087 | 3300047315 | Bacteria | 9528 |
| 984 | Ga0495581_0010887 | 3300047315 | Bacteria | 5259 |
| 985 | Ga0495581_0361105 | 3300047315 | Bacteria | 848 |
| 986 | Ga0495604_0011387 | 3300047317 | Bacteria | 7057 |
| 987 | Ga0495604_0012674 | 3300047317 | Bacteria | 6708 |
| 988 | Ga0495604_0024157 | 3300047317 | Bacteria | 4851 |
| 989 | Ga0495604_0052856 | 3300047317 | Bacteria | 3143 |
| 990 | Ga0495604_0227417 | 3300047317 | Bacteria | 1281 |
| 991 | Ga0495604_0742885 | 3300047317 | Bacteria | 621 |
| 992 | Ga0495604_1003370 | 3300047317 | Bacteria | 517 |
| 993 | Ga0495674_0001394 | 3300047319 | Bacteria | 23617 |
| 994 | Ga0495674_0006864 | 3300047319 | Bacteria | 10895 |
| 995 | Ga0495674_0017919 | 3300047319 | Bacteria | 6593 |
| 996 | Ga0495674_0070670 | 3300047319 | Bacteria | 3016 |
| 997 | Ga0495674_0152280 | 3300047319 | Bacteria | 1938 |
| 998 | Ga0495674_0211608 | 3300047319 | Bacteria | 1605 |
| 999 | Ga0495674_0554372 | 3300047319 | Bacteria | 914 |
| 1000 | Ga0495674_0679948 | 3300047319 | Bacteria | 809 |
| 1001 | Ga0495674_0827682 | 3300047319 | Bacteria | 718 |
| 1002 | Ga0495676_0017719 | 3300047321 | Bacteria | 6290 |
| 1003 | Ga0495676_0175595 | 3300047321 | Bacteria | 1504 |
| 1004 | Ga0495680_0000651 | 3300047322 | Bacteria | 38967 |
| 1005 | Ga0495680_0004782 | 3300047322 | Bacteria | 12853 |
| 1006 | Ga0495680_0014670 | 3300047322 | Bacteria | 6777 |
| 1007 | Ga0495680_0031209 | 3300047322 | Bacteria | 4340 |
| 1008 | Ga0495680_0046767 | 3300047322 | Bacteria | 3409 |
| 1009 | Ga0495680_0076951 | 3300047322 | Bacteria | 2528 |
| 1010 | Ga0495680_0734250 | 3300047322 | Bacteria | 649 |
| 1011 | Ga0495675_0007195 | 3300047444 | Bacteria | 6852 |
| 1012 | Ga0495675_0021063 | 3300047444 | Bacteria | 4150 |
| 1013 | Ga0495675_0050183 | 3300047444 | Bacteria | 2652 |
| 1014 | Ga0495675_0123260 | 3300047444 | Bacteria | 1613 |
| 1015 | Ga0495675_0628370 | 3300047444 | Bacteria | 607 |
| 1016 | Ga0495684_0001154 | 3300047471 | Bacteria | 21211 |
| 1017 | Ga0495684_0015298 | 3300047471 | Bacteria | 5909 |
| 1018 | Ga0495684_0021721 | 3300047471 | Bacteria | 4942 |
| 1019 | Ga0495684_0048006 | 3300047471 | Bacteria | 3264 |
| 1020 | Ga0495684_0239095 | 3300047471 | Bacteria | 1325 |
| 1021 | Ga0495684_0376399 | 3300047471 | Bacteria | 1002 |
| 1022 | Ga0495684_0565109 | 3300047471 | Bacteria | 772 |
| 1023 | Ga0495593_0003431 | 3300047673 | Bacteria | 9489 |
| 1024 | Ga0495593_0033418 | 3300047673 | Bacteria | 2800 |
| 1025 | Ga0495593_0338321 | 3300047673 | Bacteria | 752 |
| 1026 | Ga0495602_0018126 | 3300048088 | Bacteria | 7042 |
| 1027 | Ga0495602_0058485 | 3300048088 | Bacteria | 3373 |
| 1028 | Ga0495602_0081183 | 3300048088 | Bacteria | 2727 |
| 1029 | Ga0495602_0168882 | 3300048088 | Bacteria | 1699 |
| 1030 | Ga0495602_0217814 | 3300048088 | Bacteria | 1443 |
| 1031 | Ga0495614_0113347 | 3300048089 | Bacteria | 1191 |
| 1032 | Ga0496100_0107198 | 3300048903 | Bacteria | 1935 |
| 1033 | Ga0496100_0199013 | 3300048903 | Bacteria | 1459 |
| 1034 | Ga0496100_0508561 | 3300048903 | Bacteria | 929 |
| 1035 | Ga0496101_0062360 | 3300048904 | Bacteria | 2710 |
| 1036 | Ga0496101_0301945 | 3300048904 | Bacteria | 1254 |
| 1037 | Ga0496101_0457601 | 3300048904 | Bacteria | 1007 |
| 1038 | Ga0496102_0027320 | 3300048905 | Bacteria | 5096 |
| 1039 | Ga0496102_0091693 | 3300048905 | Bacteria | 2813 |
| 1040 | Ga0496102_0239598 | 3300048905 | Bacteria | 1711 |
| 1041 | Ga0496102_0311180 | 3300048905 | Bacteria | 1484 |
| 1042 | Ga0496102_0409682 | 3300048905 | Bacteria | 1274 |
| 1043 | Ga0496102_1046365 | 3300048905 | Bacteria | 736 |
| 1044 | Ga0496103_0047613 | 3300048906 | Bacteria | 2649 |
| 1045 | Ga0496103_0089585 | 3300048906 | Bacteria | 1941 |
| 1046 | Ga0496104_0015955 | 3300048907 | Bacteria | 6818 |
| 1047 | Ga0496104_0061826 | 3300048907 | Bacteria | 3551 |
| 1048 | Ga0496104_0141493 | 3300048907 | Bacteria | 2311 |
| 1049 | Ga0496104_0270991 | 3300048907 | Bacteria | 1610 |
| 1050 | Ga0496104_0628703 | 3300048907 | Bacteria | 983 |
| 1051 | Ga0496104_1793335 | 3300048907 | Bacteria | 516 |
| 1052 | Ga0496105_0018946 | 3300048908 | Bacteria | 5544 |
| 1053 | Ga0496105_0121278 | 3300048908 | Bacteria | 2155 |
| 1054 | Ga0496105_0153020 | 3300048908 | Bacteria | 1895 |
| 1055 | Ga0496105_0203353 | 3300048908 | Bacteria | 1616 |
| 1056 | Ga0496105_0213899 | 3300048908 | Bacteria | 1571 |
| 1057 | Ga0496105_0637291 | 3300048908 | Bacteria | 824 |
| 1058 | Ga0496106_1403938 | 3300048909 | Bacteria | 539 |
| 1059 | Ga0496107_0010224 | 3300048910 | Bacteria | 6511 |
| 1060 | Ga0496107_0074178 | 3300048910 | Bacteria | 2475 |
| 1061 | Ga0496107_0528634 | 3300048910 | Bacteria | 874 |
| 1062 | Ga0496108_0014150 | 3300048911 | Bacteria | 6510 |
| 1063 | Ga0496108_0054254 | 3300048911 | Bacteria | 3364 |
| 1064 | Ga0496108_0069497 | 3300048911 | Bacteria | 2972 |
| 1065 | Ga0496108_0099967 | 3300048911 | Bacteria | 2473 |
| 1066 | Ga0496108_0271197 | 3300048911 | Bacteria | 1477 |
| 1067 | Ga0496108_0368207 | 3300048911 | Bacteria | 1254 |
| 1068 | Ga0496108_1217409 | 3300048911 | Bacteria | 636 |
| 1069 | Ga0496109_0011196 | 3300048912 | Bacteria | 7698 |
| 1070 | Ga0496109_0067691 | 3300048912 | Bacteria | 3272 |
| 1071 | Ga0496109_0076279 | 3300048912 | Bacteria | 3083 |
| 1072 | Ga0496109_0135737 | 3300048912 | Bacteria | 2298 |
| 1073 | Ga0496109_0146641 | 3300048912 | Bacteria | 2208 |
| 1074 | Ga0496109_0389591 | 3300048912 | Bacteria | 1316 |
| 1075 | Ga0496109_0389621 | 3300048912 | Bacteria | 1316 |
| 1076 | Ga0496109_0525402 | 3300048912 | Bacteria | 1117 |
| 1077 | Ga0496109_0606077 | 3300048912 | Bacteria | 1031 |
| 1078 | Ga0496109_0658909 | 3300048912 | Bacteria | 984 |
| 1079 | Ga0496109_0879501 | 3300048912 | Bacteria | 834 |
| 1080 | Ga0496109_1963097 | 3300048912 | Bacteria | 517 |
| 1081 | Ga0496110_0223570 | 3300048913 | Bacteria | 1712 |
| 1082 | Ga0496110_0367153 | 3300048913 | Bacteria | 1311 |
| 1083 | Ga0496110_0425503 | 3300048913 | Bacteria | 1210 |
| 1084 | Ga0496110_0444673 | 3300048913 | Bacteria | 1181 |
| 1085 | Ga0496110_1014147 | 3300048913 | Bacteria | 737 |
| 1086 | Ga0496111_0014907 | 3300048914 | Bacteria | 5321 |
| 1087 | Ga0496111_0124085 | 3300048914 | Bacteria | 1908 |
| 1088 | Ga0496111_0212254 | 3300048914 | Bacteria | 1438 |
| 1089 | Ga0496111_0446004 | 3300048914 | Bacteria | 955 |
| 1090 | Ga0496112_0204288 | 3300048915 | Bacteria | 1934 |
| 1091 | Ga0496112_0539445 | 3300048915 | Bacteria | 1101 |
| 1092 | Ga0496113_0010456 | 3300048916 | Bacteria | 6136 |
| 1093 | Ga0496113_0069328 | 3300048916 | Bacteria | 2678 |
| 1094 | Ga0496113_0633864 | 3300048916 | Bacteria | 855 |
| 1095 | Ga0496113_1251254 | 3300048916 | Bacteria | 578 |
| 1096 | Ga0496114_0064230 | 3300048917 | Bacteria | 3074 |
| 1097 | Ga0496114_0081630 | 3300048917 | Bacteria | 2731 |
| 1098 | Ga0496114_0310318 | 3300048917 | Bacteria | 1393 |
| 1099 | Ga0496114_0429297 | 3300048917 | Bacteria | 1170 |
