F491616
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1203 | 723 | 861 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300006353|Ga0075370_10119806|Ga0075370_101198062 |
| Length | 299 |
| Sequence | MNWLAPRLRALRVASPTPDRGQRQRPGTAGSTALPVRSQRRPIAPLEPVSSRARWLLGVGFFVLFVAVWAFFTLGGFVSPTFLASPVTMVKEGWLLFTEYNFIHDIGMTVWRVFGGFVLAALIAVPLGIAMGAWKPVEAFFEPFVSFCRYLPASAFIPLLILWAGIGETQKLLVIFIGSVFQIILMVAVIVGGARKDLVEAAYTLGANSKGIVARVLIPGAAPGIAETLRLVLGWAWTYVIVAELIGSSSGIGHMITDSQALLNTGQIIFGIIVIGVIGLVSDFAFKALNRRLFAWSTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 4 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 5 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 6 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 7 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 8 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 9 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 15 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 16 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 17 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 18 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 24 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 25 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 26 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 27 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 28 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 29 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 30 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 31 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 32 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 33 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 34 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 35 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 36 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 37 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 38 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 39 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 40 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 41 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 42 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 43 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 44 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 45 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 46 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 47 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 48 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 49 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 50 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 51 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 52 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 53 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 54 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 55 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 56 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 57 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 58 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 59 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 60 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 61 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 62 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 63 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 64 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 65 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 66 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 67 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 68 | 2791355199 | |||
| 69 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 70 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 71 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 72 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 73 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 74 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 75 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 76 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 77 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 78 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 79 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 80 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 81 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 82 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 83 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 84 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 85 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 86 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 87 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 88 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 89 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 90 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 91 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 92 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 93 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 94 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 95 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 96 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 97 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 98 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 99 | 2842718218 | Acidovorax sp. R-73343 | Isolate | Unclassified |
| 100 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 101 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 102 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 103 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 104 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 105 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 106 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 107 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 108 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 109 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 110 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 111 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 112 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 113 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 114 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 115 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 116 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 117 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 118 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 119 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 120 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 121 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 122 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 123 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 124 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 125 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 126 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 127 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 128 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 129 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 130 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 131 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 132 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 133 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 134 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 135 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 136 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 137 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 138 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 139 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 140 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 141 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 142 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 143 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 144 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 145 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 146 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 147 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 148 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 149 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 150 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 151 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 152 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 153 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 154 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 155 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 156 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 157 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 158 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 159 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 160 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 161 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 162 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 163 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 164 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 165 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 166 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 167 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 168 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 169 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 170 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 171 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 172 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 173 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 174 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 175 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 176 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 177 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 178 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 179 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 180 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 181 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 182 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 183 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 184 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 185 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 186 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 187 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 188 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 189 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 190 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 191 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 192 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 193 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 194 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 195 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 196 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 197 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 198 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 199 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 200 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 201 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 202 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 203 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 204 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 205 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 206 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 207 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 208 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 209 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 210 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 211 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 212 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 213 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 214 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 215 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 216 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 217 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 218 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 219 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 220 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 221 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 222 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 223 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 224 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 225 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 226 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 227 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 228 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 229 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 230 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 231 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 232 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 233 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 234 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 235 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 236 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 237 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 238 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 239 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 240 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 241 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 242 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 243 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 244 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 245 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 246 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 247 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 248 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 249 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 250 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 251 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 252 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 253 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 254 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 255 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 256 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 257 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 258 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 259 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 260 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 261 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 262 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 263 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 264 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 265 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 266 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 267 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 268 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 269 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 270 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 271 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 272 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 273 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 274 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 275 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 276 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 277 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 278 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 279 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 280 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 281 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 282 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 283 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 284 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 285 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 286 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 287 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 288 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 289 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 290 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 291 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 292 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 293 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 294 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 295 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 296 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 297 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 298 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 299 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 300 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 301 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 302 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 303 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 304 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 305 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 306 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 307 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 308 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 309 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 310 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 311 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 312 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 313 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 314 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 315 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 316 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 317 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 318 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 319 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 320 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 321 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 322 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 323 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 324 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 325 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 326 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 327 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 328 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 329 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 330 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 331 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 332 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 333 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 334 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 335 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 336 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 337 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 338 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 339 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 340 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 341 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 342 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 343 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 344 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 345 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 346 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 347 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 348 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 349 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 350 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 351 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 352 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 353 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 354 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 355 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 356 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 357 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 358 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 359 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 360 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 361 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 362 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 363 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 364 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 365 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 366 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 367 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 368 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 369 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 370 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 371 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 372 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 373 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 374 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 375 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 376 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 377 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 378 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 379 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 380 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 381 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 382 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 383 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 384 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 385 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 386 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 387 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 388 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 389 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 390 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 391 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 392 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 393 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 394 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 395 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 396 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 397 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 398 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 399 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 400 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 401 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 402 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 403 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 405 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 406 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 407 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 408 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 409 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 410 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 411 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 412 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 414 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 415 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 416 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 417 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 418 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 419 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 421 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 422 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 424 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 425 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 426 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 427 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 428 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 429 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 430 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 431 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 432 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 433 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 434 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 435 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 436 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 437 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 438 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 439 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 440 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 441 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 442 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 443 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 444 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 445 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 446 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 447 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 448 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 449 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 450 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 451 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 452 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 453 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 454 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 455 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 456 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 457 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 458 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 459 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 460 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 461 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 462 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 463 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 464 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 465 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 466 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 507 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 508 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 509 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 510 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 515 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 518 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 519 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 520 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 521 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 522 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 523 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 524 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 525 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 526 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 527 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 528 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 529 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 530 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 531 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 532 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 533 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 534 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 535 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 536 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 537 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 538 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 539 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 540 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 541 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 542 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 543 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 544 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 545 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 546 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 547 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 548 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 549 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 550 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 551 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 552 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 553 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 554 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 555 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 556 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 557 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 558 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 559 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 560 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 561 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 562 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 563 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 564 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 565 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 566 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 567 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 568 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 569 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 570 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 571 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 572 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 573 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 574 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 575 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 576 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 577 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 578 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 579 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 580 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 581 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 582 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 583 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 584 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 585 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 586 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 587 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 588 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 589 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 590 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 591 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 620 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 621 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 622 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 623 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 624 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 625 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 626 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 627 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 628 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 629 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 630 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 631 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 632 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 633 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 634 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 635 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 636 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 637 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 638 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 639 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 640 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 641 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 642 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 644 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 645 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 646 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 647 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 648 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 649 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 650 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 651 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 652 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 653 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 654 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 656 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 657 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 658 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 659 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 660 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 661 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 662 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 663 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 664 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 665 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 666 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 667 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 668 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 669 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 670 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 671 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 672 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 673 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 674 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 675 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 676 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 677 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 678 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 679 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 680 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 681 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 682 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 683 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 684 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 685 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 686 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 687 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 688 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 689 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 690 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 691 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 692 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 693 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 694 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 695 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 696 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 697 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 698 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 699 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 700 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 701 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 702 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 703 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 704 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 705 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 706 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 707 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 708 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 709 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 710 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 711 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 712 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 713 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 714 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 715 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 716 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 717 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 718 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 719 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 720 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 721 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 722 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 723 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 71.55 |
| Metatranscriptomes | 0.08 |
| Isolates | 28.37 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.42 |
| Bulb | 0 |
| Endosphere | 15.13 |
| Nodule | 18.45 |
| Rhizoplane | 2 |
| Rhizosphere | 50.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10038319 | 3300001979 | Bacteria | 1471 |
| 2 | JGI24739J22299_10021921 | 3300001989 | Bacteria | 2270 |
| 3 | JGI25158J39367_1001672 | 3300002739 | Bacteria | 3814 |
| 4 | JGI25158J39367_1005795 | 3300002739 | Bacteria | 1797 |
| 5 | JGI25152J39213_1006299 | 3300002773 | Bacteria | 3273 |
| 6 | JGI25152J39213_1025471 | 3300002773 | Bacteria | 978 |
| 7 | JGI25150J39212_1002656 | 3300002774 | Bacteria | 4378 |
| 8 | JGI25151J46595_10000018 | 3300003187 | Bacteria | 238438 |
| 9 | JGI25151J46595_10001245 | 3300003187 | Bacteria | 18075 |
| 10 | JGI25151J46595_10012250 | 3300003187 | Bacteria | 3907 |
| 11 | JGI25151J46595_10017707 | 3300003187 | Bacteria | 3080 |
| 12 | JGI25153J46596_10002113 | 3300003215 | Bacteria | 11625 |
| 13 | JGI25153J46596_10014479 | 3300003215 | Bacteria | 3275 |
| 14 | JGI25161J50226_1005466 | 3300003374 | Bacteria | 2456 |
| 15 | Ga0006562J51391_1014936 | 3300003578 | Bacteria | 2870 |
| 16 | Ga0055526_1002567 | 3300003771 | Bacteria | 12179 |
| 17 | Ga0055526_1019943 | 3300003771 | Bacteria | 2414 |
| 18 | Ga0055537_1000477 | 3300003773 | Bacteria | 25091 |
| 19 | Ga0055537_1004941 | 3300003773 | Bacteria | 3682 |
| 20 | Ga0055524_1000048 | 3300003775 | Bacteria | 149598 |
| 21 | Ga0055524_1012611 | 3300003775 | Bacteria | 3233 |
| 22 | Ga0055536_1000123 | 3300003781 | Bacteria | 66351 |
| 23 | Ga0055536_1013631 | 3300003781 | Bacteria | 2911 |
| 24 | Ga0055536_1014821 | 3300003781 | Bacteria | 2708 |
| 25 | Ga0055534_1000275 | 3300003784 | Bacteria | 35088 |
| 26 | Ga0055534_1000810 | 3300003784 | Bacteria | 14462 |
| 27 | Ga0055534_1010796 | 3300003784 | Bacteria | 1888 |
| 28 | Ga0055528_1000109 | 3300003790 | Bacteria | 66661 |
| 29 | Ga0055528_1001435 | 3300003790 | Bacteria | 14583 |
| 30 | Ga0055528_1010050 | 3300003790 | Bacteria | 3888 |
| 31 | Ga0055530_10001751 | 3300003791 | Bacteria | 15180 |
| 32 | Ga0055530_10004541 | 3300003791 | Bacteria | 7093 |
| 33 | Ga0055540_1008215 | 3300003792 | Bacteria | 3795 |
| 34 | Ga0055540_1011011 | 3300003792 | Bacteria | 2956 |
| 35 | Ga0055540_1011211 | 3300003792 | Bacteria | 2911 |
| 36 | Ga0055540_1012318 | 3300003792 | Bacteria | 2692 |
| 37 | Ga0055531_10005150 | 3300003794 | Bacteria | 7710 |
| 38 | Ga0055543_1014166 | 3300004625 | Bacteria | 1559 |
| 39 | Ga0065165_1000062 | 3300005262 | Bacteria | 178885 |
| 40 | Ga0065704_10079879 | 3300005289 | Bacteria | 4058 |
| 41 | Ga0065707_10149432 | 3300005295 | Bacteria | 1675 |
| 42 | Ga0070676_10006949 | 3300005328 | Bacteria | 6060 |
| 43 | Ga0070676_10027197 | 3300005328 | Bacteria | 3242 |
| 44 | Ga0070676_10189479 | 3300005328 | Bacteria | 1342 |
| 45 | Ga0070676_10229245 | 3300005328 | Bacteria | 1230 |
| 46 | Ga0070670_100005028 | 3300005331 | Bacteria | 11125 |
| 47 | Ga0070670_100032734 | 3300005331 | Bacteria | 4478 |
| 48 | Ga0070670_100423694 | 3300005331 | Bacteria | 1177 |
| 49 | Ga0068869_100004298 | 3300005334 | Bacteria | 8845 |
| 50 | Ga0068869_100016023 | 3300005334 | Bacteria | 5045 |
| 51 | Ga0068869_100330923 | 3300005334 | Bacteria | 1238 |
| 52 | Ga0070666_10005278 | 3300005335 | Bacteria | 7918 |
| 53 | Ga0070666_10101952 | 3300005335 | Bacteria | 1979 |
| 54 | Ga0070680_100148322 | 3300005336 | Bacteria | 1969 |
| 55 | Ga0068868_100119948 | 3300005338 | Bacteria | 2144 |
| 56 | Ga0068868_100183063 | 3300005338 | Bacteria | 1739 |
| 57 | Ga0068868_100622188 | 3300005338 | Bacteria | 959 |
| 58 | Ga0070660_100028918 | 3300005339 | Bacteria | 4150 |
| 59 | Ga0070689_100009872 | 3300005340 | Bacteria | 6788 |
| 60 | Ga0070689_100134486 | 3300005340 | Bacteria | 1985 |
| 61 | Ga0070661_100013467 | 3300005344 | Bacteria | 5741 |
| 62 | Ga0070661_100154375 | 3300005344 | Bacteria | 1736 |
| 63 | Ga0070661_100175767 | 3300005344 | Bacteria | 1628 |
| 64 | Ga0070668_100001341 | 3300005347 | Bacteria | 17586 |
| 65 | Ga0070668_100096217 | 3300005347 | Bacteria | 2340 |
| 66 | Ga0070668_100148675 | 3300005347 | Bacteria | 1893 |
| 67 | Ga0070668_100165565 | 3300005347 | Bacteria | 1796 |
| 68 | Ga0070668_100208450 | 3300005347 | Bacteria | 1607 |
| 69 | Ga0070669_100000668 | 3300005353 | Bacteria | 25208 |
| 70 | Ga0070669_100086513 | 3300005353 | Bacteria | 2342 |
| 71 | Ga0070669_100107204 | 3300005353 | Bacteria | 2116 |
| 72 | Ga0070669_100114943 | 3300005353 | Bacteria | 2046 |
| 73 | Ga0070669_100331203 | 3300005353 | Bacteria | 1231 |
| 74 | Ga0070675_100001258 | 3300005354 | Bacteria | 18530 |
| 75 | Ga0070675_100053001 | 3300005354 | Bacteria | 3336 |
| 76 | Ga0070675_100621279 | 3300005354 | Bacteria | 981 |
| 77 | Ga0070671_100004906 | 3300005355 | Bacteria | 10647 |
| 78 | Ga0070671_100086646 | 3300005355 | Bacteria | 2621 |
| 79 | Ga0070671_100087289 | 3300005355 | Bacteria | 2610 |
| 80 | Ga0070671_100092362 | 3300005355 | Bacteria | 2536 |
| 81 | Ga0070671_100165158 | 3300005355 | Bacteria | 1872 |
| 82 | Ga0070671_100226100 | 3300005355 | Bacteria | 1588 |
| 83 | Ga0070674_100055615 | 3300005356 | Bacteria | 2741 |
| 84 | Ga0070674_100061525 | 3300005356 | Bacteria | 2620 |
| 85 | Ga0070674_100145610 | 3300005356 | Bacteria | 1783 |
| 86 | Ga0070674_100310482 | 3300005356 | Bacteria | 1260 |
| 87 | Ga0070673_100006412 | 3300005364 | Bacteria | 7650 |
| 88 | Ga0070673_100010287 | 3300005364 | Bacteria | 6328 |
| 89 | Ga0070673_100092350 | 3300005364 | Bacteria | 2476 |
| 90 | Ga0070673_100103547 | 3300005364 | Bacteria | 2349 |
| 91 | Ga0070673_100143193 | 3300005364 | Bacteria | 2018 |
| 92 | Ga0070659_100027510 | 3300005366 | Bacteria | 4382 |
| 93 | Ga0070659_100041038 | 3300005366 | Bacteria | 3616 |
| 94 | Ga0070659_100268957 | 3300005366 | Bacteria | 1416 |
| 95 | Ga0070667_100004919 | 3300005367 | Bacteria | 11200 |
| 96 | Ga0070667_100005264 | 3300005367 | Bacteria | 10819 |
| 97 | Ga0070667_100007303 | 3300005367 | Bacteria | 9188 |
| 98 | Ga0070667_100037796 | 3300005367 | Bacteria | 4047 |
| 99 | Ga0070667_100183395 | 3300005367 | Bacteria | 1852 |
| 100 | Ga0070667_100230329 | 3300005367 | Bacteria | 1652 |