| 1100 | Ga0496114_1221534 | 3300048917 | Bacteria | 638 |
| 1101 | Ga0496114_1280263 | 3300048917 | Bacteria | 620 |
| 1102 | Ga0496114_1800105 | 3300048917 | Bacteria | 500 |
| 1103 | Ga0496115_0004348 | 3300048918 | Bacteria | 10250 |
| 1104 | Ga0496115_0149349 | 3300048918 | Bacteria | 1929 |
| 1105 | Ga0496115_0274481 | 3300048918 | Bacteria | 1385 |
| 1106 | Ga0496115_0761295 | 3300048918 | Bacteria | 756 |
| 1107 | Ga0496115_0910353 | 3300048918 | Bacteria | 678 |
| 1108 | Ga0496117_0049331 | 3300048920 | Bacteria | 2995 |
| 1109 | Ga0496118_0062966 | 3300048921 | Bacteria | 2732 |
| 1110 | Ga0496118_0132657 | 3300048921 | Bacteria | 1596 |
| 1111 | Ga0496122_0000583 | 3300048925 | Bacteria | 74712 |
| 1112 | Ga0496122_0001054 | 3300048925 | Bacteria | 48096 |
| 1113 | Ga0496123_0003034 | 3300048926 | Bacteria | 19353 |
| 1114 | Ga0496124_0001569 | 3300048927 | Bacteria | 33052 |
| 1115 | Ga0496124_0597899 | 3300048927 | Bacteria | 718 |
| 1116 | Ga0496125_0000069 | 3300048928 | Bacteria | 246981 |
| 1117 | Ga0496126_0146238 | 3300048929 | Bacteria | 2030 |
| 1118 | Ga0496126_0428152 | 3300048929 | Bacteria | 1069 |
| 1119 | Ga0496126_0493710 | 3300048929 | Bacteria | 979 |
| 1120 | Ga0501321_062720 | 3300049537 | Bacteria | 565 |
| 1121 | Ga0501321_064043 | 3300049537 | Bacteria | 561 |
| 1122 | Ga0501032_0285140 | 3300049569 | Bacteria | 1069 |
| 1123 | Ga0501032_0442259 | 3300049569 | Bacteria | 833 |
| 1124 | Ga0501034_0233334 | 3300049571 | Bacteria | 1788 |
| 1125 | Ga0501036_0348777 | 3300049572 | Bacteria | 1236 |
| 1126 | Ga0501037_0041530 | 3300049573 | Bacteria | 3383 |
| 1127 | Ga0501037_0247879 | 3300049573 | Bacteria | 1247 |
| 1128 | Ga0501038_0199662 | 3300049574 | Bacteria | 1606 |
| 1129 | Ga0501038_0959271 | 3300049574 | Bacteria | 629 |
| 1130 | Ga0501039_1229646 | 3300049575 | Bacteria | 579 |
| 1131 | Ga0501040_1292022 | 3300049576 | Bacteria | 529 |
| 1132 | Ga0501047_0263628 | 3300049581 | Bacteria | 1570 |
| 1133 | Ga0501047_0472989 | 3300049581 | Bacteria | 1081 |
| 1134 | Ga0501047_0713849 | 3300049581 | Bacteria | 820 |
| 1135 | Ga0501067_0286748 | 3300049583 | Bacteria | 917 |
| 1136 | Ga0501070_0000870 | 3300049586 | Bacteria | 27482 |
| 1137 | Ga0501070_0002439 | 3300049586 | Bacteria | 16306 |
| 1138 | Ga0501070_0008387 | 3300049586 | Bacteria | 8729 |
| 1139 | Ga0501070_0119798 | 3300049586 | Bacteria | 2175 |
| 1140 | Ga0501071_0074886 | 3300049587 | Bacteria | 2471 |
| 1141 | Ga0501072_0115703 | 3300049588 | Bacteria | 2135 |
| 1142 | Ga0501073_0010141 | 3300049589 | Bacteria | 6923 |
| 1143 | Ga0501074_0000165 | 3300049590 | Bacteria | 35249 |
| 1144 | Ga0501076_0015578 | 3300049592 | Bacteria | 5751 |
| 1145 | Ga0501079_0000028 | 3300049741 | Bacteria | 60671 |
| 1146 | Ga0501079_0106786 | 3300049741 | Bacteria | 2173 |
| 1147 | Ga0501079_0827233 | 3300049741 | Bacteria | 729 |
| 1148 | Ga0501080_0000294 | 3300049742 | Bacteria | 37892 |
| 1149 | Ga0501080_0123710 | 3300049742 | Bacteria | 2396 |
| 1150 | Ga0501080_0245239 | 3300049742 | Bacteria | 1634 |
| 1151 | Ga0501080_1612952 | 3300049742 | Bacteria | 549 |
| 1152 | Ga0501035_0938581 | 3300049822 | Bacteria | 683 |
| 1153 | Ga0501035_1027947 | 3300049822 | Bacteria | 647 |
| 1154 | Ga0501044_0047605 | 3300049823 | Bacteria | 4435 |
| 1155 | Ga0501044_0106545 | 3300049823 | Bacteria | 2815 |
| 1156 | Ga0501044_0622133 | 3300049823 | Bacteria | 971 |
| 1157 | nmdc:mga03n38_196994_c1 | 3300050490 | Bacteria | 1040 |
| 1158 | nmdc:mga0qj67_254350_c1 | 3300050509 | Bacteria | 1425 |
| 1159 | nmdc:mga0n895_1106466_c1 | 3300050512 | Bacteria | 769 |
| 1160 | nmdc:mga0n895_1443160_c1 | 3300050512 | Bacteria | 656 |
| 1161 | nmdc:mga0n895_649741_c1 | 3300050512 | Bacteria | 1054 |
| 1162 | nmdc:mga0rr50_466932_c1 | 3300050513 | Bacteria | 1071 |
| 1163 | nmdc:mga08x19_412551_c1 | 3300050514 | Bacteria | 948 |
| 1164 | nmdc:mga08x19_531065_c1 | 3300050514 | Bacteria | 832 |
| 1165 | nmdc:mga0a205_343328_c1 | 3300050515 | Bacteria | 1361 |
| 1166 | Ga0495601_0046075 | 3300053077 | Bacteria | 2744 |
| 1167 | Ga0495601_0065334 | 3300053077 | Bacteria | 2315 |
| 1168 | Ga0495601_0097862 | 3300053077 | Bacteria | 1893 |
| 1169 | Ga0495601_0603446 | 3300053077 | Bacteria | 704 |
| 1170 | Ga0495601_0784920 | 3300053077 | Bacteria | 605 |
| 1171 | Ga0495612_0005449 | 3300053078 | Bacteria | 5260 |
| 1172 | Ga0495612_0019602 | 3300053078 | Bacteria | 2709 |
| 1173 | Ga0495612_0053775 | 3300053078 | Bacteria | 1658 |
| 1174 | Ga0495612_0115923 | 3300053078 | Bacteria | 1150 |
| 1175 | Ga0495595_0000695 | 3300053084 | Bacteria | 12852 |
| 1176 | Ga0495595_0003978 | 3300053084 | Bacteria | 5907 |
| 1177 | Ga0495595_0031873 | 3300053084 | Bacteria | 2371 |
| 1178 | Ga0495595_0132347 | 3300053084 | Bacteria | 1220 |
| 1179 | Ga0495595_0175118 | 3300053084 | Bacteria | 1063 |
| 1180 | Ga0495619_0070377 | 3300053085 | Bacteria | 2339 |
| 1181 | Ga0495619_0211476 | 3300053085 | Bacteria | 1343 |
| 1182 | Ga0495619_0225921 | 3300053085 | Bacteria | 1297 |
| 1183 | Ga0495619_0409132 | 3300053085 | Bacteria | 936 |
| 1184 | Ga0495619_0513577 | 3300053085 | Bacteria | 823 |
| 1185 | Ga0500604_0021036 | 3300053151 | Bacteria | 1841 |
| 1186 | Ga0500616_0005761 | 3300053153 | Bacteria | 8323 |
| 1187 | Ga0500616_0027666 | 3300053153 | Bacteria | 3129 |
| 1188 | Ga0500627_0431834 | 3300053158 | Bacteria | 557 |
| 1189 | Ga0501084_0073828 | 3300054114 | Bacteria | 2856 |
| 1190 | Ga0501082_0258393 | 3300060353 | Bacteria | 1515 |
| 1191 | Ga0466962_0094382 | 3300061719 | Bacteria | 1434 |
| 1192 | Ga0466962_0206295 | 3300061719 | Bacteria | 961 |
| 1193 | Ga0466962_0211969 | 3300061719 | Bacteria | 948 |
| 1194 | Ga0466962_0401100 | 3300061719 | Bacteria | 687 |
| 1195 | Ga0466962_0735411 | 3300061719 | Bacteria | 507 |
| 1196 | Ga0530510_0064626 | 3300061734 | Bacteria | 2650 |
| 1197 | Ga0530510_0881200 | 3300061734 | Bacteria | 684 |
| 1198 | 2644035741 | 2643221604 | Bacteria | 5014917 |
| 1199 | 2644080909 | 2643221613 | Bacteria | 4622396 |
| 1200 | 2644663774 | 2643221721 | Bacteria | 4486924 |
| 1201 | 2729909339 | 2728369276 | Bacteria | 5610032 |
| 1202 | 2812362696 | 2811994880 | Bacteria | 4147780 |
| 1203 | 2857482231 | 2857481737 | Bacteria | 4761446 |
| 1204 | 2915360294 | 2915358134 | Bacteria | 6050864 |
| 1205 | 2935892405 | 2935890801 | Bacteria | 4593001 |
| 1206 | 2974319383 | 2974315732 | Bacteria | 4602776 |
| 1207 | 2984527591 | 2984523437 | Bacteria | 4508481 |
| 1208 | 8054478914 | 8054472261 | Bacteria | 7464355 |
| 1209 | Ga0105238_10804158 | |||
| 1210 | JGI24746J21847_1013548 | |||
| 1211 | JGI24737J22298_10039524 | |||
| 1212 | JGI24737J22298_10078850 | |||
| 1213 | JGI24737J22298_10240644 | |||
| 1214 | JGI24743J22301_10019798 | |||
| 1215 | JGI24743J22301_10115525 | |||
| 1216 | JGI24735J21928_10078215 | |||
| 1217 | JGI24745J21846_1001491 | |||
| 1218 | JGI24738J21930_10009655 | |||
| 1219 | JGI24749J21850_1003410 | |||