| 101 | Ga0070709_10497762 | 3300005434 | Bacteria | 925 |
| 102 | Ga0070714_100009061 | 3300005435 | Bacteria | 7801 |
| 103 | Ga0070705_100038190 | 3300005440 | Bacteria | 2715 |
| 104 | Ga0070705_100147916 | 3300005440 | Bacteria | 1555 |
| 105 | Ga0070694_100020659 | 3300005444 | Bacteria | 4199 |
| 106 | Ga0070694_100022197 | 3300005444 | Bacteria | 4064 |
| 107 | Ga0070708_100000538 | 3300005445 | Bacteria | 28503 |
| 108 | Ga0070663_100176398 | 3300005455 | Bacteria | 1655 |
| 109 | Ga0070663_100190759 | 3300005455 | Bacteria | 1595 |
| 110 | Ga0070663_100195596 | 3300005455 | Bacteria | 1576 |
| 111 | Ga0070678_100003201 | 3300005456 | Bacteria | 9087 |
| 112 | Ga0070678_100024961 | 3300005456 | Bacteria | 4012 |
| 113 | Ga0070678_100064344 | 3300005456 | Bacteria | 2718 |
| 114 | Ga0070678_100406550 | 3300005456 | Bacteria | 1184 |
| 115 | Ga0070662_100008353 | 3300005457 | Bacteria | 6747 |
| 116 | Ga0070662_100106616 | 3300005457 | Bacteria | 2129 |
| 117 | Ga0070662_100227288 | 3300005457 | Bacteria | 1491 |
| 118 | Ga0070681_10065412 | 3300005458 | Bacteria | 3605 |
| 119 | Ga0068867_100000099 | 3300005459 | Bacteria | 55452 |
| 120 | Ga0068867_100000975 | 3300005459 | Bacteria | 19545 |
| 121 | Ga0068867_100003039 | 3300005459 | Bacteria | 11834 |
| 122 | Ga0068867_100035090 | 3300005459 | Bacteria | 3637 |
| 123 | Ga0068867_100095043 | 3300005459 | Bacteria | 2267 |
| 124 | Ga0068867_100156810 | 3300005459 | Bacteria | 1792 |
| 125 | Ga0068867_100256202 | 3300005459 | Bacteria | 1425 |
| 126 | Ga0070685_10095974 | 3300005466 | Bacteria | 1803 |
| 127 | Ga0070707_100021241 | 3300005468 | Bacteria | 6136 |
| 128 | Ga0070707_100100630 | 3300005468 | Bacteria | 2800 |
| 129 | Ga0070707_100196507 | 3300005468 | Bacteria | 1966 |
| 130 | Ga0070698_100256914 | 3300005471 | Bacteria | 1679 |
| 131 | Ga0070699_100508479 | 3300005518 | Bacteria | 1095 |
| 132 | Ga0070684_100028122 | 3300005535 | Bacteria | 4753 |
| 133 | Ga0070697_100091416 | 3300005536 | Bacteria | 2516 |
| 134 | Ga0068853_100187736 | 3300005539 | Bacteria | 1877 |
| 135 | Ga0070672_100000287 | 3300005543 | Bacteria | 28567 |
| 136 | Ga0070672_100013687 | 3300005543 | Bacteria | 5736 |
| 137 | Ga0070672_100027710 | 3300005543 | Bacteria | 4228 |
| 138 | Ga0070672_100056332 | 3300005543 | Bacteria | 3083 |
| 139 | Ga0070672_100066504 | 3300005543 | Bacteria | 2854 |
| 140 | Ga0070686_100422066 | 3300005544 | Bacteria | 1019 |
| 141 | Ga0070695_100189765 | 3300005545 | Bacteria | 1462 |
| 142 | Ga0070696_100084812 | 3300005546 | Bacteria | 2248 |
| 143 | Ga0070696_100086242 | 3300005546 | Bacteria | 2229 |
| 144 | Ga0070696_100109780 | 3300005546 | Bacteria | 1985 |
| 145 | Ga0070665_100008986 | 3300005548 | Bacteria | 10122 |
| 146 | Ga0070665_100013659 | 3300005548 | Bacteria | 8169 |
| 147 | Ga0070665_100071749 | 3300005548 | Bacteria | 3470 |
| 148 | Ga0070665_100210217 | 3300005548 | Bacteria | 1946 |
| 149 | Ga0070704_100023523 | 3300005549 | Bacteria | 4027 |
| 150 | Ga0068855_100073653 | 3300005563 | Bacteria | 3967 |
| 151 | Ga0070664_100003932 | 3300005564 | Bacteria | 11986 |
| 152 | Ga0070664_100016107 | 3300005564 | Bacteria | 6127 |
| 153 | Ga0070664_100052511 | 3300005564 | Bacteria | 3453 |
| 154 | Ga0068857_100046789 | 3300005577 | Bacteria | 3839 |
| 155 | Ga0068854_100012109 | 3300005578 | Bacteria | 5641 |
| 156 | Ga0068854_100064932 | 3300005578 | Bacteria | 2653 |
| 157 | Ga0068856_100017956 | 3300005614 | Bacteria | 6859 |
| 158 | Ga0068852_100381668 | 3300005616 | Bacteria | 1382 |
| 159 | Ga0068852_100423327 | 3300005616 | Bacteria | 1314 |
| 160 | Ga0068852_100557285 | 3300005616 | Bacteria | 1147 |
| 161 | Ga0068852_100860267 | 3300005616 | Bacteria | 922 |
| 162 | Ga0068859_100083674 | 3300005617 | Bacteria | 3234 |
| 163 | Ga0068859_100216526 | 3300005617 | Bacteria | 2002 |
| 164 | Ga0068864_100005258 | 3300005618 | Bacteria | 10611 |
| 165 | Ga0068866_10025436 | 3300005718 | Bacteria | 2783 |
| 166 | Ga0068861_100081818 | 3300005719 | Bacteria | 2529 |
| 167 | Ga0068851_10084996 | 3300005834 | Bacteria | 1658 |
| 168 | Ga0068851_10199993 | 3300005834 | Bacteria | 1115 |
| 169 | Ga0068870_10013741 | 3300005840 | Bacteria | 3812 |
| 170 | Ga0068870_10062228 | 3300005840 | Bacteria | 2009 |
| 171 | Ga0068870_10268574 | 3300005840 | Bacteria | 1064 |
| 172 | Ga0068863_100001368 | 3300005841 | Bacteria | 24235 |
| 173 | Ga0068863_100067898 | 3300005841 | Bacteria | 3372 |
| 174 | Ga0068863_100069165 | 3300005841 | Bacteria | 3339 |
| 175 | Ga0068863_100114297 | 3300005841 | Bacteria | 2572 |
| 176 | Ga0068863_100155443 | 3300005841 | Bacteria | 2190 |
| 177 | Ga0068863_100224200 | 3300005841 | Bacteria | 1812 |
| 178 | Ga0068863_100408123 | 3300005841 | Bacteria | 1329 |
| 179 | Ga0068858_100006176 | 3300005842 | Bacteria | 11684 |
| 180 | Ga0068858_100016320 | 3300005842 | Bacteria | 6976 |
| 181 | Ga0068858_100100231 | 3300005842 | Bacteria | 2701 |
| 182 | Ga0068858_100111857 | 3300005842 | Bacteria | 2550 |
| 183 | Ga0068860_100004808 | 3300005843 | Bacteria | 13752 |
| 184 | Ga0068860_100016563 | 3300005843 | Bacteria | 7189 |
| 185 | Ga0068860_100029914 | 3300005843 | Bacteria | 5239 |
| 186 | Ga0068860_100050139 | 3300005843 | Bacteria | 3975 |
| 187 | Ga0068860_100091904 | 3300005843 | Bacteria | 2891 |
| 188 | Ga0068860_100524444 | 3300005843 | Bacteria | 1185 |
| 189 | Ga0068862_100050180 | 3300005844 | Bacteria | 3565 |
| 190 | Ga0068862_100118197 | 3300005844 | Bacteria | 2334 |
| 191 | Ga0068862_100166714 | 3300005844 | Bacteria | 1969 |
| 192 | Ga0068862_100219208 | 3300005844 | Bacteria | 1722 |
| 193 | Ga0075365_10001436 | 3300006038 | Bacteria | 10785 |
| 194 | Ga0075365_10078426 | 3300006038 | Bacteria | 2233 |
| 195 | Ga0075368_10000984 | 3300006042 | Bacteria | 8904 |
| 196 | Ga0075368_10003446 | 3300006042 | Bacteria | 5281 |
| 197 | Ga0075363_100121273 | 3300006048 | Bacteria | 1460 |
| 198 | Ga0075363_100230677 | 3300006048 | Bacteria | 1063 |
| 199 | Ga0075364_10251656 | 3300006051 | Bacteria | 1201 |
| 200 | Ga0075432_10013808 | 3300006058 | Bacteria | 2747 |
| 201 | Ga0070712_100024529 | 3300006175 | Bacteria | 3998 |
| 202 | Ga0075362_10001700 | 3300006177 | Bacteria | 7137 |
| 203 | Ga0075362_10002210 | 3300006177 | Bacteria | 6459 |
| 204 | Ga0075362_10017702 | 3300006177 | Bacteria | 2939 |
| 205 | Ga0075362_10064606 | 3300006177 | Bacteria | 1660 |
| 206 | Ga0075367_10035836 | 3300006178 | Bacteria | 2874 |
| 207 | Ga0075369_10106944 | 3300006186 | Bacteria | 1258 |
| 208 | Ga0075366_10018446 | 3300006195 | Bacteria | 4028 |
| 209 | Ga0075366_10019325 | 3300006195 | Bacteria | 3940 |
| 210 | Ga0075366_10083898 | 3300006195 | Bacteria | 1904 |
| 211 | Ga0075366_10116299 | 3300006195 | Bacteria | 1610 |
| 212 | Ga0075366_10120596 | 3300006195 | Bacteria | 1580 |
| 213 | Ga0075366_10127921 | 3300006195 | Bacteria | 1532 |
| 214 | Ga0075366_10252156 | 3300006195 | Bacteria | 1076 |
| 215 | Ga0097621_100008005 | 3300006237 | Bacteria | 7587 |
| 216 | Ga0097621_100066231 | 3300006237 | Bacteria | 2975 |
| 217 | Ga0097621_100667861 | 3300006237 | Bacteria | 955 |
| 218 | Ga0075370_10001026 | 3300006353 | Bacteria | 11604 |
| 219 | Ga0075370_10012303 | 3300006353 | Bacteria | 4518 |
| 220 | Ga0075370_10013080 | 3300006353 | Bacteria | 4403 |
| 221 | Ga0075370_10018238 | 3300006353 | Bacteria | 3806 |
| 222 | Ga0075370_10119806 | 3300006353 | Bacteria | 1531 |
| 223 | Ga0075370_10133975 | 3300006353 | Bacteria | 1446 |
| 224 | Ga0068871_100000834 | 3300006358 | Bacteria | 20645 |
| 225 | Ga0068871_100306256 | 3300006358 | Bacteria | 1396 |
| 226 | Ga0068871_100315663 | 3300006358 | Bacteria | 1375 |
| 227 | Ga0075428_100157357 | 3300006844 | Bacteria | 2467 |
| 228 | Ga0075430_100129355 | 3300006846 | Bacteria | 2105 |
| 229 | Ga0075431_100009702 | 3300006847 | Bacteria | 9672 |
| 230 | Ga0075433_10005479 | 3300006852 | Bacteria | 9971 |
| 231 | Ga0075434_100010081 | 3300006871 | Bacteria | 8848 |
| 232 | Ga0068865_100003861 | 3300006881 | Bacteria | 8988 |
| 233 | Ga0068865_100095099 | 3300006881 | Bacteria | 2170 |
| 234 | Ga0097620_100083685 | 3300006931 | Bacteria | 3234 |
| 235 | Ga0097620_100206606 | 3300006931 | Bacteria | 2049 |
| 236 | Ga0097620_100216535 | 3300006931 | Bacteria | 2002 |
| 237 | Ga0079104_1000008 | 3300006946 | Bacteria | 371223 |
| 238 | Ga0099826_10000676 | 3300006948 | Bacteria | 17684 |
| 239 | Ga0099826_10013619 | 3300006948 | Bacteria | 6145 |
| 240 | Ga0099826_10142827 | 3300006948 | Bacteria | 1380 |
| 241 | Ga0075435_100026800 | 3300007076 | Bacteria | 4501 |
| 242 | Ga0105244_10120609 | 3300009036 | Bacteria | 1270 |
| 243 | Ga0105250_10000002 | 3300009092 | Bacteria | 566949 |
| 244 | Ga0105250_10000043 | 3300009092 | Bacteria | 129336 |
| 245 | Ga0105240_10002428 | 3300009093 | Bacteria | 29958 |
| 246 | Ga0105240_10033941 | 3300009093 | Bacteria | 6588 |
| 247 | Ga0105240_10146257 | 3300009093 | Bacteria | 2820 |
| 248 | Ga0111539_10568708 | 3300009094 | Bacteria | 1320 |
| 249 | Ga0105245_10290998 | 3300009098 | Bacteria | 1600 |
| 250 | Ga0105247_10055080 | 3300009101 | Bacteria | 2454 |
| 251 | Ga0114129_10101400 | 3300009147 | Bacteria | 3983 |
| 252 | Ga0114129_10581372 | 3300009147 | Bacteria | 1453 |
| 253 | Ga0114129_11157898 | 3300009147 | Bacteria | 965 |
| 254 | Ga0105243_10001109 | 3300009148 | Bacteria | 24446 |
| 255 | Ga0105243_10019715 | 3300009148 | Bacteria | 5114 |
| 256 | Ga0105243_10439369 | 3300009148 | Bacteria | 1221 |
| 257 | Ga0105241_10089319 | 3300009174 | Bacteria | 2427 |
| 258 | Ga0105241_10218219 | 3300009174 | Bacteria | 1601 |
| 259 | Ga0105241_10707664 | 3300009174 | Bacteria | 920 |
| 260 | Ga0105242_10001450 | 3300009176 | Bacteria | 18665 |
| 261 | Ga0105248_10007765 | 3300009177 | Bacteria | 11773 |
| 262 | Ga0105248_10017795 | 3300009177 | Bacteria | 7842 |
| 263 | Ga0105248_10056706 | 3300009177 | Bacteria | 4395 |
| 264 | Ga0105248_10396226 | 3300009177 | Bacteria | 1554 |
| 265 | Ga0105237_10006305 | 3300009545 | Bacteria | 13189 |
| 266 | Ga0105237_10082068 | 3300009545 | Bacteria | 3215 |
| 267 | Ga0105237_10108996 | 3300009545 | Bacteria | 2760 |
| 268 | Ga0105237_10123598 | 3300009545 | Bacteria | 2582 |
| 269 | Ga0105237_10341609 | 3300009545 | Bacteria | 1501 |
| 270 | Ga0105238_10001044 | 3300009551 | Bacteria | 28027 |
| 271 | Ga0105238_10482816 | 3300009551 | Bacteria | 1239 |
| 272 | Ga0105249_10405712 | 3300009553 | Bacteria | 1394 |
| 273 | Ga0105249_10433299 | 3300009553 | Bacteria | 1351 |
| 274 | Ga0105249_10701946 | 3300009553 | Bacteria | 1072 |
| 275 | Ga0105239_10168139 | 3300010375 | Bacteria | 2452 |
| 276 | Ga0105239_10429329 | 3300010375 | Bacteria | 1498 |
| 277 | Ga0105246_10025728 | 3300011119 | Bacteria | 3838 |
| 278 | Ga0157317_1002651 | 3300012475 | Bacteria | 1070 |
| 279 | Ga0157373_10001146 | 3300013100 | Bacteria | 20311 |
| 280 | Ga0157373_10009126 | 3300013100 | Bacteria | 7335 |
| 281 | Ga0157373_10013023 | 3300013100 | Bacteria | 6103 |
| 282 | Ga0157373_10235924 | 3300013100 | Bacteria | 1292 |
| 283 | Ga0157371_10000004 | 3300013102 | Bacteria | 512593 |
| 284 | Ga0157371_10004156 | 3300013102 | Bacteria | 12757 |
| 285 | Ga0157371_10022060 | 3300013102 | Bacteria | 4670 |
| 286 | Ga0157371_10142941 | 3300013102 | Bacteria | 1704 |
| 287 | Ga0157370_10005765 | 3300013104 | Bacteria | 13841 |
| 288 | Ga0157370_10015688 | 3300013104 | Bacteria | 7695 |
| 289 | Ga0157369_10029638 | 3300013105 | Bacteria | 6045 |
| 290 | Ga0157369_10193777 | 3300013105 | Bacteria | 2135 |
| 291 | Ga0157369_10252200 | 3300013105 | Bacteria | 1841 |
| 292 | Ga0157374_10003813 | 3300013296 | Bacteria | 12661 |
| 293 | Ga0157374_10339524 | 3300013296 | Bacteria | 1491 |
| 294 | Ga0157378_10007092 | 3300013297 | Bacteria | 9785 |
| 295 | Ga0157378_10173463 | 3300013297 | Bacteria | 2024 |
| 296 | Ga0157378_10296299 | 3300013297 | Bacteria | 1564 |
| 297 | Ga0163162_10003831 | 3300013306 | Bacteria | 14422 |
| 298 | Ga0163162_10006954 | 3300013306 | Bacteria | 10971 |
| 299 | Ga0163162_10018668 | 3300013306 | Bacteria | 6794 |
| 300 | Ga0163162_10227800 | 3300013306 | Bacteria | 1994 |
| 301 | Ga0157372_10002798 | 3300013307 | Bacteria | 18848 |
| 302 | Ga0157375_10003753 | 3300013308 | Bacteria | 13176 |
| 303 | Ga0157375_10135518 | 3300013308 | Bacteria | 2586 |
| 304 | Ga0157375_10172413 | 3300013308 | Bacteria | 2311 |
| 305 | Ga0157375_10269029 | 3300013308 | Bacteria | 1866 |
| 306 | Ga0163163_10014074 | 3300014325 | Bacteria | 7345 |
| 307 | Ga0157380_10264250 | 3300014326 | Bacteria | 1565 |
| 308 | Ga0182008_10003519 | 3300014497 | Bacteria | 9426 |
| 309 | Ga0182008_10055566 | 3300014497 | Bacteria | 1957 |
| 310 | Ga0157377_10000010 | 3300014745 | Bacteria | 380929 |
| 311 | Ga0157379_10000858 | 3300014968 | Bacteria | 24649 |
| 312 | Ga0157379_10040595 | 3300014968 | Bacteria | 4154 |
| 313 | Ga0157379_10155337 | 3300014968 | Bacteria | 2064 |
| 314 | Ga0157376_10000986 | 3300014969 | Bacteria | 18545 |
| 315 | Ga0157376_10766761 | 3300014969 | Bacteria | 975 |
| 316 | Ga0182007_10001492 | 3300015262 | Bacteria | 12525 |
| 317 | Ga0182007_10011260 | 3300015262 | Bacteria | 3485 |
| 318 | Ga0163161_10001624 | 3300017792 | Bacteria | 16537 |
| 319 | Ga0163161_10040137 | 3300017792 | Bacteria | 3361 |
| 320 | Ga0163161_10050915 | 3300017792 | Bacteria | 2998 |
| 321 | Ga0163161_10130220 | 3300017792 | Bacteria | 1897 |
| 322 | Ga0163161_10171743 | 3300017792 | Bacteria | 1658 |
| 323 | Ga0163161_10289032 | 3300017792 | Bacteria | 1288 |
| 324 | Ga0207425_1003484 | 3300025245 | Bacteria | 5011 |
| 325 | Ga0209677_100318 | 3300025253 | Bacteria | 31403 |
| 326 | Ga0209129_1000168 | 3300025258 | Bacteria | 96922 |
| 327 | Ga0209129_1000517 | 3300025258 | Bacteria | 27570 |
| 328 | Ga0209565_1000078 | 3300025263 | Bacteria | 160838 |
| 329 | Ga0209565_1000938 | 3300025263 | Bacteria | 15338 |
| 330 | Ga0209565_1008820 | 3300025263 | Bacteria | 2610 |
| 331 | Ga0209673_1000005 | 3300025273 | Bacteria | 692788 |
| 332 | Ga0209673_1000627 | 3300025273 | Bacteria | 53883 |
| 333 | Ga0209673_1001328 | 3300025273 | Bacteria | 24806 |
| 334 | Ga0209673_1011889 | 3300025273 | Bacteria | 3550 |
| 335 | Ga0209130_1000235 | 3300025284 | Bacteria | 71379 |
| 336 | Ga0209130_1001063 | 3300025284 | Bacteria | 20689 |
| 337 | Ga0209130_1001335 | 3300025284 | Bacteria | 16703 |
| 338 | Ga0209675_1000239 | 3300025291 | Bacteria | 54796 |
| 339 | Ga0209675_1000393 | 3300025291 | Bacteria | 36339 |
| 340 | Ga0209675_1000413 | 3300025291 | Bacteria | 35115 |
| 341 | Ga0209675_1000470 | 3300025291 | Bacteria | 30953 |
| 342 | Ga0209675_1000759 | 3300025291 | Bacteria | 21642 |
| 343 | Ga0209675_1005090 | 3300025291 | Bacteria | 5615 |
| 344 | Ga0209676_1000012 | 3300025292 | Bacteria | 841431 |
| 345 | Ga0209676_1000040 | 3300025292 | Bacteria | 438184 |
| 346 | Ga0209676_1007063 | 3300025292 | Bacteria | 5381 |
| 347 | Ga0209676_1010033 | 3300025292 | Bacteria | 4000 |
| 348 | Ga0209676_1011558 | 3300025292 | Bacteria | 3549 |
| 349 | Ga0209676_1012115 | 3300025292 | Bacteria | 3418 |
| 350 | Ga0209676_1020433 | 3300025292 | Bacteria | 2249 |
| 351 | Ga0209676_1027731 | 3300025292 | Bacteria | 1777 |
| 352 | Ga0209025_1000010 | 3300025294 | Bacteria | 986612 |
| 353 | Ga0209025_1000378 | 3300025294 | Bacteria | 92632 |
| 354 | Ga0209025_1001501 | 3300025294 | Bacteria | 30085 |
| 355 | Ga0209025_1002982 | 3300025294 | Bacteria | 16775 |
| 356 | Ga0209025_1004003 | 3300025294 | Bacteria | 13219 |
| 357 | Ga0209025_1004618 | 3300025294 | Bacteria | 11782 |
| 358 | Ga0209025_1010852 | 3300025294 | Bacteria | 6106 |
| 359 | Ga0209025_1054216 | 3300025294 | Bacteria | 1563 |
| 360 | Ga0209025_1060801 | 3300025294 | Bacteria | 1415 |
| 361 | Ga0209564_1000034 | 3300025295 | Bacteria | 444284 |
| 362 | Ga0209564_1000157 | 3300025295 | Bacteria | 164758 |
| 363 | Ga0209564_1000862 | 3300025295 | Bacteria | 40422 |
| 364 | Ga0209564_1001365 | 3300025295 | Bacteria | 25619 |
| 365 | Ga0209758_1000042 | 3300025297 | Bacteria | 407145 |
| 366 | Ga0209758_1000220 | 3300025297 | Bacteria | 123972 |
| 367 | Ga0209758_1015827 | 3300025297 | Bacteria | 3876 |
| 368 | Ga0209050_1000021 | 3300025298 | Bacteria | 574406 |
| 369 | Ga0209050_1001833 | 3300025298 | Bacteria | 20672 |
| 370 | Ga0209050_1036466 | 3300025298 | Bacteria | 1434 |
| 371 | Ga0209256_1000026 | 3300025299 | Bacteria | 432835 |
| 372 | Ga0209256_1000182 | 3300025299 | Bacteria | 122471 |
| 373 | Ga0209256_1000549 | 3300025299 | Bacteria | 53852 |
| 374 | Ga0209256_1002051 | 3300025299 | Bacteria | 17856 |
| 375 | Ga0209256_1004580 | 3300025299 | Bacteria | 8566 |
| 376 | Ga0207426_1000055 | 3300025302 | Bacteria | 374450 |
| 377 | Ga0207426_1000079 | 3300025302 | Bacteria | 314709 |
| 378 | Ga0207426_1030274 | 3300025302 | Bacteria | 1776 |
| 379 | Ga0209051_1000111 | 3300025303 | Bacteria | 153024 |
| 380 | Ga0209051_1000286 | 3300025303 | Bacteria | 81784 |
| 381 | Ga0209051_1000376 | 3300025303 | Bacteria | 63531 |
| 382 | Ga0209051_1005061 | 3300025303 | Bacteria | 7844 |
| 383 | Ga0209257_1000043 | 3300025304 | Bacteria | 512127 |
| 384 | Ga0209257_1000215 | 3300025304 | Bacteria | 136521 |
| 385 | Ga0209257_1009727 | 3300025304 | Bacteria | 5054 |
| 386 | Ga0209257_1010745 | 3300025304 | Bacteria | 4556 |
| 387 | Ga0209257_1013240 | 3300025304 | Bacteria | 3696 |
| 388 | Ga0209257_1028939 | 3300025304 | Bacteria | 1814 |
| 389 | Ga0207697_10003403 | 3300025315 | Bacteria | 7896 |
| 390 | Ga0207697_10128192 | 3300025315 | Bacteria | 1095 |
| 391 | Ga0207656_10046411 | 3300025321 | Bacteria | 1863 |
| 392 | Ga0207656_10078344 | 3300025321 | Bacteria | 1481 |
| 393 | Ga0207696_1000239 | 3300025711 | Bacteria | 75936 |
| 394 | Ga0207696_1000509 | 3300025711 | Bacteria | 32376 |
| 395 | Ga0207655_1001999 | 3300025728 | Bacteria | 17332 |
| 396 | Ga0207642_10071734 | 3300025899 | Bacteria | 1651 |
| 397 | Ga0207710_10023946 | 3300025900 | Bacteria | 2627 |
| 398 | Ga0207680_10043785 | 3300025903 | Bacteria | 2628 |
| 399 | Ga0207645_10000157 | 3300025907 | Bacteria | 53374 |
| 400 | Ga0207645_10029420 | 3300025907 | Bacteria | 3542 |
| 401 | Ga0207645_10120119 | 3300025907 | Bacteria | 1706 |
| 402 | Ga0207645_10130797 | 3300025907 | Bacteria | 1633 |
| 403 | Ga0207643_10004227 | 3300025908 | Bacteria | 7735 |
| 404 | Ga0207643_10032933 | 3300025908 | Bacteria | 2898 |
| 405 | Ga0207684_10023462 | 3300025910 | Bacteria | 5267 |
| 406 | Ga0207684_10106152 | 3300025910 | Bacteria | 2402 |
| 407 | Ga0207654_10025190 | 3300025911 | Bacteria | 3206 |
| 408 | Ga0207654_10150673 | 3300025911 | Bacteria | 1493 |
| 409 | Ga0207707_10114127 | 3300025912 | Bacteria | 2361 |
| 410 | Ga0207707_10224069 | 3300025912 | Bacteria | 1637 |
| 411 | Ga0207695_10021259 | 3300025913 | Bacteria | 7410 |
| 412 | Ga0207695_10187093 | 3300025913 | Bacteria | 1989 |
| 413 | Ga0207671_10026895 | 3300025914 | Bacteria | 4304 |
| 414 | Ga0207671_10092039 | 3300025914 | Bacteria | 2286 |
| 415 | Ga0207671_10208610 | 3300025914 | Bacteria | 1528 |
| 416 | Ga0207671_10255177 | 3300025914 | Bacteria | 1379 |
| 417 | Ga0207693_10004790 | 3300025915 | Bacteria | 11380 |
| 418 | Ga0207660_10199803 | 3300025917 | Bacteria | 1561 |
| 419 | Ga0207657_10003501 | 3300025919 | Bacteria | 16765 |
| 420 | Ga0207649_10201701 | 3300025920 | Bacteria | 1406 |
| 421 | Ga0207652_10052455 | 3300025921 | Bacteria | 3500 |
| 422 | Ga0207646_10030223 | 3300025922 | Bacteria | 4914 |
| 423 | Ga0207681_10004068 | 3300025923 | Bacteria | 9061 |
| 424 | Ga0207681_10086435 | 3300025923 | Bacteria | 2228 |
| 425 | Ga0207681_10120799 | 3300025923 | Bacteria | 1921 |
| 426 | Ga0207694_10166408 | 3300025924 | Bacteria | 1783 |
| 427 | Ga0207694_10222900 | 3300025924 | Bacteria | 1539 |
| 428 | Ga0207650_10080620 | 3300025925 | Bacteria | 2468 |
| 429 | Ga0207650_10082918 | 3300025925 | Bacteria | 2435 |
| 430 | Ga0207650_10100420 | 3300025925 | Bacteria | 2226 |
| 431 | Ga0207650_10347855 | 3300025925 | Bacteria | 1219 |
| 432 | Ga0207659_10002948 | 3300025926 | Bacteria | 10131 |
| 433 | Ga0207687_10148873 | 3300025927 | Bacteria | 1784 |
| 434 | Ga0207644_10011516 | 3300025931 | Bacteria | 5855 |
| 435 | Ga0207644_10019823 | 3300025931 | Bacteria | 4566 |
| 436 | Ga0207644_10093030 | 3300025931 | Bacteria | 2250 |
| 437 | Ga0207644_10238755 | 3300025931 | Bacteria | 1446 |
| 438 | Ga0207644_10258482 | 3300025931 | Bacteria | 1392 |
| 439 | Ga0207690_10026090 | 3300025932 | Bacteria | 3677 |
| 440 | Ga0207690_10150674 | 3300025932 | Bacteria | 1724 |
| 441 | Ga0207706_10002095 | 3300025933 | Bacteria | 19518 |
| 442 | Ga0207706_10009799 | 3300025933 | Bacteria | 8792 |
| 443 | Ga0207706_10137720 | 3300025933 | Bacteria | 2147 |
| 444 | Ga0207686_10017732 | 3300025934 | Bacteria | 4016 |
| 445 | Ga0207709_10000070 | 3300025935 | Bacteria | 183020 |
| 446 | Ga0207709_10000627 | 3300025935 | Bacteria | 28968 |
| 447 | Ga0207709_10011114 | 3300025935 | Bacteria | 4964 |
| 448 | Ga0207709_10038438 | 3300025935 | Bacteria | 2850 |
| 449 | Ga0207709_10064386 | 3300025935 | Bacteria | 2302 |
| 450 | Ga0207669_10022300 | 3300025937 | Bacteria | 3361 |
| 451 | Ga0207669_10053034 | 3300025937 | Bacteria | 2440 |
| 452 | Ga0207704_10253566 | 3300025938 | Bacteria | 1322 |
| 453 | Ga0207665_10544825 | 3300025939 | Bacteria | 901 |
| 454 | Ga0207691_10000249 | 3300025940 | Bacteria | 53276 |
| 455 | Ga0207691_10105747 | 3300025940 | Bacteria | 2507 |
| 456 | Ga0207691_10139540 | 3300025940 | Bacteria | 2137 |
| 457 | Ga0207691_10205582 | 3300025940 | Bacteria | 1712 |
| 458 | Ga0207691_10400820 | 3300025940 | Bacteria | 1170 |
| 459 | Ga0207711_10081928 | 3300025941 | Bacteria | 2820 |
| 460 | Ga0207689_10003129 | 3300025942 | Bacteria | 15185 |
| 461 | Ga0207689_10009790 | 3300025942 | Bacteria | 8258 |
| 462 | Ga0207689_10009937 | 3300025942 | Bacteria | 8206 |
| 463 | Ga0207689_10368165 | 3300025942 | Bacteria | 1196 |
| 464 | Ga0207689_10404320 | 3300025942 | Bacteria | 1138 |
| 465 | Ga0207679_10010256 | 3300025945 | Bacteria | 6027 |
| 466 | Ga0207667_10061918 | 3300025949 | Bacteria | 3914 |
| 467 | Ga0207667_10230963 | 3300025949 | Bacteria | 1894 |
| 468 | Ga0207667_10384419 | 3300025949 | Bacteria | 1430 |
| 469 | Ga0207667_10495141 | 3300025949 | Bacteria | 1240 |
| 470 | Ga0207651_10014375 | 3300025960 | Bacteria | 4567 |
| 471 | Ga0207651_10074685 | 3300025960 | Bacteria | 2415 |
| 472 | Ga0207651_10201659 | 3300025960 | Bacteria | 1595 |
| 473 | Ga0207651_10256576 | 3300025960 | Bacteria | 1433 |
| 474 | Ga0207651_10273028 | 3300025960 | Bacteria | 1393 |
| 475 | Ga0207651_10629915 | 3300025960 | Bacteria | 940 |
| 476 | Ga0207668_10013050 | 3300025972 | Bacteria | 5104 |
| 477 | Ga0207668_10099520 | 3300025972 | Bacteria | 2157 |
| 478 | Ga0207668_10110796 | 3300025972 | Bacteria | 2059 |
| 479 | Ga0207668_10173237 | 3300025972 | Bacteria | 1694 |
| 480 | Ga0207668_10466643 | 3300025972 | Bacteria | 1080 |
| 481 | Ga0207640_10005591 | 3300025981 | Bacteria | 6854 |
| 482 | Ga0207640_10019565 | 3300025981 | Bacteria | 4003 |
| 483 | Ga0207640_10112596 | 3300025981 | Bacteria | 1932 |
| 484 | Ga0207658_10001272 | 3300025986 | Bacteria | 19944 |
| 485 | Ga0207658_10040512 | 3300025986 | Bacteria | 3368 |
| 486 | Ga0207658_10172443 | 3300025986 | Bacteria | 1783 |
| 487 | Ga0207658_10181466 | 3300025986 | Bacteria | 1742 |
| 488 | Ga0207658_10381568 | 3300025986 | Bacteria | 1234 |
| 489 | Ga0207658_10453660 | 3300025986 | Bacteria | 1135 |
| 490 | Ga0207677_10046514 | 3300026023 | Bacteria | 2906 |
| 491 | Ga0207677_10398099 | 3300026023 | Bacteria | 1167 |
| 492 | Ga0207703_10002253 | 3300026035 | Bacteria | 16857 |
| 493 | Ga0207703_10023868 | 3300026035 | Bacteria | 4809 |
| 494 | Ga0207703_10113812 | 3300026035 | Bacteria | 2313 |
| 495 | Ga0207703_10166256 | 3300026035 | Bacteria | 1936 |
| 496 | Ga0207639_10018991 | 3300026041 | Bacteria | 4894 |
| 497 | Ga0207639_10068258 | 3300026041 | Bacteria | 2769 |
| 498 | Ga0207639_10293762 | 3300026041 | Bacteria | 1434 |
| 499 | Ga0207639_10320494 | 3300026041 | Bacteria | 1376 |
| 500 | Ga0207678_10012240 | 3300026067 | Bacteria | 7533 |
| 501 | Ga0207678_10041936 | 3300026067 | Bacteria | 3967 |
| 502 | Ga0207678_10100982 | 3300026067 | Bacteria | 2464 |
| 503 | Ga0207708_10184156 | 3300026075 | Bacteria | 1659 |
| 504 | Ga0207702_10019967 | 3300026078 | Bacteria | 5550 |
| 505 | Ga0207702_10445467 | 3300026078 | Bacteria | 1256 |
| 506 | Ga0207641_10000374 | 3300026088 | Bacteria | 53088 |
| 507 | Ga0207641_10030209 | 3300026088 | Bacteria | 4487 |
| 508 | Ga0207641_10135882 | 3300026088 | Bacteria | 2213 |
| 509 | Ga0207641_10144290 | 3300026088 | Bacteria | 2151 |
| 510 | Ga0207641_10159602 | 3300026088 | Bacteria | 2049 |
| 511 | Ga0207641_10842171 | 3300026088 | Bacteria | 909 |
| 512 | Ga0207648_10000002 | 3300026089 | Bacteria | 307909 |
| 513 | Ga0207648_10000523 | 3300026089 | Bacteria | 42961 |
| 514 | Ga0207648_10001083 | 3300026089 | Bacteria | 30493 |
| 515 | Ga0207648_10013639 | 3300026089 | Bacteria | 7544 |
| 516 | Ga0207648_10021215 | 3300026089 | Bacteria | 5839 |
| 517 | Ga0207648_10028050 | 3300026089 | Bacteria | 4993 |
| 518 | Ga0207648_10101597 | 3300026089 | Bacteria | 2520 |
| 519 | Ga0207648_10213060 | 3300026089 | Bacteria | 1715 |
| 520 | Ga0207648_10292465 | 3300026089 | Bacteria | 1459 |
| 521 | Ga0207648_10347428 | 3300026089 | Bacteria | 1337 |
| 522 | Ga0207676_10008789 | 3300026095 | Bacteria | 7187 |
| 523 | Ga0207674_10000118 | 3300026116 | Bacteria | 92408 |
| 524 | Ga0207674_10026157 | 3300026116 | Bacteria | 6208 |
| 525 | Ga0207674_10063541 | 3300026116 | Bacteria | 3727 |
| 526 | Ga0207675_100066282 | 3300026118 | Bacteria | 3375 |
| 527 | Ga0207675_100075232 | 3300026118 | Bacteria | 3161 |
| 528 | Ga0207675_100108631 | 3300026118 | Bacteria | 2616 |
| 529 | Ga0207675_100445806 | 3300026118 | Bacteria | 1282 |
| 530 | Ga0207683_10000476 | 3300026121 | Bacteria | 37318 |
| 531 | Ga0207683_10040510 | 3300026121 | Bacteria | 4065 |
| 532 | Ga0207683_10293128 | 3300026121 | Bacteria | 1488 |
| 533 | Ga0207698_10037561 | 3300026142 | Bacteria | 3569 |
| 534 | Ga0207698_10182797 | 3300026142 | Bacteria | 1859 |
| 535 | Ga0207698_10478534 | 3300026142 | Bacteria | 1207 |
| 536 | Ga0209281_1000029 | 3300027111 | Bacteria | 431495 |
| 537 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 538 | Ga0209371_1007734 | 3300027312 | Bacteria | 3686 |
| 539 | Ga0209371_1036684 | 3300027312 | Bacteria | 1023 |
| 540 | Ga0209282_1000052 | 3300027666 | Bacteria | 104317 |
| 541 | Ga0209282_1000088 | 3300027666 | Bacteria | 66037 |
| 542 | Ga0209282_1006186 | 3300027666 | Bacteria | 7418 |
| 543 | Ga0209282_1043586 | 3300027666 | Bacteria | 2637 |
| 544 | Ga0209813_10059153 | 3300027866 | Bacteria | 1219 |
| 545 | Ga0268266_10004526 | 3300028379 | Bacteria | 13283 |
| 546 | Ga0268266_10023108 | 3300028379 | Bacteria | 5292 |
| 547 | Ga0268266_10050840 | 3300028379 | Bacteria | 3557 |
| 548 | Ga0268266_10084658 | 3300028379 | Bacteria | 2769 |
| 549 | Ga0268265_10004995 | 3300028380 | Bacteria | 9105 |
| 550 | Ga0268265_10018279 | 3300028380 | Bacteria | 4856 |
| 551 | Ga0268265_10018436 | 3300028380 | Bacteria | 4836 |
| 552 | Ga0268265_10084594 | 3300028380 | Bacteria | 2515 |
| 553 | Ga0268265_10104426 | 3300028380 | Bacteria | 2296 |
| 554 | Ga0268265_10284785 | 3300028380 | Bacteria | 1480 |
| 555 | Ga0268264_10008187 | 3300028381 | Bacteria | 8681 |
| 556 | Ga0268264_10029798 | 3300028381 | Bacteria | 4472 |
| 557 | Ga0268264_10034214 | 3300028381 | Bacteria | 4178 |
| 558 | Ga0265337_1003809 | 3300028556 | Bacteria | 6412 |
| 559 | Ga0265326_10002334 | 3300028558 | Bacteria | 6410 |
| 560 | Ga0265319_1005177 | 3300028563 | Bacteria | 6303 |
| 561 | Ga0265334_10001347 | 3300028573 | Bacteria | 11870 |
| 562 | Ga0265318_10005245 | 3300028577 | Bacteria | 6101 |
| 563 | Ga0265323_10000539 | 3300028653 | Bacteria | 20989 |
| 564 | Ga0265322_10002074 | 3300028654 | Bacteria | 6288 |
| 565 | Ga0265336_10000483 | 3300028666 | Bacteria | 23547 |
| 566 | Ga0307517_10070639 | 3300028786 | Bacteria | 3142 |
| 567 | Ga0307515_10000049 | 3300028794 | Bacteria | 278611 |
| 568 | Ga0307515_10000066 | 3300028794 | Bacteria | 244076 |
| 569 | Ga0307515_10000219 | 3300028794 | Bacteria | 141532 |
| 570 | Ga0307515_10027455 | 3300028794 | Bacteria | 9730 |
| 571 | Ga0307515_10028862 | 3300028794 | Bacteria | 9409 |
| 572 | Ga0307515_10040292 | 3300028794 | Bacteria | 7391 |
| 573 | Ga0307515_10063405 | 3300028794 | Bacteria | 5192 |
| 574 | Ga0307515_10254487 | 3300028794 | Bacteria | 1503 |
| 575 | Ga0307515_10263486 | 3300028794 | Bacteria | 1456 |
| 576 | Ga0265338_10000081 | 3300028800 | Bacteria | 176402 |
| 577 | Ga0265324_10002127 | 3300029957 | Bacteria | 10424 |
| 578 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 579 | Ga0268256_1007407 | 3300030500 | Bacteria | 3921 |
| 580 | Ga0268256_1013945 | 3300030500 | Bacteria | 2409 |
| 581 | Ga0307512_10061292 | 3300030522 | Bacteria | 2899 |
| 582 | Ga0307512_10062849 | 3300030522 | Bacteria | 2844 |
| 583 | Ga0316177_1112440 | 3300030731 | Bacteria | 1323 |
| 584 | Ga0316176_1185062 | 3300030732 | Bacteria | 2360 |
| 585 | Ga0314311_1026270 | 3300030733 | Bacteria | 4965 |
| 586 | Ga0316178_1074219 | 3300030735 | Bacteria | 2195 |
| 587 | Ga0316180_1168541 | 3300030736 | Bacteria | 2297 |
| 588 | Ga0316183_1066146 | 3300030742 | Bacteria | 2729 |
| 589 | Ga0316181_1019403 | 3300030744 | Bacteria | 1180 |
| 590 | Ga0316181_1022414 | 3300030744 | Bacteria | 5916 |
| 591 | Ga0316181_1085438 | 3300030744 | Bacteria | 4928 |
| 592 | Ga0316182_1245277 | 3300030745 | Bacteria | 3003 |
| 593 | Ga0316182_1429538 | 3300030745 | Bacteria | 2016 |
| 594 | Ga0265327_10005949 | 3300031251 | Bacteria | 9945 |
| 595 | Ga0307513_10000012 | 3300031456 | Bacteria | 328865 |
| 596 | Ga0307513_10030448 | 3300031456 | Bacteria | 6131 |
| 597 | Ga0307513_10221759 | 3300031456 | Bacteria | 1711 |
| 598 | Ga0307513_10339883 | 3300031456 | Bacteria | 1252 |
| 599 | Ga0307509_10003715 | 3300031507 | Bacteria | 22843 |
| 600 | Ga0307509_10004792 | 3300031507 | Bacteria | 19239 |
| 601 | Ga0307509_10018758 | 3300031507 | Bacteria | 7922 |
| 602 | Ga0307509_10114365 | 3300031507 | Bacteria | 2693 |
| 603 | Ga0307509_10121145 | 3300031507 | Bacteria | 2593 |
| 604 | Ga0307408_100004608 | 3300031548 | Bacteria | 9320 |
| 605 | Ga0307408_100078880 | 3300031548 | Bacteria | 2455 |
| 606 | Ga0307408_100171434 | 3300031548 | Bacteria | 1733 |
| 607 | Ga0307408_100288482 | 3300031548 | Bacteria | 1369 |
| 608 | Ga0307508_10000222 | 3300031616 | Bacteria | 69029 |
| 609 | Ga0307508_10003666 | 3300031616 | Bacteria | 15394 |
| 610 | Ga0307508_10098088 | 3300031616 | Bacteria | 2522 |
| 611 | Ga0307514_10001095 | 3300031649 | Bacteria | 37913 |
| 612 | Ga0307514_10010830 | 3300031649 | Bacteria | 7616 |
| 613 | Ga0307514_10019111 | 3300031649 | Bacteria | 5611 |
| 614 | Ga0307514_10134819 | 3300031649 | Bacteria | 1692 |
| 615 | Ga0307516_10079017 | 3300031730 | Bacteria | 3135 |
| 616 | Ga0307516_10152400 | 3300031730 | Bacteria | 2070 |
| 617 | Ga0307516_10180443 | 3300031730 | Bacteria | 1845 |
| 618 | Ga0307516_10332758 | 3300031730 | Bacteria | 1187 |
| 619 | Ga0307405_10055501 | 3300031731 | Bacteria | 2479 |
| 620 | Ga0307405_10301034 | 3300031731 | Bacteria | 1216 |
| 621 | Ga0307413_10046593 | 3300031824 | Bacteria | 2579 |
| 622 | Ga0307406_10000768 | 3300031901 | Bacteria | 18002 |
| 623 | Ga0307412_10001927 | 3300031911 | Bacteria | 11464 |
| 624 | Ga0307412_10023449 | 3300031911 | Bacteria | 3797 |
| 625 | Ga0307412_10139293 | 3300031911 | Bacteria | 1774 |
| 626 | Ga0307412_10147293 | 3300031911 | Bacteria | 1732 |
| 627 | Ga0307412_10157277 | 3300031911 | Bacteria | 1684 |
| 628 | Ga0307416_100079319 | 3300032002 | Bacteria | 2766 |
| 629 | Ga0307416_100090048 | 3300032002 | Bacteria | 2629 |
| 630 | Ga0307416_100096710 | 3300032002 | Bacteria | 2554 |
| 631 | Ga0307416_100258707 | 3300032002 | Bacteria | 1700 |
| 632 | Ga0307416_100933182 | 3300032002 | Bacteria | 969 |
| 633 | Ga0307411_10171535 | 3300032005 | Bacteria | 1636 |
| 634 | Ga0307510_10000779 | 3300033180 | Bacteria | 32991 |
| 635 | Ga0307510_10004087 | 3300033180 | Bacteria | 17118 |
| 636 | Ga0307510_10208180 | 3300033180 | Bacteria | 1481 |
| 637 | Ga0373930_0010086 | 3300034816 | Bacteria | 1682 |
| 638 | Ga0373931_0009521 | 3300035691 | Bacteria | 4645 |
| 639 | Ga0373931_0020204 | 3300035691 | Bacteria | 3330 |
| 640 | Ga0373927_0156135 | 3300035695 | Bacteria | 1494 |
| 641 | Ga0373937_0092465 | 3300036401 | Bacteria | 2804 |
| 642 | Ga0373937_0548175 | 3300036401 | Bacteria | 1098 |
| 643 | Ga0373925_0112886 | 3300037068 | Bacteria | 2101 |
| 644 | Ga0395899_0007556 | 3300037312 | Bacteria | 8392 |
| 645 | Ga0395900_0003906 | 3300037418 | Bacteria | 15918 |
| 646 | Ga0395900_0387907 | 3300037418 | Bacteria | 1363 |
| 647 | Ga0395898_0013566 | 3300037466 | Bacteria | 8386 |
| 648 | Ga0395898_0290977 | 3300037466 | Bacteria | 1558 |
| 649 | Ga0395905_0004967 | 3300037471 | Bacteria | 13702 |
| 650 | Ga0395905_0046704 | 3300037471 | Bacteria | 4060 |
| 651 | Ga0395905_0076516 | 3300037471 | Bacteria | 3136 |
| 652 | Ga0395905_0133441 | 3300037471 | Bacteria | 2335 |
| 653 | Ga0395905_0137255 | 3300037471 | Bacteria | 2301 |
| 654 | Ga0395905_0155861 | 3300037471 | Bacteria | 2148 |
| 655 | Ga0395905_0419516 | 3300037471 | Bacteria | 1234 |
| 656 | Ga0395901_0098596 | 3300038443 | Bacteria | 3064 |
| 657 | Ga0395901_0321027 | 3300038443 | Bacteria | 1602 |
| 658 | Ga0395901_0737347 | 3300038443 | Bacteria | 979 |
| 659 | Ga0436365_1170862 | 3300039437 | Bacteria | 1318 |
| 660 | Ga0439436_0001183 | 3300041404 | Bacteria | 7408 |
| 661 | Ga0439436_0043738 | 3300041404 | Bacteria | 1277 |
| 662 | Ga0439466_0065685 | 3300041411 | Bacteria | 1162 |
| 663 | Ga0439465_0007105 | 3300041413 | Bacteria | 3559 |
| 664 | Ga0439465_0054294 | 3300041413 | Bacteria | 1318 |
| 665 | Ga0451839_0812530 | 3300041496 | Bacteria | 897 |
| 666 | Ga0439445_0041638 | 3300042004 | Bacteria | 1221 |
| 667 | Ga0439449_0000862 | 3300042007 | Bacteria | 11820 |
| 668 | Ga0439449_0000864 | 3300042007 | Bacteria | 11814 |
| 669 | Ga0439449_0018255 | 3300042007 | Bacteria | 2632 |
| 670 | Ga0439449_0036707 | 3300042007 | Bacteria | 1823 |
| 671 | Ga0439452_005795 | 3300042010 | Bacteria | 3944 |
| 672 | Ga0439452_006476 | 3300042010 | Bacteria | 3667 |
| 673 | Ga0450894_002833 | 3300042131 | Bacteria | 2302 |
| 674 | Ga0450899_002031 | 3300042135 | Bacteria | 2222 |
| 675 | Ga0450906_005940 | 3300042145 | Bacteria | 2484 |
| 676 | Ga0439446_0087324 | 3300042156 | Bacteria | 973 |
| 677 | Ga0450908_011714 | 3300042184 | Bacteria | 1601 |
| 678 | Ga0450908_016073 | 3300042184 | Bacteria | 1337 |
| 679 | Ga0439434_0047276 | 3300042435 | Bacteria | 1329 |
| 680 | Ga0439434_0078644 | 3300042435 | Bacteria | 1045 |
| 681 | Ga0451577_0076658 | 3300042876 | Bacteria | 2981 |
| 682 | Ga0451577_0110605 | 3300042876 | Bacteria | 2458 |
| 683 | Ga0451577_0183167 | 3300042876 | Bacteria | 1888 |
| 684 | Ga0453683_0001822 | 3300044673 | Bacteria | 17588 |
| 685 | Ga0453683_0202975 | 3300044673 | Bacteria | 1259 |
| 686 | Ga0451576_0008457 | 3300045051 | Bacteria | 12084 |
| 687 | Ga0451576_0529392 | 3300045051 | Bacteria | 1238 |
| 688 | Ga0495592_0008519 | 3300046454 | Bacteria | 7698 |
| 689 | Ga0495603_0053146 | 3300046455 | Bacteria | 2404 |
| 690 | Ga0495638_0271350 | 3300046460 | Bacteria | 926 |
| 691 | Ga0495580_0178313 | 3300046472 | Bacteria | 1467 |
| 692 | Ga0495605_0038060 | 3300046474 | Bacteria | 2415 |
| 693 | Ga0495596_0002574 | 3300046500 | Bacteria | 9633 |
| 694 | Ga0495596_0012021 | 3300046500 | Bacteria | 3715 |
| 695 | Ga0495607_0000044 | 3300046501 | Bacteria | 125410 |
| 696 | Ga0495607_0027544 | 3300046501 | Bacteria | 3512 |
| 697 | Ga0495606_0065195 | 3300046507 | Bacteria | 2315 |
| 698 | Ga0495610_0006580 | 3300046512 | Bacteria | 7942 |
| 699 | Ga0495616_0019277 | 3300046513 | Bacteria | 3724 |
| 700 | Ga0495620_0134320 | 3300046515 | Bacteria | 970 |
| 701 | Ga0495631_0000416 | 3300046518 | Bacteria | 29385 |
| 702 | Ga0495654_0012062 | 3300046530 | Bacteria | 4655 |
| 703 | Ga0495654_0099313 | 3300046530 | Bacteria | 1342 |
| 704 | Ga0495609_0036164 | 3300046538 | Bacteria | 2231 |
| 705 | Ga0495621_0060229 | 3300046539 | Bacteria | 1376 |
| 706 | Ga0495656_0003313 | 3300046615 | Bacteria | 5436 |
| 707 | Ga0495625_0000778 | 3300046660 | Bacteria | 44311 |
| 708 | Ga0495625_0076361 | 3300046660 | Bacteria | 2342 |
| 709 | Ga0495659_0021836 | 3300046664 | Bacteria | 2160 |
| 710 | Ga0495588_0102778 | 3300046674 | Bacteria | 1502 |
| 711 | Ga0495658_0119510 | 3300046683 | Bacteria | 1593 |
| 712 | Ga0495624_0069842 | 3300046690 | Bacteria | 2187 |
| 713 | Ga0495671_0004533 | 3300046692 | Bacteria | 8286 |
| 714 | Ga0495671_0057225 | 3300046692 | Bacteria | 1929 |
| 715 | Ga0495636_0040348 | 3300047318 | Bacteria | 1935 |
| 716 | Ga0495676_0013984 | 3300047321 | Bacteria | 7189 |
| 717 | Ga0495676_0047327 | 3300047321 | Bacteria | 3478 |
| 718 | Ga0495681_0003812 | 3300047470 | Bacteria | 10443 |
| 719 | Ga0495681_0008367 | 3300047470 | Bacteria | 6494 |
| 720 | Ga0495686_0002427 | 3300047472 | Bacteria | 17622 |
| 721 | Ga0495593_0021590 | 3300047673 | Bacteria | 3593 |
| 722 | Ga0495614_0006317 | 3300048089 | Bacteria | 5324 |
| 723 | Ga0496100_0130749 | 3300048903 | Bacteria | 1768 |
| 724 | Ga0496100_0189394 | 3300048903 | Bacteria | 1493 |
| 725 | Ga0496101_0193685 | 3300048904 | Bacteria | 1569 |
| 726 | Ga0496102_0009393 | 3300048905 | Bacteria | 8402 |
| 727 | Ga0496102_0450163 | 3300048905 | Bacteria | 1208 |
| 728 | Ga0496104_0491641 | 3300048907 | Bacteria | 1138 |
| 729 | Ga0496105_0006491 | 3300048908 | Bacteria | 8992 |
| 730 | Ga0496106_0036886 | 3300048909 | Bacteria | 3656 |
| 731 | Ga0496106_0230870 | 3300048909 | Bacteria | 1477 |
| 732 | Ga0496108_0505781 | 3300048911 | Bacteria | 1055 |
| 733 | Ga0496109_0031971 | 3300048912 | Bacteria | 4728 |
| 734 | Ga0496110_0017408 | 3300048913 | Bacteria | 6012 |
| 735 | Ga0496112_0012289 | 3300048915 | Bacteria | 7863 |
| 736 | Ga0496112_0078957 | 3300048915 | Bacteria | 3255 |
| 737 | Ga0496113_0143138 | 3300048916 | Bacteria | 1882 |
| 738 | Ga0496113_0292602 | 3300048916 | Bacteria | 1303 |
| 739 | Ga0496116_0000395 | 3300048919 | Bacteria | 63403 |
| 740 | Ga0496116_0014094 | 3300048919 | Bacteria | 6402 |
| 741 | Ga0496116_0024710 | 3300048919 | Bacteria | 4434 |
| 742 | Ga0496116_0050323 | 3300048919 | Bacteria | 2777 |
| 743 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 744 | Ga0496117_0036934 | 3300048920 | Bacteria | 3647 |
| 745 | Ga0496117_0037706 | 3300048920 | Bacteria | 3596 |
| 746 | Ga0496118_0001167 | 3300048921 | Bacteria | 40506 |
| 747 | Ga0496118_0024886 | 3300048921 | Bacteria | 5153 |
| 748 | Ga0496118_0054541 | 3300048921 | Bacteria | 3026 |
| 749 | Ga0496119_0041241 | 3300048922 | Bacteria | 2942 |
| 750 | Ga0496120_0000498 | 3300048923 | Bacteria | 61391 |
| 751 | Ga0496120_0053650 | 3300048923 | Bacteria | 2289 |
| 752 | Ga0496121_0011713 | 3300048924 | Bacteria | 9682 |
| 753 | Ga0496121_0017580 | 3300048924 | Bacteria | 7290 |
| 754 | Ga0496121_0042392 | 3300048924 | Bacteria | 3960 |
| 755 | Ga0496121_0223609 | 3300048924 | Bacteria | 1324 |
| 756 | Ga0496121_0229354 | 3300048924 | Bacteria | 1302 |
| 757 | Ga0496121_0253661 | 3300048924 | Bacteria | 1218 |
| 758 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 759 | Ga0496122_0039545 | 3300048925 | Bacteria | 3760 |
| 760 | Ga0496122_0077531 | 3300048925 | Bacteria | 2332 |
| 761 | Ga0496122_0083412 | 3300048925 | Bacteria | 2216 |
| 762 | Ga0496122_0170936 | 3300048925 | Bacteria | 1310 |
| 763 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 764 | Ga0496123_0039243 | 3300048926 | Bacteria | 3314 |
| 765 | Ga0496123_0122784 | 3300048926 | Bacteria | 1456 |
| 766 | Ga0496123_0138635 | 3300048926 | Bacteria | 1334 |
| 767 | Ga0496123_0188335 | 3300048926 | Bacteria | 1070 |
| 768 | Ga0496124_0000178 | 3300048927 | Bacteria | 126118 |
| 769 | Ga0496124_0005665 | 3300048927 | Bacteria | 13932 |
| 770 | Ga0496124_0242842 | 3300048927 | Bacteria | 1338 |
| 771 | Ga0496125_0007258 | 3300048928 | Bacteria | 11808 |
| 772 | Ga0496125_0053330 | 3300048928 | Bacteria | 3316 |
| 773 | Ga0496125_0076142 | 3300048928 | Bacteria | 2592 |
| 774 | Ga0496125_0172756 | 3300048928 | Bacteria | 1450 |
| 775 | Ga0496126_0001831 | 3300048929 | Bacteria | 31033 |
| 776 | Ga0496126_0030554 | 3300048929 | Bacteria | 5101 |
| 777 | Ga0496126_0168533 | 3300048929 | Bacteria | 1867 |
| 778 | Ga0496126_0227331 | 3300048929 | Bacteria | 1565 |
| 779 | Ga0501298_002724 | 3300049521 | Bacteria | 2696 |
| 780 | Ga0501031_0019906 | 3300049568 | Bacteria | 4374 |
| 781 | Ga0501033_0482073 | 3300049570 | Bacteria | 859 |
| 782 | Ga0501034_0003224 | 3300049571 | Bacteria | 18671 |
| 783 | Ga0501037_0044179 | 3300049573 | Bacteria | 3273 |
| 784 | Ga0501037_0044246 | 3300049573 | Bacteria | 3269 |
| 785 | Ga0501048_0033542 | 3300049582 | Bacteria | 3708 |
| 786 | Ga0501068_0056555 | 3300049584 | Bacteria | 2378 |
| 787 | Ga0501072_0344877 | 3300049588 | Bacteria | 1183 |
| 788 | Ga0501075_0099242 | 3300049591 | Bacteria | 2211 |
| 789 | Ga0501077_0013625 | 3300049593 | Bacteria | 5098 |
| 790 | Ga0501079_0016435 | 3300049741 | Bacteria | 5651 |
| 791 | Ga0501079_0204136 | 3300049741 | Bacteria | 1544 |
| 792 | Ga0501079_0338838 | 3300049741 | Bacteria | 1178 |
| 793 | Ga0501080_0027985 | 3300049742 | Bacteria | 5242 |
| 794 | Ga0501081_0087845 | 3300049743 | Bacteria | 2184 |
| 795 | Ga0501035_0402716 | 3300049822 | Bacteria | 1138 |
| 796 | Ga0501044_0046553 | 3300049823 | Bacteria | 4489 |
| 797 | Ga0501045_0036108 | 3300049824 | Bacteria | 3588 |
| 798 | nmdc:mga03683_123546_c1 | 3300050489 | Bacteria | 1153 |
| 799 | nmdc:mga00v17_1172_c1 | 3300050491 | Bacteria | 13780 |
| 800 | nmdc:mga00v17_128474_c1 | 3300050491 | Bacteria | 1618 |
| 801 | nmdc:mga0yw44_186_c1 | 3300050492 | Bacteria | 21913 |
| 802 | nmdc:mga0yw44_193615_c1 | 3300050492 | Bacteria | 1341 |
| 803 | nmdc:mga0k408_119452_c1 | 3300050493 | Bacteria | 1561 |
| 804 | nmdc:mga0k408_124410_c1 | 3300050493 | Bacteria | 1529 |
| 805 | nmdc:mga0k408_12727_c2 | 3300050493 | Bacteria | 4317 |
| 806 | nmdc:mga0k408_13028_c1 | 3300050493 | Bacteria | 4554 |
| 807 | nmdc:mga0k408_19481_c1 | 3300050493 | Bacteria | 3793 |
| 808 | nmdc:mga0k408_199846_c1 | 3300050493 | Bacteria | 1193 |
| 809 | nmdc:mga0k408_48052_c1 | 3300050493 | Bacteria | 2467 |
| 810 | nmdc:mga0k408_63888_c1 | 3300050493 | Bacteria | 2142 |
| 811 | nmdc:mga0k408_90586_c1 | 3300050493 | Bacteria | 1796 |
| 812 | nmdc:mga06z11_18532_c1 | 3300050494 | Bacteria | 3181 |
| 813 | nmdc:mga06z11_256469_c1 | 3300050494 | Bacteria | 1031 |
| 814 | nmdc:mga04h51_70443_c1 | 3300050495 | Bacteria | 1219 |
| 815 | nmdc:mga07m45_111639_c1 | 3300050496 | Bacteria | 1575 |
| 816 | nmdc:mga07m45_11542_c1 | 3300050496 | Bacteria | 4646 |
| 817 | nmdc:mga07m45_17530_c1 | 3300050496 | Bacteria | 3848 |
| 818 | nmdc:mga07m45_2900_c1 | 3300050496 | Bacteria | 8127 |