| 1220 | JGI24744J21845_10007601 | |||
| 1221 | JGI24033J26618_1010355 | |||
| 1222 | JGI24742J22300_10067248 | |||
| 1223 | Ga0006778J45830_1044288 | |||
| 1224 | JGI25406J46586_10002391 | |||
| 1225 | Ga0007429J51699_1047141 | |||
| 1226 | JGI25404J52841_10011303 | |||
| 1227 | Ga0070658_10001334 | |||
| 1228 | Ga0070658_10464077 | |||
| 1229 | Ga0070676_10085328 | |||
| 1230 | Ga0070683_100177406 | |||
| 1231 | Ga0070683_100204454 | |||
| 1232 | Ga0070690_100109719 | |||
| 1233 | Ga0070690_100413224 | |||
| 1234 | Ga0068869_100290372 | |||
| 1235 | Ga0070666_10018299 | |||
| 1236 | Ga0070666_10178697 | |||
| 1237 | Ga0070680_100246607 | |||
| 1238 | Ga0070682_100058203 | |||
| 1239 | Ga0070682_100272843 | |||
| 1240 | Ga0070682_100484551 | |||
| 1241 | Ga0068868_100202855 | |||
| 1242 | Ga0070660_100446377 | |||
| 1243 | Ga0070689_100393802 | |||
| 1244 | Ga0070691_10010169 | |||
| 1245 | Ga0070691_10145861 | |||
| 1246 | Ga0070687_100002082 | |||
| 1247 | Ga0070661_100006268 | |||
| 1248 | Ga0070661_100466744 | |||
| 1249 | Ga0070692_10009092 | |||
| 1250 | Ga0070692_10043539 | |||
| 1251 | Ga0070692_10154244 | |||
| 1252 | Ga0070668_100081589 | |||
| 1253 | Ga0070668_100097032 | |||
| 1254 | Ga0070668_100279476 | |||
| 1255 | Ga0070668_101367960 | |||
| 1256 | Ga0070669_100098984 | |||
| 1257 | Ga0070669_100309009 | |||
| 1258 | Ga0070669_101185950 | |||
| 1259 | Ga0070675_100021579 | |||
| 1260 | Ga0070675_100025886 | |||
| 1261 | Ga0070671_100130792 | |||
| 1262 | Ga0070674_100071023 | |||
| 1263 | Ga0070674_100130095 | |||
| 1264 | Ga0070674_100150958 | |||
| 1265 | Ga0070673_100049541 | |||
| 1266 | Ga0070673_100773630 | |||
| 1267 | Ga0070673_100857848 | |||
| 1268 | Ga0070659_100026681 | |||
| 1269 | Ga0070659_100081814 | |||
| 1270 | Ga0070659_100617344 | |||
| 1271 | Ga0070667_100176437 | |||
| 1272 | Ga0070667_100840872 | |||
| 1273 | Ga0070703_10013561 | |||
| 1274 | Ga0070709_10069886 | |||
| 1275 | Ga0070709_10136634 | |||
| 1276 | Ga0070709_10384348 | |||
| 1277 | Ga0070709_10610528 | |||
| 1278 | Ga0070709_10625097 | |||
| 1279 | Ga0070714_100001005 | |||
| 1280 | Ga0070714_100010667 | |||
| 1281 | Ga0070714_100029966 | |||
| 1282 | Ga0070714_100108336 | |||
| 1283 | Ga0070714_100148840 | |||
| 1284 | Ga0070714_100283197 | |||
| 1285 | Ga0070714_100357625 | |||
| 1286 | Ga0070714_101209753 | |||
| 1287 | Ga0070714_101548794 | |||
| 1288 | Ga0070713_100000980 | |||
| 1289 | Ga0070713_100016714 | |||
| 1290 | Ga0070713_100031859 | |||
| 1291 | Ga0070713_100081557 | |||
| 1292 | Ga0070713_100151629 | |||
| 1293 | Ga0070713_100159598 | |||
| 1294 | Ga0070713_100238177 | |||
| 1295 | Ga0070713_100410352 | |||
| 1296 | Ga0070713_100899245 | |||
| 1297 | Ga0070713_101080159 | |||
| 1298 | Ga0070710_10000603 | |||
| 1299 | Ga0070710_10029778 | |||
| 1300 | Ga0070710_10070485 | |||
| 1301 | Ga0070710_10190414 | |||
| 1302 | Ga0070710_10321441 | |||
| 1303 | Ga0070710_10427196 | |||
| 1304 | Ga0070701_10011409 | |||
| 1305 | Ga0070701_10163401 | |||
| 1306 | Ga0070711_100019460 | |||
| 1307 | Ga0070711_100025744 | |||
| 1308 | Ga0070711_100032188 | |||
| 1309 | Ga0070711_100081106 | |||
| 1310 | Ga0070711_100314026 | |||
| 1311 | Ga0070711_100316936 | |||
| 1312 | Ga0070711_100402370 | |||
| 1313 | Ga0070700_100023955 | |||
| 1314 | Ga0070700_100516188 | |||
| 1315 | Ga0070694_100552815 | |||
| 1316 | Ga0070708_100000689 | |||
| 1317 | Ga0070708_100153080 | |||
| 1318 | Ga0070708_100165877 | |||
| 1319 | Ga0070663_100365905 | |||
| 1320 | Ga0070678_100031596 | |||
| 1321 | Ga0070681_10535103 | |||
| 1322 | Ga0068867_100021638 | |||
| 1323 | Ga0068867_100142992 | |||
| 1324 | Ga0068867_100246913 | |||
| 1325 | Ga0070685_10005567 | |||
| 1326 | Ga0070685_10061040 | |||
| 1327 | Ga0070706_100043596 | |||
| 1328 | Ga0070706_100062230 | |||
| 1329 | Ga0070706_100176904 | |||
| 1330 | Ga0070706_100656209 | |||
| 1331 | Ga0070706_100909176 | |||
| 1332 | Ga0070706_101256552 | |||
| 1333 | Ga0070707_100068631 | |||
| 1334 | Ga0070707_100071847 | |||
| 1335 | Ga0070707_100225567 | |||
| 1336 | Ga0070707_100701923 | |||
| 1337 | Ga0070707_100853199 | |||
| 1338 | Ga0070698_100008291 | |||
| 1339 | Ga0070698_100127386 | |||
| 1340 | Ga0070698_100299881 | |||
| 1341 | Ga0070698_100566646 | |||
| 1342 | Ga0070698_101099057 | |||
| 1343 | Ga0070699_100000598 | |||
| 1344 | Ga0070699_100616569 | |||
| 1345 | Ga0070699_101126584 | |||
| 1346 | Ga0070679_100192520 | |||
| 1347 | Ga0070679_100241362 | |||
| 1348 | Ga0070679_101220756 | |||
| 1349 | Ga0070684_100176846 | |||
| 1350 | Ga0070684_101203255 | |||
| 1351 | Ga0070697_100020176 | |||
| 1352 | Ga0070697_100048802 | |||
| 1353 | Ga0068853_100059745 | |||
| 1354 | Ga0068853_100545927 | |||
| 1355 | Ga0070672_100017922 | |||
| 1356 | Ga0070672_100155987 | |||
| 1357 | Ga0070686_100133122 | |||
| 1358 | Ga0070686_100283100 | |||
| 1359 | Ga0070686_101119967 | |||
| 1360 | Ga0070695_100081322 | |||
| 1361 | Ga0070665_100232955 | |||
| 1362 | Ga0070665_100464189 | |||
| 1363 | Ga0070665_100580474 | |||
| 1364 | Ga0070704_100131820 | |||
| 1365 | Ga0070704_100581480 | |||
| 1366 | Ga0068855_100376944 | |||
| 1367 | Ga0068855_100772716 | |||
| 1368 | Ga0068855_101929810 | |||
| 1369 | Ga0070664_100052167 | |||
| 1370 | Ga0070664_100419259 | |||
| 1371 | Ga0070664_100760209 | |||
| 1372 | Ga0068857_100260488 | |||
| 1373 | Ga0068857_100448452 | |||
| 1374 | Ga0068854_100229499 | |||
| 1375 | Ga0068854_100764063 | |||
| 1376 | Ga0068856_100052348 | |||
| 1377 | Ga0068856_102094204 | |||
| 1378 | Ga0070702_100018849 | |||
| 1379 | Ga0070702_100042485 | |||
| 1380 | Ga0068852_100023223 | |||
| 1381 | Ga0068852_100180961 | |||
| 1382 | Ga0068852_100305460 | |||
| 1383 | Ga0068852_100764183 | |||
| 1384 | Ga0068852_101453038 | |||
| 1385 | Ga0068864_100036842 | |||
| 1386 | Ga0068864_100453331 | |||
| 1387 | Ga0068864_101864698 | |||
| 1388 | Ga0068866_10131775 | |||
| 1389 | Ga0068861_100016968 | |||
| 1390 | Ga0068861_100058479 | |||
| 1391 | Ga0068861_100544226 | |||
| 1392 | Ga0068861_101296068 | |||
| 1393 | Ga0068851_10115374 | |||
| 1394 | Ga0068870_10006468 | |||
| 1395 | Ga0068870_10146217 | |||
| 1396 | Ga0068863_100802788 | |||
| 1397 | Ga0068863_100909255 | |||
| 1398 | Ga0068858_100333310 | |||
| 1399 | Ga0068858_100477516 | |||
| 1400 | Ga0068858_100719564 | |||
| 1401 | Ga0068858_101927015 | |||
| 1402 | Ga0068860_100118000 | |||
| 1403 | Ga0068860_101861056 | |||
| 1404 | Ga0081455_10001042 | |||
| 1405 | Ga0081540_1000155 | |||
| 1406 | Ga0081539_10000182 | |||
| 1407 | Ga0081539_10015694 | |||
| 1408 | Ga0081539_10048728 | |||
| 1409 | Ga0081539_10078950 | |||
| 1410 | Ga0070717_10014112 | |||
| 1411 | Ga0070717_10023465 | |||
| 1412 | Ga0070717_10025511 | |||
| 1413 | Ga0070717_10113142 | |||
| 1414 | Ga0070717_10173693 | |||
| 1415 | Ga0070717_10196325 | |||
| 1416 | Ga0070717_10235643 | |||
| 1417 | Ga0070717_10396267 | |||
| 1418 | Ga0070717_10457716 | |||