| 819 | nmdc:mga07m45_3025_c1 | 3300050496 | Bacteria | 8018 |
| 820 | nmdc:mga07m45_48625_c1 | 3300050496 | Bacteria | 2386 |
| 821 | nmdc:mga07m45_9895_c1 | 3300050496 | Bacteria | 4666 |
| 822 | nmdc:mga05p37_100008_c1 | 3300050507 | Bacteria | 3571 |
| 823 | nmdc:mga05p37_325811_c1 | 3300050507 | Bacteria | 1816 |
| 824 | nmdc:mga06r32_27536_c1 | 3300050510 | Bacteria | 5311 |
| 825 | nmdc:mga0n895_8945_c1 | 3300050512 | Bacteria | 8730 |
| 826 | nmdc:mga0rr50_116087_c1 | 3300050513 | Bacteria | 2125 |
| 827 | nmdc:mga0rr50_357947_c1 | 3300050513 | Bacteria | 1228 |
| 828 | nmdc:mga0a205_207545_c1 | 3300050515 | Bacteria | 1848 |
| 829 | nmdc:mga0a205_22451_c1 | 3300050515 | Bacteria | 5978 |
| 830 | Ga0500610_0002372 | 3300053079 | Bacteria | 6905 |
| 831 | Ga0500610_0108139 | 3300053079 | Bacteria | 1432 |
| 832 | Ga0500578_0062342 | 3300053086 | Bacteria | 2380 |
| 833 | Ga0500643_038555 | 3300053087 | Bacteria | 1416 |
| 834 | Ga0500651_0000470 | 3300053093 | Bacteria | 21263 |
| 835 | Ga0500651_0079981 | 3300053093 | Bacteria | 2025 |
| 836 | Ga0500650_0078255 | 3300053098 | Bacteria | 1546 |
| 837 | Ga0500560_000863 | 3300053107 | Bacteria | 4726 |
| 838 | Ga0500571_073509 | 3300053110 | Bacteria | 1717 |
| 839 | Ga0500572_001032 | 3300053111 | Bacteria | 8341 |
| 840 | Ga0500593_093443 | 3300053117 | Bacteria | 1268 |
| 841 | Ga0500607_011326 | 3300053121 | Bacteria | 5278 |
| 842 | Ga0500607_116954 | 3300053121 | Bacteria | 1297 |
| 843 | Ga0500652_063337 | 3300053131 | Bacteria | 1526 |
| 844 | Ga0500658_0001324 | 3300053134 | Bacteria | 10022 |
| 845 | Ga0500559_0000020 | 3300053136 | Bacteria | 134858 |
| 846 | Ga0500559_0001277 | 3300053136 | Bacteria | 14696 |
| 847 | Ga0500561_0000531 | 3300053137 | Bacteria | 6163 |
| 848 | Ga0500568_0012823 | 3300053139 | Bacteria | 3841 |
| 849 | Ga0500577_0108503 | 3300053142 | Bacteria | 1143 |
| 850 | Ga0500616_0079303 | 3300053153 | Bacteria | 1654 |
| 851 | Ga0500616_0115331 | 3300053153 | Bacteria | 1291 |
| 852 | Ga0500622_0018225 | 3300053156 | Bacteria | 3733 |
| 853 | Ga0500627_0009524 | 3300053158 | Bacteria | 3501 |
| 854 | Ga0500634_0104192 | 3300053161 | Bacteria | 1413 |
| 855 | Ga0500639_015544 | 3300053163 | Bacteria | 4008 |
| 856 | Ga0500645_003541 | 3300053730 | Bacteria | 6295 |
| 857 | Ga0500596_012269 | 3300053735 | Bacteria | 1301 |
| 858 | Ga0500587_000608 | 3300053739 | Bacteria | 4478 |
| 859 | Ga0501084_0020078 | 3300054114 | Bacteria | 5571 |
| 860 | Ga0466962_0088956 | 3300061719 | Bacteria | 1479 |
| 861 | Ga0530510_0066933 | 3300061734 | Bacteria | 2606 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031911 | Ga0307412_10157277 | Ga0307412_101572772 | 204 |
| 2 | 3300027666 | Ga0209282_1000052 | Ga0209282_100005240 | 209 |
| 3 | 3300037466 | Ga0395898_0290977 | Ga0395898_0290977_79_855 | 215 |
| 4 | 3300038443 | Ga0395901_0321027 | Ga0395901_0321027_474_1250 | 215 |
| 5 | 3300026089 | Ga0207648_10347428 | Ga0207648_103474282 | 219 |
| 6 | 3300049568 | Ga0501031_0019906 | Ga0501031_0019906_3057_3890 | 219 |
| 7 | 3300049573 | Ga0501037_0044246 | Ga0501037_0044246_200_1033 | 219 |
| 8 | 3300049582 | Ga0501048_0033542 | Ga0501048_0033542_2661_3494 | 219 |
| 9 | 3300049584 | Ga0501068_0056555 | Ga0501068_0056555_1481_2314 | 219 |
| 10 | 3300049588 | Ga0501072_0344877 | Ga0501072_0344877_89_922 | 219 |
| 11 | 3300049741 | Ga0501079_0338838 | Ga0501079_0338838_60_893 | 219 |
| 12 | 3300049823 | Ga0501044_0046553 | Ga0501044_0046553_3308_4147 | 219 |
| 13 | 3300049824 | Ga0501045_0036108 | Ga0501045_0036108_215_1048 | 219 |
| 14 | 3300003792 | Ga0055540_1011011 | Ga0055540_10110113 | 221 |
| 15 | 3300005338 | Ga0068868_100622188 | Ga0068868_1006221881 | 221 |
| 16 | 3300005340 | Ga0070689_100134486 | Ga0070689_1001344863 | 221 |
| 17 | 3300005353 | Ga0070669_100086513 | Ga0070669_1000865132 | 221 |
| 18 | 3300005616 | Ga0068852_100381668 | Ga0068852_1003816682 | 221 |
| 19 | 3300005840 | Ga0068870_10268574 | Ga0068870_102685741 | 221 |
| 20 | 3300005843 | Ga0068860_100524444 | Ga0068860_1005244442 | 221 |
| 21 | 3300006177 | Ga0075362_10064606 | Ga0075362_100646062 | 221 |
| 22 | 3300006195 | Ga0075366_10127921 | Ga0075366_101279212 | 221 |
| 23 | 3300009177 | Ga0105248_10007765 | Ga0105248_1000776510 | 221 |
| 24 | 3300013308 | Ga0157375_10172413 | Ga0157375_101724133 | 221 |
| 25 | 3300025941 | Ga0207711_10081928 | Ga0207711_100819284 | 221 |
| 26 | 3300026075 | Ga0207708_10184156 | Ga0207708_101841562 | 221 |
| 27 | 3300026142 | Ga0207698_10182797 | Ga0207698_101827972 | 221 |
| 28 | 3300035691 | Ga0373931_0020204 | Ga0373931_0020204_1373_2236 | 221 |
| 29 | 3300048924 | Ga0496121_0011713 | Ga0496121_0011713_4486_5280 | 221 |
| 30 | 3300014497 | Ga0182008_10003519 | Ga0182008_100035192 | 222 |
| 31 | 3300015262 | Ga0182007_10001492 | Ga0182007_100014921 | 222 |
| 32 | 3300025292 | Ga0209676_1020433 | Ga0209676_10204332 | 222 |
| 33 | 3300030736 | Ga0316180_1168541 | Ga0316180_11685412 | 222 |
| 34 | 3300037471 | Ga0395905_0046704 | Ga0395905_0046704_471_1343 | 222 |
| 35 | 3300050493 | nmdc:mga0k408_63888_c1 | nmdc:mga0k408_63888_c1_1319_2098 | 222 |
| 36 | 3300050496 | nmdc:mga07m45_111639_c1 | nmdc:mga07m45_111639_c1_329_1189 | 222 |
| 37 | 3300009093 | Ga0105240_10146257 | Ga0105240_101462571 | 223 |
| 38 | 3300025253 | Ga0209677_100318 | Ga0209677_1003187 | 223 |
| 39 | 3300028794 | Ga0307515_10000219 | Ga0307515_1000021940 | 223 |
| 40 | 3300037471 | Ga0395905_0137255 | Ga0395905_0137255_1002_1874 | 223 |
| 41 | 3300038443 | Ga0395901_0737347 | Ga0395901_0737347_121_906 | 223 |
| 42 | 3300041413 | Ga0439465_0007105 | Ga0439465_0007105_2563_3426 | 223 |
| 43 | 3300042004 | Ga0439445_0041638 | Ga0439445_0041638_42_905 | 223 |
| 44 | 3300042007 | Ga0439449_0018255 | Ga0439449_0018255_741_1604 | 223 |
| 45 | 3300042010 | Ga0439452_005795 | Ga0439452_005795_533_1396 | 223 |
| 46 | 3300042156 | Ga0439446_0087324 | Ga0439446_0087324_40_903 | 223 |
| 47 | 3300048904 | Ga0496101_0193685 | Ga0496101_0193685_39_899 | 223 |
| 48 | 3300048924 | Ga0496121_0017580 | Ga0496121_0017580_4170_4946 | 223 |
| 49 | 3300048928 | Ga0496125_0053330 | Ga0496125_0053330_955_1731 | 223 |
| 50 | 3300053098 | Ga0500650_0078255 | Ga0500650_0078255_413_1186 | 223 |
| 51 | 3300005328 | Ga0070676_10189479 | Ga0070676_101894791 | 224 |
| 52 | 3300005468 | Ga0070707_100100630 | Ga0070707_1001006303 | 224 |
| 53 | 3300006177 | Ga0075362_10017702 | Ga0075362_100177023 | 224 |
| 54 | 3300025907 | Ga0207645_10130797 | Ga0207645_101307972 | 224 |
| 55 | 3300028794 | Ga0307515_10063405 | Ga0307515_100634052 | 224 |
| 56 | 3300046501 | Ga0495607_0000044 | Ga0495607_0000044_3010_3873 | 224 |
| 57 | 3300046660 | Ga0495625_0076361 | Ga0495625_0076361_339_1112 | 224 |
| 58 | 3300005364 | Ga0070673_100143193 | Ga0070673_1001431932 | 225 |
| 59 | 3300005367 | Ga0070667_100007303 | Ga0070667_1000073034 | 225 |
| 60 | 3300005617 | Ga0068859_100216526 | Ga0068859_1002165261 | 225 |
| 61 | 3300006042 | Ga0075368_10003446 | Ga0075368_100034462 | 225 |
| 62 | 3300006048 | Ga0075363_100121273 | Ga0075363_1001212732 | 225 |
| 63 | 3300006177 | Ga0075362_10001700 | Ga0075362_100017004 | 225 |
| 64 | 3300006178 | Ga0075367_10035836 | Ga0075367_100358362 | 225 |
| 65 | 3300006237 | Ga0097621_100667861 | Ga0097621_1006678611 | 225 |
| 66 | 3300006353 | Ga0075370_10018238 | Ga0075370_100182383 | 225 |
| 67 | 3300006931 | Ga0097620_100216535 | Ga0097620_1002165351 | 225 |
| 68 | 3300009174 | Ga0105241_10707664 | Ga0105241_107076641 | 225 |
| 69 | 3300009545 | Ga0105237_10082068 | Ga0105237_100820684 | 225 |
| 70 | 3300013306 | Ga0163162_10227800 | Ga0163162_102278002 | 225 |
| 71 | 3300017792 | Ga0163161_10171743 | Ga0163161_101717432 | 225 |
| 72 | 3300025914 | Ga0207671_10092039 | Ga0207671_100920392 | 225 |
| 73 | 3300025960 | Ga0207651_10201659 | Ga0207651_102016592 | 225 |
| 74 | 3300025981 | Ga0207640_10112596 | Ga0207640_101125963 | 225 |
| 75 | 3300025986 | Ga0207658_10172443 | Ga0207658_101724432 | 225 |
| 76 | 3300026067 | Ga0207678_10100982 | Ga0207678_101009822 | 225 |
| 77 | 3300027866 | Ga0209813_10059153 | Ga0209813_100591532 | 225 |
| 78 | 3300028794 | Ga0307515_10028862 | Ga0307515_100288628 | 225 |
| 79 | 3300031251 | Ga0265327_10005949 | Ga0265327_100059494 | 225 |
| 80 | 3300031911 | Ga0307412_10139293 | Ga0307412_101392932 | 225 |
| 81 | 3300032002 | Ga0307416_100096710 | Ga0307416_1000967101 | 225 |
| 82 | 3300042131 | Ga0450894_002833 | Ga0450894_002833_119_979 | 225 |
| 83 | 3300042135 | Ga0450899_002031 | Ga0450899_002031_1142_2002 | 225 |
| 84 | 3300042184 | Ga0450908_016073 | Ga0450908_016073_121_981 | 225 |
| 85 | 3300046474 | Ga0495605_0038060 | Ga0495605_0038060_241_1161 | 225 |
| 86 | 3300046500 | Ga0495596_0012021 | Ga0495596_0012021_247_1167 | 225 |
| 87 | 3300046501 | Ga0495607_0027544 | Ga0495607_0027544_2487_3407 | 225 |
| 88 | 3300046512 | Ga0495610_0006580 | Ga0495610_0006580_2443_3363 | 225 |
| 89 | 3300046513 | Ga0495616_0019277 | Ga0495616_0019277_2522_3442 | 225 |
| 90 | 3300046538 | Ga0495609_0036164 | Ga0495609_0036164_1056_1976 | 225 |
| 91 | 3300046692 | Ga0495671_0057225 | Ga0495671_0057225_672_1592 | 225 |
| 92 | 3300048905 | Ga0496102_0009393 | Ga0496102_0009393_467_1327 | 225 |
| 93 | 3300048908 | Ga0496105_0006491 | Ga0496105_0006491_6102_6962 | 225 |
| 94 | 3300048913 | Ga0496110_0017408 | Ga0496110_0017408_2465_3325 | 225 |
| 95 | 3300048919 | Ga0496116_0014094 | Ga0496116_0014094_2522_3442 | 225 |
| 96 | 3300048925 | Ga0496122_0039545 | Ga0496122_0039545_293_1213 | 225 |
| 97 | 3300048926 | Ga0496123_0122784 | Ga0496123_0122784_62_982 | 225 |
| 98 | 3300050489 | nmdc:mga03683_123546_c1 | nmdc:mga03683_123546_c1_230_1003 | 225 |
| 99 | 3300050492 | nmdc:mga0yw44_193615_c1 | nmdc:mga0yw44_193615_c1_413_1186 | 225 |
| 100 | 3300050493 | nmdc:mga0k408_13028_c1 | nmdc:mga0k408_13028_c1_767_1540 | 225 |
| 101 | 3300050494 | nmdc:mga06z11_18532_c1 | nmdc:mga06z11_18532_c1_1985_2758 | 225 |
| 102 | 3300050495 | nmdc:mga04h51_70443_c1 | nmdc:mga04h51_70443_c1_161_934 | 225 |
| 103 | 3300050496 | nmdc:mga07m45_11542_c1 | nmdc:mga07m45_11542_c1_2603_3376 | 225 |
| 104 | 3300003187 | JGI25151J46595_10012250 | JGI25151J46595_100122502 | 226 |
| 105 | 3300003771 | Ga0055526_1019943 | Ga0055526_10199432 | 226 |
| 106 | 3300003781 | Ga0055536_1000123 | Ga0055536_10001237 | 226 |
| 107 | 3300005328 | Ga0070676_10229245 | Ga0070676_102292451 | 226 |
| 108 | 3300005334 | Ga0068869_100016023 | Ga0068869_1000160232 | 226 |
| 109 | 3300005840 | Ga0068870_10013741 | Ga0068870_100137413 | 226 |
| 110 | 3300009148 | Ga0105243_10439369 | Ga0105243_104393692 | 226 |
| 111 | 3300025291 | Ga0209675_1000470 | Ga0209675_100047010 | 226 |
| 112 | 3300025292 | Ga0209676_1000012 | Ga0209676_1000012730 | 226 |
| 113 | 3300025294 | Ga0209025_1001501 | Ga0209025_100150120 | 226 |
| 114 | 3300025294 | Ga0209025_1054216 | Ga0209025_10542162 | 226 |
| 115 | 3300025295 | Ga0209564_1001365 | Ga0209564_10013654 | 226 |
| 116 | 3300025908 | Ga0207643_10032933 | Ga0207643_100329333 | 226 |
| 117 | 3300026078 | Ga0207702_10445467 | Ga0207702_104454672 | 226 |
| 118 | 3300026088 | Ga0207641_10842171 | Ga0207641_108421711 | 226 |
| 119 | 3300026116 | Ga0207674_10026157 | Ga0207674_100261575 | 226 |
| 120 | 3300041404 | Ga0439436_0001183 | Ga0439436_0001183_2163_2936 | 226 |
| 121 | 3300042007 | Ga0439449_0000864 | Ga0439449_0000864_955_1728 | 226 |
| 122 | 3300042010 | Ga0439452_006476 | Ga0439452_006476_456_1229 | 226 |
| 123 | 3300030522 | Ga0307512_10061292 | Ga0307512_100612923 | 227 |
| 124 | 3300031507 | Ga0307509_10003715 | Ga0307509_100037154 | 227 |
| 125 | 3300031507 | Ga0307509_10018758 | Ga0307509_100187585 | 227 |
| 126 | 3300031616 | Ga0307508_10000222 | Ga0307508_1000022223 | 227 |
| 127 | 3300031649 | Ga0307514_10134819 | Ga0307514_101348192 | 227 |
| 128 | 3300031730 | Ga0307516_10152400 | Ga0307516_101524003 | 227 |
| 129 | 3300031730 | Ga0307516_10332758 | Ga0307516_103327582 | 227 |
| 130 | 3300033180 | Ga0307510_10000779 | Ga0307510_1000077917 | 227 |
| 131 | 3300046454 | Ga0495592_0008519 | Ga0495592_0008519_6473_7246 | 227 |
| 132 | 3300050493 | nmdc:mga0k408_19481_c1 | nmdc:mga0k408_19481_c1_2330_3103 | 227 |
| 133 | 3300053136 | Ga0500559_0000020 | Ga0500559_0000020_52222_52995 | 227 |
| 134 | 3300053156 | Ga0500622_0018225 | Ga0500622_0018225_1089_1862 | 227 |
| 135 | 3300053739 | Ga0500587_000608 | Ga0500587_000608_1088_1861 | 227 |
| 136 | 3300009092 | Ga0105250_10000002 | Ga0105250_1000000288 | 228 |
| 137 | 3300025711 | Ga0207696_1000239 | Ga0207696_100023927 | 228 |
| 138 | 3300031731 | Ga0307405_10301034 | Ga0307405_103010342 | 228 |
| 139 | 3300048924 | Ga0496121_0042392 | Ga0496121_0042392_2457_3230 | 228 |
| 140 | 3300053131 | Ga0500652_063337 | Ga0500652_063337_526_1281 | 228 |
| 141 | iso_pu_bacteria | 2901300506 | 2901306479 | 228 |
| 142 | 3300005434 | Ga0070709_10497762 | Ga0070709_104977621 | 229 |
| 143 | 3300005440 | Ga0070705_100147916 | Ga0070705_1001479162 | 229 |
| 144 | 3300005546 | Ga0070696_100084812 | Ga0070696_1000848123 | 229 |
| 145 | 3300005841 | Ga0068863_100155443 | Ga0068863_1001554432 | 229 |
| 146 | 3300006175 | Ga0070712_100024529 | Ga0070712_1000245293 | 229 |
| 147 | 3300009092 | Ga0105250_10000043 | Ga0105250_10000043104 | 229 |
| 148 | 3300009553 | Ga0105249_10405712 | Ga0105249_104057122 | 229 |
| 149 | 3300017792 | Ga0163161_10040137 | Ga0163161_100401372 | 229 |
| 150 | 3300025915 | Ga0207693_10004790 | Ga0207693_1000479012 | 229 |
| 151 | 3300026118 | Ga0207675_100445806 | Ga0207675_1004458062 | 229 |
| 152 | 3300030731 | Ga0316177_1112440 | Ga0316177_11124402 | 229 |
| 153 | 3300030732 | Ga0316176_1185062 | Ga0316176_11850623 | 229 |
| 154 | 3300030735 | Ga0316178_1074219 | Ga0316178_10742192 | 229 |
| 155 | 3300030742 | Ga0316183_1066146 | Ga0316183_10661461 | 229 |
| 156 | 3300030744 | Ga0316181_1019403 | Ga0316181_10194032 | 229 |
| 157 | 3300030744 | Ga0316181_1085438 | Ga0316181_10854382 | 229 |
| 158 | 3300030745 | Ga0316182_1245277 | Ga0316182_12452772 | 229 |
| 159 | 3300030745 | Ga0316182_1429538 | Ga0316182_14295382 | 229 |
| 160 | 3300031548 | Ga0307408_100078880 | Ga0307408_1000788802 | 229 |
| 161 | 3300031911 | Ga0307412_10023449 | Ga0307412_100234493 | 229 |
| 162 | 3300046660 | Ga0495625_0000778 | Ga0495625_0000778_23883_24761 | 229 |
| 163 | 3300047470 | Ga0495681_0008367 | Ga0495681_0008367_1725_2603 | 229 |
| 164 | 3300048903 | Ga0496100_0189394 | Ga0496100_0189394_22_888 | 229 |
| 165 | 3300053153 | Ga0500616_0115331 | Ga0500616_0115331_50_775 | 229 |
| 166 | iso_pu_bacteria | 2524023210 | 2524467474 | 229 |
| 167 | iso_pu_bacteria | 2903768456 | 2903768651 | 229 |
| 168 | iso_pu_bacteria | 3004289098 | 3004291512 | 229 |
| 169 | 3300002773 | JGI25152J39213_1025471 | JGI25152J39213_10254711 | 230 |
| 170 | 3300003187 | JGI25151J46595_10001245 | JGI25151J46595_100012457 | 230 |
| 171 | 3300006186 | Ga0075369_10106944 | Ga0075369_101069442 | 230 |
| 172 | 3300025258 | Ga0209129_1000517 | Ga0209129_100051710 | 230 |
| 173 | 3300025294 | Ga0209025_1000378 | Ga0209025_100037810 | 230 |
| 174 | 3300025935 | Ga0207709_10064386 | Ga0207709_100643862 | 230 |
| 175 | 3300030733 | Ga0314311_1026270 | Ga0314311_10262703 | 230 |
| 176 | 3300047472 | Ga0495686_0002427 | Ga0495686_0002427_13835_14608 | 230 |
| 177 | 3300003578 | Ga0006562J51391_1014936 | Ga0006562J51391_10149362 | 231 |
| 178 | 3300003792 | Ga0055540_1008215 | Ga0055540_10082153 | 231 |
| 179 | 3300006353 | Ga0075370_10133975 | Ga0075370_101339752 | 231 |
| 180 | 3300025294 | Ga0209025_1002982 | Ga0209025_10029824 | 231 |
| 181 | 3300025303 | Ga0209051_1005061 | Ga0209051_10050615 | 231 |
| 182 | 3300031548 | Ga0307408_100004608 | Ga0307408_1000046085 | 231 |
| 183 | 3300031901 | Ga0307406_10000768 | Ga0307406_1000076817 | 231 |
| 184 | iso_pu_bacteria | 2906393657 | 2906397439 | 231 |
| 185 | 3300006038 | Ga0075365_10078426 | Ga0075365_100784262 | 232 |
| 186 | 3300006058 | Ga0075432_10013808 | Ga0075432_100138082 | 232 |
| 187 | 3300006948 | Ga0099826_10142827 | Ga0099826_101428272 | 232 |
| 188 | 3300025263 | Ga0209565_1000078 | Ga0209565_1000078127 | 232 |
| 189 | 3300025273 | Ga0209673_1000627 | Ga0209673_100062733 | 232 |
| 190 | 3300025291 | Ga0209675_1000413 | Ga0209675_100041317 | 232 |
| 191 | 3300025294 | Ga0209025_1010852 | Ga0209025_10108523 | 232 |
| 192 | 3300027666 | Ga0209282_1000088 | Ga0209282_100008857 | 232 |
| 193 | 3300031824 | Ga0307413_10046593 | Ga0307413_100465932 | 232 |
| 194 | 3300033180 | Ga0307510_10208180 | Ga0307510_102081801 | 232 |
| 195 | 3300041411 | Ga0439466_0065685 | Ga0439466_0065685_46_924 | 232 |
| 196 | 3300042145 | Ga0450906_005940 | Ga0450906_005940_1454_2332 | 232 |
| 197 | 3300042184 | Ga0450908_011714 | Ga0450908_011714_530_1408 | 232 |
| 198 | 3300042435 | Ga0439434_0047276 | Ga0439434_0047276_386_1264 | 232 |
| 199 | 3300050491 | nmdc:mga00v17_128474_c1 | nmdc:mga00v17_128474_c1_26_904 | 232 |
| 200 | 3300005331 | Ga0070670_100423694 | Ga0070670_1004236941 | 233 |
| 201 | 3300005338 | Ga0068868_100119948 | Ga0068868_1001199483 | 233 |
| 202 | 3300005355 | Ga0070671_100086646 | Ga0070671_1000866462 | 233 |
| 203 | 3300005355 | Ga0070671_100087289 | Ga0070671_1000872892 | 233 |
| 204 | 3300005364 | Ga0070673_100010287 | Ga0070673_1000102876 | 233 |
| 205 | 3300005459 | Ga0068867_100035090 | Ga0068867_1000350903 | 233 |
| 206 | 3300005543 | Ga0070672_100056332 | Ga0070672_1000563323 | 233 |
| 207 | 3300005841 | Ga0068863_100069165 | Ga0068863_1000691653 | 233 |
| 208 | 3300006195 | Ga0075366_10116299 | Ga0075366_101162992 | 233 |
| 209 | 3300013306 | Ga0163162_10018668 | Ga0163162_100186688 | 233 |
| 210 | 3300014326 | Ga0157380_10264250 | Ga0157380_102642502 | 233 |
| 211 | 3300025927 | Ga0207687_10148873 | Ga0207687_101488732 | 233 |
| 212 | 3300025931 | Ga0207644_10093030 | Ga0207644_100930302 | 233 |
| 213 | 3300025940 | Ga0207691_10105747 | Ga0207691_101057472 | 233 |
| 214 | 3300025942 | Ga0207689_10009937 | Ga0207689_100099372 | 233 |
| 215 | 3300026023 | Ga0207677_10046514 | Ga0207677_100465142 | 233 |
| 216 | 3300026088 | Ga0207641_10030209 | Ga0207641_100302092 | 233 |
| 217 | 3300026089 | Ga0207648_10101597 | Ga0207648_101015972 | 233 |
| 218 | 3300031616 | Ga0307508_10098088 | Ga0307508_100980882 | 233 |
| 219 | 3300031649 | Ga0307514_10010830 | Ga0307514_100108304 | 233 |
| 220 | 3300033180 | Ga0307510_10004087 | Ga0307510_1000408717 | 233 |
| 221 | 3300046455 | Ga0495603_0053146 | Ga0495603_0053146_37_810 | 233 |
| 222 | 3300046530 | Ga0495654_0012062 | Ga0495654_0012062_269_1078 | 233 |
| 223 | 3300046690 | Ga0495624_0069842 | Ga0495624_0069842_55_828 | 233 |
| 224 | 3300047321 | Ga0495676_0013984 | Ga0495676_0013984_2795_3568 | 233 |
| 225 | 3300053161 | Ga0500634_0104192 | Ga0500634_0104192_69_806 | 233 |
| 226 | 3300005616 | Ga0068852_100557285 | Ga0068852_1005572852 | 234 |
| 227 | 3300009551 | Ga0105238_10482816 | Ga0105238_104828162 | 234 |
| 228 | 3300012475 | Ga0157317_1002651 | Ga0157317_10026512 | 234 |
| 229 | 3300025935 | Ga0207709_10038438 | Ga0207709_100384382 | 234 |
| 230 | 3300005456 | Ga0070678_100406550 | Ga0070678_1004065502 | 235 |
| 231 | 3300009147 | Ga0114129_11157898 | Ga0114129_111578981 | 235 |
| 232 | 3300025291 | Ga0209675_1000759 | Ga0209675_10007592 | 235 |
| 233 | 3300025304 | Ga0209257_1009727 | Ga0209257_10097272 | 235 |
| 234 | 3300005295 | Ga0065707_10149432 | Ga0065707_101494322 | 236 |
| 235 | 3300003773 | Ga0055537_1000477 | Ga0055537_10004776 | 237 |
| 236 | 3300003784 | Ga0055534_1000275 | Ga0055534_100027516 | 237 |
| 237 | 3300003790 | Ga0055528_1001435 | Ga0055528_10014356 | 237 |
| 238 | 3300005344 | Ga0070661_100175767 | Ga0070661_1001757671 | 237 |
| 239 | 3300005366 | Ga0070659_100268957 | Ga0070659_1002689572 | 237 |
| 240 | 3300005616 | Ga0068852_100860267 | Ga0068852_1008602671 | 237 |
| 241 | 3300013296 | Ga0157374_10339524 | Ga0157374_103395242 | 237 |
| 242 | 3300025321 | Ga0207656_10046411 | Ga0207656_100464112 | 237 |
| 243 | 3300025925 | Ga0207650_10347855 | Ga0207650_103478551 | 237 |
| 244 | 3300025932 | Ga0207690_10150674 | Ga0207690_101506742 | 237 |
| 245 | 3300005289 | Ga0065704_10079879 | Ga0065704_100798794 | 238 |
| 246 | 3300006946 | Ga0079104_1000008 | Ga0079104_1000008226 | 238 |
| 247 | 3300025291 | Ga0209675_1005090 | Ga0209675_10050902 | 238 |
| 248 | 3300025711 | Ga0207696_1000509 | Ga0207696_10005098 | 238 |
| 249 | 3300025935 | Ga0207709_10000070 | Ga0207709_1000007062 | 238 |
| 250 | 3300027111 | Ga0209281_1000029 | Ga0209281_1000029171 | 238 |
| 251 | 3300028794 | Ga0307515_10263486 | Ga0307515_102634861 | 238 |
| 252 | 3300050512 | nmdc:mga0n895_8945_c1 | nmdc:mga0n895_8945_c1_7278_8030 | 238 |
| 253 | 3300053117 | Ga0500593_093443 | Ga0500593_093443_453_1226 | 238 |
| 254 | iso_pu_bacteria | 2588253730 | 2588517006 | 238 |
| 255 | iso_pu_bacteria | 2856320880 | 2856325512 | 238 |
| 256 | iso_pu_bacteria | 2869278585 | 2869285203 | 238 |
| 257 | iso_pu_bacteria | 2888337043 | 2888339690 | 238 |
| 258 | 3300005536 | Ga0070697_100091416 | Ga0070697_1000914161 | 239 |
| 259 | 3300005546 | Ga0070696_100109780 | Ga0070696_1001097802 | 239 |
| 260 | 3300006852 | Ga0075433_10005479 | Ga0075433_100054795 | 239 |
| 261 | 3300007076 | Ga0075435_100026800 | Ga0075435_1000268005 | 239 |
| 262 | 3300009147 | Ga0114129_10581372 | Ga0114129_105813722 | 239 |
| 263 | 3300009148 | Ga0105243_10019715 | Ga0105243_100197155 | 239 |
| 264 | 3300025939 | Ga0207665_10544825 | Ga0207665_105448252 | 239 |
| 265 | 3300031548 | Ga0307408_100288482 | Ga0307408_1002884822 | 239 |
| 266 | 3300031911 | Ga0307412_10147293 | Ga0307412_101472932 | 239 |