| 1419 | Ga0070717_10634596 | |||
| 1420 | Ga0070717_10775984 | |||
| 1421 | Ga0070717_10861528 | |||
| 1422 | Ga0070717_10928106 | |||
| 1423 | Ga0075365_10935736 | |||
| 1424 | Ga0075364_10279144 | |||
| 1425 | Ga0075432_10137706 | |||
| 1426 | Ga0070715_10244523 | |||
| 1427 | Ga0070715_10299384 | |||
| 1428 | Ga0070715_10299591 | |||
| 1429 | Ga0070715_10523725 | |||
| 1430 | Ga0070715_10608017 | |||
| 1431 | Ga0070716_100000609 | |||
| 1432 | Ga0070716_100025893 | |||
| 1433 | Ga0070716_100392330 | |||
| 1434 | Ga0070716_100501181 | |||
| 1435 | Ga0070712_100013755 | |||
| 1436 | Ga0070712_100082193 | |||
| 1437 | Ga0070712_100133654 | |||
| 1438 | Ga0070712_100221006 | |||
| 1439 | Ga0070712_100224884 | |||
| 1440 | Ga0070712_100375282 | |||
| 1441 | Ga0070712_100406524 | |||
| 1442 | Ga0070712_100518902 | |||
| 1443 | Ga0070712_100713948 | |||
| 1444 | Ga0070712_100714242 | |||
| 1445 | Ga0075367_10378267 | |||
| 1446 | Ga0097621_100080443 | |||
| 1447 | Ga0075370_10400925 | |||
| 1448 | Ga0075428_100370093 | |||
| 1449 | Ga0075428_100505329 | |||
| 1450 | Ga0075428_100523460 | |||
| 1451 | Ga0075430_100403872 | |||
| 1452 | Ga0075433_10150008 | |||
| 1453 | Ga0075434_101178146 | |||
| 1454 | Ga0075434_102212997 | |||
| 1455 | Ga0068865_100048531 | |||
| 1456 | Ga0068865_100099173 | |||
| 1457 | Ga0075436_100398779 | |||
| 1458 | Ga0075436_100410951 | |||
| 1459 | Ga0075435_100514271 | |||
| 1460 | Ga0075435_101313102 | |||
| 1461 | Ga0099795_10171914 | |||
| 1462 | Ga0105240_10168832 | |||
| 1463 | Ga0105240_10494076 | |||
| 1464 | Ga0111539_11143479 | |||
| 1465 | Ga0105245_10044818 | |||
| 1466 | Ga0105245_10184743 | |||
| 1467 | Ga0105245_10909394 | |||
| 1468 | Ga0105247_10260883 | |||
| 1469 | Ga0105247_11138636 | |||
| 1470 | Ga0105243_10008770 | |||
| 1471 | Ga0105243_10213376 | |||
| 1472 | Ga0105242_10084985 | |||
| 1473 | Ga0105242_10311109 | |||
| 1474 | Ga0105248_10026802 | |||
| 1475 | Ga0105248_11563572 | |||
| 1476 | Ga0105248_12275657 | |||
| 1477 | Ga0105237_11389034 | |||
| 1478 | Ga0105238_10536529 | |||
| 1479 | Ga0105238_11115682 | |||
| 1480 | Ga0105249_10020433 | |||
| 1481 | Ga0105249_13110612 | |||
| 1482 | Ga0105239_10038166 | |||
| 1483 | Ga0105239_10206724 | |||
| 1484 | Ga0105239_10979084 | |||
| 1485 | Ga0105246_10186261 | |||
| 1486 | Ga0157346_1006344 | |||
| 1487 | Ga0157341_1014422 | |||
| 1488 | Ga0157345_1006121 | |||
| 1489 | Ga0157339_1002908 | |||
| 1490 | Ga0157342_1025667 | |||
| 1491 | Ga0157338_1009154 | |||
| 1492 | Ga0157371_10270031 | |||
| 1493 | Ga0157370_10195802 | |||
| 1494 | Ga0157370_10206041 | |||
| 1495 | Ga0157369_10005983 | |||
| 1496 | Ga0157369_10287479 | |||
| 1497 | Ga0157369_10384656 | |||
| 1498 | Ga0157369_10476015 | |||
| 1499 | Ga0157369_10740358 | |||
| 1500 | Ga0157369_10740414 | |||
| 1501 | Ga0157374_10090784 | |||
| 1502 | Ga0157374_10606988 | |||
| 1503 | Ga0157374_10670058 | |||
| 1504 | Ga0157374_10719302 | |||
| 1505 | Ga0157374_10747764 | |||
| 1506 | Ga0157378_10177599 | |||
| 1507 | Ga0157378_12290282 | |||
| 1508 | Ga0163162_10151792 | |||
| 1509 | Ga0163162_10163961 | |||
| 1510 | Ga0157372_10024275 | |||
| 1511 | Ga0157372_10346614 | |||
| 1512 | Ga0157372_10624214 | |||
| 1513 | Ga0157372_10899177 | |||
| 1514 | Ga0157372_12202267 | |||
| 1515 | Ga0157375_10027776 | |||
| 1516 | Ga0157375_11047718 | |||
| 1517 | Ga0157375_11581704 | |||
| 1518 | Ga0157375_12461602 | |||
| 1519 | Ga0163163_10051454 | |||
| 1520 | Ga0163163_10279240 | |||
| 1521 | Ga0163163_12199884 | |||
| 1522 | Ga0157380_10071193 | |||
| 1523 | Ga0157380_10244361 | |||
| 1524 | Ga0157380_10365665 | |||
| 1525 | Ga0157380_11435823 | |||
| 1526 | Ga0182008_10206569 | |||
| 1527 | Ga0182008_10491442 | |||
| 1528 | Ga0157377_10006429 | |||
| 1529 | Ga0157377_10102607 | |||
| 1530 | Ga0157377_10370711 | |||
| 1531 | Ga0157379_10139721 | |||
| 1532 | Ga0157379_10163456 | |||
| 1533 | Ga0197907_10508658 | |||
| 1534 | Ga0197907_10622865 | |||
| 1535 | Ga0197907_11109172 | |||
| 1536 | Ga0206356_11565027 | |||
| 1537 | Ga0206356_11660410 | |||
| 1538 | Ga0206356_11707227 | |||
| 1539 | Ga0206349_1207593 | |||
| 1540 | Ga0206349_1275547 | |||
| 1541 | Ga0206355_1328187 | |||
| 1542 | Ga0206351_10280240 | |||
| 1543 | Ga0206350_10940578 | |||
| 1544 | Ga0206354_10091345 | |||
| 1545 | Ga0206354_11716454 | |||
| 1546 | Ga0206353_10052697 | |||
| 1547 | Ga0206353_11007125 | |||
| 1548 | Ga0206353_11153682 | |||
| 1549 | Ga0206353_11908304 | |||
| 1550 | Ga0213876_10488631 | |||
| 1551 | Ga0213875_10001023 | |||
| 1552 | Ga0213875_10061756 | |||
| 1553 | Ga0224712_10218296 | |||
| 1554 | Ga0224712_10267560 | |||
| 1555 | Ga0224712_10553542 | |||
| 1556 | Ga0224712_10689319 | |||
| 1557 | Ga0207656_10497837 | |||
| 1558 | Ga0207653_10006126 | |||
| 1559 | Ga0207692_10003642 | |||
| 1560 | Ga0207692_10030932 | |||
| 1561 | Ga0207692_10185365 | |||
| 1562 | Ga0207692_10393963 | |||
| 1563 | Ga0207642_10073959 | |||
| 1564 | Ga0207710_10598489 | |||
| 1565 | Ga0207688_10313444 | |||
| 1566 | Ga0207680_10068305 | |||
| 1567 | Ga0207647_10316269 | |||
| 1568 | Ga0207647_10526590 | |||
| 1569 | Ga0207685_10265100 | |||
| 1570 | Ga0207685_10392355 | |||
| 1571 | Ga0207699_10005541 | |||
| 1572 | Ga0207699_10010766 | |||
| 1573 | Ga0207699_10015437 | |||
| 1574 | Ga0207699_10018303 | |||
| 1575 | Ga0207699_10136664 | |||
| 1576 | Ga0207699_10291591 | |||
| 1577 | Ga0207699_10463688 | |||
| 1578 | Ga0207645_10134402 | |||
| 1579 | Ga0207643_10007384 | |||
| 1580 | Ga0207643_10050196 | |||
| 1581 | Ga0207705_10000348 | |||
| 1582 | Ga0207705_10394779 | |||
| 1583 | Ga0207705_11406801 | |||
| 1584 | Ga0207684_10028586 | |||
| 1585 | Ga0207684_10033261 | |||
| 1586 | Ga0207684_10100342 | |||
| 1587 | Ga0207684_10217379 | |||
| 1588 | Ga0207707_10355858 | |||
| 1589 | Ga0207671_11086843 | |||
| 1590 | Ga0207693_10020749 | |||
| 1591 | Ga0207693_10026732 | |||
| 1592 | Ga0207693_10063429 | |||
| 1593 | Ga0207693_10126083 | |||
| 1594 | Ga0207693_10473256 | |||
| 1595 | Ga0207693_10620939 | |||
| 1596 | Ga0207663_10022954 | |||
| 1597 | Ga0207663_10129192 | |||
| 1598 | Ga0207663_10190431 | |||
| 1599 | Ga0207663_10235018 | |||
| 1600 | Ga0207663_10289353 | |||
| 1601 | Ga0207663_10600969 | |||
| 1602 | Ga0207660_10200988 | |||
| 1603 | Ga0207660_10501004 | |||
| 1604 | Ga0207662_10020778 | |||
| 1605 | Ga0207662_10042221 | |||
| 1606 | Ga0207662_10055325 | |||
| 1607 | Ga0207649_10046176 | |||
| 1608 | Ga0207649_10835734 | |||
| 1609 | Ga0207652_10101526 | |||
| 1610 | Ga0207652_10290539 | |||
| 1611 | Ga0207646_10000455 | |||
| 1612 | Ga0207646_10047539 | |||
| 1613 | Ga0207646_10060714 | |||
| 1614 | Ga0207646_10072140 | |||
| 1615 | Ga0207646_11222156 | |||
| 1616 | Ga0207646_11264748 | |||
| 1617 | Ga0207646_11273317 | |||
| 1618 | Ga0207681_10162550 | |||
| 1619 | Ga0207681_10211856 | |||
| 1620 | Ga0207694_10198116 | |||
| 1621 | Ga0207694_10688840 | |||
| 1622 | Ga0207694_11502000 | |||
| 1623 | Ga0207659_10048286 | |||
| 1624 | Ga0207687_10090470 | |||
| 1625 | Ga0207687_10203536 | |||
| 1626 | Ga0207687_10301569 | |||
| 1627 | Ga0207687_10752475 | |||
| 1628 | Ga0207687_11427047 | |||
| 1629 | Ga0207700_10003128 | |||
| 1630 | Ga0207700_10032514 | |||
| 1631 | Ga0207700_10041231 | |||
| 1632 | Ga0207700_10095506 | |||
| 1633 | Ga0207700_10127550 | |||
| 1634 | Ga0207700_10141530 | |||
| 1635 | Ga0207700_10459867 | |||
| 1636 | Ga0207700_10919010 | |||
| 1637 | Ga0207700_10968530 | |||
| 1638 | Ga0207700_11014012 | |||
| 1639 | Ga0207664_10000750 | |||
| 1640 | Ga0207664_10008250 | |||
| 1641 | Ga0207664_10011323 | |||
| 1642 | Ga0207664_10025821 | |||
| 1643 | Ga0207664_10091634 | |||
| 1644 | Ga0207664_10107229 | |||
| 1645 | Ga0207664_10146802 | |||
| 1646 | Ga0207664_10219706 | |||
| 1647 | Ga0207664_10352815 | |||
| 1648 | Ga0207664_10427580 | |||
| 1649 | Ga0207664_10666644 | |||
| 1650 | Ga0207644_10385746 | |||
| 1651 | Ga0207644_10480077 | |||
| 1652 | Ga0207644_10518686 | |||
| 1653 | Ga0207690_10035623 | |||
| 1654 | Ga0207690_10376563 | |||
| 1655 | Ga0207690_10701253 | |||
| 1656 | Ga0207706_10109079 | |||
| 1657 | Ga0207686_10230814 | |||
| 1658 | Ga0207709_10017782 | |||
| 1659 | Ga0207709_10097539 | |||
| 1660 | Ga0207709_10556548 | |||
| 1661 | Ga0207670_10078997 | |||
| 1662 | Ga0207670_10401797 | |||
| 1663 | Ga0207669_10036897 | |||
| 1664 | Ga0207669_10042551 | |||
| 1665 | Ga0207669_10070384 | |||
| 1666 | Ga0207704_10100709 | |||
| 1667 | Ga0207665_10000630 | |||
| 1668 | Ga0207665_10029520 | |||
| 1669 | Ga0207665_10154284 | |||
| 1670 | Ga0207665_11158101 | |||
| 1671 | Ga0207691_10001822 | |||
| 1672 | Ga0207691_10076277 | |||
| 1673 | Ga0207711_10546925 | |||
| 1674 | Ga0207689_10006073 | |||
| 1675 | Ga0207661_10129498 | |||
| 1676 | Ga0207661_10164855 | |||
| 1677 | Ga0207661_10183917 | |||
| 1678 | Ga0207661_10737401 | |||
| 1679 | Ga0207679_11329400 | |||
| 1680 | Ga0207679_11560748 | |||
| 1681 | Ga0207667_10149859 | |||
| 1682 | Ga0207712_10142042 | |||
| 1683 | Ga0207668_10147559 | |||
| 1684 | Ga0207668_10208508 | |||
| 1685 | Ga0207668_10427646 | |||
| 1686 | Ga0207640_10048321 | |||
| 1687 | Ga0207658_10022818 | |||
| 1688 | Ga0207677_10224393 | |||
| 1689 | Ga0207677_10910673 | |||
| 1690 | Ga0207677_11191571 | |||
| 1691 | Ga0207703_10241442 | |||
| 1692 | Ga0207703_11125464 | |||
| 1693 | Ga0207639_10173103 | |||
| 1694 | Ga0207639_10550514 | |||
| 1695 | Ga0207678_10012292 | |||
| 1696 | Ga0207678_10070567 | |||
| 1697 | Ga0207678_10376098 | |||
| 1698 | Ga0207708_10000897 | |||
| 1699 | Ga0207708_10012149 | |||
| 1700 | Ga0207708_10426919 | |||
| 1701 | Ga0207702_10083312 | |||
| 1702 | Ga0207702_10173515 | |||
| 1703 | Ga0207702_10835202 | |||
| 1704 | Ga0207702_11432338 | |||
| 1705 | Ga0207641_10155375 | |||
| 1706 | Ga0207641_10912701 | |||
| 1707 | Ga0207641_11237625 | |||
| 1708 | Ga0207648_10001889 | |||
| 1709 | Ga0207648_10075562 | |||
| 1710 | Ga0207676_10036206 | |||
| 1711 | Ga0207676_10157805 | |||
| 1712 | Ga0207676_10707540 | |||
| 1713 | Ga0207676_11345777 | |||
| 1714 | Ga0207674_10003194 | |||
| 1715 | Ga0207674_10098142 | |||
| 1716 | Ga0207674_10684699 | |||
| 1717 | Ga0207675_100009052 | |||
| 1718 | Ga0207675_100010850 | |||
| 1719 | Ga0207675_100025134 | |||
| 1720 | Ga0207675_101113697 | |||
| 1721 | Ga0207683_10003299 | |||
| 1722 | Ga0207683_10101369 | |||
| 1723 | Ga0207698_10091294 | |||
| 1724 | Ga0207698_10125713 | |||
| 1725 | Ga0207698_10180545 | |||
| 1726 | Ga0207698_10193095 | |||
| 1727 | Ga0207698_10611778 | |||
| 1728 | Ga0207698_11374801 | |||
| 1729 | Ga0207428_10087100 | |||
| 1730 | Ga0268266_10070591 | |||
| 1731 | Ga0268266_10101036 | |||
| 1732 | Ga0268266_10299978 | |||
| 1733 | Ga0268266_11365424 | |||
| 1734 | Ga0268265_10128290 | |||
| 1735 | Ga0268265_10452277 | |||
| 1736 | Ga0268264_11676015 | |||
| 1737 | Ga0268264_11686365 | |||
| 1738 | Ga0265340_10026184 | |||
| 1739 | Ga0307513_10000509 | |||
| 1740 | Ga0307513_10004140 | |||
| 1741 | Ga0307408_101110897 | |||
| 1742 | Ga0307508_10318598 | |||
| 1743 | Ga0307405_10278048 | |||
| 1744 | Ga0307405_10437318 | |||
| 1745 | Ga0307405_11009927 | |||
| 1746 | Ga0307405_11445021 | |||
| 1747 | Ga0307518_10018934 | |||
| 1748 | Ga0307410_10083351 | |||
| 1749 | Ga0307406_10367514 | |||
| 1750 | Ga0307407_10561997 | |||
| 1751 | Ga0307409_100217341 | |||
| 1752 | Ga0307409_100298104 | |||
| 1753 | Ga0307409_100547679 | |||
| 1754 | Ga0307409_100942870 | |||
| 1755 | Ga0307409_100974573 | |||
| 1756 | Ga0307416_100662092 | |||
| 1757 | Ga0307416_101254651 | |||
| 1758 | Ga0307416_101602618 | |||
| 1759 | Ga0307414_11310602 | |||
| 1760 | Ga0307411_10874916 | |||
| 1761 | Ga0307415_100599783 | |||
| 1762 | Ga0307415_101669454 | |||
| 1763 | Ga0373926_0003088 | |||
| 1764 | Ga0373926_0018529 | |||
| 1765 | Ga0373928_0040255 | |||
| 1766 | Ga0373929_0048758 | |||
| 1767 | Ga0373934_0011984 | |||
| 1768 | Ga0373934_0111726 | |||
| 1769 | Ga0373944_0001169 | |||
| 1770 | Ga0373944_0039146 | |||
| 1771 | Ga0373944_0057873 | |||
| 1772 | Ga0373952_0059096 | |||
| 1773 | Ga0373923_0008579 | |||
| 1774 | Ga0373923_0009259 | |||
| 1775 | Ga0373923_0094860 | |||
| 1776 | Ga0373923_0389044 | |||
| 1777 | Ga0373923_0584409 | |||
| 1778 | Ga0373932_0314182 | |||
| 1779 | Ga0373936_0000677 | |||
| 1780 | Ga0373936_0003020 | |||
| 1781 | Ga0373936_0039068 | |||
| 1782 | Ga0373936_0164175 | |||
| 1783 | Ga0373936_0185196 | |||
| 1784 | Ga0373941_0010718 | |||
| 1785 | Ga0373945_0000575 | |||
| 1786 | Ga0373945_0004809 | |||
| 1787 | Ga0373945_0359806 | |||
| 1788 | Ga0373953_0053563 | |||
| 1789 | Ga0373953_0175439 | |||
| 1790 | Ga0373953_0191267 | |||
| 1791 | Ga0373954_0052602 | |||
| 1792 | Ga0373954_0177958 | |||
| 1793 | Ga0373954_0232887 | |||
| 1794 | Ga0373954_0302834 | |||
| 1795 | Ga0373956_0089161 | |||
| 1796 | Ga0373956_0149317 | |||
| 1797 | Ga0373957_0016530 | |||
| 1798 | Ga0373957_0085801 | |||
| 1799 | Ga0373960_0201097 | |||
| 1800 | Ga0373943_0000379 | |||
| 1801 | Ga0373943_0045289 | |||
| 1802 | Ga0373943_0166765 | |||
| 1803 | Ga0373946_0000071 | |||
| 1804 | Ga0373946_0281200 | |||
| 1805 | Ga0373955_0029111 | |||
| 1806 | Ga0373955_0067910 | |||
| 1807 | Ga0373955_0097976 | |||
| 1808 | Ga0373942_0007491 | |||
| 1809 | Ga0373924_0006965 | |||
| 1810 | Ga0373924_0018685 | |||
| 1811 | Ga0373924_0058735 | |||
| 1812 | Ga0373924_0120167 | |||
| 1813 | Ga0373931_0276252 | |||
| 1814 | Ga0373931_0458854 | |||
| 1815 | Ga0373935_0007539 | |||
| 1816 | Ga0373935_0090545 | |||
| 1817 | Ga0373935_0104188 | |||
| 1818 | Ga0373935_0267929 | |||
| 1819 | Ga0373935_0302717 | |||
| 1820 | Ga0373935_0809744 | |||
| 1821 | Ga0373935_0985295 | |||
| 1822 | Ga0373927_0003532 | |||
| 1823 | Ga0373927_1144894 | |||
| 1824 | Ga0373933_0041762 | |||
| 1825 | Ga0373933_0118650 | |||
| 1826 | Ga0373933_0150942 | |||
| 1827 | Ga0373933_0292473 | |||
| 1828 | Ga0373947_0004135 | |||
| 1829 | Ga0373947_0077962 | |||