| 267 | 3300039437 | Ga0436365_1170862 | Ga0436365_1170862_493_1248 | 239 |
| 268 | 3300046539 | Ga0495621_0060229 | Ga0495621_0060229_282_1037 | 239 |
| 269 | 3300048912 | Ga0496109_0031971 | Ga0496109_0031971_3239_4009 | 239 |
| 270 | 3300050493 | nmdc:mga0k408_90586_c1 | nmdc:mga0k408_90586_c1_581_1351 | 239 |
| 271 | 3300050513 | nmdc:mga0rr50_116087_c1 | nmdc:mga0rr50_116087_c1_1102_1875 | 239 |
| 272 | 3300050515 | nmdc:mga0a205_22451_c1 | nmdc:mga0a205_22451_c1_3670_4443 | 239 |
| 273 | 3300003187 | JGI25151J46595_10000018 | JGI25151J46595_10000018113 | 240 |
| 274 | 3300003215 | JGI25153J46596_10002113 | JGI25153J46596_100021132 | 240 |
| 275 | 3300003771 | Ga0055526_1002567 | Ga0055526_10025674 | 240 |
| 276 | 3300003773 | Ga0055537_1004941 | Ga0055537_10049415 | 240 |
| 277 | 3300003775 | Ga0055524_1000048 | Ga0055524_100004817 | 240 |
| 278 | 3300003775 | Ga0055524_1012611 | Ga0055524_10126112 | 240 |
| 279 | 3300003790 | Ga0055528_1000109 | Ga0055528_100010957 | 240 |
| 280 | 3300005262 | Ga0065165_1000062 | Ga0065165_100006233 | 240 |
| 281 | 3300005328 | Ga0070676_10006949 | Ga0070676_100069493 | 240 |
| 282 | 3300005328 | Ga0070676_10027197 | Ga0070676_100271973 | 240 |
| 283 | 3300005331 | Ga0070670_100005028 | Ga0070670_1000050282 | 240 |
| 284 | 3300005331 | Ga0070670_100032734 | Ga0070670_1000327343 | 240 |
| 285 | 3300005334 | Ga0068869_100004298 | Ga0068869_1000042985 | 240 |
| 286 | 3300005334 | Ga0068869_100330923 | Ga0068869_1003309232 | 240 |
| 287 | 3300005335 | Ga0070666_10005278 | Ga0070666_100052782 | 240 |
| 288 | 3300005335 | Ga0070666_10101952 | Ga0070666_101019522 | 240 |
| 289 | 3300005336 | Ga0070680_100148322 | Ga0070680_1001483222 | 240 |
| 290 | 3300005338 | Ga0068868_100183063 | Ga0068868_1001830632 | 240 |
| 291 | 3300005339 | Ga0070660_100028918 | Ga0070660_1000289182 | 240 |
| 292 | 3300005340 | Ga0070689_100009872 | Ga0070689_1000098725 | 240 |
| 293 | 3300005344 | Ga0070661_100013467 | Ga0070661_1000134672 | 240 |
| 294 | 3300005344 | Ga0070661_100154375 | Ga0070661_1001543751 | 240 |
| 295 | 3300005347 | Ga0070668_100001341 | Ga0070668_10000134112 | 240 |
| 296 | 3300005347 | Ga0070668_100096217 | Ga0070668_1000962173 | 240 |
| 297 | 3300005347 | Ga0070668_100148675 | Ga0070668_1001486752 | 240 |
| 298 | 3300005347 | Ga0070668_100165565 | Ga0070668_1001655652 | 240 |
| 299 | 3300005353 | Ga0070669_100000668 | Ga0070669_1000006686 | 240 |
| 300 | 3300005353 | Ga0070669_100107204 | Ga0070669_1001072042 | 240 |
| 301 | 3300005353 | Ga0070669_100114943 | Ga0070669_1001149432 | 240 |
| 302 | 3300005353 | Ga0070669_100331203 | Ga0070669_1003312031 | 240 |
| 303 | 3300005354 | Ga0070675_100001258 | Ga0070675_10000125813 | 240 |
| 304 | 3300005354 | Ga0070675_100053001 | Ga0070675_1000530014 | 240 |
| 305 | 3300005354 | Ga0070675_100621279 | Ga0070675_1006212791 | 240 |
| 306 | 3300005355 | Ga0070671_100004906 | Ga0070671_1000049066 | 240 |
| 307 | 3300005355 | Ga0070671_100092362 | Ga0070671_1000923623 | 240 |
| 308 | 3300005355 | Ga0070671_100165158 | Ga0070671_1001651581 | 240 |
| 309 | 3300005355 | Ga0070671_100226100 | Ga0070671_1002261002 | 240 |
| 310 | 3300005356 | Ga0070674_100055615 | Ga0070674_1000556151 | 240 |
| 311 | 3300005356 | Ga0070674_100061525 | Ga0070674_1000615253 | 240 |
| 312 | 3300005356 | Ga0070674_100145610 | Ga0070674_1001456102 | 240 |
| 313 | 3300005356 | Ga0070674_100310482 | Ga0070674_1003104822 | 240 |
| 314 | 3300005364 | Ga0070673_100006412 | Ga0070673_1000064125 | 240 |
| 315 | 3300005364 | Ga0070673_100092350 | Ga0070673_1000923502 | 240 |
| 316 | 3300005364 | Ga0070673_100103547 | Ga0070673_1001035472 | 240 |
| 317 | 3300005366 | Ga0070659_100027510 | Ga0070659_1000275105 | 240 |
| 318 | 3300005366 | Ga0070659_100041038 | Ga0070659_1000410384 | 240 |
| 319 | 3300005367 | Ga0070667_100004919 | Ga0070667_1000049198 | 240 |
| 320 | 3300005367 | Ga0070667_100005264 | Ga0070667_1000052644 | 240 |
| 321 | 3300005367 | Ga0070667_100037796 | Ga0070667_1000377961 | 240 |
| 322 | 3300005367 | Ga0070667_100183395 | Ga0070667_1001833952 | 240 |
| 323 | 3300005367 | Ga0070667_100230329 | Ga0070667_1002303292 | 240 |
| 324 | 3300005435 | Ga0070714_100009061 | Ga0070714_1000090615 | 240 |
| 325 | 3300005440 | Ga0070705_100038190 | Ga0070705_1000381902 | 240 |
| 326 | 3300005444 | Ga0070694_100020659 | Ga0070694_1000206594 | 240 |
| 327 | 3300005444 | Ga0070694_100022197 | Ga0070694_1000221973 | 240 |
| 328 | 3300005445 | Ga0070708_100000538 | Ga0070708_10000053816 | 240 |
| 329 | 3300005455 | Ga0070663_100190759 | Ga0070663_1001907592 | 240 |
| 330 | 3300005456 | Ga0070678_100003201 | Ga0070678_1000032017 | 240 |
| 331 | 3300005456 | Ga0070678_100024961 | Ga0070678_1000249612 | 240 |
| 332 | 3300005456 | Ga0070678_100064344 | Ga0070678_1000643442 | 240 |
| 333 | 3300005457 | Ga0070662_100008353 | Ga0070662_1000083534 | 240 |
| 334 | 3300005457 | Ga0070662_100106616 | Ga0070662_1001066162 | 240 |
| 335 | 3300005458 | Ga0070681_10065412 | Ga0070681_100654122 | 240 |
| 336 | 3300005459 | Ga0068867_100000099 | Ga0068867_10000009914 | 240 |
| 337 | 3300005459 | Ga0068867_100000975 | Ga0068867_1000009758 | 240 |
| 338 | 3300005459 | Ga0068867_100003039 | Ga0068867_1000030399 | 240 |
| 339 | 3300005459 | Ga0068867_100156810 | Ga0068867_1001568101 | 240 |
| 340 | 3300005459 | Ga0068867_100256202 | Ga0068867_1002562022 | 240 |
| 341 | 3300005466 | Ga0070685_10095974 | Ga0070685_100959741 | 240 |
| 342 | 3300005468 | Ga0070707_100021241 | Ga0070707_1000212416 | 240 |
| 343 | 3300005468 | Ga0070707_100196507 | Ga0070707_1001965071 | 240 |
| 344 | 3300005471 | Ga0070698_100256914 | Ga0070698_1002569142 | 240 |
| 345 | 3300005518 | Ga0070699_100508479 | Ga0070699_1005084791 | 240 |
| 346 | 3300005535 | Ga0070684_100028122 | Ga0070684_1000281222 | 240 |
| 347 | 3300005539 | Ga0068853_100187736 | Ga0068853_1001877361 | 240 |
| 348 | 3300005543 | Ga0070672_100000287 | Ga0070672_10000028713 | 240 |
| 349 | 3300005543 | Ga0070672_100013687 | Ga0070672_1000136873 | 240 |
| 350 | 3300005543 | Ga0070672_100027710 | Ga0070672_1000277103 | 240 |
| 351 | 3300005543 | Ga0070672_100066504 | Ga0070672_1000665042 | 240 |
| 352 | 3300005544 | Ga0070686_100422066 | Ga0070686_1004220661 | 240 |
| 353 | 3300005545 | Ga0070695_100189765 | Ga0070695_1001897652 | 240 |
| 354 | 3300005546 | Ga0070696_100086242 | Ga0070696_1000862422 | 240 |
| 355 | 3300005548 | Ga0070665_100008986 | Ga0070665_1000089865 | 240 |
| 356 | 3300005548 | Ga0070665_100013659 | Ga0070665_1000136595 | 240 |
| 357 | 3300005548 | Ga0070665_100071749 | Ga0070665_1000717492 | 240 |
| 358 | 3300005548 | Ga0070665_100210217 | Ga0070665_1002102172 | 240 |
| 359 | 3300005549 | Ga0070704_100023523 | Ga0070704_1000235234 | 240 |
| 360 | 3300005563 | Ga0068855_100073653 | Ga0068855_1000736535 | 240 |
| 361 | 3300005564 | Ga0070664_100003932 | Ga0070664_10000393212 | 240 |
| 362 | 3300005564 | Ga0070664_100016107 | Ga0070664_1000161074 | 240 |
| 363 | 3300005577 | Ga0068857_100046789 | Ga0068857_1000467892 | 240 |
| 364 | 3300005578 | Ga0068854_100012109 | Ga0068854_1000121093 | 240 |
| 365 | 3300005578 | Ga0068854_100064932 | Ga0068854_1000649323 | 240 |
| 366 | 3300005614 | Ga0068856_100017956 | Ga0068856_1000179564 | 240 |
| 367 | 3300005616 | Ga0068852_100423327 | Ga0068852_1004233272 | 240 |
| 368 | 3300005617 | Ga0068859_100083674 | Ga0068859_1000836743 | 240 |
| 369 | 3300005618 | Ga0068864_100005258 | Ga0068864_1000052586 | 240 |
| 370 | 3300005718 | Ga0068866_10025436 | Ga0068866_100254362 | 240 |
| 371 | 3300005719 | Ga0068861_100081818 | Ga0068861_1000818183 | 240 |
| 372 | 3300005834 | Ga0068851_10084996 | Ga0068851_100849961 | 240 |
| 373 | 3300005834 | Ga0068851_10199993 | Ga0068851_101999932 | 240 |
| 374 | 3300005840 | Ga0068870_10062228 | Ga0068870_100622281 | 240 |
| 375 | 3300005841 | Ga0068863_100001368 | Ga0068863_10000136814 | 240 |
| 376 | 3300005841 | Ga0068863_100067898 | Ga0068863_1000678982 | 240 |
| 377 | 3300005841 | Ga0068863_100114297 | Ga0068863_1001142972 | 240 |
| 378 | 3300005841 | Ga0068863_100224200 | Ga0068863_1002242002 | 240 |
| 379 | 3300005841 | Ga0068863_100408123 | Ga0068863_1004081232 | 240 |
| 380 | 3300005842 | Ga0068858_100006176 | Ga0068858_1000061764 | 240 |
| 381 | 3300005842 | Ga0068858_100016320 | Ga0068858_1000163208 | 240 |
| 382 | 3300005842 | Ga0068858_100100231 | Ga0068858_1001002312 | 240 |
| 383 | 3300005842 | Ga0068858_100111857 | Ga0068858_1001118572 | 240 |
| 384 | 3300005843 | Ga0068860_100004808 | Ga0068860_1000048086 | 240 |
| 385 | 3300005843 | Ga0068860_100016563 | Ga0068860_1000165637 | 240 |
| 386 | 3300005843 | Ga0068860_100029914 | Ga0068860_1000299146 | 240 |
| 387 | 3300005843 | Ga0068860_100050139 | Ga0068860_1000501392 | 240 |
| 388 | 3300005843 | Ga0068860_100091904 | Ga0068860_1000919043 | 240 |
| 389 | 3300005844 | Ga0068862_100050180 | Ga0068862_1000501803 | 240 |
| 390 | 3300005844 | Ga0068862_100118197 | Ga0068862_1001181973 | 240 |
| 391 | 3300005844 | Ga0068862_100219208 | Ga0068862_1002192082 | 240 |
| 392 | 3300006038 | Ga0075365_10001436 | Ga0075365_100014368 | 240 |
| 393 | 3300006042 | Ga0075368_10000984 | Ga0075368_100009845 | 240 |
| 394 | 3300006048 | Ga0075363_100230677 | Ga0075363_1002306772 | 240 |
| 395 | 3300006051 | Ga0075364_10251656 | Ga0075364_102516562 | 240 |
| 396 | 3300006177 | Ga0075362_10002210 | Ga0075362_100022107 | 240 |
| 397 | 3300006195 | Ga0075366_10018446 | Ga0075366_100184464 | 240 |
| 398 | 3300006195 | Ga0075366_10019325 | Ga0075366_100193254 | 240 |
| 399 | 3300006195 | Ga0075366_10083898 | Ga0075366_100838982 | 240 |
| 400 | 3300006195 | Ga0075366_10120596 | Ga0075366_101205962 | 240 |
| 401 | 3300006195 | Ga0075366_10252156 | Ga0075366_102521562 | 240 |
| 402 | 3300006237 | Ga0097621_100008005 | Ga0097621_1000080054 | 240 |
| 403 | 3300006237 | Ga0097621_100066231 | Ga0097621_1000662313 | 240 |
| 404 | 3300006353 | Ga0075370_10001026 | Ga0075370_100010266 | 240 |
| 405 | 3300006353 | Ga0075370_10012303 | Ga0075370_100123032 | 240 |
| 406 | 3300006353 | Ga0075370_10013080 | Ga0075370_100130802 | 240 |
| 407 | 3300006358 | Ga0068871_100000834 | Ga0068871_1000008344 | 240 |
| 408 | 3300006358 | Ga0068871_100315663 | Ga0068871_1003156632 | 240 |
| 409 | 3300006844 | Ga0075428_100157357 | Ga0075428_1001573571 | 240 |
| 410 | 3300006846 | Ga0075430_100129355 | Ga0075430_1001293551 | 240 |
| 411 | 3300006847 | Ga0075431_100009702 | Ga0075431_10000970210 | 240 |
| 412 | 3300006871 | Ga0075434_100010081 | Ga0075434_1000100812 | 240 |
| 413 | 3300006881 | Ga0068865_100003861 | Ga0068865_1000038614 | 240 |
| 414 | 3300006881 | Ga0068865_100095099 | Ga0068865_1000950992 | 240 |
| 415 | 3300006931 | Ga0097620_100083685 | Ga0097620_1000836853 | 240 |
| 416 | 3300006931 | Ga0097620_100206606 | Ga0097620_1002066062 | 240 |
| 417 | 3300006948 | Ga0099826_10000676 | Ga0099826_100006764 | 240 |
| 418 | 3300006948 | Ga0099826_10013619 | Ga0099826_100136195 | 240 |
| 419 | 3300009036 | Ga0105244_10120609 | Ga0105244_101206091 | 240 |
| 420 | 3300009093 | Ga0105240_10002428 | Ga0105240_1000242828 | 240 |
| 421 | 3300009093 | Ga0105240_10033941 | Ga0105240_100339417 | 240 |
| 422 | 3300009094 | Ga0111539_10568708 | Ga0111539_105687081 | 240 |
| 423 | 3300009101 | Ga0105247_10055080 | Ga0105247_100550802 | 240 |
| 424 | 3300009147 | Ga0114129_10101400 | Ga0114129_101014003 | 240 |
| 425 | 3300009148 | Ga0105243_10001109 | Ga0105243_100011099 | 240 |
| 426 | 3300009174 | Ga0105241_10089319 | Ga0105241_100893192 | 240 |
| 427 | 3300009174 | Ga0105241_10218219 | Ga0105241_102182192 | 240 |
| 428 | 3300009177 | Ga0105248_10017795 | Ga0105248_100177956 | 240 |
| 429 | 3300009177 | Ga0105248_10056706 | Ga0105248_100567062 | 240 |
| 430 | 3300009177 | Ga0105248_10396226 | Ga0105248_103962262 | 240 |
| 431 | 3300009545 | Ga0105237_10006305 | Ga0105237_1000630512 | 240 |
| 432 | 3300009545 | Ga0105237_10108996 | Ga0105237_101089962 | 240 |
| 433 | 3300009545 | Ga0105237_10123598 | Ga0105237_101235983 | 240 |
| 434 | 3300009545 | Ga0105237_10341609 | Ga0105237_103416092 | 240 |
| 435 | 3300009551 | Ga0105238_10001044 | Ga0105238_1000104419 | 240 |
| 436 | 3300009553 | Ga0105249_10433299 | Ga0105249_104332992 | 240 |
| 437 | 3300009553 | Ga0105249_10701946 | Ga0105249_107019461 | 240 |
| 438 | 3300010375 | Ga0105239_10168139 | Ga0105239_101681392 | 240 |
| 439 | 3300010375 | Ga0105239_10429329 | Ga0105239_104293292 | 240 |
| 440 | 3300011119 | Ga0105246_10025728 | Ga0105246_100257281 | 240 |
| 441 | 3300013100 | Ga0157373_10001146 | Ga0157373_100011467 | 240 |
| 442 | 3300013100 | Ga0157373_10009126 | Ga0157373_1000912610 | 240 |
| 443 | 3300013100 | Ga0157373_10013023 | Ga0157373_100130235 | 240 |
| 444 | 3300013102 | Ga0157371_10000004 | Ga0157371_1000000496 | 240 |
| 445 | 3300013102 | Ga0157371_10004156 | Ga0157371_100041569 | 240 |
| 446 | 3300013102 | Ga0157371_10022060 | Ga0157371_100220602 | 240 |
| 447 | 3300013102 | Ga0157371_10142941 | Ga0157371_101429412 | 240 |
| 448 | 3300013104 | Ga0157370_10005765 | Ga0157370_1000576514 | 240 |
| 449 | 3300013104 | Ga0157370_10015688 | Ga0157370_100156883 | 240 |
| 450 | 3300013105 | Ga0157369_10193777 | Ga0157369_101937772 | 240 |
| 451 | 3300013105 | Ga0157369_10252200 | Ga0157369_102522002 | 240 |
| 452 | 3300013296 | Ga0157374_10003813 | Ga0157374_100038139 | 240 |
| 453 | 3300013297 | Ga0157378_10007092 | Ga0157378_1000709212 | 240 |
| 454 | 3300013297 | Ga0157378_10173463 | Ga0157378_101734631 | 240 |
| 455 | 3300013297 | Ga0157378_10296299 | Ga0157378_102962992 | 240 |
| 456 | 3300013306 | Ga0163162_10003831 | Ga0163162_100038316 | 240 |
| 457 | 3300013306 | Ga0163162_10006954 | Ga0163162_100069544 | 240 |
| 458 | 3300013307 | Ga0157372_10002798 | Ga0157372_1000279820 | 240 |
| 459 | 3300013308 | Ga0157375_10003753 | Ga0157375_1000375311 | 240 |
| 460 | 3300013308 | Ga0157375_10135518 | Ga0157375_101355183 | 240 |
| 461 | 3300013308 | Ga0157375_10269029 | Ga0157375_102690292 | 240 |
| 462 | 3300014325 | Ga0163163_10014074 | Ga0163163_100140743 | 240 |
| 463 | 3300014497 | Ga0182008_10055566 | Ga0182008_100555662 | 240 |
| 464 | 3300014745 | Ga0157377_10000010 | Ga0157377_10000010255 | 240 |
| 465 | 3300014968 | Ga0157379_10000858 | Ga0157379_1000085825 | 240 |
| 466 | 3300014968 | Ga0157379_10040595 | Ga0157379_100405952 | 240 |
| 467 | 3300014968 | Ga0157379_10155337 | Ga0157379_101553372 | 240 |
| 468 | 3300014969 | Ga0157376_10000986 | Ga0157376_1000098610 | 240 |
| 469 | 3300014969 | Ga0157376_10766761 | Ga0157376_107667612 | 240 |
| 470 | 3300017792 | Ga0163161_10050915 | Ga0163161_100509152 | 240 |
| 471 | 3300017792 | Ga0163161_10130220 | Ga0163161_101302202 | 240 |
| 472 | 3300025263 | Ga0209565_1000938 | Ga0209565_10009386 | 240 |
| 473 | 3300025263 | Ga0209565_1008820 | Ga0209565_10088203 | 240 |
| 474 | 3300025273 | Ga0209673_1000005 | Ga0209673_1000005475 | 240 |
| 475 | 3300025284 | Ga0209130_1000235 | Ga0209130_100023566 | 240 |
| 476 | 3300025291 | Ga0209675_1000239 | Ga0209675_100023945 | 240 |
| 477 | 3300025292 | Ga0209676_1010033 | Ga0209676_10100334 | 240 |
| 478 | 3300025292 | Ga0209676_1027731 | Ga0209676_10277312 | 240 |
| 479 | 3300025294 | Ga0209025_1000010 | Ga0209025_1000010121 | 240 |
| 480 | 3300025294 | Ga0209025_1004003 | Ga0209025_100400311 | 240 |
| 481 | 3300025294 | Ga0209025_1004618 | Ga0209025_10046188 | 240 |
| 482 | 3300025294 | Ga0209025_1060801 | Ga0209025_10608012 | 240 |
| 483 | 3300025295 | Ga0209564_1000034 | Ga0209564_1000034288 | 240 |
| 484 | 3300025297 | Ga0209758_1000220 | Ga0209758_100022045 | 240 |
| 485 | 3300025299 | Ga0209256_1000026 | Ga0209256_1000026276 | 240 |
| 486 | 3300025299 | Ga0209256_1000182 | Ga0209256_100018273 | 240 |
| 487 | 3300025299 | Ga0209256_1000549 | Ga0209256_100054914 | 240 |
| 488 | 3300025302 | Ga0207426_1030274 | Ga0207426_10302742 | 240 |
| 489 | 3300025304 | Ga0209257_1013240 | Ga0209257_10132404 | 240 |
| 490 | 3300025304 | Ga0209257_1028939 | Ga0209257_10289392 | 240 |
| 491 | 3300025315 | Ga0207697_10003403 | Ga0207697_100034038 | 240 |
| 492 | 3300025315 | Ga0207697_10128192 | Ga0207697_101281921 | 240 |
| 493 | 3300025899 | Ga0207642_10071734 | Ga0207642_100717342 | 240 |
| 494 | 3300025900 | Ga0207710_10023946 | Ga0207710_100239462 | 240 |
| 495 | 3300025903 | Ga0207680_10043785 | Ga0207680_100437852 | 240 |
| 496 | 3300025907 | Ga0207645_10000157 | Ga0207645_1000015714 | 240 |
| 497 | 3300025907 | Ga0207645_10029420 | Ga0207645_100294203 | 240 |
| 498 | 3300025907 | Ga0207645_10120119 | Ga0207645_101201192 | 240 |
| 499 | 3300025908 | Ga0207643_10004227 | Ga0207643_100042278 | 240 |
| 500 | 3300025910 | Ga0207684_10023462 | Ga0207684_100234623 | 240 |
| 501 | 3300025910 | Ga0207684_10106152 | Ga0207684_101061522 | 240 |
| 502 | 3300025911 | Ga0207654_10025190 | Ga0207654_100251904 | 240 |
| 503 | 3300025911 | Ga0207654_10150673 | Ga0207654_101506732 | 240 |
| 504 | 3300025912 | Ga0207707_10114127 | Ga0207707_101141273 | 240 |
| 505 | 3300025912 | Ga0207707_10224069 | Ga0207707_102240692 | 240 |
| 506 | 3300025913 | Ga0207695_10021259 | Ga0207695_100212594 | 240 |
| 507 | 3300025913 | Ga0207695_10187093 | Ga0207695_101870933 | 240 |
| 508 | 3300025914 | Ga0207671_10026895 | Ga0207671_100268952 | 240 |
| 509 | 3300025914 | Ga0207671_10255177 | Ga0207671_102551772 | 240 |
| 510 | 3300025917 | Ga0207660_10199803 | Ga0207660_101998031 | 240 |
| 511 | 3300025919 | Ga0207657_10003501 | Ga0207657_1000350112 | 240 |
| 512 | 3300025920 | Ga0207649_10201701 | Ga0207649_102017012 | 240 |
| 513 | 3300025921 | Ga0207652_10052455 | Ga0207652_100524554 | 240 |
| 514 | 3300025922 | Ga0207646_10030223 | Ga0207646_100302234 | 240 |
| 515 | 3300025923 | Ga0207681_10004068 | Ga0207681_100040682 | 240 |
| 516 | 3300025923 | Ga0207681_10086435 | Ga0207681_100864352 | 240 |
| 517 | 3300025923 | Ga0207681_10120799 | Ga0207681_101207992 | 240 |
| 518 | 3300025924 | Ga0207694_10166408 | Ga0207694_101664081 | 240 |
| 519 | 3300025924 | Ga0207694_10222900 | Ga0207694_102229002 | 240 |
| 520 | 3300025925 | Ga0207650_10080620 | Ga0207650_100806203 | 240 |
| 521 | 3300025925 | Ga0207650_10082918 | Ga0207650_100829183 | 240 |
| 522 | 3300025925 | Ga0207650_10100420 | Ga0207650_101004202 | 240 |
| 523 | 3300025926 | Ga0207659_10002948 | Ga0207659_100029482 | 240 |
| 524 | 3300025931 | Ga0207644_10011516 | Ga0207644_100115168 | 240 |
| 525 | 3300025931 | Ga0207644_10019823 | Ga0207644_100198234 | 240 |
| 526 | 3300025931 | Ga0207644_10238755 | Ga0207644_102387552 | 240 |
| 527 | 3300025931 | Ga0207644_10258482 | Ga0207644_102584822 | 240 |
| 528 | 3300025932 | Ga0207690_10026090 | Ga0207690_100260902 | 240 |
| 529 | 3300025933 | Ga0207706_10002095 | Ga0207706_100020956 | 240 |
| 530 | 3300025933 | Ga0207706_10137720 | Ga0207706_101377202 | 240 |
| 531 | 3300025935 | Ga0207709_10000627 | Ga0207709_1000062710 | 240 |
| 532 | 3300025935 | Ga0207709_10011114 | Ga0207709_100111143 | 240 |
| 533 | 3300025937 | Ga0207669_10022300 | Ga0207669_100223002 | 240 |
| 534 | 3300025937 | Ga0207669_10053034 | Ga0207669_100530343 | 240 |
| 535 | 3300025938 | Ga0207704_10253566 | Ga0207704_102535662 | 240 |
| 536 | 3300025940 | Ga0207691_10000249 | Ga0207691_1000024937 | 240 |
| 537 | 3300025940 | Ga0207691_10139540 | Ga0207691_101395402 | 240 |
| 538 | 3300025940 | Ga0207691_10205582 | Ga0207691_102055822 | 240 |
| 539 | 3300025940 | Ga0207691_10400820 | Ga0207691_104008202 | 240 |
| 540 | 3300025942 | Ga0207689_10003129 | Ga0207689_1000312915 | 240 |
| 541 | 3300025942 | Ga0207689_10009790 | Ga0207689_100097906 | 240 |
| 542 | 3300025942 | Ga0207689_10404320 | Ga0207689_104043202 | 240 |
| 543 | 3300025945 | Ga0207679_10010256 | Ga0207679_100102565 | 240 |
| 544 | 3300025949 | Ga0207667_10061918 | Ga0207667_100619184 | 240 |
| 545 | 3300025949 | Ga0207667_10230963 | Ga0207667_102309632 | 240 |
| 546 | 3300025949 | Ga0207667_10495141 | Ga0207667_104951412 | 240 |
| 547 | 3300025960 | Ga0207651_10014375 | Ga0207651_100143752 | 240 |
| 548 | 3300025960 | Ga0207651_10074685 | Ga0207651_100746852 | 240 |
| 549 | 3300025960 | Ga0207651_10256576 | Ga0207651_102565762 | 240 |
| 550 | 3300025960 | Ga0207651_10273028 | Ga0207651_102730282 | 240 |
| 551 | 3300025960 | Ga0207651_10629915 | Ga0207651_106299151 | 240 |
| 552 | 3300025972 | Ga0207668_10013050 | Ga0207668_100130503 | 240 |
| 553 | 3300025972 | Ga0207668_10099520 | Ga0207668_100995201 | 240 |
| 554 | 3300025972 | Ga0207668_10110796 | Ga0207668_101107962 | 240 |
| 555 | 3300025972 | Ga0207668_10173237 | Ga0207668_101732372 | 240 |
| 556 | 3300025972 | Ga0207668_10466643 | Ga0207668_104666432 | 240 |
| 557 | 3300025981 | Ga0207640_10005591 | Ga0207640_100055914 | 240 |
| 558 | 3300025981 | Ga0207640_10019565 | Ga0207640_100195654 | 240 |
| 559 | 3300025986 | Ga0207658_10001272 | Ga0207658_1000127223 | 240 |
| 560 | 3300025986 | Ga0207658_10040512 | Ga0207658_100405122 | 240 |
| 561 | 3300025986 | Ga0207658_10181466 | Ga0207658_101814662 | 240 |
| 562 | 3300025986 | Ga0207658_10381568 | Ga0207658_103815681 | 240 |
| 563 | 3300025986 | Ga0207658_10453660 | Ga0207658_104536602 | 240 |
| 564 | 3300026023 | Ga0207677_10398099 | Ga0207677_103980991 | 240 |
| 565 | 3300026035 | Ga0207703_10002253 | Ga0207703_1000225310 | 240 |
| 566 | 3300026035 | Ga0207703_10023868 | Ga0207703_100238683 | 240 |
| 567 | 3300026035 | Ga0207703_10113812 | Ga0207703_101138122 | 240 |
| 568 | 3300026035 | Ga0207703_10166256 | Ga0207703_101662561 | 240 |
| 569 | 3300026041 | Ga0207639_10068258 | Ga0207639_100682581 | 240 |
| 570 | 3300026041 | Ga0207639_10320494 | Ga0207639_103204941 | 240 |