| 1830 | Ga0373947_0120772 | |||
| 1831 | Ga0373947_0177916 | |||
| 1832 | Ga0373947_0447689 | |||
| 1833 | Ga0373947_0634397 | |||
| 1834 | Ga0373947_0657328 | |||
| 1835 | Ga0373947_1130273 | |||
| 1836 | Ga0373937_0017044 | |||
| 1837 | Ga0373937_0080932 | |||
| 1838 | Ga0373937_0322147 | |||
| 1839 | Ga0373937_0367143 | |||
| 1840 | Ga0373937_0411295 | |||
| 1841 | Ga0373937_0447516 | |||
| 1842 | Ga0373937_0935843 | |||
| 1843 | Ga0373937_1226550 | |||
| 1844 | Ga0373937_1440201 | |||
| 1845 | Ga0373925_0003272 | |||
| 1846 | Ga0373925_0016415 | |||
| 1847 | Ga0373925_0244303 | |||
| 1848 | Ga0373925_0306716 | |||
| 1849 | Ga0373925_0423874 | |||
| 1850 | Ga0373925_1379853 | |||
| 1851 | Ga0395900_0082652 | |||
| 1852 | Ga0395900_0370668 | |||
| 1853 | Ga0395898_0126350 | |||
| 1854 | Ga0395905_1558331 | |||
| 1855 | Ga0436364_0066527 | |||
| 1856 | Ga0436364_0093190 | |||
| 1857 | Ga0436364_0661034 | |||
| 1858 | Ga0436364_0750168 | |||
| 1859 | Ga0436364_1052723 | |||
| 1860 | Ga0395901_0005587 | |||
| 1861 | Ga0436365_0478561 | |||
| 1862 | Ga0436360_0719369 | |||
| 1863 | Ga0436361_1034955 | |||
| 1864 | Ga0436363_0347872 | |||
| 1865 | Ga0436363_0387018 | |||
| 1866 | Ga0436363_0416526 | |||
| 1867 | Ga0436363_0531864 | |||
| 1868 | Ga0436363_1356157 | |||
| 1869 | Ga0436362_0081924 | |||
| 1870 | Ga0436362_1229093 | |||
| 1871 | Ga0451789_0173773 | |||
| 1872 | Ga0451789_0179690 | |||
| 1873 | Ga0451789_1346882 | |||
| 1874 | Ga0451791_0631542 | |||
| 1875 | Ga0451791_0830000 | |||
| 1876 | Ga0451791_1727689 | |||
| 1877 | Ga0451793_0554836 | |||
| 1878 | Ga0451793_1331298 | |||
| 1879 | Ga0451797_1036889 | |||
| 1880 | Ga0451802_0186256 | |||
| 1881 | Ga0451807_2461803 | |||
| 1882 | Ga0451833_0950911 | |||
| 1883 | Ga0451837_0986391 | |||
| 1884 | Ga0451841_0284230 | |||
| 1885 | Ga0451849_1443282 | |||
| 1886 | Ga0451851_0190844 | |||
| 1887 | Ga0451851_0920371 | |||
| 1888 | Ga0451843_0186394 | |||
| 1889 | Ga0451843_0610637 | |||
| 1890 | Ga0451855_1237994 | |||
| 1891 | Ga0451853_3336502 | |||
| 1892 | Ga0466969_0082340 | |||
| 1893 | Ga0466969_0115265 | |||
| 1894 | Ga0466972_0113475 | |||
| 1895 | Ga0466965_0095583 | |||
| 1896 | Ga0466965_0230525 | |||
| 1897 | Ga0466965_0357054 | |||
| 1898 | Ga0466965_0687028 | |||
| 1899 | Ga0466965_0704093 | |||
| 1900 | Ga0466966_0004582 | |||
| 1901 | Ga0466966_0031654 | |||
| 1902 | Ga0466966_0040811 | |||
| 1903 | Ga0466966_0161108 | |||
| 1904 | Ga0466966_0166643 | |||
| 1905 | Ga0466966_0256498 | |||
| 1906 | Ga0466966_0312027 | |||
| 1907 | Ga0466961_0002635 | |||
| 1908 | Ga0466961_0014664 | |||
| 1909 | Ga0466961_0034766 | |||
| 1910 | Ga0466961_0088021 | |||
| 1911 | Ga0466961_0182537 | |||
| 1912 | Ga0466961_0223855 | |||
| 1913 | Ga0466961_0468997 | |||
| 1914 | Ga0466961_0515465 | |||
| 1915 | Ga0466961_0971579 | |||
| 1916 | Ga0466963_0010924 | |||
| 1917 | Ga0466963_0099678 | |||
| 1918 | Ga0466963_0130745 | |||
| 1919 | Ga0466963_0268246 | |||
| 1920 | Ga0466963_0268445 | |||
| 1921 | Ga0466963_0300769 | |||
| 1922 | Ga0466963_0355707 | |||
| 1923 | Ga0466963_0391680 | |||
| 1924 | Ga0466963_0424871 | |||
| 1925 | Ga0466963_0466830 | |||
| 1926 | Ga0466963_0593198 | |||
| 1927 | Ga0466963_0601025 | |||
| 1928 | Ga0466963_0667425 | |||
| 1929 | Ga0466963_0953918 | |||
| 1930 | Ga0466963_0987304 | |||
| 1931 | Ga0466963_1047609 | |||
| 1932 | Ga0466963_1329301 | |||
| 1933 | Ga0466964_0166221 | |||
| 1934 | Ga0466964_0174688 | |||
| 1935 | Ga0466964_0457525 | |||
| 1936 | Ga0466964_0510045 | |||
| 1937 | Ga0466971_0072623 | |||
| 1938 | Ga0466971_0084801 | |||
| 1939 | Ga0466971_0090062 | |||
| 1940 | Ga0466971_0403250 | |||
| 1941 | Ga0466968_0168159 | |||
| 1942 | Ga0466970_0020493 | |||
| 1943 | Ga0466970_0022917 | |||
| 1944 | Ga0466970_0024598 | |||
| 1945 | Ga0466970_0026247 | |||
| 1946 | Ga0466970_0157949 | |||
| 1947 | Ga0466970_0376147 | |||
| 1948 | Ga0466970_0446076 | |||
| 1949 | Ga0466970_0473526 | |||
| 1950 | Ga0466970_0478969 | |||
| 1951 | Ga0466970_0508907 | |||
| 1952 | Ga0466970_0760667 | |||
| 1953 | Ga0466957_0022629 | |||
| 1954 | Ga0466957_0073280 | |||
| 1955 | Ga0466957_0075396 | |||
| 1956 | Ga0466957_0119843 | |||
| 1957 | Ga0466957_0149285 | |||
| 1958 | Ga0466957_0268841 | |||
| 1959 | Ga0466957_0328331 | |||
| 1960 | Ga0466957_0518162 | |||
| 1961 | Ga0466960_0011523 | |||
| 1962 | Ga0466960_0011688 | |||
| 1963 | Ga0466960_0066500 | |||
| 1964 | Ga0466960_0084184 | |||
| 1965 | Ga0466960_0117392 | |||
| 1966 | Ga0466960_0129251 | |||
| 1967 | Ga0466960_0193951 | |||
| 1968 | Ga0466960_0262719 | |||
| 1969 | Ga0466960_0299737 | |||
| 1970 | Ga0466960_0737375 | |||
| 1971 | Ga0466959_0009566 | |||
| 1972 | Ga0466959_0057534 | |||
| 1973 | Ga0466959_0077706 | |||
| 1974 | Ga0466959_0112410 | |||
| 1975 | Ga0466959_0126441 | |||
| 1976 | Ga0466959_0319455 | |||
| 1977 | Ga0466959_0437251 | |||
| 1978 | Ga0466959_0473689 | |||
| 1979 | Ga0466958_0004678 | |||
| 1980 | Ga0466958_0014999 | |||
| 1981 | Ga0466958_0021002 | |||
| 1982 | Ga0466958_0027972 | |||
| 1983 | Ga0466958_0031381 | |||
| 1984 | Ga0466958_0099491 | |||
| 1985 | Ga0466958_0117316 | |||
| 1986 | Ga0466958_0179457 | |||
| 1987 | Ga0466958_0234118 | |||
| 1988 | Ga0466958_0390254 | |||
| 1989 | Ga0466958_0414975 | |||
| 1990 | Ga0466958_0426275 | |||
| 1991 | Ga0466967_0003013 | |||
| 1992 | Ga0466967_0027192 | |||
| 1993 | Ga0466967_0032279 | |||
| 1994 | Ga0466967_0036020 | |||
| 1995 | Ga0466967_0056346 | |||
| 1996 | Ga0466967_0069355 | |||
| 1997 | Ga0466967_0106320 | |||
| 1998 | Ga0466967_0150483 | |||
| 1999 | Ga0466967_0169692 | |||
| 2000 | Ga0466967_0198562 | |||
| 2001 | Ga0466967_0212215 | |||
| 2002 | Ga0466967_0286030 | |||
| 2003 | Ga0466967_0456031 | |||
| 2004 | Ga0466967_0635184 | |||
| 2005 | Ga0466967_0670050 | |||
| 2006 | Ga0466967_1775412 | |||
| 2007 | Ga0495592_0012147 | |||
| 2008 | Ga0495592_0064131 | |||
| 2009 | Ga0495592_0121109 | |||
| 2010 | Ga0495592_0157132 | |||
| 2011 | Ga0495592_0210064 | |||
| 2012 | Ga0495603_0391585 | |||
| 2013 | Ga0495629_0007539 | |||
| 2014 | Ga0495629_0054132 | |||
| 2015 | Ga0495629_0176774 | |||
| 2016 | Ga0495629_0261621 | |||
| 2017 | Ga0495638_0039800 | |||
| 2018 | Ga0495641_0004087 | |||
| 2019 | Ga0495641_0016540 | |||
| 2020 | Ga0495641_0091403 | |||
| 2021 | Ga0495641_0152930 | |||
| 2022 | Ga0495651_0002693 | |||
| 2023 | Ga0495651_0025710 | |||
| 2024 | Ga0495651_0093048 | |||
| 2025 | Ga0495651_0180870 | |||
| 2026 | Ga0495651_0266062 | |||
| 2027 | Ga0495651_0533487 | |||
| 2028 | Ga0495653_0000555 | |||
| 2029 | Ga0495653_0004451 | |||
| 2030 | Ga0495653_0056273 | |||
| 2031 | Ga0495653_0070817 | |||
| 2032 | Ga0495653_0116414 | |||
| 2033 | Ga0495653_0256418 | |||
| 2034 | Ga0495653_0296624 | |||
| 2035 | Ga0495653_0531748 | |||
| 2036 | Ga0495650_0074459 | |||
| 2037 | Ga0495580_0023984 | |||
| 2038 | Ga0495580_0945142 | |||
| 2039 | Ga0495582_0001326 | |||
| 2040 | Ga0495582_0272416 | |||
| 2041 | Ga0495639_0045159 | |||
| 2042 | Ga0495639_0152156 | |||
| 2043 | Ga0495639_0187853 | |||
| 2044 | Ga0495639_0434700 | |||
| 2045 | Ga0495662_0030003 | |||
| 2046 | Ga0495662_0040261 | |||
| 2047 | Ga0495662_0040872 | |||
| 2048 | Ga0495662_0181721 | |||
| 2049 | Ga0495664_0002276 | |||
| 2050 | Ga0495664_0025865 | |||
| 2051 | Ga0495664_0050670 | |||
| 2052 | Ga0495664_0056926 | |||
| 2053 | Ga0495664_0061739 | |||
| 2054 | Ga0495664_0110198 | |||
| 2055 | Ga0495664_0298062 | |||
| 2056 | Ga0495594_0096590 | |||
| 2057 | Ga0495606_0611867 | |||
| 2058 | Ga0495608_0002283 | |||
| 2059 | Ga0495608_0023903 | |||
| 2060 | Ga0495608_0072276 | |||
| 2061 | Ga0495608_0079951 | |||
| 2062 | Ga0495608_0373038 | |||
| 2063 | Ga0495608_0651081 | |||
| 2064 | Ga0495618_0008622 | |||
| 2065 | Ga0495618_0015094 | |||
| 2066 | Ga0495618_0160321 | |||
| 2067 | Ga0495618_0182874 | |||
| 2068 | Ga0495618_0272059 | |||
| 2069 | Ga0495618_0285082 | |||
| 2070 | Ga0495618_0605899 | |||
| 2071 | Ga0495618_0620368 | |||
| 2072 | Ga0495620_0254784 | |||
| 2073 | Ga0495628_0023224 | |||
| 2074 | Ga0495628_0069750 | |||
| 2075 | Ga0495628_0112169 | |||
| 2076 | Ga0495628_0141224 | |||
| 2077 | Ga0495628_0400517 | |||
| 2078 | Ga0495628_0710779 | |||
| 2079 | Ga0495628_0923894 | |||
| 2080 | Ga0495630_0012644 | |||
| 2081 | Ga0495630_0330586 | |||
| 2082 | Ga0495630_0412742 | |||
| 2083 | Ga0495630_0510650 | |||
| 2084 | Ga0495630_0777146 | |||
| 2085 | Ga0495666_0070539 | |||
| 2086 | Ga0495666_0150971 | |||
| 2087 | Ga0495652_0005885 | |||
| 2088 | Ga0495652_0015768 | |||
| 2089 | Ga0495652_0015906 | |||
| 2090 | Ga0495652_0091885 | |||
| 2091 | Ga0495652_0181514 | |||
| 2092 | Ga0495652_0214283 | |||
| 2093 | Ga0495652_0287520 | |||
| 2094 | Ga0495652_0603296 | |||
| 2095 | Ga0495665_0001105 | |||
| 2096 | Ga0495665_0005956 | |||
| 2097 | Ga0495665_0011749 | |||
| 2098 | Ga0495665_0028168 | |||
| 2099 | Ga0495665_0219232 | |||
| 2100 | Ga0495640_0021019 | |||
| 2101 | Ga0495640_0028229 | |||
| 2102 | Ga0495640_0034299 | |||
| 2103 | Ga0495640_0060998 | |||
| 2104 | Ga0495640_0257905 | |||
| 2105 | Ga0495586_0013464 | |||
| 2106 | Ga0495586_0051987 | |||
| 2107 | Ga0495586_0121218 | |||
| 2108 | Ga0495586_0252002 | |||
| 2109 | Ga0495586_0654110 | |||
| 2110 | Ga0495587_0001390 | |||
| 2111 | Ga0495587_0008890 | |||
| 2112 | Ga0495587_0042153 | |||
| 2113 | Ga0495587_0136420 | |||
| 2114 | Ga0495587_0242754 | |||
| 2115 | Ga0495587_0246155 | |||
| 2116 | Ga0495587_0606671 | |||
| 2117 | Ga0495645_0030802 | |||
| 2118 | Ga0495645_0056752 | |||
| 2119 | Ga0495645_0075578 | |||
| 2120 | Ga0495645_0131739 | |||
| 2121 | Ga0495645_0156696 | |||
| 2122 | Ga0495645_0281383 | |||
| 2123 | Ga0495645_0437175 | |||
| 2124 | Ga0495645_0540414 | |||
| 2125 | Ga0495645_0751174 | |||
| 2126 | Ga0495622_0186733 | |||
| 2127 | Ga0495667_0002120 | |||
| 2128 | Ga0495667_0002955 | |||
| 2129 | Ga0495667_0004432 | |||
| 2130 | Ga0495667_0010816 | |||
| 2131 | Ga0495667_0035285 | |||
| 2132 | Ga0495667_0228526 | |||
| 2133 | Ga0495667_0236019 | |||
| 2134 | Ga0495667_0261540 | |||
| 2135 | Ga0495634_0002716 | |||
| 2136 | Ga0495634_0035660 | |||
| 2137 | Ga0495634_0053645 | |||
| 2138 | Ga0495634_0088275 | |||
| 2139 | Ga0495634_0112701 | |||
| 2140 | Ga0495634_0168524 | |||
| 2141 | Ga0495634_0294504 | |||
| 2142 | Ga0495635_0000206 | |||
| 2143 | Ga0495635_0004637 | |||
| 2144 | Ga0495635_0025183 | |||
| 2145 | Ga0495635_0027150 | |||
| 2146 | Ga0495635_0037851 | |||
| 2147 | Ga0495635_0070027 | |||
| 2148 | Ga0495635_0264441 | |||
| 2149 | Ga0495635_0751015 | |||
| 2150 | Ga0495588_0063477 | |||
| 2151 | Ga0495657_0005327 | |||
| 2152 | Ga0495657_0006178 | |||
| 2153 | Ga0495657_0025528 | |||
| 2154 | Ga0495657_0078212 | |||
| 2155 | Ga0495657_0083957 | |||
| 2156 | Ga0495657_0206135 | |||
| 2157 | Ga0495657_0546905 | |||
| 2158 | Ga0495599_0003203 | |||
| 2159 | Ga0495599_0008033 | |||
| 2160 | Ga0495599_0023527 | |||
| 2161 | Ga0495599_0055067 | |||
| 2162 | Ga0495599_0227155 | |||
| 2163 | Ga0495599_0240286 | |||
| 2164 | Ga0495599_0383123 | |||
| 2165 | Ga0495599_0410107 | |||
| 2166 | Ga0495623_0068791 | |||
| 2167 | Ga0495623_0101438 | |||
| 2168 | Ga0495623_0102080 | |||
| 2169 | Ga0495646_0004430 | |||
| 2170 | Ga0495646_0482747 | |||
| 2171 | Ga0495646_0609280 | |||
| 2172 | Ga0495647_0008248 | |||
| 2173 | Ga0495647_0205825 | |||
| 2174 | Ga0495658_0755560 | |||
| 2175 | Ga0495658_1032777 | |||
| 2176 | Ga0495613_0005536 | |||
| 2177 | Ga0495613_0583225 | |||
| 2178 | Ga0495624_0013940 | |||
| 2179 | Ga0495624_0026895 | |||
| 2180 | Ga0495624_0030396 | |||
| 2181 | Ga0495624_0558560 | |||
| 2182 | Ga0495600_0007781 | |||
| 2183 | Ga0495600_0057493 | |||
| 2184 | Ga0495600_0137932 | |||
| 2185 | Ga0495600_0243117 | |||
| 2186 | Ga0495600_0313518 | |||
| 2187 | Ga0495600_0357743 | |||
| 2188 | Ga0495600_0482558 | |||
| 2189 | Ga0495600_0617640 | |||
| 2190 | Ga0495600_0619627 | |||
| 2191 | Ga0495581_0003087 | |||
| 2192 | Ga0495581_0010887 | |||
| 2193 | Ga0495581_0361105 | |||
| 2194 | Ga0495604_0011387 | |||
| 2195 | Ga0495604_0012674 | |||
| 2196 | Ga0495604_0024157 | |||
| 2197 | Ga0495604_0052856 | |||
| 2198 | Ga0495604_0227417 | |||
| 2199 | Ga0495604_0742885 | |||
| 2200 | Ga0495604_1003370 | |||
| 2201 | Ga0495674_0001394 | |||
| 2202 | Ga0495674_0006864 | |||
| 2203 | Ga0495674_0017919 | |||
| 2204 | Ga0495674_0070670 | |||
| 2205 | Ga0495674_0152280 | |||
| 2206 | Ga0495674_0211608 | |||
| 2207 | Ga0495674_0554372 | |||
| 2208 | Ga0495674_0679948 | |||
| 2209 | Ga0495674_0827682 | |||
| 2210 | Ga0495676_0017719 | |||
| 2211 | Ga0495676_0175595 | |||
| 2212 | Ga0495680_0000651 | |||
| 2213 | Ga0495680_0004782 | |||
| 2214 | Ga0495680_0014670 | |||
| 2215 | Ga0495680_0031209 | |||
| 2216 | Ga0495680_0046767 | |||
| 2217 | Ga0495680_0076951 | |||
| 2218 | Ga0495680_0734250 | |||
| 2219 | Ga0495675_0007195 | |||
| 2220 | Ga0495675_0021063 | |||
| 2221 | Ga0495675_0050183 | |||
| 2222 | Ga0495675_0123260 | |||
| 2223 | Ga0495675_0628370 | |||
| 2224 | Ga0495684_0001154 | |||
| 2225 | Ga0495684_0015298 | |||
| 2226 | Ga0495684_0021721 | |||
| 2227 | Ga0495684_0048006 | |||
| 2228 | Ga0495684_0239095 | |||
| 2229 | Ga0495684_0376399 | |||
| 2230 | Ga0495684_0565109 | |||
| 2231 | Ga0495593_0003431 | |||
| 2232 | Ga0495593_0033418 | |||
| 2233 | Ga0495593_0338321 | |||
| 2234 | Ga0495602_0018126 | |||
| 2235 | Ga0495602_0058485 | |||
| 2236 | Ga0495602_0081183 | |||
| 2237 | Ga0495602_0168882 | |||
| 2238 | Ga0495602_0217814 | |||
| 2239 | Ga0495614_0113347 | |||
| 2240 | Ga0496100_0107198 | |||
| 2241 | Ga0496100_0199013 | |||
| 2242 | Ga0496100_0508561 | |||
| 2243 | Ga0496101_0062360 | |||
| 2244 | Ga0496101_0301945 | |||
| 2245 | Ga0496101_0457601 | |||
| 2246 | Ga0496102_0027320 | |||
| 2247 | Ga0496102_0091693 | |||
| 2248 | Ga0496102_0239598 | |||
| 2249 | Ga0496102_0311180 | |||
| 2250 | Ga0496102_0409682 | |||
| 2251 | Ga0496102_1046365 | |||
| 2252 | Ga0496103_0047613 | |||
| 2253 | Ga0496103_0089585 | |||
| 2254 | Ga0496104_0015955 | |||
| 2255 | Ga0496104_0061826 | |||
| 2256 | Ga0496104_0141493 | |||
| 2257 | Ga0496104_0270991 | |||
| 2258 | Ga0496104_0628703 | |||
| 2259 | Ga0496104_1793335 | |||
| 2260 | Ga0496105_0018946 | |||
| 2261 | Ga0496105_0121278 | |||
| 2262 | Ga0496105_0153020 | |||
| 2263 | Ga0496105_0203353 | |||
| 2264 | Ga0496105_0213899 | |||
| 2265 | Ga0496105_0637291 | |||
| 2266 | Ga0496106_1403938 | |||
| 2267 | Ga0496107_0010224 | |||
| 2268 | Ga0496107_0074178 | |||
| 2269 | Ga0496107_0528634 | |||
| 2270 | Ga0496108_0014150 | |||
| 2271 | Ga0496108_0054254 | |||
| 2272 | Ga0496108_0069497 | |||
| 2273 | Ga0496108_0099967 | |||
| 2274 | Ga0496108_0271197 | |||
| 2275 | Ga0496108_0368207 | |||
| 2276 | Ga0496108_1217409 | |||
| 2277 | Ga0496109_0011196 | |||
| 2278 | Ga0496109_0067691 | |||
| 2279 | Ga0496109_0076279 | |||
| 2280 | Ga0496109_0135737 | |||
| 2281 | Ga0496109_0146641 | |||
| 2282 | Ga0496109_0389591 | |||
| 2283 | Ga0496109_0389621 | |||
| 2284 | Ga0496109_0525402 | |||
| 2285 | Ga0496109_0606077 | |||
| 2286 | Ga0496109_0658909 | |||
| 2287 | Ga0496109_0879501 | |||
| 2288 | Ga0496109_1963097 | |||
| 2289 | Ga0496110_0223570 | |||
| 2290 | Ga0496110_0367153 | |||
| 2291 | Ga0496110_0425503 | |||
| 2292 | Ga0496110_0444673 | |||
| 2293 | Ga0496110_1014147 | |||
| 2294 | Ga0496111_0014907 | |||
| 2295 | Ga0496111_0124085 | |||
| 2296 | Ga0496111_0212254 | |||
| 2297 | Ga0496111_0446004 | |||
| 2298 | Ga0496112_0204288 | |||
| 2299 | Ga0496112_0539445 | |||
| 2300 | Ga0496113_0010456 | |||
| 2301 | Ga0496113_0069328 | |||
| 2302 | Ga0496113_0633864 | |||
| 2303 | Ga0496113_1251254 | |||
| 2304 | Ga0496114_0064230 | |||
| 2305 | Ga0496114_0081630 | |||
| 2306 | Ga0496114_0310318 | |||
| 2307 | Ga0496114_0429297 | |||
| 2308 | Ga0496114_1221534 | |||
| 2309 | Ga0496114_1280263 | |||
| 2310 | Ga0496114_1800105 | |||
| 2311 | Ga0496115_0004348 | |||
| 2312 | Ga0496115_0149349 | |||
| 2313 | Ga0496115_0274481 | |||
| 2314 | Ga0496115_0761295 | |||
| 2315 | Ga0496115_0910353 | |||
| 2316 | Ga0496117_0049331 | |||
| 2317 | Ga0496118_0062966 | |||
| 2318 | Ga0496118_0132657 | |||
| 2319 | Ga0496122_0000583 | |||
| 2320 | Ga0496122_0001054 | |||
| 2321 | Ga0496123_0003034 | |||
| 2322 | Ga0496124_0001569 | |||
| 2323 | Ga0496124_0597899 | |||
| 2324 | Ga0496125_0000069 | |||
| 2325 | Ga0496126_0146238 | |||
| 2326 | Ga0496126_0428152 | |||
| 2327 | Ga0496126_0493710 | |||
| 2328 | Ga0501321_062720 | |||
| 2329 | Ga0501321_064043 | |||
| 2330 | Ga0501032_0285140 | |||
| 2331 | Ga0501032_0442259 | |||
| 2332 | Ga0501034_0233334 | |||
| 2333 | Ga0501036_0348777 | |||
| 2334 | Ga0501037_0041530 | |||
| 2335 | Ga0501037_0247879 | |||
| 2336 | Ga0501038_0199662 | |||
| 2337 | Ga0501038_0959271 | |||
| 2338 | Ga0501039_1229646 | |||
| 2339 | Ga0501040_1292022 | |||
| 2340 | Ga0501047_0263628 | |||
| 2341 | Ga0501047_0472989 | |||
| 2342 | Ga0501047_0713849 | |||
| 2343 | Ga0501067_0286748 | |||
| 2344 | Ga0501070_0000870 | |||
| 2345 | Ga0501070_0002439 | |||
| 2346 | Ga0501070_0008387 | |||
| 2347 | Ga0501070_0119798 | |||
| 2348 | Ga0501071_0074886 | |||
| 2349 | Ga0501072_0115703 | |||
| 2350 | Ga0501073_0010141 | |||
| 2351 | Ga0501074_0000165 | |||
| 2352 | Ga0501076_0015578 | |||
| 2353 | Ga0501079_0000028 | |||
| 2354 | Ga0501079_0106786 | |||
| 2355 | Ga0501079_0827233 | |||
| 2356 | Ga0501080_0000294 | |||
| 2357 | Ga0501080_0123710 | |||
| 2358 | Ga0501080_0245239 | |||
| 2359 | Ga0501080_1612952 | |||
| 2360 | Ga0501035_0938581 | |||
| 2361 | Ga0501035_1027947 | |||
| 2362 | Ga0501044_0047605 | |||
| 2363 | Ga0501044_0106545 | |||
| 2364 | Ga0501044_0622133 | |||
| 2365 | nmdc:mga03n38_196994_c1 | |||
| 2366 | nmdc:mga0qj67_254350_c1 | |||
| 2367 | nmdc:mga0n895_1106466_c1 | |||
| 2368 | nmdc:mga0n895_1443160_c1 | |||
| 2369 | nmdc:mga0n895_649741_c1 | |||
| 2370 | nmdc:mga0rr50_466932_c1 | |||
| 2371 | nmdc:mga08x19_412551_c1 | |||
| 2372 | nmdc:mga08x19_531065_c1 | |||
| 2373 | nmdc:mga0a205_343328_c1 | |||
| 2374 | Ga0495601_0046075 | |||
| 2375 | Ga0495601_0065334 | |||
| 2376 | Ga0495601_0097862 | |||
| 2377 | Ga0495601_0603446 | |||
| 2378 | Ga0495601_0784920 | |||
| 2379 | Ga0495612_0005449 | |||
| 2380 | Ga0495612_0019602 | |||
| 2381 | Ga0495612_0053775 | |||
| 2382 | Ga0495612_0115923 | |||
| 2383 | Ga0495595_0000695 | |||
| 2384 | Ga0495595_0003978 | |||
| 2385 | Ga0495595_0031873 | |||
| 2386 | Ga0495595_0132347 | |||
| 2387 | Ga0495595_0175118 | |||
| 2388 | Ga0495619_0070377 | |||
| 2389 | Ga0495619_0211476 | |||
| 2390 | Ga0495619_0225921 | |||
| 2391 | Ga0495619_0409132 | |||
| 2392 | Ga0495619_0513577 | |||
| 2393 | Ga0500604_0021036 | |||
| 2394 | Ga0500616_0005761 | |||
| 2395 | Ga0500616_0027666 | |||
| 2396 | Ga0500627_0431834 | |||
| 2397 | Ga0501084_0073828 | |||
| 2398 | Ga0501082_0258393 | |||
| 2399 | Ga0466962_0094382 | |||
| 2400 | Ga0466962_0206295 | |||
| 2401 | Ga0466962_0211969 | |||
| 2402 | Ga0466962_0401100 | |||
| 2403 | Ga0466962_0735411 | |||
| 2404 | Ga0530510_0064626 | |||
| 2405 | Ga0530510_0881200 | |||
| 2406 | 2644035741 | |||
| 2407 | 2644080909 | |||
| 2408 | 2644663774 | |||
| 2409 | 2729909339 | |||
| 2410 | 2812362696 | |||
| 2411 | 2857482231 | |||
| 2412 | 2915360294 | |||
| 2413 | 2935892405 | |||
| 2414 | 2974319383 | |||
| 2415 | 2984527591 | |||
| 2416 | 8054478914 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ukk-assembly1.cif.gz_B | structure of osmotically inducible protein c from thermus thermophilus | 0.9479 | 2 | 145 |
| 1ukk-assembly1.cif.gz_B | structure of osmotically inducible protein c from thermus thermophilus | 0.9414 | 2 | 145 |
| 1nye-assembly1.cif.gz_A | crystal structure of osmc from e. coli | 0.939 | 1 | 146 |
| 1nye-assembly2.cif.gz_D | crystal structure of osmc from e. coli | 0.936 | 1 | 146 |
| 1qwi-assembly1.cif.gz_B | crystal structure of e. coli osmc | 0.9314 | 1 | 146 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9373 | 2 | 145 | 3.30.300.20 |
| 1ukkB00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9308 | 2 | 145 | 3.30.300.20 |
| 1nyeE00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9295 | 1 | 146 | 3.30.300.20 |
| 6mjnB02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.9085 | 48 | 145 | 3.30.300.20 |
| 6mjnB02 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain | 0.8998 | 48 | 145 | 3.30.300.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4U3CIK3-F1-model_v4 | Peroxiredoxin | 0.9906 | 1 | 146 |
GO:0004601
GO:0006979 |
| AF-E9T1M9-F1-model_v4 | Peroxiredoxin, OsmC subfamily | 0.9899 | 22 | 145 |
GO:0004601
GO:0006979 |
| AF-A0A346BVL7-F1-model_v4 | Peroxiredoxin | 0.9877 | 1 | 146 |
GO:0004601
GO:0006979 |
| AF-A0A0B8N4J9-F1-model_v4 | Peroxiredoxin | 0.9856 | 1 | 90 |
GO:0004601
GO:0006979 |
| AF-A0A2W6DJ16-F1-model_v4 | Peroxiredoxin | 0.9844 | 18 | 146 |
GO:0004601
GO:0006979 |