| 571 | 3300026067 | Ga0207678_10012240 | Ga0207678_100122404 | 240 |
| 572 | 3300026067 | Ga0207678_10041936 | Ga0207678_100419364 | 240 |
| 573 | 3300026078 | Ga0207702_10019967 | Ga0207702_100199674 | 240 |
| 574 | 3300026088 | Ga0207641_10000374 | Ga0207641_1000037438 | 240 |
| 575 | 3300026088 | Ga0207641_10135882 | Ga0207641_101358823 | 240 |
| 576 | 3300026088 | Ga0207641_10144290 | Ga0207641_101442902 | 240 |
| 577 | 3300026088 | Ga0207641_10159602 | Ga0207641_101596022 | 240 |
| 578 | 3300026089 | Ga0207648_10000002 | Ga0207648_10000002192 | 240 |
| 579 | 3300026089 | Ga0207648_10000523 | Ga0207648_100005238 | 240 |
| 580 | 3300026089 | Ga0207648_10001083 | Ga0207648_1000108326 | 240 |
| 581 | 3300026089 | Ga0207648_10013639 | Ga0207648_100136393 | 240 |
| 582 | 3300026089 | Ga0207648_10021215 | Ga0207648_100212152 | 240 |
| 583 | 3300026089 | Ga0207648_10213060 | Ga0207648_102130602 | 240 |
| 584 | 3300026089 | Ga0207648_10292465 | Ga0207648_102924652 | 240 |
| 585 | 3300026095 | Ga0207676_10008789 | Ga0207676_100087893 | 240 |
| 586 | 3300026116 | Ga0207674_10000118 | Ga0207674_1000011879 | 240 |
| 587 | 3300026116 | Ga0207674_10063541 | Ga0207674_100635412 | 240 |
| 588 | 3300026118 | Ga0207675_100066282 | Ga0207675_1000662823 | 240 |
| 589 | 3300026118 | Ga0207675_100075232 | Ga0207675_1000752323 | 240 |
| 590 | 3300026118 | Ga0207675_100108631 | Ga0207675_1001086313 | 240 |
| 591 | 3300026121 | Ga0207683_10000476 | Ga0207683_1000047612 | 240 |
| 592 | 3300026121 | Ga0207683_10040510 | Ga0207683_100405104 | 240 |
| 593 | 3300026121 | Ga0207683_10293128 | Ga0207683_102931282 | 240 |
| 594 | 3300026142 | Ga0207698_10478534 | Ga0207698_104785342 | 240 |
| 595 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009900 | 240 |
| 596 | 3300027312 | Ga0209371_1007734 | Ga0209371_10077343 | 240 |
| 597 | 3300027312 | Ga0209371_1036684 | Ga0209371_10366842 | 240 |
| 598 | 3300027666 | Ga0209282_1006186 | Ga0209282_10061866 | 240 |
| 599 | 3300027666 | Ga0209282_1043586 | Ga0209282_10435862 | 240 |
| 600 | 3300028379 | Ga0268266_10004526 | Ga0268266_1000452610 | 240 |
| 601 | 3300028379 | Ga0268266_10023108 | Ga0268266_100231087 | 240 |
| 602 | 3300028379 | Ga0268266_10050840 | Ga0268266_100508402 | 240 |
| 603 | 3300028379 | Ga0268266_10084658 | Ga0268266_100846583 | 240 |
| 604 | 3300028380 | Ga0268265_10004995 | Ga0268265_100049952 | 240 |
| 605 | 3300028380 | Ga0268265_10018436 | Ga0268265_100184363 | 240 |
| 606 | 3300028380 | Ga0268265_10084594 | Ga0268265_100845943 | 240 |
| 607 | 3300028380 | Ga0268265_10104426 | Ga0268265_101044262 | 240 |
| 608 | 3300028380 | Ga0268265_10284785 | Ga0268265_102847852 | 240 |
| 609 | 3300028381 | Ga0268264_10008187 | Ga0268264_100081873 | 240 |
| 610 | 3300028381 | Ga0268264_10029798 | Ga0268264_100297981 | 240 |
| 611 | 3300028381 | Ga0268264_10034214 | Ga0268264_100342143 | 240 |
| 612 | 3300028556 | Ga0265337_1003809 | Ga0265337_10038094 | 240 |
| 613 | 3300028558 | Ga0265326_10002334 | Ga0265326_100023346 | 240 |
| 614 | 3300028563 | Ga0265319_1005177 | Ga0265319_10051774 | 240 |
| 615 | 3300028573 | Ga0265334_10001347 | Ga0265334_100013474 | 240 |
| 616 | 3300028577 | Ga0265318_10005245 | Ga0265318_100052454 | 240 |
| 617 | 3300028653 | Ga0265323_10000539 | Ga0265323_1000053911 | 240 |
| 618 | 3300028654 | Ga0265322_10002074 | Ga0265322_100020747 | 240 |
| 619 | 3300028666 | Ga0265336_10000483 | Ga0265336_100004839 | 240 |
| 620 | 3300028786 | Ga0307517_10070639 | Ga0307517_100706392 | 240 |
| 621 | 3300028794 | Ga0307515_10000049 | Ga0307515_10000049138 | 240 |
| 622 | 3300028794 | Ga0307515_10000066 | Ga0307515_10000066174 | 240 |
| 623 | 3300028794 | Ga0307515_10027455 | Ga0307515_100274557 | 240 |
| 624 | 3300028794 | Ga0307515_10040292 | Ga0307515_100402928 | 240 |
| 625 | 3300028800 | Ga0265338_10000081 | Ga0265338_1000008177 | 240 |
| 626 | 3300029957 | Ga0265324_10002127 | Ga0265324_100021274 | 240 |
| 627 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010899 | 240 |
| 628 | 3300030500 | Ga0268256_1007407 | Ga0268256_10074073 | 240 |
| 629 | 3300030500 | Ga0268256_1013945 | Ga0268256_10139451 | 240 |
| 630 | 3300030522 | Ga0307512_10062849 | Ga0307512_100628493 | 240 |
| 631 | 3300030744 | Ga0316181_1022414 | Ga0316181_10224142 | 240 |
| 632 | 3300031456 | Ga0307513_10000012 | Ga0307513_10000012181 | 240 |
| 633 | 3300031456 | Ga0307513_10030448 | Ga0307513_100304482 | 240 |
| 634 | 3300031456 | Ga0307513_10221759 | Ga0307513_102217592 | 240 |
| 635 | 3300031456 | Ga0307513_10339883 | Ga0307513_103398832 | 240 |
| 636 | 3300031507 | Ga0307509_10004792 | Ga0307509_100047927 | 240 |
| 637 | 3300031507 | Ga0307509_10114365 | Ga0307509_101143652 | 240 |
| 638 | 3300031507 | Ga0307509_10121145 | Ga0307509_101211452 | 240 |
| 639 | 3300031548 | Ga0307408_100171434 | Ga0307408_1001714342 | 240 |
| 640 | 3300031616 | Ga0307508_10003666 | Ga0307508_100036665 | 240 |
| 641 | 3300031649 | Ga0307514_10019111 | Ga0307514_100191115 | 240 |
| 642 | 3300031730 | Ga0307516_10079017 | Ga0307516_100790172 | 240 |
| 643 | 3300031730 | Ga0307516_10180443 | Ga0307516_101804432 | 240 |
| 644 | 3300031911 | Ga0307412_10001927 | Ga0307412_100019279 | 240 |
| 645 | 3300032002 | Ga0307416_100258707 | Ga0307416_1002587072 | 240 |
| 646 | 3300032002 | Ga0307416_100933182 | Ga0307416_1009331821 | 240 |
| 647 | 3300034816 | Ga0373930_0010086 | Ga0373930_0010086_237_1010 | 240 |
| 648 | 3300035691 | Ga0373931_0009521 | Ga0373931_0009521_855_1628 | 240 |
| 649 | 3300035695 | Ga0373927_0156135 | Ga0373927_0156135_609_1382 | 240 |
| 650 | 3300036401 | Ga0373937_0092465 | Ga0373937_0092465_77_850 | 240 |
| 651 | 3300036401 | Ga0373937_0548175 | Ga0373937_0548175_315_1088 | 240 |
| 652 | 3300037068 | Ga0373925_0112886 | Ga0373925_0112886_201_974 | 240 |
| 653 | 3300037312 | Ga0395899_0007556 | Ga0395899_0007556_4149_4934 | 240 |
| 654 | 3300037418 | Ga0395900_0003906 | Ga0395900_0003906_10435_11220 | 240 |
| 655 | 3300037418 | Ga0395900_0387907 | Ga0395900_0387907_324_1100 | 240 |
| 656 | 3300037466 | Ga0395898_0013566 | Ga0395898_0013566_7558_8343 | 240 |
| 657 | 3300037471 | Ga0395905_0004967 | Ga0395905_0004967_1172_1957 | 240 |
| 658 | 3300037471 | Ga0395905_0076516 | Ga0395905_0076516_1118_1891 | 240 |
| 659 | 3300037471 | Ga0395905_0133441 | Ga0395905_0133441_1537_2313 | 240 |
| 660 | 3300037471 | Ga0395905_0155861 | Ga0395905_0155861_1362_2138 | 240 |
| 661 | 3300037471 | Ga0395905_0419516 | Ga0395905_0419516_97_876 | 240 |
| 662 | 3300038443 | Ga0395901_0098596 | Ga0395901_0098596_1893_2669 | 240 |
| 663 | 3300041404 | Ga0439436_0043738 | Ga0439436_0043738_373_1152 | 240 |
| 664 | 3300041413 | Ga0439465_0054294 | Ga0439465_0054294_290_1069 | 240 |
| 665 | 3300041496 | Ga0451839_0812530 | Ga0451839_0812530_27_800 | 240 |
| 666 | 3300042007 | Ga0439449_0000862 | Ga0439449_0000862_7337_8113 | 240 |
| 667 | 3300042007 | Ga0439449_0036707 | Ga0439449_0036707_928_1701 | 240 |
| 668 | 3300042435 | Ga0439434_0078644 | Ga0439434_0078644_96_875 | 240 |
| 669 | 3300042876 | Ga0451577_0076658 | Ga0451577_0076658_1069_1842 | 240 |
| 670 | 3300042876 | Ga0451577_0110605 | Ga0451577_0110605_810_1586 | 240 |
| 671 | 3300042876 | Ga0451577_0183167 | Ga0451577_0183167_700_1473 | 240 |
| 672 | 3300044673 | Ga0453683_0202975 | Ga0453683_0202975_417_1190 | 240 |
| 673 | 3300045051 | Ga0451576_0529392 | Ga0451576_0529392_284_1072 | 240 |
| 674 | 3300046460 | Ga0495638_0271350 | Ga0495638_0271350_22_795 | 240 |
| 675 | 3300046472 | Ga0495580_0178313 | Ga0495580_0178313_96_869 | 240 |
| 676 | 3300046507 | Ga0495606_0065195 | Ga0495606_0065195_636_1409 | 240 |
| 677 | 3300046664 | Ga0495659_0021836 | Ga0495659_0021836_684_1457 | 240 |
| 678 | 3300046674 | Ga0495588_0102778 | Ga0495588_0102778_607_1380 | 240 |
| 679 | 3300046683 | Ga0495658_0119510 | Ga0495658_0119510_274_1047 | 240 |
| 680 | 3300046692 | Ga0495671_0004533 | Ga0495671_0004533_1289_2062 | 240 |
| 681 | 3300047470 | Ga0495681_0003812 | Ga0495681_0003812_7861_8634 | 240 |
| 682 | 3300048903 | Ga0496100_0130749 | Ga0496100_0130749_276_1049 | 240 |
| 683 | 3300048907 | Ga0496104_0491641 | Ga0496104_0491641_11_784 | 240 |
| 684 | 3300048909 | Ga0496106_0036886 | Ga0496106_0036886_336_1109 | 240 |
| 685 | 3300048909 | Ga0496106_0230870 | Ga0496106_0230870_639_1412 | 240 |
| 686 | 3300048911 | Ga0496108_0505781 | Ga0496108_0505781_204_977 | 240 |
| 687 | 3300048915 | Ga0496112_0012289 | Ga0496112_0012289_3008_3781 | 240 |
| 688 | 3300048915 | Ga0496112_0078957 | Ga0496112_0078957_206_982 | 240 |
| 689 | 3300048916 | Ga0496113_0143138 | Ga0496113_0143138_372_1145 | 240 |
| 690 | 3300048916 | Ga0496113_0292602 | Ga0496113_0292602_160_933 | 240 |
| 691 | 3300048919 | Ga0496116_0000395 | Ga0496116_0000395_52487_53278 | 240 |
| 692 | 3300048919 | Ga0496116_0024710 | Ga0496116_0024710_1200_1973 | 240 |
| 693 | 3300048919 | Ga0496116_0050323 | Ga0496116_0050323_815_1588 | 240 |
| 694 | 3300048920 | Ga0496117_0000002 | Ga0496117_0000002_2382527_2383300 | 240 |
| 695 | 3300048920 | Ga0496117_0036934 | Ga0496117_0036934_2278_3069 | 240 |
| 696 | 3300048921 | Ga0496118_0001167 | Ga0496118_0001167_2809_3582 | 240 |
| 697 | 3300048921 | Ga0496118_0024886 | Ga0496118_0024886_3988_4761 | 240 |
| 698 | 3300048922 | Ga0496119_0041241 | Ga0496119_0041241_1659_2432 | 240 |
| 699 | 3300048923 | Ga0496120_0000498 | Ga0496120_0000498_40985_41758 | 240 |
| 700 | 3300048923 | Ga0496120_0053650 | Ga0496120_0053650_1442_2215 | 240 |
| 701 | 3300048924 | Ga0496121_0223609 | Ga0496121_0223609_459_1235 | 240 |
| 702 | 3300048924 | Ga0496121_0229354 | Ga0496121_0229354_242_1015 | 240 |
| 703 | 3300048925 | Ga0496122_0000001 | Ga0496122_0000001_1726535_1727308 | 240 |
| 704 | 3300048925 | Ga0496122_0077531 | Ga0496122_0077531_383_1156 | 240 |
| 705 | 3300048925 | Ga0496122_0083412 | Ga0496122_0083412_768_1559 | 240 |
| 706 | 3300048926 | Ga0496123_0000001 | Ga0496123_0000001_1730266_1731039 | 240 |
| 707 | 3300048926 | Ga0496123_0039243 | Ga0496123_0039243_2288_3061 | 240 |
| 708 | 3300048926 | Ga0496123_0138635 | Ga0496123_0138635_425_1216 | 240 |
| 709 | 3300048926 | Ga0496123_0188335 | Ga0496123_0188335_105_881 | 240 |
| 710 | 3300048927 | Ga0496124_0005665 | Ga0496124_0005665_9351_10124 | 240 |
| 711 | 3300048927 | Ga0496124_0242842 | Ga0496124_0242842_137_910 | 240 |
| 712 | 3300048928 | Ga0496125_0007258 | Ga0496125_0007258_1375_2148 | 240 |
| 713 | 3300048929 | Ga0496126_0001831 | Ga0496126_0001831_10058_10831 | 240 |
| 714 | 3300048929 | Ga0496126_0030554 | Ga0496126_0030554_75_851 | 240 |
| 715 | 3300048929 | Ga0496126_0168533 | Ga0496126_0168533_278_1051 | 240 |
| 716 | 3300048929 | Ga0496126_0227331 | Ga0496126_0227331_202_975 | 240 |
| 717 | 3300049521 | Ga0501298_002724 | Ga0501298_002724_1717_2490 | 240 |
| 718 | 3300049570 | Ga0501033_0482073 | Ga0501033_0482073_62_835 | 240 |
| 719 | 3300049573 | Ga0501037_0044179 | Ga0501037_0044179_628_1401 | 240 |
| 720 | 3300049593 | Ga0501077_0013625 | Ga0501077_0013625_469_1245 | 240 |
| 721 | 3300049741 | Ga0501079_0204136 | Ga0501079_0204136_448_1224 | 240 |
| 722 | 3300049822 | Ga0501035_0402716 | Ga0501035_0402716_83_856 | 240 |
| 723 | 3300050491 | nmdc:mga00v17_1172_c1 | nmdc:mga00v17_1172_c1_3077_3850 | 240 |
| 724 | 3300050492 | nmdc:mga0yw44_186_c1 | nmdc:mga0yw44_186_c1_4613_5386 | 240 |
| 725 | 3300050493 | nmdc:mga0k408_119452_c1 | nmdc:mga0k408_119452_c1_729_1502 | 240 |
| 726 | 3300050493 | nmdc:mga0k408_124410_c1 | nmdc:mga0k408_124410_c1_84_962 | 240 |
| 727 | 3300050493 | nmdc:mga0k408_12727_c2 | nmdc:mga0k408_12727_c2_1353_2126 | 240 |
| 728 | 3300050493 | nmdc:mga0k408_199846_c1 | nmdc:mga0k408_199846_c1_60_833 | 240 |
| 729 | 3300050494 | nmdc:mga06z11_256469_c1 | nmdc:mga06z11_256469_c1_201_974 | 240 |
| 730 | 3300050496 | nmdc:mga07m45_2900_c1 | nmdc:mga07m45_2900_c1_541_1314 | 240 |
| 731 | 3300050496 | nmdc:mga07m45_3025_c1 | nmdc:mga07m45_3025_c1_2310_3083 | 240 |
| 732 | 3300050496 | nmdc:mga07m45_48625_c1 | nmdc:mga07m45_48625_c1_202_975 | 240 |
| 733 | 3300050496 | nmdc:mga07m45_9895_c1 | nmdc:mga07m45_9895_c1_1207_2085 | 240 |
| 734 | 3300050507 | nmdc:mga05p37_100008_c1 | nmdc:mga05p37_100008_c1_1736_2512 | 240 |
| 735 | 3300050507 | nmdc:mga05p37_325811_c1 | nmdc:mga05p37_325811_c1_734_1522 | 240 |
| 736 | 3300050510 | nmdc:mga06r32_27536_c1 | nmdc:mga06r32_27536_c1_3451_4227 | 240 |
| 737 | 3300050513 | nmdc:mga0rr50_357947_c1 | nmdc:mga0rr50_357947_c1_436_1209 | 240 |
| 738 | 3300050515 | nmdc:mga0a205_207545_c1 | nmdc:mga0a205_207545_c1_954_1727 | 240 |
| 739 | 3300053086 | Ga0500578_0062342 | Ga0500578_0062342_143_916 | 240 |
| 740 | 3300053093 | Ga0500651_0079981 | Ga0500651_0079981_1150_1923 | 240 |
| 741 | 3300053107 | Ga0500560_000863 | Ga0500560_000863_2215_2988 | 240 |
| 742 | 3300053111 | Ga0500572_001032 | Ga0500572_001032_7482_8255 | 240 |
| 743 | 3300053136 | Ga0500559_0001277 | Ga0500559_0001277_5281_6054 | 240 |
| 744 | 3300053137 | Ga0500561_0000531 | Ga0500561_0000531_3005_3778 | 240 |
| 745 | 3300053142 | Ga0500577_0108503 | Ga0500577_0108503_214_987 | 240 |
| 746 | 3300053153 | Ga0500616_0079303 | Ga0500616_0079303_426_1205 | 240 |
| 747 | 3300053163 | Ga0500639_015544 | Ga0500639_015544_2441_3214 | 240 |
| 748 | 3300053730 | Ga0500645_003541 | Ga0500645_003541_276_1049 | 240 |
| 749 | 3300053735 | Ga0500596_012269 | Ga0500596_012269_440_1213 | 240 |
| 750 | 3300061719 | Ga0466962_0088956 | Ga0466962_0088956_69_848 | 240 |
| 751 | iso_pu_bacteria | 2507262055 | 2507510775 | 240 |
| 752 | iso_pu_bacteria | 2508501042 | 2508697287 | 240 |
| 753 | iso_pu_bacteria | 2508501123 | 2509118098 | 240 |
| 754 | iso_pu_bacteria | 2509276018 | 2509367577 | 240 |
| 755 | iso_pu_bacteria | 2509276022 | 2509396558 | 240 |
| 756 | iso_pu_bacteria | 2512875016 | 2512931226 | 240 |
| 757 | iso_pu_bacteria | 2512875024 | 2512959047 | 240 |
| 758 | iso_pu_bacteria | 2513237090 | 2513610811 | 240 |
| 759 | iso_pu_bacteria | 2513237096 | 2513653724 | 240 |
| 760 | iso_pu_bacteria | 2513237098 | 2513671237 | 240 |
| 761 | iso_pu_bacteria | 2513237101 | 2513698013 | 240 |
| 762 | iso_pu_bacteria | 2513237137 | 2513856164 | 240 |
| 763 | iso_pu_bacteria | 2513237145 | 2513918064 | 240 |
| 764 | iso_pu_bacteria | 2513237164 | 2514038090 | 240 |
| 765 | iso_pu_bacteria | 2515154112 | 2515628016 | 240 |
| 766 | iso_pu_bacteria | 2517572143 | 2517891696 | 240 |
| 767 | iso_pu_bacteria | 2524023205 | 2524437172 | 240 |
| 768 | iso_pu_bacteria | 2524023228 | 2524536683 | 240 |
| 769 | iso_pu_bacteria | 2537561587 | 2537877298 | 240 |
| 770 | iso_pu_bacteria | 2545555834 | 2545677978 | 240 |
| 771 | iso_pu_bacteria | 2554235003 | 2554246195 | 240 |
| 772 | iso_pu_bacteria | 2558860242 | 2559293418 | 240 |
| 773 | iso_pu_bacteria | 2599185210 | 2599604301 | 240 |
| 774 | iso_pu_bacteria | 2599185301 | 2599938476 | 240 |
| 775 | iso_pu_bacteria | 2600255279 | 2601609563 | 240 |
| 776 | iso_pu_bacteria | 2600255308 | 2601746338 | 240 |
| 777 | iso_pu_bacteria | 2643221568 | 2643857585 | 240 |
| 778 | iso_pu_bacteria | 2643221595 | 2643984642 | 240 |
| 779 | iso_pu_bacteria | 2643221627 | 2644158534 | 240 |
| 780 | iso_pu_bacteria | 2643221654 | 2644305357 | 240 |
| 781 | iso_pu_bacteria | 2643221693 | 2644519616 | 240 |
| 782 | iso_pu_bacteria | 2643221734 | 2644733878 | 240 |
| 783 | iso_pu_bacteria | 2643221736 | 2644742400 | 240 |
| 784 | iso_pu_bacteria | 2667528175 | 2671118534 | 240 |
| 785 | iso_pu_bacteria | 2687453392 | 2688598694 | 240 |
| 786 | iso_pu_bacteria | 2693429783 | 2694633179 | 240 |
| 787 | iso_pu_bacteria | 2693429784 | 2694638248 | 240 |
| 788 | iso_pu_bacteria | 2721755755 | 2723846799 | 240 |
| 789 | iso_pu_bacteria | 2744054633 | 2745076391 | 240 |
| 790 | iso_pu_bacteria | 2756170246 | 2756675205 | 240 |
| 791 | iso_pu_bacteria | 2791355123 | 2792749502 | 240 |
| 792 | iso_pu_bacteria | 2791355199 | 2793076454 | 240 |
| 793 | iso_pu_bacteria | 2818991439 | 2819556885 | 240 |
| 794 | iso_pu_bacteria | 2818991467 | 2819716834 | 240 |
| 795 | iso_pu_bacteria | 2838675328 | 2838677622 | 240 |
| 796 | iso_pu_bacteria | 2838714209 | 2838716511 | 240 |
| 797 | iso_pu_bacteria | 2838719591 | 2838719689 | 240 |
| 798 | iso_pu_bacteria | 2838724970 | 2838727262 | 240 |
| 799 | iso_pu_bacteria | 2840764183 | 2840769969 | 240 |
| 800 | iso_pu_bacteria | 2841760612 | 2841763824 | 240 |
| 801 | iso_pu_bacteria | 2841846520 | 2841846620 | 240 |
| 802 | iso_pu_bacteria | 2841859092 | 2841860850 | 240 |
| 803 | iso_pu_bacteria | 2841911363 | 2841916900 | 240 |
| 804 | iso_pu_bacteria | 2841917233 | 2841917596 | 240 |
| 805 | iso_pu_bacteria | 2842038055 | 2842043107 | 240 |
| 806 | iso_pu_bacteria | 2842045827 | 2842051148 | 240 |
| 807 | iso_pu_bacteria | 2842124991 | 2842127351 | 240 |
| 808 | iso_pu_bacteria | 2842130223 | 2842132515 | 240 |
| 809 | iso_pu_bacteria | 2842152218 | 2842152316 | 240 |
| 810 | iso_pu_bacteria | 2842170452 | 2842172756 | 240 |
| 811 | iso_pu_bacteria | 2842175837 | 2842175935 | 240 |
| 812 | iso_pu_bacteria | 2842187318 | 2842189618 | 240 |
| 813 | iso_pu_bacteria | 2842211629 | 2842213932 | 240 |
| 814 | iso_pu_bacteria | 2842224351 | 2842224450 | 240 |
| 815 | iso_pu_bacteria | 2842515876 | 2842517635 | 240 |
| 816 | iso_pu_bacteria | 2842747753 | 2842750522 | 240 |
| 817 | iso_pu_bacteria | 2844002411 | 2844007164 | 240 |
| 818 | iso_pu_bacteria | 2844104063 | 2844109272 | 240 |
| 819 | iso_pu_bacteria | 2851182111 | 2851183079 | 240 |
| 820 | iso_pu_bacteria | 2851246043 | 2851251379 | 240 |
| 821 | iso_pu_bacteria | 2856328259 | 2856331351 | 240 |
| 822 | iso_pu_bacteria | 2856334872 | 2856341858 | 240 |
| 823 | iso_pu_bacteria | 2857349434 | 2857350824 | 240 |
| 824 | iso_pu_bacteria | 2869249662 | 2869254407 | 240 |
| 825 | iso_pu_bacteria | 2869264136 | 2869268871 | 240 |
| 826 | iso_pu_bacteria | 2869271264 | 2869274721 | 240 |
| 827 | iso_pu_bacteria | 2869285874 | 2869291881 | 240 |
| 828 | iso_pu_bacteria | 2871429161 | 2871435090 | 240 |
| 829 | iso_pu_bacteria | 2871459585 | 2871465469 | 240 |
| 830 | iso_pu_bacteria | 2871466892 | 2871472694 | 240 |
| 831 | iso_pu_bacteria | 2871495908 | 2871499883 | 240 |
| 832 | iso_pu_bacteria | 2874139085 | 2874146140 | 240 |
| 833 | iso_pu_bacteria | 2874146452 | 2874149482 | 240 |
| 834 | iso_pu_bacteria | 2874155637 | 2874157744 | 240 |
| 835 | iso_pu_bacteria | 2874162495 | 2874162702 | 240 |
| 836 | iso_pu_bacteria | 2874168670 | 2874174544 | 240 |
| 837 | iso_pu_bacteria | 2874590934 | 2874592282 | 240 |
| 838 | iso_pu_bacteria | 2874604998 | 2874611240 | 240 |
| 839 | iso_pu_bacteria | 2874628541 | 2874634530 | 240 |
| 840 | iso_pu_bacteria | 2874645413 | 2874650111 | 240 |
| 841 | iso_pu_bacteria | 2876363079 | 2876369284 | 240 |
| 842 | iso_pu_bacteria | 2876369609 | 2876376518 | 240 |
| 843 | iso_pu_bacteria | 2876377896 | 2876383782 | 240 |
| 844 | iso_pu_bacteria | 2876399893 | 2876402986 | 240 |
| 845 | iso_pu_bacteria | 2876406927 | 2876408884 | 240 |
| 846 | iso_pu_bacteria | 2876413966 | 2876415948 | 240 |
| 847 | iso_pu_bacteria | 2876771140 | 2876775360 | 240 |
| 848 | iso_pu_bacteria | 2876818435 | 2876826287 | 240 |
| 849 | iso_pu_bacteria | 2878738818 | 2878745493 | 240 |
| 850 | iso_pu_bacteria | 2878745973 | 2878752225 | 240 |
| 851 | iso_pu_bacteria | 2878760144 | 2878764038 | 240 |
| 852 | iso_pu_bacteria | 2878767105 | 2878771077 | 240 |
| 853 | iso_pu_bacteria | 2878774303 | 2878774577 | 240 |
| 854 | iso_pu_bacteria | 2879074833 | 2879079552 | 240 |
| 855 | iso_pu_bacteria | 2879127579 | 2879132201 | 240 |
| 856 | iso_pu_bacteria | 2879142872 | 2879146850 | 240 |
| 857 | iso_pu_bacteria | 2881147464 | 2881151780 | 240 |
| 858 | iso_pu_bacteria | 2881665667 | 2881668538 | 240 |
| 859 | iso_pu_bacteria | 2885305155 | 2885309687 | 240 |
| 860 | iso_pu_bacteria | 2885326080 | 2885326982 | 240 |
| 861 | iso_pu_bacteria | 2885334103 | 2885337331 | 240 |
| 862 | iso_pu_bacteria | 2885374607 | 2885381026 | 240 |
| 863 | iso_pu_bacteria | 2889010040 | 2889010955 | 240 |
| 864 | iso_pu_bacteria | 2889016732 | 2889017353 | 240 |
| 865 | iso_pu_bacteria | 2889033259 | 2889038415 | 240 |
| 866 | iso_pu_bacteria | 2889914905 | 2889915422 | 240 |
| 867 | iso_pu_bacteria | 2891048133 | 2891048212 | 240 |
| 868 | iso_pu_bacteria | 2899792073 | 2899794324 | 240 |
| 869 | iso_pu_bacteria | 2899845264 | 2899845705 | 240 |
| 870 | iso_pu_bacteria | 2903448605 | 2903455303 | 240 |
| 871 | iso_pu_bacteria | 2903492973 | 2903493217 | 240 |
| 872 | iso_pu_bacteria | 2903521522 | 2903523109 | 240 |
| 873 | iso_pu_bacteria | 2903528002 | 2903534431 | 240 |
| 874 | iso_pu_bacteria | 2903540706 | 2903544697 | 240 |
| 875 | iso_pu_bacteria | 2906308376 | 2906314619 | 240 |
| 876 | iso_pu_bacteria | 2906321335 | 2906327787 | 240 |
| 877 | iso_pu_bacteria | 2906354277 | 2906361658 | 240 |
| 878 | iso_pu_bacteria | 2906363423 | 2906368350 | 240 |
| 879 | iso_pu_bacteria | 2906370794 | 2906375938 | 240 |
| 880 | iso_pu_bacteria | 2906378014 | 2906384733 | 240 |
| 881 | iso_pu_bacteria | 2906386501 | 2906387029 | 240 |
| 882 | iso_pu_bacteria | 2906408224 | 2906412210 | 240 |
| 883 | iso_pu_bacteria | 2906626472 | 2906630372 | 240 |
| 884 | iso_pu_bacteria | 2906635258 | 2906642910 | 240 |
| 885 | iso_pu_bacteria | 2906660503 | 2906667200 | 240 |
| 886 | iso_pu_bacteria | 2917699015 | 2917701656 | 240 |
| 887 | iso_pu_bacteria | 2919114240 | 2919116728 | 240 |
| 888 | iso_pu_bacteria | 2919166419 | 2919166429 | 240 |
| 889 | iso_pu_bacteria | 2922130491 | 2922133895 | 240 |
| 890 | iso_pu_bacteria | 2922151315 | 2922154534 | 240 |
| 891 | iso_pu_bacteria | 2922172374 | 2922174545 | 240 |
| 892 | iso_pu_bacteria | 2922185730 | 2922190041 | 240 |
| 893 | iso_pu_bacteria | 2922361189 | 2922362497 | 240 |
| 894 | iso_pu_bacteria | 2922386360 | 2922390404 | 240 |
| 895 | iso_pu_bacteria | 2924748358 | 2924753789 | 240 |
| 896 | iso_pu_bacteria | 2924762789 | 2924764122 | 240 |
| 897 | iso_pu_bacteria | 2924776078 | 2924783737 | 240 |
| 898 | iso_pu_bacteria | 2926754445 | 2926754737 | 240 |
| 899 | iso_pu_bacteria | 2926760298 | 2926761906 | 240 |
| 900 | iso_pu_bacteria | 2928115317 | 2928116540 | 240 |
| 901 | iso_pu_bacteria | 2929160207 | 2929160397 | 240 |
| 902 | iso_pu_bacteria | 2933006813 | 2933006963 | 240 |
| 903 | iso_pu_bacteria | 2933011516 | 2933015446 | 240 |
| 904 | iso_pu_bacteria | 2933594066 | 2933594166 | 240 |
| 905 | iso_pu_bacteria | 2935608549 | 2935616044 | 240 |
| 906 | iso_pu_bacteria | 2935819856 | 2935819940 | 240 |
| 907 | iso_pu_bacteria | 2935847175 | 2935850050 | 240 |
| 908 | iso_pu_bacteria | 2935908558 | 2935915201 | 240 |
| 909 | iso_pu_bacteria | 2935916978 | 2935923878 | 240 |
| 910 | iso_pu_bacteria | 2935926038 | 2935932698 | 240 |
| 911 | iso_pu_bacteria | 2935934488 | 2935941218 | 240 |
| 912 | iso_pu_bacteria | 2935942939 | 2935949368 | 240 |
| 913 | iso_pu_bacteria | 2935951376 | 2935958063 | 240 |
| 914 | iso_pu_bacteria | 2935959822 | 2935963808 | 240 |
| 915 | iso_pu_bacteria | 2935967501 | 2935974295 | 240 |
| 916 | iso_pu_bacteria | 2935975950 | 2935979496 | 240 |
| 917 | iso_pu_bacteria | 2935984226 | 2935991645 | 240 |
| 918 | iso_pu_bacteria | 2936055302 | 2936059264 | 240 |
| 919 | iso_pu_bacteria | 2937813078 | 2937816078 | 240 |
| 920 | iso_pu_bacteria | 2937822353 | 2937824738 | 240 |
| 921 | iso_pu_bacteria | 2937848649 | 2937852922 | 240 |
| 922 | iso_pu_bacteria | 2937868953 | 2937872928 | 240 |
| 923 | iso_pu_bacteria | 2937877337 | 2937881858 | 240 |
| 924 | iso_pu_bacteria | 2937972304 | 2937975597 | 240 |
| 925 | iso_pu_bacteria | 2937994558 | 2937998544 | 240 |
| 926 | iso_pu_bacteria | 2958034702 | 2958040904 | 240 |
| 927 | iso_pu_bacteria | 2958041894 | 2958056986 | 240 |
| 928 | iso_pu_bacteria | 2958064165 | 2958067677 | 240 |
| 929 | iso_pu_bacteria | 2958084443 | 2958088978 | 240 |
| 930 | iso_pu_bacteria | 2958092219 | 2958093831 | 240 |
| 931 | iso_pu_bacteria | 2958100919 | 2958102994 | 240 |
| 932 | iso_pu_bacteria | 2958122699 | 2958125357 | 240 |
| 933 | iso_pu_bacteria | 2958130278 | 2958136279 | 240 |
| 934 | iso_pu_bacteria | 2958137437 | 2958144355 | 240 |
| 935 | iso_pu_bacteria | 2958144490 | 2958148499 | 240 |
| 936 | iso_pu_bacteria | 2958158011 | 2958161156 | 240 |
| 937 | iso_pu_bacteria | 2958165035 | 2958169023 | 240 |
| 938 | iso_pu_bacteria | 2958172287 | 2958176228 | 240 |
| 939 | iso_pu_bacteria | 2958179912 | 2958185747 | 240 |
| 940 | iso_pu_bacteria | 2961077736 | 2961084124 | 240 |
| 941 | iso_pu_bacteria | 2961136820 | 2961141190 | 240 |
| 942 | iso_pu_bacteria | 2961163497 | 2961167482 | 240 |
| 943 | iso_pu_bacteria | 2963644680 | 2963647993 | 240 |
| 944 | iso_pu_bacteria | 2965018300 | 2965022305 | 240 |
| 945 | iso_pu_bacteria | 2965025482 | 2965026409 | 240 |
| 946 | iso_pu_bacteria | 2965032056 | 2965038356 | 240 |
| 947 | iso_pu_bacteria | 2965040258 | 2965041810 | 240 |
| 948 | iso_pu_bacteria | 2965089291 | 2965091802 | 240 |
| 949 | iso_pu_bacteria | 2965102966 | 2965104990 | 240 |
| 950 | iso_pu_bacteria | 2965110997 | 2965118951 | 240 |
| 951 | iso_pu_bacteria | 2965119406 | 2965126790 | 240 |
| 952 | iso_pu_bacteria | 2968016561 | 2968018175 | 240 |
| 953 | iso_pu_bacteria | 2968083720 | 2968090813 | 240 |
| 954 | iso_pu_bacteria | 2968117919 | 2968120944 | 240 |
| 955 | iso_pu_bacteria | 2968171901 | 2968175889 | 240 |
| 956 | iso_pu_bacteria | 2970469710 | 2970471651 | 240 |
| 957 | iso_pu_bacteria | 2970547951 | 2970549334 | 240 |
| 958 | iso_pu_bacteria | 2970554993 | 2970558883 | 240 |
| 959 | iso_pu_bacteria | 2970593180 | 2970599816 | 240 |
| 960 | iso_pu_bacteria | 2977843712 | 2977846314 | 240 |
| 961 | iso_pu_bacteria | 2977864932 | 2977868949 | 240 |
| 962 | iso_pu_bacteria | 2977872689 | 2977876339 | 240 |
| 963 | iso_pu_bacteria | 2977915119 | 2977922462 | 240 |
| 964 | iso_pu_bacteria | 2977922695 | 2977924497 | 240 |
| 965 | iso_pu_bacteria | 2977935797 | 2977936854 | 240 |
| 966 | iso_pu_bacteria | 2977942078 | 2977947474 | 240 |
| 967 | iso_pu_bacteria | 2977950692 | 2977951417 | 240 |
| 968 | iso_pu_bacteria | 2977957713 | 2977964378 | 240 |
| 969 | iso_pu_bacteria | 2977986579 | 2977988345 | 240 |
| 970 | iso_pu_bacteria | 2978969890 | 2978972822 | 240 |
| 971 | iso_pu_bacteria | 2979089926 | 2979092829 | 240 |
| 972 | iso_pu_bacteria | 2979095461 | 2979099783 | 240 |
| 973 | iso_pu_bacteria | 2979100975 | 2979104800 | 240 |
| 974 | iso_pu_bacteria | 2979710463 | 2979711116 | 240 |
| 975 | iso_pu_bacteria | 2979742915 | 2979749597 | 240 |
| 976 | iso_pu_bacteria | 2979793036 | 2979795543 | 240 |
| 977 | iso_pu_bacteria | 2984509177 | 2984513401 | 240 |
| 978 | iso_pu_bacteria | 2984518228 | 2984520231 | 240 |
| 979 | iso_pu_bacteria | 2984537506 | 2984539527 | 240 |
| 980 | iso_pu_bacteria | 2984587000 | 2984591073 | 240 |
| 981 | iso_pu_bacteria | 2984601300 | 2984601755 | 240 |
| 982 | iso_pu_bacteria | 2987636660 | 2987638009 | 240 |
| 983 | iso_pu_bacteria | 2987645492 | 2987645585 | 240 |
| 984 | iso_pu_bacteria | 2987652177 | 2987655922 | 240 |
| 985 | iso_pu_bacteria | 2987659509 | 2987663488 | 240 |
| 986 | iso_pu_bacteria | 2987666974 | 2987668973 | 240 |
| 987 | iso_pu_bacteria | 2987673487 | 2987679379 | 240 |
| 988 | iso_pu_bacteria | 3004188549 | 3004192549 | 240 |
| 989 | iso_pu_bacteria | 3004203850 | 3004205669 | 240 |
| 990 | iso_pu_bacteria | 3004211236 | 3004216230 | 240 |
| 991 | iso_pu_bacteria | 3004218560 | 3004223980 | 240 |
| 992 | iso_pu_bacteria | 3004239961 | 3004246501 | 240 |
| 993 | iso_pu_bacteria | 3004334049 | 3004341435 | 240 |
| 994 | iso_pu_bacteria | 3005409236 | 3005413628 | 240 |
| 995 | iso_pu_bacteria | 637000159 | 637074326 | 240 |
| 996 | iso_pu_bacteria | 641522639 | 641642502 | 240 |
| 997 | iso_pu_bacteria | 649633066 | 649873211 | 240 |
| 998 | iso_pu_bacteria | 650716007 | 650738654 | 240 |
| 999 | iso_pu_bacteria | 8003570095 | 8003572199 | 240 |
| 1000 | iso_pu_bacteria | 8004300914 | 8004301854 | 240 |
| 1001 | iso_pu_bacteria | 8004361976 | 8004367103 | 240 |
| 1002 | iso_pu_bacteria | 8004387939 | 8004394393 | 240 |
| 1003 | iso_pu_bacteria | 8004640170 | 8004640556 | 240 |
| 1004 | iso_pu_bacteria | 8004695233 | 8004697783 | 240 |
| 1005 | iso_pu_bacteria | 8004714634 | 8004720880 | 240 |
| 1006 | iso_pu_bacteria | 8006926726 | 8006928570 | 240 |
| 1007 | iso_pu_bacteria | 8006933436 | 8006939839 | 240 |
| 1008 | iso_pu_bacteria | 8006964411 | 8006970025 | 240 |
| 1009 | iso_pu_bacteria | 8006984368 | 8006985295 | 240 |
| 1010 | iso_pu_bacteria | 8006994254 | 8006995072 | 240 |
| 1011 | iso_pu_bacteria | 8016583857 | 8016589853 | 240 |
| 1012 | iso_pu_bacteria | 8016630954 | 8016633587 | 240 |
| 1013 | iso_pu_bacteria | 8019619141 | 8019625591 | 240 |
| 1014 | iso_pu_bacteria | 8019629233 | 8019636698 | 240 |
| 1015 | iso_pu_bacteria | 8019638758 | 8019642926 | 240 |
| 1016 | iso_pu_bacteria | 8019659431 | 8019664500 | 240 |
| 1017 | iso_pu_bacteria | 8019668869 | 8019674088 | 240 |
| 1018 | iso_pu_bacteria | 8019678201 | 8019682034 | 240 |
| 1019 | iso_pu_bacteria | 8019687851 | 8019693573 | 240 |
| 1020 | iso_pu_bacteria | 8056673599 | 8056679635 | 240 |
| 1021 | iso_pu_bacteria | 8057529695 | 8057534249 | 240 |
| 1022 | iso_pu_bacteria | 2935656913 | 2935663803 | 241 |
| 1023 | iso_pu_bacteria | 2936011229 | 2936017959 | 241 |
| 1024 | iso_pu_bacteria | 2936019824 | 2936026462 | 241 |
| 1025 | iso_pu_bacteria | 2936028420 | 2936035131 | 241 |
| 1026 | iso_pu_bacteria | 2936046547 | 2936053281 | 241 |
| 1027 | 3300005455 | Ga0070663_100176398 | Ga0070663_1001763982 | 242 |
| 1028 | 3300049571 | Ga0501034_0003224 | Ga0501034_0003224_4544_5410 | 243 |
| 1029 | 3300044673 | Ga0453683_0001822 | Ga0453683_0001822_4320_5138 | 244 |
| 1030 | 3300045051 | Ga0451576_0008457 | Ga0451576_0008457_7377_8195 | 244 |
| 1031 | 3300048928 | Ga0496125_0076142 | Ga0496125_0076142_1315_2232 | 244 |
| 1032 | iso_pu_bacteria | 2839138175 | 2839142327 | 244 |
| 1033 | 3300005459 | Ga0068867_100095043 | Ga0068867_1000950432 | 245 |
| 1034 | 3300025321 | Ga0207656_10078344 | Ga0207656_100783441 | 245 |
| 1035 | 3300025934 | Ga0207686_10017732 | Ga0207686_100177324 | 245 |
| 1036 | 3300026041 | Ga0207639_10293762 | Ga0207639_102937622 | 245 |
| 1037 | 3300026089 | Ga0207648_10028050 | Ga0207648_100280505 | 245 |
| 1038 | 3300031731 | Ga0307405_10055501 | Ga0307405_100555013 | 245 |
| 1039 | 3300032002 | Ga0307416_100090048 | Ga0307416_1000900482 | 245 |
| 1040 | 3300032005 | Ga0307411_10171535 | Ga0307411_101715352 | 245 |
| 1041 | iso_pu_bacteria | 2858688981 | 2858698239 | 245 |
| 1042 | 3300003784 | Ga0055534_1000810 | Ga0055534_100081013 | 246 |
| 1043 | 3300004625 | Ga0055543_1014166 | Ga0055543_10141661 | 246 |
| 1044 | 3300025245 | Ga0207425_1003484 | Ga0207425_10034844 | 246 |
| 1045 | 3300025258 | Ga0209129_1000168 | Ga0209129_10001684 | 246 |
| 1046 | 3300025284 | Ga0209130_1001063 | Ga0209130_100106316 | 246 |
| 1047 | 3300025284 | Ga0209130_1001335 | Ga0209130_100133510 | 246 |
| 1048 | 3300025292 | Ga0209676_1007063 | Ga0209676_10070632 | 246 |
| 1049 | 3300025295 | Ga0209564_1000157 | Ga0209564_1000157139 | 246 |
| 1050 | 3300025297 | Ga0209758_1000042 | Ga0209758_100004210 | 246 |
| 1051 | 3300025297 | Ga0209758_1015827 | Ga0209758_10158272 | 246 |
| 1052 | 3300025298 | Ga0209050_1036466 | Ga0209050_10364662 | 246 |
| 1053 | 3300025299 | Ga0209256_1002051 | Ga0209256_10020515 | 246 |
| 1054 | 3300025302 | Ga0207426_1000055 | Ga0207426_1000055321 | 246 |
| 1055 | 3300049743 | Ga0501081_0087845 | Ga0501081_0087845_989_1843 | 246 |
| 1056 | iso_pu_bacteria | 2738543013 | 2739247531 | 246 |
| 1057 | iso_pu_bacteria | 2842677519 | 2842682520 | 246 |
| 1058 | iso_pu_bacteria | 2904541872 | 2904543163 | 246 |
| 1059 | 3300053121 | Ga0500607_116954 | Ga0500607_116954_87_980 | 247 |
| 1060 | iso_pu_bacteria | 2834641062 | 2834645500 | 247 |
| 1061 | iso_pu_bacteria | 2904449895 | 2904451506 | 247 |
| 1062 | iso_pu_bacteria | 2904456579 | 2904458363 | 247 |
| 1063 | iso_pu_bacteria | 2929520902 | 2929524057 | 247 |
| 1064 | iso_pu_bacteria | 2945945610 | 2945950579 | 247 |
| 1065 | iso_pu_bacteria | 2945972063 | 2945974786 | 247 |
| 1066 | 3300005347 | Ga0070668_100208450 | Ga0070668_1002084502 | 248 |
| 1067 | 3300013105 | Ga0157369_10029638 | Ga0157369_100296383 | 248 |
| 1068 | 3300017792 | Ga0163161_10289032 | Ga0163161_102890322 | 248 |
| 1069 | 3300025914 | Ga0207671_10208610 | Ga0207671_102086102 | 248 |
| 1070 | 3300025949 | Ga0207667_10384419 | Ga0207667_103844192 | 248 |
| 1071 | 3300026142 | Ga0207698_10037561 | Ga0207698_100375613 | 248 |
| 1072 | 3300031649 | Ga0307514_10001095 | Ga0307514_100010956 | 248 |
| 1073 | 3300046615 | Ga0495656_0003313 | Ga0495656_0003313_2144_3007 | 248 |
| 1074 | 3300048925 | Ga0496122_0170936 | Ga0496122_0170936_180_1013 | 248 |
| 1075 | 3300048927 | Ga0496124_0000178 | Ga0496124_0000178_48333_49160 | 248 |
| 1076 | iso_pu_bacteria | 2547132374 | 2548501037 | 248 |
| 1077 | iso_pu_bacteria | 2643221596 | 2643993478 | 248 |
| 1078 | iso_pu_bacteria | 2643221658 | 2644326666 | 248 |
| 1079 | iso_pu_bacteria | 2643221672 | 2644397019 | 248 |
| 1080 | iso_pu_bacteria | 2643221717 | 2644645921 | 248 |
| 1081 | iso_pu_bacteria | 2885192300 | 2885193344 | 248 |
| 1082 | iso_pu_bacteria | 2990710928 | 2990712710 | 248 |
| 1083 | 3300002773 | JGI25152J39213_1006299 | JGI25152J39213_10062993 | 249 |
| 1084 | 3300002774 | JGI25150J39212_1002656 | JGI25150J39212_10026562 | 249 |
| 1085 | 3300005564 | Ga0070664_100052511 | Ga0070664_1000525113 | 249 |
| 1086 | 3300006358 | Ga0068871_100306256 | Ga0068871_1003062562 | 249 |
| 1087 | 3300009098 | Ga0105245_10290998 | Ga0105245_102909982 | 249 |
| 1088 | 3300015262 | Ga0182007_10011260 | Ga0182007_100112602 | 249 |
| 1089 | 3300025728 | Ga0207655_1001999 | Ga0207655_10019995 | 249 |
| 1090 | 3300025942 | Ga0207689_10368165 | Ga0207689_103681652 | 249 |
| 1091 | 3300028794 | Ga0307515_10254487 | Ga0307515_102544872 | 249 |
| 1092 | 3300047318 | Ga0495636_0040348 | Ga0495636_0040348_754_1623 | 249 |
| 1093 | 3300049591 | Ga0501075_0099242 | Ga0501075_0099242_1325_2188 | 249 |
| 1094 | 3300049741 | Ga0501079_0016435 | Ga0501079_0016435_633_1496 | 249 |
| 1095 | 3300049742 | Ga0501080_0027985 | Ga0501080_0027985_2400_3263 | 249 |
| 1096 | 3300053079 | Ga0500610_0002372 | Ga0500610_0002372_5468_6343 | 249 |
| 1097 | 3300053079 | Ga0500610_0108139 | Ga0500610_0108139_270_1145 | 249 |
| 1098 | 3300053121 | Ga0500607_011326 | Ga0500607_011326_4223_5098 | 249 |
| 1099 | 3300053158 | Ga0500627_0009524 | Ga0500627_0009524_2009_2875 | 249 |
| 1100 | 3300054114 | Ga0501084_0020078 | Ga0501084_0020078_1536_2399 | 249 |
| 1101 | 3300061734 | Ga0530510_0066933 | Ga0530510_0066933_153_1016 | 249 |
| 1102 | iso_pu_bacteria | 2513237150 | 2513954440 | 249 |
| 1103 | iso_pu_bacteria | 2513237165 | 2514041040 | 249 |
| 1104 | iso_pu_bacteria | 2643221570 | 2643866745 | 249 |
| 1105 | iso_pu_bacteria | 2643221609 | 2644061397 | 249 |
| 1106 | iso_pu_bacteria | 2643221611 | 2644076558 | 249 |
| 1107 | iso_pu_bacteria | 2643221652 | 2644294616 | 249 |
| 1108 | iso_pu_bacteria | 2738543012 | 2739246837 | 249 |
| 1109 | iso_pu_bacteria | 2816332133 | 2816474051 | 249 |
| 1110 | iso_pu_bacteria | 2928037797 | 2928043659 | 249 |
| 1111 | iso_pu_bacteria | 2928044640 | 2928049710 | 249 |
| 1112 | iso_pu_bacteria | 2928051484 | 2928054308 | 249 |
| 1113 | iso_pu_bacteria | 2928064002 | 2928069894 | 249 |
| 1114 | iso_pu_bacteria | 2928070936 | 2928074486 | 249 |
| 1115 | iso_pu_bacteria | 644736347 | 644748812 | 249 |
| 1116 | 3300002739 | JGI25158J39367_1001672 | JGI25158J39367_10016723 | 250 |
| 1117 | 3300002739 | JGI25158J39367_1005795 | JGI25158J39367_10057952 | 250 |
| 1118 | 3300003187 | JGI25151J46595_10017707 | JGI25151J46595_100177073 | 250 |
| 1119 | 3300003215 | JGI25153J46596_10014479 | JGI25153J46596_100144793 | 250 |
| 1120 | 3300003374 | JGI25161J50226_1005466 | JGI25161J50226_10054662 | 250 |
| 1121 | 3300003781 | Ga0055536_1013631 | Ga0055536_10136313 | 250 |
| 1122 | 3300003781 | Ga0055536_1014821 | Ga0055536_10148212 | 250 |
| 1123 | 3300003784 | Ga0055534_1010796 | Ga0055534_10107962 | 250 |
| 1124 | 3300003790 | Ga0055528_1010050 | Ga0055528_10100503 | 250 |
| 1125 | 3300003791 | Ga0055530_10001751 | Ga0055530_100017513 | 250 |
| 1126 | 3300003791 | Ga0055530_10004541 | Ga0055530_100045415 | 250 |
| 1127 | 3300003792 | Ga0055540_1011211 | Ga0055540_10112112 | 250 |
| 1128 | 3300003792 | Ga0055540_1012318 | Ga0055540_10123182 | 250 |
| 1129 | 3300003794 | Ga0055531_10005150 | Ga0055531_100051505 | 250 |
| 1130 | 3300005457 | Ga0070662_100227288 | Ga0070662_1002272882 | 250 |
| 1131 | 3300005844 | Ga0068862_100166714 | Ga0068862_1001667142 | 250 |
| 1132 | 3300009176 | Ga0105242_10001450 | Ga0105242_100014506 | 250 |
| 1133 | 3300013100 | Ga0157373_10235924 | Ga0157373_102359242 | 250 |
| 1134 | 3300025273 | Ga0209673_1001328 | Ga0209673_10013285 | 250 |
| 1135 | 3300025273 | Ga0209673_1011889 | Ga0209673_10118893 | 250 |
| 1136 | 3300025291 | Ga0209675_1000393 | Ga0209675_10003936 | 250 |
| 1137 | 3300025292 | Ga0209676_1000040 | Ga0209676_1000040381 | 250 |
| 1138 | 3300025292 | Ga0209676_1011558 | Ga0209676_10115582 | 250 |
| 1139 | 3300025292 | Ga0209676_1012115 | Ga0209676_10121152 | 250 |
| 1140 | 3300025295 | Ga0209564_1000862 | Ga0209564_10008629 | 250 |
| 1141 | 3300025298 | Ga0209050_1000021 | Ga0209050_100002112 | 250 |
| 1142 | 3300025298 | Ga0209050_1001833 | Ga0209050_10018335 | 250 |
| 1143 | 3300025299 | Ga0209256_1004580 | Ga0209256_10045805 | 250 |
| 1144 | 3300025302 | Ga0207426_1000079 | Ga0207426_100007913 | 250 |
| 1145 | 3300025303 | Ga0209051_1000111 | Ga0209051_1000111122 | 250 |
| 1146 | 3300025303 | Ga0209051_1000286 | Ga0209051_100028666 | 250 |
| 1147 | 3300025303 | Ga0209051_1000376 | Ga0209051_100037613 | 250 |
| 1148 | 3300025304 | Ga0209257_1000043 | Ga0209257_10000437 | 250 |
| 1149 | 3300025304 | Ga0209257_1000215 | Ga0209257_100021514 | 250 |
| 1150 | 3300025304 | Ga0209257_1010745 | Ga0209257_10107453 | 250 |
| 1151 | 3300025933 | Ga0207706_10009799 | Ga0207706_100097992 | 250 |
| 1152 | 3300028380 | Ga0268265_10018279 | Ga0268265_100182793 | 250 |
| 1153 | 3300032002 | Ga0307416_100079319 | Ga0307416_1000793192 | 250 |
| 1154 | 3300048905 | Ga0496102_0450163 | Ga0496102_0450163_48_926 | 250 |
| 1155 | 3300048920 | Ga0496117_0037706 | Ga0496117_0037706_406_1284 | 250 |
| 1156 | 3300048921 | Ga0496118_0054541 | Ga0496118_0054541_309_1187 | 250 |
| 1157 | iso_pu_bacteria | 2513020051 | 2513228534 | 250 |
| 1158 | iso_pu_bacteria | 2721755523 | 2722880962 | 250 |
| 1159 | iso_pu_bacteria | 2842718218 | 2842719987 | 250 |
| 1160 | iso_pu_bacteria | 2857576091 | 2857578331 | 250 |
| 1161 | iso_pu_bacteria | 2945909444 | 2945915425 | 250 |
| 1162 | iso_pu_bacteria | 2945984333 | 2945989173 | 250 |
| 1163 | iso_pu_bacteria | 2954767861 | 2954769984 | 250 |
| 1164 | iso_pu_bacteria | 2974320154 | 2974323061 | 250 |
| 1165 | 3300017792 | Ga0163161_10001624 | Ga0163161_1000162414 | 251 |
| 1166 | 3300046500 | Ga0495596_0002574 | Ga0495596_0002574_3796_4650 | 251 |
| 1167 | 3300046515 | Ga0495620_0134320 | Ga0495620_0134320_33_896 | 251 |
| 1168 | 3300046518 | Ga0495631_0000416 | Ga0495631_0000416_14513_15376 | 251 |
| 1169 | 3300046530 | Ga0495654_0099313 | Ga0495654_0099313_418_1281 | 251 |
| 1170 | 3300048924 | Ga0496121_0253661 | Ga0496121_0253661_78_941 | 251 |
| 1171 | 3300053093 | Ga0500651_0000470 | Ga0500651_0000470_2693_3556 | 251 |
| 1172 | 3300053134 | Ga0500658_0001324 | Ga0500658_0001324_831_1694 | 251 |
| 1173 | 3300053139 | Ga0500568_0012823 | Ga0500568_0012823_414_1277 | 251 |
| 1174 | iso_pu_bacteria | 2643221628 | 2644163377 | 251 |
| 1175 | iso_pu_bacteria | 2643221683 | 2644469310 | 251 |
| 1176 | iso_pu_bacteria | 2738541277 | 2738724044 | 251 |
| 1177 | iso_pu_bacteria | 2738541307 | 2738883467 | 251 |
| 1178 | iso_pu_bacteria | 2738543019 | 2739284729 | 251 |
| 1179 | iso_pu_bacteria | 2599185214 | 2599627401 | 252 |
| 1180 | iso_pu_bacteria | 2599185226 | 2599677128 | 252 |
| 1181 | iso_pu_bacteria | 2599185227 | 2599685043 | 252 |
| 1182 | iso_pu_bacteria | 2599185229 | 2599696949 | 252 |
| 1183 | iso_pu_bacteria | 2818991446 | 2819599307 | 252 |
| 1184 | iso_pu_bacteria | 2831265667 | 2831271055 | 252 |
| 1185 | iso_pu_bacteria | 2885198086 | 2885200397 | 252 |
| 1186 | iso_pu_bacteria | 2885211737 | 2885214087 | 252 |
| 1187 | iso_pu_bacteria | 2928084124 | 2928090372 | 252 |
| 1188 | 3300001979 | JGI24740J21852_10038319 | JGI24740J21852_100383192 | 253 |
| 1189 | 3300001989 | JGI24739J22299_10021921 | JGI24739J22299_100219212 | 253 |
| 1190 | 3300005455 | Ga0070663_100195596 | Ga0070663_1001955962 | 253 |
| 1191 | 3300006353 | Ga0075370_10119806 | Ga0075370_101198062 | 253 |
| 1192 | 3300026041 | Ga0207639_10018991 | Ga0207639_100189913 | 253 |
| 1193 | 3300047321 | Ga0495676_0047327 | Ga0495676_0047327_2366_3235 | 253 |
| 1194 | 3300047673 | Ga0495593_0021590 | Ga0495593_0021590_2476_3345 | 253 |
| 1195 | 3300048089 | Ga0495614_0006317 | Ga0495614_0006317_4111_4980 | 253 |
| 1196 | 3300048928 | Ga0496125_0172756 | Ga0496125_0172756_245_1120 | 253 |
| 1197 | 3300050493 | nmdc:mga0k408_48052_c1 | nmdc:mga0k408_48052_c1_282_1181 | 253 |
| 1198 | 3300050496 | nmdc:mga07m45_17530_c1 | nmdc:mga07m45_17530_c1_619_1518 | 253 |
| 1199 | 3300053087 | Ga0500643_038555 | Ga0500643_038555_206_1075 | 253 |
| 1200 | 3300053110 | Ga0500571_073509 | Ga0500571_073509_396_1265 | 253 |
| 1201 | iso_pu_bacteria | 2838054893 | 2838059105 | 253 |
| 1202 | iso_pu_bacteria | 2899924645 | 2899930103 | 253 |
| 1203 | iso_pu_bacteria | 2919462493 | 2919466528 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
124
295
0.98
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dhw-assembly1.cif.gz_B | crystal structure of methionine importer metni | 0.7879 | 68 | 239 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7626 | 50 | 246 |
| 3dhw-assembly2.cif.gz_F | crystal structure of methionine importer metni | 0.7586 | 74 | 239 |
| 3dhw-assembly1.cif.gz_A | crystal structure of methionine importer metni | 0.7345 | 76 | 239 |
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.7238 | 60 | 247 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9048 | 64 | 245 | 1.10.3720.10 |
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9045 | 69 | 244 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8948 | 70 | 247 | 1.10.3720.10 |
| af_Q2G1I4_54_251_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.883 | 68 | 249 | 1.10.3720.10 |
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.844 | 64 | 245 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519H0D7-F1-model_v4 | ABC transporter permease | 0.92 | 40 | 253 |
GO:0005886
GO:0055085 |
| AF-A0A2A7MMG9-F1-model_v4 | ABC transporter permease | 0.9097 | 42 | 248 |
GO:0005886
GO:0055085 |
| AF-A0A2E2MMU3-F1-model_v4 | ABC transporter permease | 0.9064 | 44 | 246 |
GO:0005886
GO:0055085 |
| AF-A0A1V5ZZI9-F1-model_v4 | Bicarbonate transport system permease protein CmpB | 0.8865 | 44 | 252 |
GO:0005886
GO:0055085 |
| AF-A0A1F7TNA4-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.8848 | 32 | 252 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar