F491616

General Info

Members Datasets Scaffolds Average Seq Length
1203 723 861 256

Family's Representative Sequence

Representative Sequence 3300006353|Ga0075370_10119806|Ga0075370_101198062
Length 299
Sequence MNWLAPRLRALRVASPTPDRGQRQRPGTAGSTALPVRSQRRPIAPLEPVSSRARWLLGVGFFVLFVAVWAFFTLGGFVSPTFLASPVTMVKEGWLLFTEYNFIHDIGMTVWRVFGGFVLAALIAVPLGIAMGAWKPVEAFFEPFVSFCRYLPASAFIPLLILWAGIGETQKLLVIFIGSVFQIILMVAVIVGGARKDLVEAAYTLGANSKGIVARVLIPGAAPGIAETLRLVLGWAWTYVIVAELIGSSSGIGHMITDSQALLNTGQIIFGIIVIGVIGLVSDFAFKALNRRLFAWSTL

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
7 2512875024 Mesorhizobium loti R88b Isolate Nodule
8 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
9 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
14 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
15 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
16 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
17 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
18 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
22 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
23 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
24 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
25 2547132374 Acidovorax radicis N35 Isolate Unclassified
26 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
27 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
28 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
29 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
30 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
31 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
32 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
33 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
34 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
35 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
36 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
37 2643221568 Rhizobium sp. Root564 Isolate Unclassified
38 2643221570 Acidovorax sp. Root568 Isolate Unclassified
39 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
40 2643221596 Acidovorax sp. Root70 Isolate Unclassified
41 2643221609 Acidovorax sp. Root217 Isolate Unclassified
42 2643221611 Acidovorax sp. Root219 Isolate Unclassified
43 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
44 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
45 2643221652 Acidovorax sp. Root402 Isolate Unclassified
46 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
47 2643221658 Variovorax sp. Root411 Isolate Unclassified
48 2643221672 Variovorax sp. Root434 Isolate Unclassified
49 2643221683 Variovorax sp. Root473 Isolate Unclassified
50 2643221693 Rhizobium sp. Root491 Isolate Unclassified
51 2643221717 Acidovorax sp. Root267 Isolate Unclassified
52 2643221734 Bosea sp. Root670 Isolate Unclassified
53 2643221736 Bosea sp. Root483D1 Isolate Unclassified
54 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
55 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
56 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
57 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
58 2721755523 Delftia sp. HK171 Isolate Unclassified
59 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
60 2738541277 Variovorax sp. GV051 Isolate Unclassified
61 2738541307 Variovorax sp. GV008 Isolate Unclassified
62 2738543012 Acidovorax sp. CF301 Isolate Unclassified
63 2738543013 Variovorax sp. BT01 Isolate Unclassified
64 2738543019 Variovorax sp. GV040 Isolate Unclassified
65 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
66 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
67 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
68 2791355199
69 2816332133 Acidovorax radicis 2721A Isolate Unclassified
70 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
71 2818991446 Variovorax sp. 1180 Isolate Unclassified
72 2818991467 Bosea vestrisii 3192 Isolate Unclassified
73 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
74 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
75 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
76 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
77 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
78 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
79 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
80 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
81 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
82 2841760612 Bosea sp. Tri-49 Isolate Nodule
83 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
84 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
85 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
86 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
87 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
88 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
89 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
90 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
91 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
92 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
93 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
94 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
95 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
96 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
97 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
98 2842677519 Variovorax sp. R-72495 Isolate Unclassified
99 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
100 2842747753 Variovorax sp. R-72060 Isolate Unclassified
101 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
102 2844104063 Bosea sp. Tri-39 Isolate Nodule
103 2851182111 Bosea sp. Tri-44 Isolate Nodule
104 2851246043 Bosea sp. Tri-54 Isolate Nodule
105 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
106 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
107 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
108 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
109 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
110 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
111 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
112 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
113 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
114 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
115 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
116 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
117 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
118 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
119 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
120 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
121 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
122 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
123 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
124 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
125 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
126 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
127 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
128 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
129 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
130 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
131 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
132 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
133 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
134 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
135 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
136 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
137 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
138 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
139 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
140 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
141 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
142 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
143 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
144 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
145 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
146 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
147 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
148 2885198086 Variovorax sp. 679 Isolate Unclassified
149 2885211737 Variovorax sp. 553 Isolate Unclassified
150 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
151 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
152 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
153 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
154 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
155 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
156 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
157 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
158 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
159 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
160 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
161 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
162 2899924645 Variovorax sp. 369 Isolate Unclassified
163 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
164 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
165 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
166 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
167 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
168 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
169 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
170 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
171 2904456579 Variovorax sp. 2002 Isolate Unclassified
172 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
173 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
174 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
175 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
176 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
177 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
178 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
179 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
180 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
181 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
182 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
183 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
184 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
185 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
186 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
187 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
188 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
189 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
190 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
191 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
192 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
193 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
194 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
195 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
196 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
197 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
198 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
199 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
200 2928037797 Variovorax sp. 1126 Isolate Unclassified
201 2928044640 Variovorax sp. 1128 Isolate Unclassified
202 2928051484 Variovorax sp. 1133 Isolate Unclassified
203 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
204 2928070936 Variovorax gossypii 1167 Isolate Unclassified
205 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
206 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
207 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
208 2929520902 Variovorax beijingensis 502 Isolate Unclassified
209 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
210 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
211 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
212 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
213 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
214 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
215 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
216 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
217 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
218 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
219 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
220 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
221 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
222 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
223 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
224 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
225 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
226 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
227 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
228 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
229 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
230 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
231 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
232 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
233 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
234 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
235 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
236 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
237 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
238 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
239 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
240 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
241 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
242 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
243 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
244 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
245 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
246 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
247 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
248 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
249 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
250 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
251 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
252 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
253 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
254 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
255 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
256 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
257 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
258 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
259 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
260 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
261 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
262 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
263 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
264 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
265 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
266 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
267 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
268 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
269 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
270 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
271 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
272 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
273 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
274 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
275 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
276 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
277 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
278 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
279 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
280 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
281 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
282 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
283 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
284 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
285 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
286 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
287 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
288 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
289 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
290 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
291 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
292 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
293 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
294 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
295 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
296 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
297 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
298 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
299 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
300 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
301 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
302 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
303 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
304 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
305 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
306 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
307 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
308 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
309 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
310 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
311 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
312 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
313 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
314 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
315 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
316 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
317 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
318 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
319 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
320 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
321 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
322 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
323 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
324 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
325 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
326 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
327 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
328 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
329 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
330 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
331 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
332 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
333 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
334 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
335 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
336 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
337 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
338 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
339 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
340 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
341 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
342 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
343 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
344 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
345 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
346 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
347 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
348 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
349 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
350 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
351 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
352 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
353 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
354 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
355 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
356 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
357 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
358 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
359 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
360 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
361 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
362 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
363 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
364 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
365 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
366 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
367 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
368 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
369 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
370 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
371 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
372 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
373 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
374 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
375 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
376 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
377 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
378 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
379 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
380 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
381 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
382 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
383 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
384 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
385 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
386 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
387 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
388 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
389 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
390 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
391 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
392 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
393 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
394 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
395 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
396 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
397 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
398 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
399 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
400 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
401 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
402 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
403 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
404 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
405 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
406 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
407 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
408 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
409 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
410 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
411 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
412 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
413 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
414 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
415 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
416 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
417 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
418 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
419 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
420 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
421 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
422 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
423 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
424 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
425 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
426 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
427 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
428 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
429 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
430 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
431 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
432 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
433 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
434 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
435 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
436 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
437 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
438 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
439 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
440 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
441 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
442 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
443 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
444 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
445 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
446 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
447 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
448 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
449 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
450 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
451 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
452 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
453 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
454 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
455 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
456 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
457 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
458 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
459 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
460 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
461 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
462 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
463 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
464 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
465 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
466 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
510 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
511 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
514 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
515 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
516 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
517 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
518 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
519 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
521 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
522 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
523 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
524 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
525 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
526 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
528 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
529 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
530 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
531 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
532 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
533 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
534 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
535 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
536 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
537 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
538 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
539 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
540 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
541 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
542 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
543 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
544 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
545 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
546 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
547 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
548 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
549 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
550 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
551 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
552 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
553 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
554 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
555 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
556 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
557 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
558 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
559 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
560 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
561 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
562 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
563 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
564 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
565 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
566 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
567 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
568 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
569 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
570 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
571 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
572 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
573 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
574 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
575 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
576 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
577 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
578 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
579 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
580 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
581 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
582 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
583 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
584 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
585 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
586 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
587 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
588 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
589 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
590 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
591 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
592 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
593 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
594 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
595 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
596 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
597 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
598 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
599 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
600 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
601 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
602 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
603 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
604 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
605 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
606 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
607 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
608 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
609 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
610 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
611 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
612 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
613 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
614 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
615 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
616 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
617 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
618 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
619 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
620 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
621 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
622 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
623 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
624 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
625 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
626 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
627 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
628 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
629 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
630 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
631 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
632 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
633 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
634 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
635 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
636 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
637 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
638 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
639 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
640 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
641 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
642 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
643 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
644 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
645 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
646 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
647 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
648 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
649 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
650 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
651 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
652 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
653 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
654 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
655 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
656 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
657 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
658 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
659 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
660 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
661 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
662 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
663 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
664 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
665 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
666 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
667 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
668 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
669 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
670 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
671 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
672 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
673 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
674 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
675 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
676 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
677 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
678 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
679 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
680 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
681 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
682 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
683 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
684 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
685 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
686 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
687 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
688 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
689 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
690 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
691 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
692 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
693 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
694 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
695 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
696 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
697 641522639 Methylobacterium sp. 4-46 Isolate Nodule
698 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
699 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
700 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
701 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
702 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
703 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
704 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
705 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
706 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
707 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
708 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
709 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
710 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
711 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
712 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
713 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
714 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
715 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
716 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
717 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
718 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
719 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
720 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
721 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
722 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
723 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.55
Metatranscriptomes 0.08
Isolates 28.37

Biome Distribution

Category Percentage (%)
Aerial Root 0.42
Bulb 0
Endosphere 15.13
Nodule 18.45
Rhizoplane 2
Rhizosphere 50.37
Stem 0
Stem Tuber 0
Unclassified 13.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10038319 3300001979 Bacteria 1471
2 JGI24739J22299_10021921 3300001989 Bacteria 2270
3 JGI25158J39367_1001672 3300002739 Bacteria 3814
4 JGI25158J39367_1005795 3300002739 Bacteria 1797
5 JGI25152J39213_1006299 3300002773 Bacteria 3273
6 JGI25152J39213_1025471 3300002773 Bacteria 978
7 JGI25150J39212_1002656 3300002774 Bacteria 4378
8 JGI25151J46595_10000018 3300003187 Bacteria 238438
9 JGI25151J46595_10001245 3300003187 Bacteria 18075
10 JGI25151J46595_10012250 3300003187 Bacteria 3907
11 JGI25151J46595_10017707 3300003187 Bacteria 3080
12 JGI25153J46596_10002113 3300003215 Bacteria 11625
13 JGI25153J46596_10014479 3300003215 Bacteria 3275
14 JGI25161J50226_1005466 3300003374 Bacteria 2456
15 Ga0006562J51391_1014936 3300003578 Bacteria 2870
16 Ga0055526_1002567 3300003771 Bacteria 12179
17 Ga0055526_1019943 3300003771 Bacteria 2414
18 Ga0055537_1000477 3300003773 Bacteria 25091
19 Ga0055537_1004941 3300003773 Bacteria 3682
20 Ga0055524_1000048 3300003775 Bacteria 149598
21 Ga0055524_1012611 3300003775 Bacteria 3233
22 Ga0055536_1000123 3300003781 Bacteria 66351
23 Ga0055536_1013631 3300003781 Bacteria 2911
24 Ga0055536_1014821 3300003781 Bacteria 2708
25 Ga0055534_1000275 3300003784 Bacteria 35088
26 Ga0055534_1000810 3300003784 Bacteria 14462
27 Ga0055534_1010796 3300003784 Bacteria 1888
28 Ga0055528_1000109 3300003790 Bacteria 66661
29 Ga0055528_1001435 3300003790 Bacteria 14583
30 Ga0055528_1010050 3300003790 Bacteria 3888
31 Ga0055530_10001751 3300003791 Bacteria 15180
32 Ga0055530_10004541 3300003791 Bacteria 7093
33 Ga0055540_1008215 3300003792 Bacteria 3795
34 Ga0055540_1011011 3300003792 Bacteria 2956
35 Ga0055540_1011211 3300003792 Bacteria 2911
36 Ga0055540_1012318 3300003792 Bacteria 2692
37 Ga0055531_10005150 3300003794 Bacteria 7710
38 Ga0055543_1014166 3300004625 Bacteria 1559
39 Ga0065165_1000062 3300005262 Bacteria 178885
40 Ga0065704_10079879 3300005289 Bacteria 4058
41 Ga0065707_10149432 3300005295 Bacteria 1675
42 Ga0070676_10006949 3300005328 Bacteria 6060
43 Ga0070676_10027197 3300005328 Bacteria 3242
44 Ga0070676_10189479 3300005328 Bacteria 1342
45 Ga0070676_10229245 3300005328 Bacteria 1230
46 Ga0070670_100005028 3300005331 Bacteria 11125
47 Ga0070670_100032734 3300005331 Bacteria 4478
48 Ga0070670_100423694 3300005331 Bacteria 1177
49 Ga0068869_100004298 3300005334 Bacteria 8845
50 Ga0068869_100016023 3300005334 Bacteria 5045
51 Ga0068869_100330923 3300005334 Bacteria 1238
52 Ga0070666_10005278 3300005335 Bacteria 7918
53 Ga0070666_10101952 3300005335 Bacteria 1979
54 Ga0070680_100148322 3300005336 Bacteria 1969
55 Ga0068868_100119948 3300005338 Bacteria 2144
56 Ga0068868_100183063 3300005338 Bacteria 1739
57 Ga0068868_100622188 3300005338 Bacteria 959
58 Ga0070660_100028918 3300005339 Bacteria 4150
59 Ga0070689_100009872 3300005340 Bacteria 6788
60 Ga0070689_100134486 3300005340 Bacteria 1985
61 Ga0070661_100013467 3300005344 Bacteria 5741
62 Ga0070661_100154375 3300005344 Bacteria 1736
63 Ga0070661_100175767 3300005344 Bacteria 1628
64 Ga0070668_100001341 3300005347 Bacteria 17586
65 Ga0070668_100096217 3300005347 Bacteria 2340
66 Ga0070668_100148675 3300005347 Bacteria 1893
67 Ga0070668_100165565 3300005347 Bacteria 1796
68 Ga0070668_100208450 3300005347 Bacteria 1607
69 Ga0070669_100000668 3300005353 Bacteria 25208
70 Ga0070669_100086513 3300005353 Bacteria 2342
71 Ga0070669_100107204 3300005353 Bacteria 2116
72 Ga0070669_100114943 3300005353 Bacteria 2046
73 Ga0070669_100331203 3300005353 Bacteria 1231
74 Ga0070675_100001258 3300005354 Bacteria 18530
75 Ga0070675_100053001 3300005354 Bacteria 3336
76 Ga0070675_100621279 3300005354 Bacteria 981
77 Ga0070671_100004906 3300005355 Bacteria 10647
78 Ga0070671_100086646 3300005355 Bacteria 2621
79 Ga0070671_100087289 3300005355 Bacteria 2610
80 Ga0070671_100092362 3300005355 Bacteria 2536
81 Ga0070671_100165158 3300005355 Bacteria 1872
82 Ga0070671_100226100 3300005355 Bacteria 1588
83 Ga0070674_100055615 3300005356 Bacteria 2741
84 Ga0070674_100061525 3300005356 Bacteria 2620
85 Ga0070674_100145610 3300005356 Bacteria 1783
86 Ga0070674_100310482 3300005356 Bacteria 1260
87 Ga0070673_100006412 3300005364 Bacteria 7650
88 Ga0070673_100010287 3300005364 Bacteria 6328
89 Ga0070673_100092350 3300005364 Bacteria 2476
90 Ga0070673_100103547 3300005364 Bacteria 2349
91 Ga0070673_100143193 3300005364 Bacteria 2018
92 Ga0070659_100027510 3300005366 Bacteria 4382
93 Ga0070659_100041038 3300005366 Bacteria 3616
94 Ga0070659_100268957 3300005366 Bacteria 1416
95 Ga0070667_100004919 3300005367 Bacteria 11200
96 Ga0070667_100005264 3300005367 Bacteria 10819
97 Ga0070667_100007303 3300005367 Bacteria 9188
98 Ga0070667_100037796 3300005367 Bacteria 4047
99 Ga0070667_100183395 3300005367 Bacteria 1852
100 Ga0070667_100230329 3300005367 Bacteria 1652
101 Ga0070709_10497762 3300005434 Bacteria 925
102 Ga0070714_100009061 3300005435 Bacteria 7801
103 Ga0070705_100038190 3300005440 Bacteria 2715
104 Ga0070705_100147916 3300005440 Bacteria 1555
105 Ga0070694_100020659 3300005444 Bacteria 4199
106 Ga0070694_100022197 3300005444 Bacteria 4064
107 Ga0070708_100000538 3300005445 Bacteria 28503
108 Ga0070663_100176398 3300005455 Bacteria 1655
109 Ga0070663_100190759 3300005455 Bacteria 1595
110 Ga0070663_100195596 3300005455 Bacteria 1576
111 Ga0070678_100003201 3300005456 Bacteria 9087
112 Ga0070678_100024961 3300005456 Bacteria 4012
113 Ga0070678_100064344 3300005456 Bacteria 2718
114 Ga0070678_100406550 3300005456 Bacteria 1184
115 Ga0070662_100008353 3300005457 Bacteria 6747
116 Ga0070662_100106616 3300005457 Bacteria 2129
117 Ga0070662_100227288 3300005457 Bacteria 1491
118 Ga0070681_10065412 3300005458 Bacteria 3605
119 Ga0068867_100000099 3300005459 Bacteria 55452
120 Ga0068867_100000975 3300005459 Bacteria 19545
121 Ga0068867_100003039 3300005459 Bacteria 11834
122 Ga0068867_100035090 3300005459 Bacteria 3637
123 Ga0068867_100095043 3300005459 Bacteria 2267
124 Ga0068867_100156810 3300005459 Bacteria 1792
125 Ga0068867_100256202 3300005459 Bacteria 1425
126 Ga0070685_10095974 3300005466 Bacteria 1803
127 Ga0070707_100021241 3300005468 Bacteria 6136
128 Ga0070707_100100630 3300005468 Bacteria 2800
129 Ga0070707_100196507 3300005468 Bacteria 1966
130 Ga0070698_100256914 3300005471 Bacteria 1679
131 Ga0070699_100508479 3300005518 Bacteria 1095
132 Ga0070684_100028122 3300005535 Bacteria 4753
133 Ga0070697_100091416 3300005536 Bacteria 2516
134 Ga0068853_100187736 3300005539 Bacteria 1877
135 Ga0070672_100000287 3300005543 Bacteria 28567
136 Ga0070672_100013687 3300005543 Bacteria 5736
137 Ga0070672_100027710 3300005543 Bacteria 4228
138 Ga0070672_100056332 3300005543 Bacteria 3083
139 Ga0070672_100066504 3300005543 Bacteria 2854
140 Ga0070686_100422066 3300005544 Bacteria 1019
141 Ga0070695_100189765 3300005545 Bacteria 1462
142 Ga0070696_100084812 3300005546 Bacteria 2248
143 Ga0070696_100086242 3300005546 Bacteria 2229
144 Ga0070696_100109780 3300005546 Bacteria 1985
145 Ga0070665_100008986 3300005548 Bacteria 10122
146 Ga0070665_100013659 3300005548 Bacteria 8169
147 Ga0070665_100071749 3300005548 Bacteria 3470
148 Ga0070665_100210217 3300005548 Bacteria 1946
149 Ga0070704_100023523 3300005549 Bacteria 4027
150 Ga0068855_100073653 3300005563 Bacteria 3967
151 Ga0070664_100003932 3300005564 Bacteria 11986
152 Ga0070664_100016107 3300005564 Bacteria 6127
153 Ga0070664_100052511 3300005564 Bacteria 3453
154 Ga0068857_100046789 3300005577 Bacteria 3839
155 Ga0068854_100012109 3300005578 Bacteria 5641
156 Ga0068854_100064932 3300005578 Bacteria 2653
157 Ga0068856_100017956 3300005614 Bacteria 6859
158 Ga0068852_100381668 3300005616 Bacteria 1382
159 Ga0068852_100423327 3300005616 Bacteria 1314
160 Ga0068852_100557285 3300005616 Bacteria 1147
161 Ga0068852_100860267 3300005616 Bacteria 922
162 Ga0068859_100083674 3300005617 Bacteria 3234
163 Ga0068859_100216526 3300005617 Bacteria 2002
164 Ga0068864_100005258 3300005618 Bacteria 10611
165 Ga0068866_10025436 3300005718 Bacteria 2783
166 Ga0068861_100081818 3300005719 Bacteria 2529
167 Ga0068851_10084996 3300005834 Bacteria 1658
168 Ga0068851_10199993 3300005834 Bacteria 1115
169 Ga0068870_10013741 3300005840 Bacteria 3812
170 Ga0068870_10062228 3300005840 Bacteria 2009
171 Ga0068870_10268574 3300005840 Bacteria 1064
172 Ga0068863_100001368 3300005841 Bacteria 24235
173 Ga0068863_100067898 3300005841 Bacteria 3372
174 Ga0068863_100069165 3300005841 Bacteria 3339
175 Ga0068863_100114297 3300005841 Bacteria 2572
176 Ga0068863_100155443 3300005841 Bacteria 2190
177 Ga0068863_100224200 3300005841 Bacteria 1812
178 Ga0068863_100408123 3300005841 Bacteria 1329
179 Ga0068858_100006176 3300005842 Bacteria 11684
180 Ga0068858_100016320 3300005842 Bacteria 6976
181 Ga0068858_100100231 3300005842 Bacteria 2701
182 Ga0068858_100111857 3300005842 Bacteria 2550
183 Ga0068860_100004808 3300005843 Bacteria 13752
184 Ga0068860_100016563 3300005843 Bacteria 7189
185 Ga0068860_100029914 3300005843 Bacteria 5239
186 Ga0068860_100050139 3300005843 Bacteria 3975
187 Ga0068860_100091904 3300005843 Bacteria 2891
188 Ga0068860_100524444 3300005843 Bacteria 1185
189 Ga0068862_100050180 3300005844 Bacteria 3565
190 Ga0068862_100118197 3300005844 Bacteria 2334
191 Ga0068862_100166714 3300005844 Bacteria 1969
192 Ga0068862_100219208 3300005844 Bacteria 1722
193 Ga0075365_10001436 3300006038 Bacteria 10785
194 Ga0075365_10078426 3300006038 Bacteria 2233
195 Ga0075368_10000984 3300006042 Bacteria 8904
196 Ga0075368_10003446 3300006042 Bacteria 5281
197 Ga0075363_100121273 3300006048 Bacteria 1460
198 Ga0075363_100230677 3300006048 Bacteria 1063
199 Ga0075364_10251656 3300006051 Bacteria 1201
200 Ga0075432_10013808 3300006058 Bacteria 2747
201 Ga0070712_100024529 3300006175 Bacteria 3998
202 Ga0075362_10001700 3300006177 Bacteria 7137
203 Ga0075362_10002210 3300006177 Bacteria 6459
204 Ga0075362_10017702 3300006177 Bacteria 2939
205 Ga0075362_10064606 3300006177 Bacteria 1660
206 Ga0075367_10035836 3300006178 Bacteria 2874
207 Ga0075369_10106944 3300006186 Bacteria 1258
208 Ga0075366_10018446 3300006195 Bacteria 4028
209 Ga0075366_10019325 3300006195 Bacteria 3940
210 Ga0075366_10083898 3300006195 Bacteria 1904
211 Ga0075366_10116299 3300006195 Bacteria 1610
212 Ga0075366_10120596 3300006195 Bacteria 1580
213 Ga0075366_10127921 3300006195 Bacteria 1532
214 Ga0075366_10252156 3300006195 Bacteria 1076
215 Ga0097621_100008005 3300006237 Bacteria 7587
216 Ga0097621_100066231 3300006237 Bacteria 2975
217 Ga0097621_100667861 3300006237 Bacteria 955
218 Ga0075370_10001026 3300006353 Bacteria 11604
219 Ga0075370_10012303 3300006353 Bacteria 4518
220 Ga0075370_10013080 3300006353 Bacteria 4403
221 Ga0075370_10018238 3300006353 Bacteria 3806
222 Ga0075370_10119806 3300006353 Bacteria 1531
223 Ga0075370_10133975 3300006353 Bacteria 1446
224 Ga0068871_100000834 3300006358 Bacteria 20645
225 Ga0068871_100306256 3300006358 Bacteria 1396
226 Ga0068871_100315663 3300006358 Bacteria 1375
227 Ga0075428_100157357 3300006844 Bacteria 2467
228 Ga0075430_100129355 3300006846 Bacteria 2105
229 Ga0075431_100009702 3300006847 Bacteria 9672
230 Ga0075433_10005479 3300006852 Bacteria 9971
231 Ga0075434_100010081 3300006871 Bacteria 8848
232 Ga0068865_100003861 3300006881 Bacteria 8988
233 Ga0068865_100095099 3300006881 Bacteria 2170
234 Ga0097620_100083685 3300006931 Bacteria 3234
235 Ga0097620_100206606 3300006931 Bacteria 2049
236 Ga0097620_100216535 3300006931 Bacteria 2002
237 Ga0079104_1000008 3300006946 Bacteria 371223
238 Ga0099826_10000676 3300006948 Bacteria 17684
239 Ga0099826_10013619 3300006948 Bacteria 6145
240 Ga0099826_10142827 3300006948 Bacteria 1380
241 Ga0075435_100026800 3300007076 Bacteria 4501
242 Ga0105244_10120609 3300009036 Bacteria 1270
243 Ga0105250_10000002 3300009092 Bacteria 566949
244 Ga0105250_10000043 3300009092 Bacteria 129336
245 Ga0105240_10002428 3300009093 Bacteria 29958
246 Ga0105240_10033941 3300009093 Bacteria 6588
247 Ga0105240_10146257 3300009093 Bacteria 2820
248 Ga0111539_10568708 3300009094 Bacteria 1320
249 Ga0105245_10290998 3300009098 Bacteria 1600
250 Ga0105247_10055080 3300009101 Bacteria 2454
251 Ga0114129_10101400 3300009147 Bacteria 3983
252 Ga0114129_10581372 3300009147 Bacteria 1453
253 Ga0114129_11157898 3300009147 Bacteria 965
254 Ga0105243_10001109 3300009148 Bacteria 24446
255 Ga0105243_10019715 3300009148 Bacteria 5114
256 Ga0105243_10439369 3300009148 Bacteria 1221
257 Ga0105241_10089319 3300009174 Bacteria 2427
258 Ga0105241_10218219 3300009174 Bacteria 1601
259 Ga0105241_10707664 3300009174 Bacteria 920
260 Ga0105242_10001450 3300009176 Bacteria 18665
261 Ga0105248_10007765 3300009177 Bacteria 11773
262 Ga0105248_10017795 3300009177 Bacteria 7842
263 Ga0105248_10056706 3300009177 Bacteria 4395
264 Ga0105248_10396226 3300009177 Bacteria 1554
265 Ga0105237_10006305 3300009545 Bacteria 13189
266 Ga0105237_10082068 3300009545 Bacteria 3215
267 Ga0105237_10108996 3300009545 Bacteria 2760
268 Ga0105237_10123598 3300009545 Bacteria 2582
269 Ga0105237_10341609 3300009545 Bacteria 1501
270 Ga0105238_10001044 3300009551 Bacteria 28027
271 Ga0105238_10482816 3300009551 Bacteria 1239
272 Ga0105249_10405712 3300009553 Bacteria 1394
273 Ga0105249_10433299 3300009553 Bacteria 1351
274 Ga0105249_10701946 3300009553 Bacteria 1072
275 Ga0105239_10168139 3300010375 Bacteria 2452
276 Ga0105239_10429329 3300010375 Bacteria 1498
277 Ga0105246_10025728 3300011119 Bacteria 3838
278 Ga0157317_1002651 3300012475 Bacteria 1070
279 Ga0157373_10001146 3300013100 Bacteria 20311
280 Ga0157373_10009126 3300013100 Bacteria 7335
281 Ga0157373_10013023 3300013100 Bacteria 6103
282 Ga0157373_10235924 3300013100 Bacteria 1292
283 Ga0157371_10000004 3300013102 Bacteria 512593
284 Ga0157371_10004156 3300013102 Bacteria 12757
285 Ga0157371_10022060 3300013102 Bacteria 4670
286 Ga0157371_10142941 3300013102 Bacteria 1704
287 Ga0157370_10005765 3300013104 Bacteria 13841
288 Ga0157370_10015688 3300013104 Bacteria 7695
289 Ga0157369_10029638 3300013105 Bacteria 6045
290 Ga0157369_10193777 3300013105 Bacteria 2135
291 Ga0157369_10252200 3300013105 Bacteria 1841
292 Ga0157374_10003813 3300013296 Bacteria 12661
293 Ga0157374_10339524 3300013296 Bacteria 1491
294 Ga0157378_10007092 3300013297 Bacteria 9785
295 Ga0157378_10173463 3300013297 Bacteria 2024
296 Ga0157378_10296299 3300013297 Bacteria 1564
297 Ga0163162_10003831 3300013306 Bacteria 14422
298 Ga0163162_10006954 3300013306 Bacteria 10971
299 Ga0163162_10018668 3300013306 Bacteria 6794
300 Ga0163162_10227800 3300013306 Bacteria 1994
301 Ga0157372_10002798 3300013307 Bacteria 18848
302 Ga0157375_10003753 3300013308 Bacteria 13176
303 Ga0157375_10135518 3300013308 Bacteria 2586
304 Ga0157375_10172413 3300013308 Bacteria 2311
305 Ga0157375_10269029 3300013308 Bacteria 1866
306 Ga0163163_10014074 3300014325 Bacteria 7345
307 Ga0157380_10264250 3300014326 Bacteria 1565
308 Ga0182008_10003519 3300014497 Bacteria 9426
309 Ga0182008_10055566 3300014497 Bacteria 1957
310 Ga0157377_10000010 3300014745 Bacteria 380929
311 Ga0157379_10000858 3300014968 Bacteria 24649
312 Ga0157379_10040595 3300014968 Bacteria 4154
313 Ga0157379_10155337 3300014968 Bacteria 2064
314 Ga0157376_10000986 3300014969 Bacteria 18545
315 Ga0157376_10766761 3300014969 Bacteria 975
316 Ga0182007_10001492 3300015262 Bacteria 12525
317 Ga0182007_10011260 3300015262 Bacteria 3485
318 Ga0163161_10001624 3300017792 Bacteria 16537
319 Ga0163161_10040137 3300017792 Bacteria 3361
320 Ga0163161_10050915 3300017792 Bacteria 2998
321 Ga0163161_10130220 3300017792 Bacteria 1897
322 Ga0163161_10171743 3300017792 Bacteria 1658
323 Ga0163161_10289032 3300017792 Bacteria 1288
324 Ga0207425_1003484 3300025245 Bacteria 5011
325 Ga0209677_100318 3300025253 Bacteria 31403
326 Ga0209129_1000168 3300025258 Bacteria 96922
327 Ga0209129_1000517 3300025258 Bacteria 27570
328 Ga0209565_1000078 3300025263 Bacteria 160838
329 Ga0209565_1000938 3300025263 Bacteria 15338
330 Ga0209565_1008820 3300025263 Bacteria 2610
331 Ga0209673_1000005 3300025273 Bacteria 692788
332 Ga0209673_1000627 3300025273 Bacteria 53883
333 Ga0209673_1001328 3300025273 Bacteria 24806
334 Ga0209673_1011889 3300025273 Bacteria 3550
335 Ga0209130_1000235 3300025284 Bacteria 71379
336 Ga0209130_1001063 3300025284 Bacteria 20689
337 Ga0209130_1001335 3300025284 Bacteria 16703
338 Ga0209675_1000239 3300025291 Bacteria 54796
339 Ga0209675_1000393 3300025291 Bacteria 36339
340 Ga0209675_1000413 3300025291 Bacteria 35115
341 Ga0209675_1000470 3300025291 Bacteria 30953
342 Ga0209675_1000759 3300025291 Bacteria 21642
343 Ga0209675_1005090 3300025291 Bacteria 5615
344 Ga0209676_1000012 3300025292 Bacteria 841431
345 Ga0209676_1000040 3300025292 Bacteria 438184
346 Ga0209676_1007063 3300025292 Bacteria 5381
347 Ga0209676_1010033 3300025292 Bacteria 4000
348 Ga0209676_1011558 3300025292 Bacteria 3549
349 Ga0209676_1012115 3300025292 Bacteria 3418
350 Ga0209676_1020433 3300025292 Bacteria 2249
351 Ga0209676_1027731 3300025292 Bacteria 1777
352 Ga0209025_1000010 3300025294 Bacteria 986612
353 Ga0209025_1000378 3300025294 Bacteria 92632
354 Ga0209025_1001501 3300025294 Bacteria 30085
355 Ga0209025_1002982 3300025294 Bacteria 16775
356 Ga0209025_1004003 3300025294 Bacteria 13219
357 Ga0209025_1004618 3300025294 Bacteria 11782
358 Ga0209025_1010852 3300025294 Bacteria 6106
359 Ga0209025_1054216 3300025294 Bacteria 1563
360 Ga0209025_1060801 3300025294 Bacteria 1415
361 Ga0209564_1000034 3300025295 Bacteria 444284
362 Ga0209564_1000157 3300025295 Bacteria 164758
363 Ga0209564_1000862 3300025295 Bacteria 40422
364 Ga0209564_1001365 3300025295 Bacteria 25619
365 Ga0209758_1000042 3300025297 Bacteria 407145
366 Ga0209758_1000220 3300025297 Bacteria 123972
367 Ga0209758_1015827 3300025297 Bacteria 3876
368 Ga0209050_1000021 3300025298 Bacteria 574406
369 Ga0209050_1001833 3300025298 Bacteria 20672
370 Ga0209050_1036466 3300025298 Bacteria 1434
371 Ga0209256_1000026 3300025299 Bacteria 432835
372 Ga0209256_1000182 3300025299 Bacteria 122471
373 Ga0209256_1000549 3300025299 Bacteria 53852
374 Ga0209256_1002051 3300025299 Bacteria 17856
375 Ga0209256_1004580 3300025299 Bacteria 8566
376 Ga0207426_1000055 3300025302 Bacteria 374450
377 Ga0207426_1000079 3300025302 Bacteria 314709
378 Ga0207426_1030274 3300025302 Bacteria 1776
379 Ga0209051_1000111 3300025303 Bacteria 153024
380 Ga0209051_1000286 3300025303 Bacteria 81784
381 Ga0209051_1000376 3300025303 Bacteria 63531
382 Ga0209051_1005061 3300025303 Bacteria 7844
383 Ga0209257_1000043 3300025304 Bacteria 512127
384 Ga0209257_1000215 3300025304 Bacteria 136521
385 Ga0209257_1009727 3300025304 Bacteria 5054
386 Ga0209257_1010745 3300025304 Bacteria 4556
387 Ga0209257_1013240 3300025304 Bacteria 3696
388 Ga0209257_1028939 3300025304 Bacteria 1814
389 Ga0207697_10003403 3300025315 Bacteria 7896
390 Ga0207697_10128192 3300025315 Bacteria 1095
391 Ga0207656_10046411 3300025321 Bacteria 1863
392 Ga0207656_10078344 3300025321 Bacteria 1481
393 Ga0207696_1000239 3300025711 Bacteria 75936
394 Ga0207696_1000509 3300025711 Bacteria 32376
395 Ga0207655_1001999 3300025728 Bacteria 17332
396 Ga0207642_10071734 3300025899 Bacteria 1651
397 Ga0207710_10023946 3300025900 Bacteria 2627
398 Ga0207680_10043785 3300025903 Bacteria 2628
399 Ga0207645_10000157 3300025907 Bacteria 53374
400 Ga0207645_10029420 3300025907 Bacteria 3542
401 Ga0207645_10120119 3300025907 Bacteria 1706
402 Ga0207645_10130797 3300025907 Bacteria 1633
403 Ga0207643_10004227 3300025908 Bacteria 7735
404 Ga0207643_10032933 3300025908 Bacteria 2898
405 Ga0207684_10023462 3300025910 Bacteria 5267
406 Ga0207684_10106152 3300025910 Bacteria 2402
407 Ga0207654_10025190 3300025911 Bacteria 3206
408 Ga0207654_10150673 3300025911 Bacteria 1493
409 Ga0207707_10114127 3300025912 Bacteria 2361
410 Ga0207707_10224069 3300025912 Bacteria 1637
411 Ga0207695_10021259 3300025913 Bacteria 7410
412 Ga0207695_10187093 3300025913 Bacteria 1989
413 Ga0207671_10026895 3300025914 Bacteria 4304
414 Ga0207671_10092039 3300025914 Bacteria 2286
415 Ga0207671_10208610 3300025914 Bacteria 1528
416 Ga0207671_10255177 3300025914 Bacteria 1379
417 Ga0207693_10004790 3300025915 Bacteria 11380
418 Ga0207660_10199803 3300025917 Bacteria 1561
419 Ga0207657_10003501 3300025919 Bacteria 16765
420 Ga0207649_10201701 3300025920 Bacteria 1406
421 Ga0207652_10052455 3300025921 Bacteria 3500
422 Ga0207646_10030223 3300025922 Bacteria 4914
423 Ga0207681_10004068 3300025923 Bacteria 9061
424 Ga0207681_10086435 3300025923 Bacteria 2228
425 Ga0207681_10120799 3300025923 Bacteria 1921
426 Ga0207694_10166408 3300025924 Bacteria 1783
427 Ga0207694_10222900 3300025924 Bacteria 1539
428 Ga0207650_10080620 3300025925 Bacteria 2468
429 Ga0207650_10082918 3300025925 Bacteria 2435
430 Ga0207650_10100420 3300025925 Bacteria 2226
431 Ga0207650_10347855 3300025925 Bacteria 1219
432 Ga0207659_10002948 3300025926 Bacteria 10131
433 Ga0207687_10148873 3300025927 Bacteria 1784
434 Ga0207644_10011516 3300025931 Bacteria 5855
435 Ga0207644_10019823 3300025931 Bacteria 4566
436 Ga0207644_10093030 3300025931 Bacteria 2250
437 Ga0207644_10238755 3300025931 Bacteria 1446
438 Ga0207644_10258482 3300025931 Bacteria 1392
439 Ga0207690_10026090 3300025932 Bacteria 3677
440 Ga0207690_10150674 3300025932 Bacteria 1724
441 Ga0207706_10002095 3300025933 Bacteria 19518
442 Ga0207706_10009799 3300025933 Bacteria 8792
443 Ga0207706_10137720 3300025933 Bacteria 2147
444 Ga0207686_10017732 3300025934 Bacteria 4016
445 Ga0207709_10000070 3300025935 Bacteria 183020
446 Ga0207709_10000627 3300025935 Bacteria 28968
447 Ga0207709_10011114 3300025935 Bacteria 4964
448 Ga0207709_10038438 3300025935 Bacteria 2850
449 Ga0207709_10064386 3300025935 Bacteria 2302
450 Ga0207669_10022300 3300025937 Bacteria 3361
451 Ga0207669_10053034 3300025937 Bacteria 2440
452 Ga0207704_10253566 3300025938 Bacteria 1322
453 Ga0207665_10544825 3300025939 Bacteria 901
454 Ga0207691_10000249 3300025940 Bacteria 53276
455 Ga0207691_10105747 3300025940 Bacteria 2507
456 Ga0207691_10139540 3300025940 Bacteria 2137
457 Ga0207691_10205582 3300025940 Bacteria 1712
458 Ga0207691_10400820 3300025940 Bacteria 1170
459 Ga0207711_10081928 3300025941 Bacteria 2820
460 Ga0207689_10003129 3300025942 Bacteria 15185
461 Ga0207689_10009790 3300025942 Bacteria 8258
462 Ga0207689_10009937 3300025942 Bacteria 8206
463 Ga0207689_10368165 3300025942 Bacteria 1196
464 Ga0207689_10404320 3300025942 Bacteria 1138
465 Ga0207679_10010256 3300025945 Bacteria 6027
466 Ga0207667_10061918 3300025949 Bacteria 3914
467 Ga0207667_10230963 3300025949 Bacteria 1894
468 Ga0207667_10384419 3300025949 Bacteria 1430
469 Ga0207667_10495141 3300025949 Bacteria 1240
470 Ga0207651_10014375 3300025960 Bacteria 4567
471 Ga0207651_10074685 3300025960 Bacteria 2415
472 Ga0207651_10201659 3300025960 Bacteria 1595
473 Ga0207651_10256576 3300025960 Bacteria 1433
474 Ga0207651_10273028 3300025960 Bacteria 1393
475 Ga0207651_10629915 3300025960 Bacteria 940
476 Ga0207668_10013050 3300025972 Bacteria 5104
477 Ga0207668_10099520 3300025972 Bacteria 2157
478 Ga0207668_10110796 3300025972 Bacteria 2059
479 Ga0207668_10173237 3300025972 Bacteria 1694
480 Ga0207668_10466643 3300025972 Bacteria 1080
481 Ga0207640_10005591 3300025981 Bacteria 6854
482 Ga0207640_10019565 3300025981 Bacteria 4003
483 Ga0207640_10112596 3300025981 Bacteria 1932
484 Ga0207658_10001272 3300025986 Bacteria 19944
485 Ga0207658_10040512 3300025986 Bacteria 3368
486 Ga0207658_10172443 3300025986 Bacteria 1783
487 Ga0207658_10181466 3300025986 Bacteria 1742
488 Ga0207658_10381568 3300025986 Bacteria 1234
489 Ga0207658_10453660 3300025986 Bacteria 1135
490 Ga0207677_10046514 3300026023 Bacteria 2906
491 Ga0207677_10398099 3300026023 Bacteria 1167
492 Ga0207703_10002253 3300026035 Bacteria 16857
493 Ga0207703_10023868 3300026035 Bacteria 4809
494 Ga0207703_10113812 3300026035 Bacteria 2313
495 Ga0207703_10166256 3300026035 Bacteria 1936
496 Ga0207639_10018991 3300026041 Bacteria 4894
497 Ga0207639_10068258 3300026041 Bacteria 2769
498 Ga0207639_10293762 3300026041 Bacteria 1434
499 Ga0207639_10320494 3300026041 Bacteria 1376
500 Ga0207678_10012240 3300026067 Bacteria 7533
501 Ga0207678_10041936 3300026067 Bacteria 3967
502 Ga0207678_10100982 3300026067 Bacteria 2464
503 Ga0207708_10184156 3300026075 Bacteria 1659
504 Ga0207702_10019967 3300026078 Bacteria 5550
505 Ga0207702_10445467 3300026078 Bacteria 1256
506 Ga0207641_10000374 3300026088 Bacteria 53088
507 Ga0207641_10030209 3300026088 Bacteria 4487
508 Ga0207641_10135882 3300026088 Bacteria 2213
509 Ga0207641_10144290 3300026088 Bacteria 2151
510 Ga0207641_10159602 3300026088 Bacteria 2049
511 Ga0207641_10842171 3300026088 Bacteria 909
512 Ga0207648_10000002 3300026089 Bacteria 307909
513 Ga0207648_10000523 3300026089 Bacteria 42961
514 Ga0207648_10001083 3300026089 Bacteria 30493
515 Ga0207648_10013639 3300026089 Bacteria 7544
516 Ga0207648_10021215 3300026089 Bacteria 5839
517 Ga0207648_10028050 3300026089 Bacteria 4993
518 Ga0207648_10101597 3300026089 Bacteria 2520
519 Ga0207648_10213060 3300026089 Bacteria 1715
520 Ga0207648_10292465 3300026089 Bacteria 1459
521 Ga0207648_10347428 3300026089 Bacteria 1337
522 Ga0207676_10008789 3300026095 Bacteria 7187
523 Ga0207674_10000118 3300026116 Bacteria 92408
524 Ga0207674_10026157 3300026116 Bacteria 6208
525 Ga0207674_10063541 3300026116 Bacteria 3727
526 Ga0207675_100066282 3300026118 Bacteria 3375
527 Ga0207675_100075232 3300026118 Bacteria 3161
528 Ga0207675_100108631 3300026118 Bacteria 2616
529 Ga0207675_100445806 3300026118 Bacteria 1282
530 Ga0207683_10000476 3300026121 Bacteria 37318
531 Ga0207683_10040510 3300026121 Bacteria 4065
532 Ga0207683_10293128 3300026121 Bacteria 1488
533 Ga0207698_10037561 3300026142 Bacteria 3569
534 Ga0207698_10182797 3300026142 Bacteria 1859
535 Ga0207698_10478534 3300026142 Bacteria 1207
536 Ga0209281_1000029 3300027111 Bacteria 431495
537 Ga0209371_1000009 3300027312 Bacteria 963030
538 Ga0209371_1007734 3300027312 Bacteria 3686
539 Ga0209371_1036684 3300027312 Bacteria 1023
540 Ga0209282_1000052 3300027666 Bacteria 104317
541 Ga0209282_1000088 3300027666 Bacteria 66037
542 Ga0209282_1006186 3300027666 Bacteria 7418
543 Ga0209282_1043586 3300027666 Bacteria 2637
544 Ga0209813_10059153 3300027866 Bacteria 1219
545 Ga0268266_10004526 3300028379 Bacteria 13283
546 Ga0268266_10023108 3300028379 Bacteria 5292
547 Ga0268266_10050840 3300028379 Bacteria 3557
548 Ga0268266_10084658 3300028379 Bacteria 2769
549 Ga0268265_10004995 3300028380 Bacteria 9105
550 Ga0268265_10018279 3300028380 Bacteria 4856
551 Ga0268265_10018436 3300028380 Bacteria 4836
552 Ga0268265_10084594 3300028380 Bacteria 2515
553 Ga0268265_10104426 3300028380 Bacteria 2296
554 Ga0268265_10284785 3300028380 Bacteria 1480
555 Ga0268264_10008187 3300028381 Bacteria 8681
556 Ga0268264_10029798 3300028381 Bacteria 4472
557 Ga0268264_10034214 3300028381 Bacteria 4178
558 Ga0265337_1003809 3300028556 Bacteria 6412
559 Ga0265326_10002334 3300028558 Bacteria 6410
560 Ga0265319_1005177 3300028563 Bacteria 6303
561 Ga0265334_10001347 3300028573 Bacteria 11870
562 Ga0265318_10005245 3300028577 Bacteria 6101
563 Ga0265323_10000539 3300028653 Bacteria 20989
564 Ga0265322_10002074 3300028654 Bacteria 6288
565 Ga0265336_10000483 3300028666 Bacteria 23547
566 Ga0307517_10070639 3300028786 Bacteria 3142
567 Ga0307515_10000049 3300028794 Bacteria 278611
568 Ga0307515_10000066 3300028794 Bacteria 244076
569 Ga0307515_10000219 3300028794 Bacteria 141532
570 Ga0307515_10027455 3300028794 Bacteria 9730
571 Ga0307515_10028862 3300028794 Bacteria 9409
572 Ga0307515_10040292 3300028794 Bacteria 7391
573 Ga0307515_10063405 3300028794 Bacteria 5192
574 Ga0307515_10254487 3300028794 Bacteria 1503
575 Ga0307515_10263486 3300028794 Bacteria 1456
576 Ga0265338_10000081 3300028800 Bacteria 176402
577 Ga0265324_10002127 3300029957 Bacteria 10424
578 Ga0268256_1000010 3300030500 Bacteria 963034
579 Ga0268256_1007407 3300030500 Bacteria 3921
580 Ga0268256_1013945 3300030500 Bacteria 2409
581 Ga0307512_10061292 3300030522 Bacteria 2899
582 Ga0307512_10062849 3300030522 Bacteria 2844
583 Ga0316177_1112440 3300030731 Bacteria 1323
584 Ga0316176_1185062 3300030732 Bacteria 2360
585 Ga0314311_1026270 3300030733 Bacteria 4965
586 Ga0316178_1074219 3300030735 Bacteria 2195
587 Ga0316180_1168541 3300030736 Bacteria 2297
588 Ga0316183_1066146 3300030742 Bacteria 2729
589 Ga0316181_1019403 3300030744 Bacteria 1180
590 Ga0316181_1022414 3300030744 Bacteria 5916
591 Ga0316181_1085438 3300030744 Bacteria 4928
592 Ga0316182_1245277 3300030745 Bacteria 3003
593 Ga0316182_1429538 3300030745 Bacteria 2016
594 Ga0265327_10005949 3300031251 Bacteria 9945
595 Ga0307513_10000012 3300031456 Bacteria 328865
596 Ga0307513_10030448 3300031456 Bacteria 6131
597 Ga0307513_10221759 3300031456 Bacteria 1711
598 Ga0307513_10339883 3300031456 Bacteria 1252
599 Ga0307509_10003715 3300031507 Bacteria 22843
600 Ga0307509_10004792 3300031507 Bacteria 19239
601 Ga0307509_10018758 3300031507 Bacteria 7922
602 Ga0307509_10114365 3300031507 Bacteria 2693
603 Ga0307509_10121145 3300031507 Bacteria 2593
604 Ga0307408_100004608 3300031548 Bacteria 9320
605 Ga0307408_100078880 3300031548 Bacteria 2455
606 Ga0307408_100171434 3300031548 Bacteria 1733
607 Ga0307408_100288482 3300031548 Bacteria 1369
608 Ga0307508_10000222 3300031616 Bacteria 69029
609 Ga0307508_10003666 3300031616 Bacteria 15394
610 Ga0307508_10098088 3300031616 Bacteria 2522
611 Ga0307514_10001095 3300031649 Bacteria 37913
612 Ga0307514_10010830 3300031649 Bacteria 7616
613 Ga0307514_10019111 3300031649 Bacteria 5611
614 Ga0307514_10134819 3300031649 Bacteria 1692
615 Ga0307516_10079017 3300031730 Bacteria 3135
616 Ga0307516_10152400 3300031730 Bacteria 2070
617 Ga0307516_10180443 3300031730 Bacteria 1845
618 Ga0307516_10332758 3300031730 Bacteria 1187
619 Ga0307405_10055501 3300031731 Bacteria 2479
620 Ga0307405_10301034 3300031731 Bacteria 1216
621 Ga0307413_10046593 3300031824 Bacteria 2579
622 Ga0307406_10000768 3300031901 Bacteria 18002
623 Ga0307412_10001927 3300031911 Bacteria 11464
624 Ga0307412_10023449 3300031911 Bacteria 3797
625 Ga0307412_10139293 3300031911 Bacteria 1774
626 Ga0307412_10147293 3300031911 Bacteria 1732
627 Ga0307412_10157277 3300031911 Bacteria 1684
628 Ga0307416_100079319 3300032002 Bacteria 2766
629 Ga0307416_100090048 3300032002 Bacteria 2629
630 Ga0307416_100096710 3300032002 Bacteria 2554
631 Ga0307416_100258707 3300032002 Bacteria 1700
632 Ga0307416_100933182 3300032002 Bacteria 969
633 Ga0307411_10171535 3300032005 Bacteria 1636
634 Ga0307510_10000779 3300033180 Bacteria 32991
635 Ga0307510_10004087 3300033180 Bacteria 17118
636 Ga0307510_10208180 3300033180 Bacteria 1481
637 Ga0373930_0010086 3300034816 Bacteria 1682
638 Ga0373931_0009521 3300035691 Bacteria 4645
639 Ga0373931_0020204 3300035691 Bacteria 3330
640 Ga0373927_0156135 3300035695 Bacteria 1494
641 Ga0373937_0092465 3300036401 Bacteria 2804
642 Ga0373937_0548175 3300036401 Bacteria 1098
643 Ga0373925_0112886 3300037068 Bacteria 2101
644 Ga0395899_0007556 3300037312 Bacteria 8392
645 Ga0395900_0003906 3300037418 Bacteria 15918
646 Ga0395900_0387907 3300037418 Bacteria 1363
647 Ga0395898_0013566 3300037466 Bacteria 8386
648 Ga0395898_0290977 3300037466 Bacteria 1558
649 Ga0395905_0004967 3300037471 Bacteria 13702
650 Ga0395905_0046704 3300037471 Bacteria 4060
651 Ga0395905_0076516 3300037471 Bacteria 3136
652 Ga0395905_0133441 3300037471 Bacteria 2335
653 Ga0395905_0137255 3300037471 Bacteria 2301
654 Ga0395905_0155861 3300037471 Bacteria 2148
655 Ga0395905_0419516 3300037471 Bacteria 1234
656 Ga0395901_0098596 3300038443 Bacteria 3064
657 Ga0395901_0321027 3300038443 Bacteria 1602
658 Ga0395901_0737347 3300038443 Bacteria 979
659 Ga0436365_1170862 3300039437 Bacteria 1318
660 Ga0439436_0001183 3300041404 Bacteria 7408
661 Ga0439436_0043738 3300041404 Bacteria 1277
662 Ga0439466_0065685 3300041411 Bacteria 1162
663 Ga0439465_0007105 3300041413 Bacteria 3559
664 Ga0439465_0054294 3300041413 Bacteria 1318
665 Ga0451839_0812530 3300041496 Bacteria 897
666 Ga0439445_0041638 3300042004 Bacteria 1221
667 Ga0439449_0000862 3300042007 Bacteria 11820
668 Ga0439449_0000864 3300042007 Bacteria 11814
669 Ga0439449_0018255 3300042007 Bacteria 2632
670 Ga0439449_0036707 3300042007 Bacteria 1823
671 Ga0439452_005795 3300042010 Bacteria 3944
672 Ga0439452_006476 3300042010 Bacteria 3667
673 Ga0450894_002833 3300042131 Bacteria 2302
674 Ga0450899_002031 3300042135 Bacteria 2222
675 Ga0450906_005940 3300042145 Bacteria 2484
676 Ga0439446_0087324 3300042156 Bacteria 973
677 Ga0450908_011714 3300042184 Bacteria 1601
678 Ga0450908_016073 3300042184 Bacteria 1337
679 Ga0439434_0047276 3300042435 Bacteria 1329
680 Ga0439434_0078644 3300042435 Bacteria 1045
681 Ga0451577_0076658 3300042876 Bacteria 2981
682 Ga0451577_0110605 3300042876 Bacteria 2458
683 Ga0451577_0183167 3300042876 Bacteria 1888
684 Ga0453683_0001822 3300044673 Bacteria 17588
685 Ga0453683_0202975 3300044673 Bacteria 1259
686 Ga0451576_0008457 3300045051 Bacteria 12084
687 Ga0451576_0529392 3300045051 Bacteria 1238
688 Ga0495592_0008519 3300046454 Bacteria 7698
689 Ga0495603_0053146 3300046455 Bacteria 2404
690 Ga0495638_0271350 3300046460 Bacteria 926
691 Ga0495580_0178313 3300046472 Bacteria 1467
692 Ga0495605_0038060 3300046474 Bacteria 2415
693 Ga0495596_0002574 3300046500 Bacteria 9633
694 Ga0495596_0012021 3300046500 Bacteria 3715
695 Ga0495607_0000044 3300046501 Bacteria 125410
696 Ga0495607_0027544 3300046501 Bacteria 3512
697 Ga0495606_0065195 3300046507 Bacteria 2315
698 Ga0495610_0006580 3300046512 Bacteria 7942
699 Ga0495616_0019277 3300046513 Bacteria 3724
700 Ga0495620_0134320 3300046515 Bacteria 970
701 Ga0495631_0000416 3300046518 Bacteria 29385
702 Ga0495654_0012062 3300046530 Bacteria 4655
703 Ga0495654_0099313 3300046530 Bacteria 1342
704 Ga0495609_0036164 3300046538 Bacteria 2231
705 Ga0495621_0060229 3300046539 Bacteria 1376
706 Ga0495656_0003313 3300046615 Bacteria 5436
707 Ga0495625_0000778 3300046660 Bacteria 44311
708 Ga0495625_0076361 3300046660 Bacteria 2342
709 Ga0495659_0021836 3300046664 Bacteria 2160
710 Ga0495588_0102778 3300046674 Bacteria 1502
711 Ga0495658_0119510 3300046683 Bacteria 1593
712 Ga0495624_0069842 3300046690 Bacteria 2187
713 Ga0495671_0004533 3300046692 Bacteria 8286
714 Ga0495671_0057225 3300046692 Bacteria 1929
715 Ga0495636_0040348 3300047318 Bacteria 1935
716 Ga0495676_0013984 3300047321 Bacteria 7189
717 Ga0495676_0047327 3300047321 Bacteria 3478
718 Ga0495681_0003812 3300047470 Bacteria 10443
719 Ga0495681_0008367 3300047470 Bacteria 6494
720 Ga0495686_0002427 3300047472 Bacteria 17622
721 Ga0495593_0021590 3300047673 Bacteria 3593
722 Ga0495614_0006317 3300048089 Bacteria 5324
723 Ga0496100_0130749 3300048903 Bacteria 1768
724 Ga0496100_0189394 3300048903 Bacteria 1493
725 Ga0496101_0193685 3300048904 Bacteria 1569
726 Ga0496102_0009393 3300048905 Bacteria 8402
727 Ga0496102_0450163 3300048905 Bacteria 1208
728 Ga0496104_0491641 3300048907 Bacteria 1138
729 Ga0496105_0006491 3300048908 Bacteria 8992
730 Ga0496106_0036886 3300048909 Bacteria 3656
731 Ga0496106_0230870 3300048909 Bacteria 1477
732 Ga0496108_0505781 3300048911 Bacteria 1055
733 Ga0496109_0031971 3300048912 Bacteria 4728
734 Ga0496110_0017408 3300048913 Bacteria 6012
735 Ga0496112_0012289 3300048915 Bacteria 7863
736 Ga0496112_0078957 3300048915 Bacteria 3255
737 Ga0496113_0143138 3300048916 Bacteria 1882
738 Ga0496113_0292602 3300048916 Bacteria 1303
739 Ga0496116_0000395 3300048919 Bacteria 63403
740 Ga0496116_0014094 3300048919 Bacteria 6402
741 Ga0496116_0024710 3300048919 Bacteria 4434
742 Ga0496116_0050323 3300048919 Bacteria 2777
743 Ga0496117_0000002 3300048920 Bacteria 2483758
744 Ga0496117_0036934 3300048920 Bacteria 3647
745 Ga0496117_0037706 3300048920 Bacteria 3596
746 Ga0496118_0001167 3300048921 Bacteria 40506
747 Ga0496118_0024886 3300048921 Bacteria 5153
748 Ga0496118_0054541 3300048921 Bacteria 3026
749 Ga0496119_0041241 3300048922 Bacteria 2942
750 Ga0496120_0000498 3300048923 Bacteria 61391
751 Ga0496120_0053650 3300048923 Bacteria 2289
752 Ga0496121_0011713 3300048924 Bacteria 9682
753 Ga0496121_0017580 3300048924 Bacteria 7290
754 Ga0496121_0042392 3300048924 Bacteria 3960
755 Ga0496121_0223609 3300048924 Bacteria 1324
756 Ga0496121_0229354 3300048924 Bacteria 1302
757 Ga0496121_0253661 3300048924 Bacteria 1218
758 Ga0496122_0000001 3300048925 Bacteria 1827766
759 Ga0496122_0039545 3300048925 Bacteria 3760
760 Ga0496122_0077531 3300048925 Bacteria 2332
761 Ga0496122_0083412 3300048925 Bacteria 2216
762 Ga0496122_0170936 3300048925 Bacteria 1310
763 Ga0496123_0000001 3300048926 Bacteria 1831497
764 Ga0496123_0039243 3300048926 Bacteria 3314
765 Ga0496123_0122784 3300048926 Bacteria 1456
766 Ga0496123_0138635 3300048926 Bacteria 1334
767 Ga0496123_0188335 3300048926 Bacteria 1070
768 Ga0496124_0000178 3300048927 Bacteria 126118
769 Ga0496124_0005665 3300048927 Bacteria 13932
770 Ga0496124_0242842 3300048927 Bacteria 1338
771 Ga0496125_0007258 3300048928 Bacteria 11808
772 Ga0496125_0053330 3300048928 Bacteria 3316
773 Ga0496125_0076142 3300048928 Bacteria 2592
774 Ga0496125_0172756 3300048928 Bacteria 1450
775 Ga0496126_0001831 3300048929 Bacteria 31033
776 Ga0496126_0030554 3300048929 Bacteria 5101
777 Ga0496126_0168533 3300048929 Bacteria 1867
778 Ga0496126_0227331 3300048929 Bacteria 1565
779 Ga0501298_002724 3300049521 Bacteria 2696
780 Ga0501031_0019906 3300049568 Bacteria 4374
781 Ga0501033_0482073 3300049570 Bacteria 859
782 Ga0501034_0003224 3300049571 Bacteria 18671
783 Ga0501037_0044179 3300049573 Bacteria 3273
784 Ga0501037_0044246 3300049573 Bacteria 3269
785 Ga0501048_0033542 3300049582 Bacteria 3708
786 Ga0501068_0056555 3300049584 Bacteria 2378
787 Ga0501072_0344877 3300049588 Bacteria 1183
788 Ga0501075_0099242 3300049591 Bacteria 2211
789 Ga0501077_0013625 3300049593 Bacteria 5098
790 Ga0501079_0016435 3300049741 Bacteria 5651
791 Ga0501079_0204136 3300049741 Bacteria 1544
792 Ga0501079_0338838 3300049741 Bacteria 1178
793 Ga0501080_0027985 3300049742 Bacteria 5242
794 Ga0501081_0087845 3300049743 Bacteria 2184
795 Ga0501035_0402716 3300049822 Bacteria 1138
796 Ga0501044_0046553 3300049823 Bacteria 4489
797 Ga0501045_0036108 3300049824 Bacteria 3588
798 nmdc:mga03683_123546_c1 3300050489 Bacteria 1153
799 nmdc:mga00v17_1172_c1 3300050491 Bacteria 13780
800 nmdc:mga00v17_128474_c1 3300050491 Bacteria 1618
801 nmdc:mga0yw44_186_c1 3300050492 Bacteria 21913
802 nmdc:mga0yw44_193615_c1 3300050492 Bacteria 1341
803 nmdc:mga0k408_119452_c1 3300050493 Bacteria 1561
804 nmdc:mga0k408_124410_c1 3300050493 Bacteria 1529
805 nmdc:mga0k408_12727_c2 3300050493 Bacteria 4317
806 nmdc:mga0k408_13028_c1 3300050493 Bacteria 4554
807 nmdc:mga0k408_19481_c1 3300050493 Bacteria 3793
808 nmdc:mga0k408_199846_c1 3300050493 Bacteria 1193
809 nmdc:mga0k408_48052_c1 3300050493 Bacteria 2467
810 nmdc:mga0k408_63888_c1 3300050493 Bacteria 2142
811 nmdc:mga0k408_90586_c1 3300050493 Bacteria 1796
812 nmdc:mga06z11_18532_c1 3300050494 Bacteria 3181
813 nmdc:mga06z11_256469_c1 3300050494 Bacteria 1031
814 nmdc:mga04h51_70443_c1 3300050495 Bacteria 1219
815 nmdc:mga07m45_111639_c1 3300050496 Bacteria 1575
816 nmdc:mga07m45_11542_c1 3300050496 Bacteria 4646
817 nmdc:mga07m45_17530_c1 3300050496 Bacteria 3848
818 nmdc:mga07m45_2900_c1 3300050496 Bacteria 8127
819 nmdc:mga07m45_3025_c1 3300050496 Bacteria 8018
820 nmdc:mga07m45_48625_c1 3300050496 Bacteria 2386
821 nmdc:mga07m45_9895_c1 3300050496 Bacteria 4666
822 nmdc:mga05p37_100008_c1 3300050507 Bacteria 3571
823 nmdc:mga05p37_325811_c1 3300050507 Bacteria 1816
824 nmdc:mga06r32_27536_c1 3300050510 Bacteria 5311
825 nmdc:mga0n895_8945_c1 3300050512 Bacteria 8730
826 nmdc:mga0rr50_116087_c1 3300050513 Bacteria 2125
827 nmdc:mga0rr50_357947_c1 3300050513 Bacteria 1228
828 nmdc:mga0a205_207545_c1 3300050515 Bacteria 1848
829 nmdc:mga0a205_22451_c1 3300050515 Bacteria 5978
830 Ga0500610_0002372 3300053079 Bacteria 6905
831 Ga0500610_0108139 3300053079 Bacteria 1432
832 Ga0500578_0062342 3300053086 Bacteria 2380
833 Ga0500643_038555 3300053087 Bacteria 1416
834 Ga0500651_0000470 3300053093 Bacteria 21263
835 Ga0500651_0079981 3300053093 Bacteria 2025
836 Ga0500650_0078255 3300053098 Bacteria 1546
837 Ga0500560_000863 3300053107 Bacteria 4726
838 Ga0500571_073509 3300053110 Bacteria 1717
839 Ga0500572_001032 3300053111 Bacteria 8341
840 Ga0500593_093443 3300053117 Bacteria 1268
841 Ga0500607_011326 3300053121 Bacteria 5278
842 Ga0500607_116954 3300053121 Bacteria 1297
843 Ga0500652_063337 3300053131 Bacteria 1526
844 Ga0500658_0001324 3300053134 Bacteria 10022
845 Ga0500559_0000020 3300053136 Bacteria 134858
846 Ga0500559_0001277 3300053136 Bacteria 14696
847 Ga0500561_0000531 3300053137 Bacteria 6163
848 Ga0500568_0012823 3300053139 Bacteria 3841
849 Ga0500577_0108503 3300053142 Bacteria 1143
850 Ga0500616_0079303 3300053153 Bacteria 1654
851 Ga0500616_0115331 3300053153 Bacteria 1291
852 Ga0500622_0018225 3300053156 Bacteria 3733
853 Ga0500627_0009524 3300053158 Bacteria 3501
854 Ga0500634_0104192 3300053161 Bacteria 1413
855 Ga0500639_015544 3300053163 Bacteria 4008
856 Ga0500645_003541 3300053730 Bacteria 6295
857 Ga0500596_012269 3300053735 Bacteria 1301
858 Ga0500587_000608 3300053739 Bacteria 4478
859 Ga0501084_0020078 3300054114 Bacteria 5571
860 Ga0466962_0088956 3300061719 Bacteria 1479
861 Ga0530510_0066933 3300061734 Bacteria 2606

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031911 Ga0307412_10157277 Ga0307412_101572772 204
2 3300027666 Ga0209282_1000052 Ga0209282_100005240 209
3 3300037466 Ga0395898_0290977 Ga0395898_0290977_79_855 215
4 3300038443 Ga0395901_0321027 Ga0395901_0321027_474_1250 215
5 3300026089 Ga0207648_10347428 Ga0207648_103474282 219
6 3300049568 Ga0501031_0019906 Ga0501031_0019906_3057_3890 219
7 3300049573 Ga0501037_0044246 Ga0501037_0044246_200_1033 219
8 3300049582 Ga0501048_0033542 Ga0501048_0033542_2661_3494 219
9 3300049584 Ga0501068_0056555 Ga0501068_0056555_1481_2314 219
10 3300049588 Ga0501072_0344877 Ga0501072_0344877_89_922 219
11 3300049741 Ga0501079_0338838 Ga0501079_0338838_60_893 219
12 3300049823 Ga0501044_0046553 Ga0501044_0046553_3308_4147 219
13 3300049824 Ga0501045_0036108 Ga0501045_0036108_215_1048 219
14 3300003792 Ga0055540_1011011 Ga0055540_10110113 221
15 3300005338 Ga0068868_100622188 Ga0068868_1006221881 221
16 3300005340 Ga0070689_100134486 Ga0070689_1001344863 221
17 3300005353 Ga0070669_100086513 Ga0070669_1000865132 221
18 3300005616 Ga0068852_100381668 Ga0068852_1003816682 221
19 3300005840 Ga0068870_10268574 Ga0068870_102685741 221
20 3300005843 Ga0068860_100524444 Ga0068860_1005244442 221
21 3300006177 Ga0075362_10064606 Ga0075362_100646062 221
22 3300006195 Ga0075366_10127921 Ga0075366_101279212 221
23 3300009177 Ga0105248_10007765 Ga0105248_1000776510 221
24 3300013308 Ga0157375_10172413 Ga0157375_101724133 221
25 3300025941 Ga0207711_10081928 Ga0207711_100819284 221
26 3300026075 Ga0207708_10184156 Ga0207708_101841562 221
27 3300026142 Ga0207698_10182797 Ga0207698_101827972 221
28 3300035691 Ga0373931_0020204 Ga0373931_0020204_1373_2236 221
29 3300048924 Ga0496121_0011713 Ga0496121_0011713_4486_5280 221
30 3300014497 Ga0182008_10003519 Ga0182008_100035192 222
31 3300015262 Ga0182007_10001492 Ga0182007_100014921 222
32 3300025292 Ga0209676_1020433 Ga0209676_10204332 222
33 3300030736 Ga0316180_1168541 Ga0316180_11685412 222
34 3300037471 Ga0395905_0046704 Ga0395905_0046704_471_1343 222
35 3300050493 nmdc:mga0k408_63888_c1 nmdc:mga0k408_63888_c1_1319_2098 222
36 3300050496 nmdc:mga07m45_111639_c1 nmdc:mga07m45_111639_c1_329_1189 222
37 3300009093 Ga0105240_10146257 Ga0105240_101462571 223
38 3300025253 Ga0209677_100318 Ga0209677_1003187 223
39 3300028794 Ga0307515_10000219 Ga0307515_1000021940 223
40 3300037471 Ga0395905_0137255 Ga0395905_0137255_1002_1874 223
41 3300038443 Ga0395901_0737347 Ga0395901_0737347_121_906 223
42 3300041413 Ga0439465_0007105 Ga0439465_0007105_2563_3426 223
43 3300042004 Ga0439445_0041638 Ga0439445_0041638_42_905 223
44 3300042007 Ga0439449_0018255 Ga0439449_0018255_741_1604 223
45 3300042010 Ga0439452_005795 Ga0439452_005795_533_1396 223
46 3300042156 Ga0439446_0087324 Ga0439446_0087324_40_903 223
47 3300048904 Ga0496101_0193685 Ga0496101_0193685_39_899 223
48 3300048924 Ga0496121_0017580 Ga0496121_0017580_4170_4946 223
49 3300048928 Ga0496125_0053330 Ga0496125_0053330_955_1731 223
50 3300053098 Ga0500650_0078255 Ga0500650_0078255_413_1186 223
51 3300005328 Ga0070676_10189479 Ga0070676_101894791 224
52 3300005468 Ga0070707_100100630 Ga0070707_1001006303 224
53 3300006177 Ga0075362_10017702 Ga0075362_100177023 224
54 3300025907 Ga0207645_10130797 Ga0207645_101307972 224
55 3300028794 Ga0307515_10063405 Ga0307515_100634052 224
56 3300046501 Ga0495607_0000044 Ga0495607_0000044_3010_3873 224
57 3300046660 Ga0495625_0076361 Ga0495625_0076361_339_1112 224
58 3300005364 Ga0070673_100143193 Ga0070673_1001431932 225
59 3300005367 Ga0070667_100007303 Ga0070667_1000073034 225
60 3300005617 Ga0068859_100216526 Ga0068859_1002165261 225
61 3300006042 Ga0075368_10003446 Ga0075368_100034462 225
62 3300006048 Ga0075363_100121273 Ga0075363_1001212732 225
63 3300006177 Ga0075362_10001700 Ga0075362_100017004 225
64 3300006178 Ga0075367_10035836 Ga0075367_100358362 225
65 3300006237 Ga0097621_100667861 Ga0097621_1006678611 225
66 3300006353 Ga0075370_10018238 Ga0075370_100182383 225
67 3300006931 Ga0097620_100216535 Ga0097620_1002165351 225
68 3300009174 Ga0105241_10707664 Ga0105241_107076641 225
69 3300009545 Ga0105237_10082068 Ga0105237_100820684 225
70 3300013306 Ga0163162_10227800 Ga0163162_102278002 225
71 3300017792 Ga0163161_10171743 Ga0163161_101717432 225
72 3300025914 Ga0207671_10092039 Ga0207671_100920392 225
73 3300025960 Ga0207651_10201659 Ga0207651_102016592 225
74 3300025981 Ga0207640_10112596 Ga0207640_101125963 225
75 3300025986 Ga0207658_10172443 Ga0207658_101724432 225
76 3300026067 Ga0207678_10100982 Ga0207678_101009822 225
77 3300027866 Ga0209813_10059153 Ga0209813_100591532 225
78 3300028794 Ga0307515_10028862 Ga0307515_100288628 225
79 3300031251 Ga0265327_10005949 Ga0265327_100059494 225
80 3300031911 Ga0307412_10139293 Ga0307412_101392932 225
81 3300032002 Ga0307416_100096710 Ga0307416_1000967101 225
82 3300042131 Ga0450894_002833 Ga0450894_002833_119_979 225
83 3300042135 Ga0450899_002031 Ga0450899_002031_1142_2002 225
84 3300042184 Ga0450908_016073 Ga0450908_016073_121_981 225
85 3300046474 Ga0495605_0038060 Ga0495605_0038060_241_1161 225
86 3300046500 Ga0495596_0012021 Ga0495596_0012021_247_1167 225
87 3300046501 Ga0495607_0027544 Ga0495607_0027544_2487_3407 225
88 3300046512 Ga0495610_0006580 Ga0495610_0006580_2443_3363 225
89 3300046513 Ga0495616_0019277 Ga0495616_0019277_2522_3442 225
90 3300046538 Ga0495609_0036164 Ga0495609_0036164_1056_1976 225
91 3300046692 Ga0495671_0057225 Ga0495671_0057225_672_1592 225
92 3300048905 Ga0496102_0009393 Ga0496102_0009393_467_1327 225
93 3300048908 Ga0496105_0006491 Ga0496105_0006491_6102_6962 225
94 3300048913 Ga0496110_0017408 Ga0496110_0017408_2465_3325 225
95 3300048919 Ga0496116_0014094 Ga0496116_0014094_2522_3442 225
96 3300048925 Ga0496122_0039545 Ga0496122_0039545_293_1213 225
97 3300048926 Ga0496123_0122784 Ga0496123_0122784_62_982 225
98 3300050489 nmdc:mga03683_123546_c1 nmdc:mga03683_123546_c1_230_1003 225
99 3300050492 nmdc:mga0yw44_193615_c1 nmdc:mga0yw44_193615_c1_413_1186 225
100 3300050493 nmdc:mga0k408_13028_c1 nmdc:mga0k408_13028_c1_767_1540 225
101 3300050494 nmdc:mga06z11_18532_c1 nmdc:mga06z11_18532_c1_1985_2758 225
102 3300050495 nmdc:mga04h51_70443_c1 nmdc:mga04h51_70443_c1_161_934 225
103 3300050496 nmdc:mga07m45_11542_c1 nmdc:mga07m45_11542_c1_2603_3376 225
104 3300003187 JGI25151J46595_10012250 JGI25151J46595_100122502 226
105 3300003771 Ga0055526_1019943 Ga0055526_10199432 226
106 3300003781 Ga0055536_1000123 Ga0055536_10001237 226
107 3300005328 Ga0070676_10229245 Ga0070676_102292451 226
108 3300005334 Ga0068869_100016023 Ga0068869_1000160232 226
109 3300005840 Ga0068870_10013741 Ga0068870_100137413 226
110 3300009148 Ga0105243_10439369 Ga0105243_104393692 226
111 3300025291 Ga0209675_1000470 Ga0209675_100047010 226
112 3300025292 Ga0209676_1000012 Ga0209676_1000012730 226
113 3300025294 Ga0209025_1001501 Ga0209025_100150120 226
114 3300025294 Ga0209025_1054216 Ga0209025_10542162 226
115 3300025295 Ga0209564_1001365 Ga0209564_10013654 226
116 3300025908 Ga0207643_10032933 Ga0207643_100329333 226
117 3300026078 Ga0207702_10445467 Ga0207702_104454672 226
118 3300026088 Ga0207641_10842171 Ga0207641_108421711 226
119 3300026116 Ga0207674_10026157 Ga0207674_100261575 226
120 3300041404 Ga0439436_0001183 Ga0439436_0001183_2163_2936 226
121 3300042007 Ga0439449_0000864 Ga0439449_0000864_955_1728 226
122 3300042010 Ga0439452_006476 Ga0439452_006476_456_1229 226
123 3300030522 Ga0307512_10061292 Ga0307512_100612923 227
124 3300031507 Ga0307509_10003715 Ga0307509_100037154 227
125 3300031507 Ga0307509_10018758 Ga0307509_100187585 227
126 3300031616 Ga0307508_10000222 Ga0307508_1000022223 227
127 3300031649 Ga0307514_10134819 Ga0307514_101348192 227
128 3300031730 Ga0307516_10152400 Ga0307516_101524003 227
129 3300031730 Ga0307516_10332758 Ga0307516_103327582 227
130 3300033180 Ga0307510_10000779 Ga0307510_1000077917 227
131 3300046454 Ga0495592_0008519 Ga0495592_0008519_6473_7246 227
132 3300050493 nmdc:mga0k408_19481_c1 nmdc:mga0k408_19481_c1_2330_3103 227
133 3300053136 Ga0500559_0000020 Ga0500559_0000020_52222_52995 227
134 3300053156 Ga0500622_0018225 Ga0500622_0018225_1089_1862 227
135 3300053739 Ga0500587_000608 Ga0500587_000608_1088_1861 227
136 3300009092 Ga0105250_10000002 Ga0105250_1000000288 228
137 3300025711 Ga0207696_1000239 Ga0207696_100023927 228
138 3300031731 Ga0307405_10301034 Ga0307405_103010342 228
139 3300048924 Ga0496121_0042392 Ga0496121_0042392_2457_3230 228
140 3300053131 Ga0500652_063337 Ga0500652_063337_526_1281 228
141 iso_pu_bacteria 2901300506 2901306479 228
142 3300005434 Ga0070709_10497762 Ga0070709_104977621 229
143 3300005440 Ga0070705_100147916 Ga0070705_1001479162 229
144 3300005546 Ga0070696_100084812 Ga0070696_1000848123 229
145 3300005841 Ga0068863_100155443 Ga0068863_1001554432 229
146 3300006175 Ga0070712_100024529 Ga0070712_1000245293 229
147 3300009092 Ga0105250_10000043 Ga0105250_10000043104 229
148 3300009553 Ga0105249_10405712 Ga0105249_104057122 229
149 3300017792 Ga0163161_10040137 Ga0163161_100401372 229
150 3300025915 Ga0207693_10004790 Ga0207693_1000479012 229
151 3300026118 Ga0207675_100445806 Ga0207675_1004458062 229
152 3300030731 Ga0316177_1112440 Ga0316177_11124402 229
153 3300030732 Ga0316176_1185062 Ga0316176_11850623 229
154 3300030735 Ga0316178_1074219 Ga0316178_10742192 229
155 3300030742 Ga0316183_1066146 Ga0316183_10661461 229
156 3300030744 Ga0316181_1019403 Ga0316181_10194032 229
157 3300030744 Ga0316181_1085438 Ga0316181_10854382 229
158 3300030745 Ga0316182_1245277 Ga0316182_12452772 229
159 3300030745 Ga0316182_1429538 Ga0316182_14295382 229
160 3300031548 Ga0307408_100078880 Ga0307408_1000788802 229
161 3300031911 Ga0307412_10023449 Ga0307412_100234493 229
162 3300046660 Ga0495625_0000778 Ga0495625_0000778_23883_24761 229
163 3300047470 Ga0495681_0008367 Ga0495681_0008367_1725_2603 229
164 3300048903 Ga0496100_0189394 Ga0496100_0189394_22_888 229
165 3300053153 Ga0500616_0115331 Ga0500616_0115331_50_775 229
166 iso_pu_bacteria 2524023210 2524467474 229
167 iso_pu_bacteria 2903768456 2903768651 229
168 iso_pu_bacteria 3004289098 3004291512 229
169 3300002773 JGI25152J39213_1025471 JGI25152J39213_10254711 230
170 3300003187 JGI25151J46595_10001245 JGI25151J46595_100012457 230
171 3300006186 Ga0075369_10106944 Ga0075369_101069442 230
172 3300025258 Ga0209129_1000517 Ga0209129_100051710 230
173 3300025294 Ga0209025_1000378 Ga0209025_100037810 230
174 3300025935 Ga0207709_10064386 Ga0207709_100643862 230
175 3300030733 Ga0314311_1026270 Ga0314311_10262703 230
176 3300047472 Ga0495686_0002427 Ga0495686_0002427_13835_14608 230
177 3300003578 Ga0006562J51391_1014936 Ga0006562J51391_10149362 231
178 3300003792 Ga0055540_1008215 Ga0055540_10082153 231
179 3300006353 Ga0075370_10133975 Ga0075370_101339752 231
180 3300025294 Ga0209025_1002982 Ga0209025_10029824 231
181 3300025303 Ga0209051_1005061 Ga0209051_10050615 231
182 3300031548 Ga0307408_100004608 Ga0307408_1000046085 231
183 3300031901 Ga0307406_10000768 Ga0307406_1000076817 231
184 iso_pu_bacteria 2906393657 2906397439 231
185 3300006038 Ga0075365_10078426 Ga0075365_100784262 232
186 3300006058 Ga0075432_10013808 Ga0075432_100138082 232
187 3300006948 Ga0099826_10142827 Ga0099826_101428272 232
188 3300025263 Ga0209565_1000078 Ga0209565_1000078127 232
189 3300025273 Ga0209673_1000627 Ga0209673_100062733 232
190 3300025291 Ga0209675_1000413 Ga0209675_100041317 232
191 3300025294 Ga0209025_1010852 Ga0209025_10108523 232
192 3300027666 Ga0209282_1000088 Ga0209282_100008857 232
193 3300031824 Ga0307413_10046593 Ga0307413_100465932 232
194 3300033180 Ga0307510_10208180 Ga0307510_102081801 232
195 3300041411 Ga0439466_0065685 Ga0439466_0065685_46_924 232
196 3300042145 Ga0450906_005940 Ga0450906_005940_1454_2332 232
197 3300042184 Ga0450908_011714 Ga0450908_011714_530_1408 232
198 3300042435 Ga0439434_0047276 Ga0439434_0047276_386_1264 232
199 3300050491 nmdc:mga00v17_128474_c1 nmdc:mga00v17_128474_c1_26_904 232
200 3300005331 Ga0070670_100423694 Ga0070670_1004236941 233
201 3300005338 Ga0068868_100119948 Ga0068868_1001199483 233
202 3300005355 Ga0070671_100086646 Ga0070671_1000866462 233
203 3300005355 Ga0070671_100087289 Ga0070671_1000872892 233
204 3300005364 Ga0070673_100010287 Ga0070673_1000102876 233
205 3300005459 Ga0068867_100035090 Ga0068867_1000350903 233
206 3300005543 Ga0070672_100056332 Ga0070672_1000563323 233
207 3300005841 Ga0068863_100069165 Ga0068863_1000691653 233
208 3300006195 Ga0075366_10116299 Ga0075366_101162992 233
209 3300013306 Ga0163162_10018668 Ga0163162_100186688 233
210 3300014326 Ga0157380_10264250 Ga0157380_102642502 233
211 3300025927 Ga0207687_10148873 Ga0207687_101488732 233
212 3300025931 Ga0207644_10093030 Ga0207644_100930302 233
213 3300025940 Ga0207691_10105747 Ga0207691_101057472 233
214 3300025942 Ga0207689_10009937 Ga0207689_100099372 233
215 3300026023 Ga0207677_10046514 Ga0207677_100465142 233
216 3300026088 Ga0207641_10030209 Ga0207641_100302092 233
217 3300026089 Ga0207648_10101597 Ga0207648_101015972 233
218 3300031616 Ga0307508_10098088 Ga0307508_100980882 233
219 3300031649 Ga0307514_10010830 Ga0307514_100108304 233
220 3300033180 Ga0307510_10004087 Ga0307510_1000408717 233
221 3300046455 Ga0495603_0053146 Ga0495603_0053146_37_810 233
222 3300046530 Ga0495654_0012062 Ga0495654_0012062_269_1078 233
223 3300046690 Ga0495624_0069842 Ga0495624_0069842_55_828 233
224 3300047321 Ga0495676_0013984 Ga0495676_0013984_2795_3568 233
225 3300053161 Ga0500634_0104192 Ga0500634_0104192_69_806 233
226 3300005616 Ga0068852_100557285 Ga0068852_1005572852 234
227 3300009551 Ga0105238_10482816 Ga0105238_104828162 234
228 3300012475 Ga0157317_1002651 Ga0157317_10026512 234
229 3300025935 Ga0207709_10038438 Ga0207709_100384382 234
230 3300005456 Ga0070678_100406550 Ga0070678_1004065502 235
231 3300009147 Ga0114129_11157898 Ga0114129_111578981 235
232 3300025291 Ga0209675_1000759 Ga0209675_10007592 235
233 3300025304 Ga0209257_1009727 Ga0209257_10097272 235
234 3300005295 Ga0065707_10149432 Ga0065707_101494322 236
235 3300003773 Ga0055537_1000477 Ga0055537_10004776 237
236 3300003784 Ga0055534_1000275 Ga0055534_100027516 237
237 3300003790 Ga0055528_1001435 Ga0055528_10014356 237
238 3300005344 Ga0070661_100175767 Ga0070661_1001757671 237
239 3300005366 Ga0070659_100268957 Ga0070659_1002689572 237
240 3300005616 Ga0068852_100860267 Ga0068852_1008602671 237
241 3300013296 Ga0157374_10339524 Ga0157374_103395242 237
242 3300025321 Ga0207656_10046411 Ga0207656_100464112 237
243 3300025925 Ga0207650_10347855 Ga0207650_103478551 237
244 3300025932 Ga0207690_10150674 Ga0207690_101506742 237
245 3300005289 Ga0065704_10079879 Ga0065704_100798794 238
246 3300006946 Ga0079104_1000008 Ga0079104_1000008226 238
247 3300025291 Ga0209675_1005090 Ga0209675_10050902 238
248 3300025711 Ga0207696_1000509 Ga0207696_10005098 238
249 3300025935 Ga0207709_10000070 Ga0207709_1000007062 238
250 3300027111 Ga0209281_1000029 Ga0209281_1000029171 238
251 3300028794 Ga0307515_10263486 Ga0307515_102634861 238
252 3300050512 nmdc:mga0n895_8945_c1 nmdc:mga0n895_8945_c1_7278_8030 238
253 3300053117 Ga0500593_093443 Ga0500593_093443_453_1226 238
254 iso_pu_bacteria 2588253730 2588517006 238
255 iso_pu_bacteria 2856320880 2856325512 238
256 iso_pu_bacteria 2869278585 2869285203 238
257 iso_pu_bacteria 2888337043 2888339690 238
258 3300005536 Ga0070697_100091416 Ga0070697_1000914161 239
259 3300005546 Ga0070696_100109780 Ga0070696_1001097802 239
260 3300006852 Ga0075433_10005479 Ga0075433_100054795 239
261 3300007076 Ga0075435_100026800 Ga0075435_1000268005 239
262 3300009147 Ga0114129_10581372 Ga0114129_105813722 239
263 3300009148 Ga0105243_10019715 Ga0105243_100197155 239
264 3300025939 Ga0207665_10544825 Ga0207665_105448252 239
265 3300031548 Ga0307408_100288482 Ga0307408_1002884822 239
266 3300031911 Ga0307412_10147293 Ga0307412_101472932 239
267 3300039437 Ga0436365_1170862 Ga0436365_1170862_493_1248 239
268 3300046539 Ga0495621_0060229 Ga0495621_0060229_282_1037 239
269 3300048912 Ga0496109_0031971 Ga0496109_0031971_3239_4009 239
270 3300050493 nmdc:mga0k408_90586_c1 nmdc:mga0k408_90586_c1_581_1351 239
271 3300050513 nmdc:mga0rr50_116087_c1 nmdc:mga0rr50_116087_c1_1102_1875 239
272 3300050515 nmdc:mga0a205_22451_c1 nmdc:mga0a205_22451_c1_3670_4443 239
273 3300003187 JGI25151J46595_10000018 JGI25151J46595_10000018113 240
274 3300003215 JGI25153J46596_10002113 JGI25153J46596_100021132 240
275 3300003771 Ga0055526_1002567 Ga0055526_10025674 240
276 3300003773 Ga0055537_1004941 Ga0055537_10049415 240
277 3300003775 Ga0055524_1000048 Ga0055524_100004817 240
278 3300003775 Ga0055524_1012611 Ga0055524_10126112 240
279 3300003790 Ga0055528_1000109 Ga0055528_100010957 240
280 3300005262 Ga0065165_1000062 Ga0065165_100006233 240
281 3300005328 Ga0070676_10006949 Ga0070676_100069493 240
282 3300005328 Ga0070676_10027197 Ga0070676_100271973 240
283 3300005331 Ga0070670_100005028 Ga0070670_1000050282 240
284 3300005331 Ga0070670_100032734 Ga0070670_1000327343 240
285 3300005334 Ga0068869_100004298 Ga0068869_1000042985 240
286 3300005334 Ga0068869_100330923 Ga0068869_1003309232 240
287 3300005335 Ga0070666_10005278 Ga0070666_100052782 240
288 3300005335 Ga0070666_10101952 Ga0070666_101019522 240
289 3300005336 Ga0070680_100148322 Ga0070680_1001483222 240
290 3300005338 Ga0068868_100183063 Ga0068868_1001830632 240
291 3300005339 Ga0070660_100028918 Ga0070660_1000289182 240
292 3300005340 Ga0070689_100009872 Ga0070689_1000098725 240
293 3300005344 Ga0070661_100013467 Ga0070661_1000134672 240
294 3300005344 Ga0070661_100154375 Ga0070661_1001543751 240
295 3300005347 Ga0070668_100001341 Ga0070668_10000134112 240
296 3300005347 Ga0070668_100096217 Ga0070668_1000962173 240
297 3300005347 Ga0070668_100148675 Ga0070668_1001486752 240
298 3300005347 Ga0070668_100165565 Ga0070668_1001655652 240
299 3300005353 Ga0070669_100000668 Ga0070669_1000006686 240
300 3300005353 Ga0070669_100107204 Ga0070669_1001072042 240
301 3300005353 Ga0070669_100114943 Ga0070669_1001149432 240
302 3300005353 Ga0070669_100331203 Ga0070669_1003312031 240
303 3300005354 Ga0070675_100001258 Ga0070675_10000125813 240
304 3300005354 Ga0070675_100053001 Ga0070675_1000530014 240
305 3300005354 Ga0070675_100621279 Ga0070675_1006212791 240
306 3300005355 Ga0070671_100004906 Ga0070671_1000049066 240
307 3300005355 Ga0070671_100092362 Ga0070671_1000923623 240
308 3300005355 Ga0070671_100165158 Ga0070671_1001651581 240
309 3300005355 Ga0070671_100226100 Ga0070671_1002261002 240
310 3300005356 Ga0070674_100055615 Ga0070674_1000556151 240
311 3300005356 Ga0070674_100061525 Ga0070674_1000615253 240
312 3300005356 Ga0070674_100145610 Ga0070674_1001456102 240
313 3300005356 Ga0070674_100310482 Ga0070674_1003104822 240
314 3300005364 Ga0070673_100006412 Ga0070673_1000064125 240
315 3300005364 Ga0070673_100092350 Ga0070673_1000923502 240
316 3300005364 Ga0070673_100103547 Ga0070673_1001035472 240
317 3300005366 Ga0070659_100027510 Ga0070659_1000275105 240
318 3300005366 Ga0070659_100041038 Ga0070659_1000410384 240
319 3300005367 Ga0070667_100004919 Ga0070667_1000049198 240
320 3300005367 Ga0070667_100005264 Ga0070667_1000052644 240
321 3300005367 Ga0070667_100037796 Ga0070667_1000377961 240
322 3300005367 Ga0070667_100183395 Ga0070667_1001833952 240
323 3300005367 Ga0070667_100230329 Ga0070667_1002303292 240
324 3300005435 Ga0070714_100009061 Ga0070714_1000090615 240
325 3300005440 Ga0070705_100038190 Ga0070705_1000381902 240
326 3300005444 Ga0070694_100020659 Ga0070694_1000206594 240
327 3300005444 Ga0070694_100022197 Ga0070694_1000221973 240
328 3300005445 Ga0070708_100000538 Ga0070708_10000053816 240
329 3300005455 Ga0070663_100190759 Ga0070663_1001907592 240
330 3300005456 Ga0070678_100003201 Ga0070678_1000032017 240
331 3300005456 Ga0070678_100024961 Ga0070678_1000249612 240
332 3300005456 Ga0070678_100064344 Ga0070678_1000643442 240
333 3300005457 Ga0070662_100008353 Ga0070662_1000083534 240
334 3300005457 Ga0070662_100106616 Ga0070662_1001066162 240
335 3300005458 Ga0070681_10065412 Ga0070681_100654122 240
336 3300005459 Ga0068867_100000099 Ga0068867_10000009914 240
337 3300005459 Ga0068867_100000975 Ga0068867_1000009758 240
338 3300005459 Ga0068867_100003039 Ga0068867_1000030399 240
339 3300005459 Ga0068867_100156810 Ga0068867_1001568101 240
340 3300005459 Ga0068867_100256202 Ga0068867_1002562022 240
341 3300005466 Ga0070685_10095974 Ga0070685_100959741 240
342 3300005468 Ga0070707_100021241 Ga0070707_1000212416 240
343 3300005468 Ga0070707_100196507 Ga0070707_1001965071 240
344 3300005471 Ga0070698_100256914 Ga0070698_1002569142 240
345 3300005518 Ga0070699_100508479 Ga0070699_1005084791 240
346 3300005535 Ga0070684_100028122 Ga0070684_1000281222 240
347 3300005539 Ga0068853_100187736 Ga0068853_1001877361 240
348 3300005543 Ga0070672_100000287 Ga0070672_10000028713 240
349 3300005543 Ga0070672_100013687 Ga0070672_1000136873 240
350 3300005543 Ga0070672_100027710 Ga0070672_1000277103 240
351 3300005543 Ga0070672_100066504 Ga0070672_1000665042 240
352 3300005544 Ga0070686_100422066 Ga0070686_1004220661 240
353 3300005545 Ga0070695_100189765 Ga0070695_1001897652 240
354 3300005546 Ga0070696_100086242 Ga0070696_1000862422 240
355 3300005548 Ga0070665_100008986 Ga0070665_1000089865 240
356 3300005548 Ga0070665_100013659 Ga0070665_1000136595 240
357 3300005548 Ga0070665_100071749 Ga0070665_1000717492 240
358 3300005548 Ga0070665_100210217 Ga0070665_1002102172 240
359 3300005549 Ga0070704_100023523 Ga0070704_1000235234 240
360 3300005563 Ga0068855_100073653 Ga0068855_1000736535 240
361 3300005564 Ga0070664_100003932 Ga0070664_10000393212 240
362 3300005564 Ga0070664_100016107 Ga0070664_1000161074 240
363 3300005577 Ga0068857_100046789 Ga0068857_1000467892 240
364 3300005578 Ga0068854_100012109 Ga0068854_1000121093 240
365 3300005578 Ga0068854_100064932 Ga0068854_1000649323 240
366 3300005614 Ga0068856_100017956 Ga0068856_1000179564 240
367 3300005616 Ga0068852_100423327 Ga0068852_1004233272 240
368 3300005617 Ga0068859_100083674 Ga0068859_1000836743 240
369 3300005618 Ga0068864_100005258 Ga0068864_1000052586 240
370 3300005718 Ga0068866_10025436 Ga0068866_100254362 240
371 3300005719 Ga0068861_100081818 Ga0068861_1000818183 240
372 3300005834 Ga0068851_10084996 Ga0068851_100849961 240
373 3300005834 Ga0068851_10199993 Ga0068851_101999932 240
374 3300005840 Ga0068870_10062228 Ga0068870_100622281 240
375 3300005841 Ga0068863_100001368 Ga0068863_10000136814 240
376 3300005841 Ga0068863_100067898 Ga0068863_1000678982 240
377 3300005841 Ga0068863_100114297 Ga0068863_1001142972 240
378 3300005841 Ga0068863_100224200 Ga0068863_1002242002 240
379 3300005841 Ga0068863_100408123 Ga0068863_1004081232 240
380 3300005842 Ga0068858_100006176 Ga0068858_1000061764 240
381 3300005842 Ga0068858_100016320 Ga0068858_1000163208 240
382 3300005842 Ga0068858_100100231 Ga0068858_1001002312 240
383 3300005842 Ga0068858_100111857 Ga0068858_1001118572 240
384 3300005843 Ga0068860_100004808 Ga0068860_1000048086 240
385 3300005843 Ga0068860_100016563 Ga0068860_1000165637 240
386 3300005843 Ga0068860_100029914 Ga0068860_1000299146 240
387 3300005843 Ga0068860_100050139 Ga0068860_1000501392 240
388 3300005843 Ga0068860_100091904 Ga0068860_1000919043 240
389 3300005844 Ga0068862_100050180 Ga0068862_1000501803 240
390 3300005844 Ga0068862_100118197 Ga0068862_1001181973 240
391 3300005844 Ga0068862_100219208 Ga0068862_1002192082 240
392 3300006038 Ga0075365_10001436 Ga0075365_100014368 240
393 3300006042 Ga0075368_10000984 Ga0075368_100009845 240
394 3300006048 Ga0075363_100230677 Ga0075363_1002306772 240
395 3300006051 Ga0075364_10251656 Ga0075364_102516562 240
396 3300006177 Ga0075362_10002210 Ga0075362_100022107 240
397 3300006195 Ga0075366_10018446 Ga0075366_100184464 240
398 3300006195 Ga0075366_10019325 Ga0075366_100193254 240
399 3300006195 Ga0075366_10083898 Ga0075366_100838982 240
400 3300006195 Ga0075366_10120596 Ga0075366_101205962 240
401 3300006195 Ga0075366_10252156 Ga0075366_102521562 240
402 3300006237 Ga0097621_100008005 Ga0097621_1000080054 240
403 3300006237 Ga0097621_100066231 Ga0097621_1000662313 240
404 3300006353 Ga0075370_10001026 Ga0075370_100010266 240
405 3300006353 Ga0075370_10012303 Ga0075370_100123032 240
406 3300006353 Ga0075370_10013080 Ga0075370_100130802 240
407 3300006358 Ga0068871_100000834 Ga0068871_1000008344 240
408 3300006358 Ga0068871_100315663 Ga0068871_1003156632 240
409 3300006844 Ga0075428_100157357 Ga0075428_1001573571 240
410 3300006846 Ga0075430_100129355 Ga0075430_1001293551 240
411 3300006847 Ga0075431_100009702 Ga0075431_10000970210 240
412 3300006871 Ga0075434_100010081 Ga0075434_1000100812 240
413 3300006881 Ga0068865_100003861 Ga0068865_1000038614 240
414 3300006881 Ga0068865_100095099 Ga0068865_1000950992 240
415 3300006931 Ga0097620_100083685 Ga0097620_1000836853 240
416 3300006931 Ga0097620_100206606 Ga0097620_1002066062 240
417 3300006948 Ga0099826_10000676 Ga0099826_100006764 240
418 3300006948 Ga0099826_10013619 Ga0099826_100136195 240
419 3300009036 Ga0105244_10120609 Ga0105244_101206091 240
420 3300009093 Ga0105240_10002428 Ga0105240_1000242828 240
421 3300009093 Ga0105240_10033941 Ga0105240_100339417 240
422 3300009094 Ga0111539_10568708 Ga0111539_105687081 240
423 3300009101 Ga0105247_10055080 Ga0105247_100550802 240
424 3300009147 Ga0114129_10101400 Ga0114129_101014003 240
425 3300009148 Ga0105243_10001109 Ga0105243_100011099 240
426 3300009174 Ga0105241_10089319 Ga0105241_100893192 240
427 3300009174 Ga0105241_10218219 Ga0105241_102182192 240
428 3300009177 Ga0105248_10017795 Ga0105248_100177956 240
429 3300009177 Ga0105248_10056706 Ga0105248_100567062 240
430 3300009177 Ga0105248_10396226 Ga0105248_103962262 240
431 3300009545 Ga0105237_10006305 Ga0105237_1000630512 240
432 3300009545 Ga0105237_10108996 Ga0105237_101089962 240
433 3300009545 Ga0105237_10123598 Ga0105237_101235983 240
434 3300009545 Ga0105237_10341609 Ga0105237_103416092 240
435 3300009551 Ga0105238_10001044 Ga0105238_1000104419 240
436 3300009553 Ga0105249_10433299 Ga0105249_104332992 240
437 3300009553 Ga0105249_10701946 Ga0105249_107019461 240
438 3300010375 Ga0105239_10168139 Ga0105239_101681392 240
439 3300010375 Ga0105239_10429329 Ga0105239_104293292 240
440 3300011119 Ga0105246_10025728 Ga0105246_100257281 240
441 3300013100 Ga0157373_10001146 Ga0157373_100011467 240
442 3300013100 Ga0157373_10009126 Ga0157373_1000912610 240
443 3300013100 Ga0157373_10013023 Ga0157373_100130235 240
444 3300013102 Ga0157371_10000004 Ga0157371_1000000496 240
445 3300013102 Ga0157371_10004156 Ga0157371_100041569 240
446 3300013102 Ga0157371_10022060 Ga0157371_100220602 240
447 3300013102 Ga0157371_10142941 Ga0157371_101429412 240
448 3300013104 Ga0157370_10005765 Ga0157370_1000576514 240
449 3300013104 Ga0157370_10015688 Ga0157370_100156883 240
450 3300013105 Ga0157369_10193777 Ga0157369_101937772 240
451 3300013105 Ga0157369_10252200 Ga0157369_102522002 240
452 3300013296 Ga0157374_10003813 Ga0157374_100038139 240
453 3300013297 Ga0157378_10007092 Ga0157378_1000709212 240
454 3300013297 Ga0157378_10173463 Ga0157378_101734631 240
455 3300013297 Ga0157378_10296299 Ga0157378_102962992 240
456 3300013306 Ga0163162_10003831 Ga0163162_100038316 240
457 3300013306 Ga0163162_10006954 Ga0163162_100069544 240
458 3300013307 Ga0157372_10002798 Ga0157372_1000279820 240
459 3300013308 Ga0157375_10003753 Ga0157375_1000375311 240
460 3300013308 Ga0157375_10135518 Ga0157375_101355183 240
461 3300013308 Ga0157375_10269029 Ga0157375_102690292 240
462 3300014325 Ga0163163_10014074 Ga0163163_100140743 240
463 3300014497 Ga0182008_10055566 Ga0182008_100555662 240
464 3300014745 Ga0157377_10000010 Ga0157377_10000010255 240
465 3300014968 Ga0157379_10000858 Ga0157379_1000085825 240
466 3300014968 Ga0157379_10040595 Ga0157379_100405952 240
467 3300014968 Ga0157379_10155337 Ga0157379_101553372 240
468 3300014969 Ga0157376_10000986 Ga0157376_1000098610 240
469 3300014969 Ga0157376_10766761 Ga0157376_107667612 240
470 3300017792 Ga0163161_10050915 Ga0163161_100509152 240
471 3300017792 Ga0163161_10130220 Ga0163161_101302202 240
472 3300025263 Ga0209565_1000938 Ga0209565_10009386 240
473 3300025263 Ga0209565_1008820 Ga0209565_10088203 240
474 3300025273 Ga0209673_1000005 Ga0209673_1000005475 240
475 3300025284 Ga0209130_1000235 Ga0209130_100023566 240
476 3300025291 Ga0209675_1000239 Ga0209675_100023945 240
477 3300025292 Ga0209676_1010033 Ga0209676_10100334 240
478 3300025292 Ga0209676_1027731 Ga0209676_10277312 240
479 3300025294 Ga0209025_1000010 Ga0209025_1000010121 240
480 3300025294 Ga0209025_1004003 Ga0209025_100400311 240
481 3300025294 Ga0209025_1004618 Ga0209025_10046188 240
482 3300025294 Ga0209025_1060801 Ga0209025_10608012 240
483 3300025295 Ga0209564_1000034 Ga0209564_1000034288 240
484 3300025297 Ga0209758_1000220 Ga0209758_100022045 240
485 3300025299 Ga0209256_1000026 Ga0209256_1000026276 240
486 3300025299 Ga0209256_1000182 Ga0209256_100018273 240
487 3300025299 Ga0209256_1000549 Ga0209256_100054914 240
488 3300025302 Ga0207426_1030274 Ga0207426_10302742 240
489 3300025304 Ga0209257_1013240 Ga0209257_10132404 240
490 3300025304 Ga0209257_1028939 Ga0209257_10289392 240
491 3300025315 Ga0207697_10003403 Ga0207697_100034038 240
492 3300025315 Ga0207697_10128192 Ga0207697_101281921 240
493 3300025899 Ga0207642_10071734 Ga0207642_100717342 240
494 3300025900 Ga0207710_10023946 Ga0207710_100239462 240
495 3300025903 Ga0207680_10043785 Ga0207680_100437852 240
496 3300025907 Ga0207645_10000157 Ga0207645_1000015714 240
497 3300025907 Ga0207645_10029420 Ga0207645_100294203 240
498 3300025907 Ga0207645_10120119 Ga0207645_101201192 240
499 3300025908 Ga0207643_10004227 Ga0207643_100042278 240
500 3300025910 Ga0207684_10023462 Ga0207684_100234623 240
501 3300025910 Ga0207684_10106152 Ga0207684_101061522 240
502 3300025911 Ga0207654_10025190 Ga0207654_100251904 240
503 3300025911 Ga0207654_10150673 Ga0207654_101506732 240
504 3300025912 Ga0207707_10114127 Ga0207707_101141273 240
505 3300025912 Ga0207707_10224069 Ga0207707_102240692 240
506 3300025913 Ga0207695_10021259 Ga0207695_100212594 240
507 3300025913 Ga0207695_10187093 Ga0207695_101870933 240
508 3300025914 Ga0207671_10026895 Ga0207671_100268952 240
509 3300025914 Ga0207671_10255177 Ga0207671_102551772 240
510 3300025917 Ga0207660_10199803 Ga0207660_101998031 240
511 3300025919 Ga0207657_10003501 Ga0207657_1000350112 240
512 3300025920 Ga0207649_10201701 Ga0207649_102017012 240
513 3300025921 Ga0207652_10052455 Ga0207652_100524554 240
514 3300025922 Ga0207646_10030223 Ga0207646_100302234 240
515 3300025923 Ga0207681_10004068 Ga0207681_100040682 240
516 3300025923 Ga0207681_10086435 Ga0207681_100864352 240
517 3300025923 Ga0207681_10120799 Ga0207681_101207992 240
518 3300025924 Ga0207694_10166408 Ga0207694_101664081 240
519 3300025924 Ga0207694_10222900 Ga0207694_102229002 240
520 3300025925 Ga0207650_10080620 Ga0207650_100806203 240
521 3300025925 Ga0207650_10082918 Ga0207650_100829183 240
522 3300025925 Ga0207650_10100420 Ga0207650_101004202 240
523 3300025926 Ga0207659_10002948 Ga0207659_100029482 240
524 3300025931 Ga0207644_10011516 Ga0207644_100115168 240
525 3300025931 Ga0207644_10019823 Ga0207644_100198234 240
526 3300025931 Ga0207644_10238755 Ga0207644_102387552 240
527 3300025931 Ga0207644_10258482 Ga0207644_102584822 240
528 3300025932 Ga0207690_10026090 Ga0207690_100260902 240
529 3300025933 Ga0207706_10002095 Ga0207706_100020956 240
530 3300025933 Ga0207706_10137720 Ga0207706_101377202 240
531 3300025935 Ga0207709_10000627 Ga0207709_1000062710 240
532 3300025935 Ga0207709_10011114 Ga0207709_100111143 240
533 3300025937 Ga0207669_10022300 Ga0207669_100223002 240
534 3300025937 Ga0207669_10053034 Ga0207669_100530343 240
535 3300025938 Ga0207704_10253566 Ga0207704_102535662 240
536 3300025940 Ga0207691_10000249 Ga0207691_1000024937 240
537 3300025940 Ga0207691_10139540 Ga0207691_101395402 240
538 3300025940 Ga0207691_10205582 Ga0207691_102055822 240
539 3300025940 Ga0207691_10400820 Ga0207691_104008202 240
540 3300025942 Ga0207689_10003129 Ga0207689_1000312915 240
541 3300025942 Ga0207689_10009790 Ga0207689_100097906 240
542 3300025942 Ga0207689_10404320 Ga0207689_104043202 240
543 3300025945 Ga0207679_10010256 Ga0207679_100102565 240
544 3300025949 Ga0207667_10061918 Ga0207667_100619184 240
545 3300025949 Ga0207667_10230963 Ga0207667_102309632 240
546 3300025949 Ga0207667_10495141 Ga0207667_104951412 240
547 3300025960 Ga0207651_10014375 Ga0207651_100143752 240
548 3300025960 Ga0207651_10074685 Ga0207651_100746852 240
549 3300025960 Ga0207651_10256576 Ga0207651_102565762 240
550 3300025960 Ga0207651_10273028 Ga0207651_102730282 240
551 3300025960 Ga0207651_10629915 Ga0207651_106299151 240
552 3300025972 Ga0207668_10013050 Ga0207668_100130503 240
553 3300025972 Ga0207668_10099520 Ga0207668_100995201 240
554 3300025972 Ga0207668_10110796 Ga0207668_101107962 240
555 3300025972 Ga0207668_10173237 Ga0207668_101732372 240
556 3300025972 Ga0207668_10466643 Ga0207668_104666432 240
557 3300025981 Ga0207640_10005591 Ga0207640_100055914 240
558 3300025981 Ga0207640_10019565 Ga0207640_100195654 240
559 3300025986 Ga0207658_10001272 Ga0207658_1000127223 240
560 3300025986 Ga0207658_10040512 Ga0207658_100405122 240
561 3300025986 Ga0207658_10181466 Ga0207658_101814662 240
562 3300025986 Ga0207658_10381568 Ga0207658_103815681 240
563 3300025986 Ga0207658_10453660 Ga0207658_104536602 240
564 3300026023 Ga0207677_10398099 Ga0207677_103980991 240
565 3300026035 Ga0207703_10002253 Ga0207703_1000225310 240
566 3300026035 Ga0207703_10023868 Ga0207703_100238683 240
567 3300026035 Ga0207703_10113812 Ga0207703_101138122 240
568 3300026035 Ga0207703_10166256 Ga0207703_101662561 240
569 3300026041 Ga0207639_10068258 Ga0207639_100682581 240
570 3300026041 Ga0207639_10320494 Ga0207639_103204941 240
571 3300026067 Ga0207678_10012240 Ga0207678_100122404 240
572 3300026067 Ga0207678_10041936 Ga0207678_100419364 240
573 3300026078 Ga0207702_10019967 Ga0207702_100199674 240
574 3300026088 Ga0207641_10000374 Ga0207641_1000037438 240
575 3300026088 Ga0207641_10135882 Ga0207641_101358823 240
576 3300026088 Ga0207641_10144290 Ga0207641_101442902 240
577 3300026088 Ga0207641_10159602 Ga0207641_101596022 240
578 3300026089 Ga0207648_10000002 Ga0207648_10000002192 240
579 3300026089 Ga0207648_10000523 Ga0207648_100005238 240
580 3300026089 Ga0207648_10001083 Ga0207648_1000108326 240
581 3300026089 Ga0207648_10013639 Ga0207648_100136393 240
582 3300026089 Ga0207648_10021215 Ga0207648_100212152 240
583 3300026089 Ga0207648_10213060 Ga0207648_102130602 240
584 3300026089 Ga0207648_10292465 Ga0207648_102924652 240
585 3300026095 Ga0207676_10008789 Ga0207676_100087893 240
586 3300026116 Ga0207674_10000118 Ga0207674_1000011879 240
587 3300026116 Ga0207674_10063541 Ga0207674_100635412 240
588 3300026118 Ga0207675_100066282 Ga0207675_1000662823 240
589 3300026118 Ga0207675_100075232 Ga0207675_1000752323 240
590 3300026118 Ga0207675_100108631 Ga0207675_1001086313 240
591 3300026121 Ga0207683_10000476 Ga0207683_1000047612 240
592 3300026121 Ga0207683_10040510 Ga0207683_100405104 240
593 3300026121 Ga0207683_10293128 Ga0207683_102931282 240
594 3300026142 Ga0207698_10478534 Ga0207698_104785342 240
595 3300027312 Ga0209371_1000009 Ga0209371_1000009900 240
596 3300027312 Ga0209371_1007734 Ga0209371_10077343 240
597 3300027312 Ga0209371_1036684 Ga0209371_10366842 240
598 3300027666 Ga0209282_1006186 Ga0209282_10061866 240
599 3300027666 Ga0209282_1043586 Ga0209282_10435862 240
600 3300028379 Ga0268266_10004526 Ga0268266_1000452610 240
601 3300028379 Ga0268266_10023108 Ga0268266_100231087 240
602 3300028379 Ga0268266_10050840 Ga0268266_100508402 240
603 3300028379 Ga0268266_10084658 Ga0268266_100846583 240
604 3300028380 Ga0268265_10004995 Ga0268265_100049952 240
605 3300028380 Ga0268265_10018436 Ga0268265_100184363 240
606 3300028380 Ga0268265_10084594 Ga0268265_100845943 240
607 3300028380 Ga0268265_10104426 Ga0268265_101044262 240
608 3300028380 Ga0268265_10284785 Ga0268265_102847852 240
609 3300028381 Ga0268264_10008187 Ga0268264_100081873 240
610 3300028381 Ga0268264_10029798 Ga0268264_100297981 240
611 3300028381 Ga0268264_10034214 Ga0268264_100342143 240
612 3300028556 Ga0265337_1003809 Ga0265337_10038094 240
613 3300028558 Ga0265326_10002334 Ga0265326_100023346 240
614 3300028563 Ga0265319_1005177 Ga0265319_10051774 240
615 3300028573 Ga0265334_10001347 Ga0265334_100013474 240
616 3300028577 Ga0265318_10005245 Ga0265318_100052454 240
617 3300028653 Ga0265323_10000539 Ga0265323_1000053911 240
618 3300028654 Ga0265322_10002074 Ga0265322_100020747 240
619 3300028666 Ga0265336_10000483 Ga0265336_100004839 240
620 3300028786 Ga0307517_10070639 Ga0307517_100706392 240
621 3300028794 Ga0307515_10000049 Ga0307515_10000049138 240
622 3300028794 Ga0307515_10000066 Ga0307515_10000066174 240
623 3300028794 Ga0307515_10027455 Ga0307515_100274557 240
624 3300028794 Ga0307515_10040292 Ga0307515_100402928 240
625 3300028800 Ga0265338_10000081 Ga0265338_1000008177 240
626 3300029957 Ga0265324_10002127 Ga0265324_100021274 240
627 3300030500 Ga0268256_1000010 Ga0268256_1000010899 240
628 3300030500 Ga0268256_1007407 Ga0268256_10074073 240
629 3300030500 Ga0268256_1013945 Ga0268256_10139451 240
630 3300030522 Ga0307512_10062849 Ga0307512_100628493 240
631 3300030744 Ga0316181_1022414 Ga0316181_10224142 240
632 3300031456 Ga0307513_10000012 Ga0307513_10000012181 240
633 3300031456 Ga0307513_10030448 Ga0307513_100304482 240
634 3300031456 Ga0307513_10221759 Ga0307513_102217592 240
635 3300031456 Ga0307513_10339883 Ga0307513_103398832 240
636 3300031507 Ga0307509_10004792 Ga0307509_100047927 240
637 3300031507 Ga0307509_10114365 Ga0307509_101143652 240
638 3300031507 Ga0307509_10121145 Ga0307509_101211452 240
639 3300031548 Ga0307408_100171434 Ga0307408_1001714342 240
640 3300031616 Ga0307508_10003666 Ga0307508_100036665 240
641 3300031649 Ga0307514_10019111 Ga0307514_100191115 240
642 3300031730 Ga0307516_10079017 Ga0307516_100790172 240
643 3300031730 Ga0307516_10180443 Ga0307516_101804432 240
644 3300031911 Ga0307412_10001927 Ga0307412_100019279 240
645 3300032002 Ga0307416_100258707 Ga0307416_1002587072 240
646 3300032002 Ga0307416_100933182 Ga0307416_1009331821 240
647 3300034816 Ga0373930_0010086 Ga0373930_0010086_237_1010 240
648 3300035691 Ga0373931_0009521 Ga0373931_0009521_855_1628 240
649 3300035695 Ga0373927_0156135 Ga0373927_0156135_609_1382 240
650 3300036401 Ga0373937_0092465 Ga0373937_0092465_77_850 240
651 3300036401 Ga0373937_0548175 Ga0373937_0548175_315_1088 240
652 3300037068 Ga0373925_0112886 Ga0373925_0112886_201_974 240
653 3300037312 Ga0395899_0007556 Ga0395899_0007556_4149_4934 240
654 3300037418 Ga0395900_0003906 Ga0395900_0003906_10435_11220 240
655 3300037418 Ga0395900_0387907 Ga0395900_0387907_324_1100 240
656 3300037466 Ga0395898_0013566 Ga0395898_0013566_7558_8343 240
657 3300037471 Ga0395905_0004967 Ga0395905_0004967_1172_1957 240
658 3300037471 Ga0395905_0076516 Ga0395905_0076516_1118_1891 240
659 3300037471 Ga0395905_0133441 Ga0395905_0133441_1537_2313 240
660 3300037471 Ga0395905_0155861 Ga0395905_0155861_1362_2138 240
661 3300037471 Ga0395905_0419516 Ga0395905_0419516_97_876 240
662 3300038443 Ga0395901_0098596 Ga0395901_0098596_1893_2669 240
663 3300041404 Ga0439436_0043738 Ga0439436_0043738_373_1152 240
664 3300041413 Ga0439465_0054294 Ga0439465_0054294_290_1069 240
665 3300041496 Ga0451839_0812530 Ga0451839_0812530_27_800 240
666 3300042007 Ga0439449_0000862 Ga0439449_0000862_7337_8113 240
667 3300042007 Ga0439449_0036707 Ga0439449_0036707_928_1701 240
668 3300042435 Ga0439434_0078644 Ga0439434_0078644_96_875 240
669 3300042876 Ga0451577_0076658 Ga0451577_0076658_1069_1842 240
670 3300042876 Ga0451577_0110605 Ga0451577_0110605_810_1586 240
671 3300042876 Ga0451577_0183167 Ga0451577_0183167_700_1473 240
672 3300044673 Ga0453683_0202975 Ga0453683_0202975_417_1190 240
673 3300045051 Ga0451576_0529392 Ga0451576_0529392_284_1072 240
674 3300046460 Ga0495638_0271350 Ga0495638_0271350_22_795 240
675 3300046472 Ga0495580_0178313 Ga0495580_0178313_96_869 240
676 3300046507 Ga0495606_0065195 Ga0495606_0065195_636_1409 240
677 3300046664 Ga0495659_0021836 Ga0495659_0021836_684_1457 240
678 3300046674 Ga0495588_0102778 Ga0495588_0102778_607_1380 240
679 3300046683 Ga0495658_0119510 Ga0495658_0119510_274_1047 240
680 3300046692 Ga0495671_0004533 Ga0495671_0004533_1289_2062 240
681 3300047470 Ga0495681_0003812 Ga0495681_0003812_7861_8634 240
682 3300048903 Ga0496100_0130749 Ga0496100_0130749_276_1049 240
683 3300048907 Ga0496104_0491641 Ga0496104_0491641_11_784 240
684 3300048909 Ga0496106_0036886 Ga0496106_0036886_336_1109 240
685 3300048909 Ga0496106_0230870 Ga0496106_0230870_639_1412 240
686 3300048911 Ga0496108_0505781 Ga0496108_0505781_204_977 240
687 3300048915 Ga0496112_0012289 Ga0496112_0012289_3008_3781 240
688 3300048915 Ga0496112_0078957 Ga0496112_0078957_206_982 240
689 3300048916 Ga0496113_0143138 Ga0496113_0143138_372_1145 240
690 3300048916 Ga0496113_0292602 Ga0496113_0292602_160_933 240
691 3300048919 Ga0496116_0000395 Ga0496116_0000395_52487_53278 240
692 3300048919 Ga0496116_0024710 Ga0496116_0024710_1200_1973 240
693 3300048919 Ga0496116_0050323 Ga0496116_0050323_815_1588 240
694 3300048920 Ga0496117_0000002 Ga0496117_0000002_2382527_2383300 240
695 3300048920 Ga0496117_0036934 Ga0496117_0036934_2278_3069 240
696 3300048921 Ga0496118_0001167 Ga0496118_0001167_2809_3582 240
697 3300048921 Ga0496118_0024886 Ga0496118_0024886_3988_4761 240
698 3300048922 Ga0496119_0041241 Ga0496119_0041241_1659_2432 240
699 3300048923 Ga0496120_0000498 Ga0496120_0000498_40985_41758 240
700 3300048923 Ga0496120_0053650 Ga0496120_0053650_1442_2215 240
701 3300048924 Ga0496121_0223609 Ga0496121_0223609_459_1235 240
702 3300048924 Ga0496121_0229354 Ga0496121_0229354_242_1015 240
703 3300048925 Ga0496122_0000001 Ga0496122_0000001_1726535_1727308 240
704 3300048925 Ga0496122_0077531 Ga0496122_0077531_383_1156 240
705 3300048925 Ga0496122_0083412 Ga0496122_0083412_768_1559 240
706 3300048926 Ga0496123_0000001 Ga0496123_0000001_1730266_1731039 240
707 3300048926 Ga0496123_0039243 Ga0496123_0039243_2288_3061 240
708 3300048926 Ga0496123_0138635 Ga0496123_0138635_425_1216 240
709 3300048926 Ga0496123_0188335 Ga0496123_0188335_105_881 240
710 3300048927 Ga0496124_0005665 Ga0496124_0005665_9351_10124 240
711 3300048927 Ga0496124_0242842 Ga0496124_0242842_137_910 240
712 3300048928 Ga0496125_0007258 Ga0496125_0007258_1375_2148 240
713 3300048929 Ga0496126_0001831 Ga0496126_0001831_10058_10831 240
714 3300048929 Ga0496126_0030554 Ga0496126_0030554_75_851 240
715 3300048929 Ga0496126_0168533 Ga0496126_0168533_278_1051 240
716 3300048929 Ga0496126_0227331 Ga0496126_0227331_202_975 240
717 3300049521 Ga0501298_002724 Ga0501298_002724_1717_2490 240
718 3300049570 Ga0501033_0482073 Ga0501033_0482073_62_835 240
719 3300049573 Ga0501037_0044179 Ga0501037_0044179_628_1401 240
720 3300049593 Ga0501077_0013625 Ga0501077_0013625_469_1245 240
721 3300049741 Ga0501079_0204136 Ga0501079_0204136_448_1224 240
722 3300049822 Ga0501035_0402716 Ga0501035_0402716_83_856 240
723 3300050491 nmdc:mga00v17_1172_c1 nmdc:mga00v17_1172_c1_3077_3850 240
724 3300050492 nmdc:mga0yw44_186_c1 nmdc:mga0yw44_186_c1_4613_5386 240
725 3300050493 nmdc:mga0k408_119452_c1 nmdc:mga0k408_119452_c1_729_1502 240
726 3300050493 nmdc:mga0k408_124410_c1 nmdc:mga0k408_124410_c1_84_962 240
727 3300050493 nmdc:mga0k408_12727_c2 nmdc:mga0k408_12727_c2_1353_2126 240
728 3300050493 nmdc:mga0k408_199846_c1 nmdc:mga0k408_199846_c1_60_833 240
729 3300050494 nmdc:mga06z11_256469_c1 nmdc:mga06z11_256469_c1_201_974 240
730 3300050496 nmdc:mga07m45_2900_c1 nmdc:mga07m45_2900_c1_541_1314 240
731 3300050496 nmdc:mga07m45_3025_c1 nmdc:mga07m45_3025_c1_2310_3083 240
732 3300050496 nmdc:mga07m45_48625_c1 nmdc:mga07m45_48625_c1_202_975 240
733 3300050496 nmdc:mga07m45_9895_c1 nmdc:mga07m45_9895_c1_1207_2085 240
734 3300050507 nmdc:mga05p37_100008_c1 nmdc:mga05p37_100008_c1_1736_2512 240
735 3300050507 nmdc:mga05p37_325811_c1 nmdc:mga05p37_325811_c1_734_1522 240
736 3300050510 nmdc:mga06r32_27536_c1 nmdc:mga06r32_27536_c1_3451_4227 240
737 3300050513 nmdc:mga0rr50_357947_c1 nmdc:mga0rr50_357947_c1_436_1209 240
738 3300050515 nmdc:mga0a205_207545_c1 nmdc:mga0a205_207545_c1_954_1727 240
739 3300053086 Ga0500578_0062342 Ga0500578_0062342_143_916 240
740 3300053093 Ga0500651_0079981 Ga0500651_0079981_1150_1923 240
741 3300053107 Ga0500560_000863 Ga0500560_000863_2215_2988 240
742 3300053111 Ga0500572_001032 Ga0500572_001032_7482_8255 240
743 3300053136 Ga0500559_0001277 Ga0500559_0001277_5281_6054 240
744 3300053137 Ga0500561_0000531 Ga0500561_0000531_3005_3778 240
745 3300053142 Ga0500577_0108503 Ga0500577_0108503_214_987 240
746 3300053153 Ga0500616_0079303 Ga0500616_0079303_426_1205 240
747 3300053163 Ga0500639_015544 Ga0500639_015544_2441_3214 240
748 3300053730 Ga0500645_003541 Ga0500645_003541_276_1049 240
749 3300053735 Ga0500596_012269 Ga0500596_012269_440_1213 240
750 3300061719 Ga0466962_0088956 Ga0466962_0088956_69_848 240
751 iso_pu_bacteria 2507262055 2507510775 240
752 iso_pu_bacteria 2508501042 2508697287 240
753 iso_pu_bacteria 2508501123 2509118098 240
754 iso_pu_bacteria 2509276018 2509367577 240
755 iso_pu_bacteria 2509276022 2509396558 240
756 iso_pu_bacteria 2512875016 2512931226 240
757 iso_pu_bacteria 2512875024 2512959047 240
758 iso_pu_bacteria 2513237090 2513610811 240
759 iso_pu_bacteria 2513237096 2513653724 240
760 iso_pu_bacteria 2513237098 2513671237 240
761 iso_pu_bacteria 2513237101 2513698013 240
762 iso_pu_bacteria 2513237137 2513856164 240
763 iso_pu_bacteria 2513237145 2513918064 240
764 iso_pu_bacteria 2513237164 2514038090 240
765 iso_pu_bacteria 2515154112 2515628016 240
766 iso_pu_bacteria 2517572143 2517891696 240
767 iso_pu_bacteria 2524023205 2524437172 240
768 iso_pu_bacteria 2524023228 2524536683 240
769 iso_pu_bacteria 2537561587 2537877298 240
770 iso_pu_bacteria 2545555834 2545677978 240
771 iso_pu_bacteria 2554235003 2554246195 240
772 iso_pu_bacteria 2558860242 2559293418 240
773 iso_pu_bacteria 2599185210 2599604301 240
774 iso_pu_bacteria 2599185301 2599938476 240
775 iso_pu_bacteria 2600255279 2601609563 240
776 iso_pu_bacteria 2600255308 2601746338 240
777 iso_pu_bacteria 2643221568 2643857585 240
778 iso_pu_bacteria 2643221595 2643984642 240
779 iso_pu_bacteria 2643221627 2644158534 240
780 iso_pu_bacteria 2643221654 2644305357 240
781 iso_pu_bacteria 2643221693 2644519616 240
782 iso_pu_bacteria 2643221734 2644733878 240
783 iso_pu_bacteria 2643221736 2644742400 240
784 iso_pu_bacteria 2667528175 2671118534 240
785 iso_pu_bacteria 2687453392 2688598694 240
786 iso_pu_bacteria 2693429783 2694633179 240
787 iso_pu_bacteria 2693429784 2694638248 240
788 iso_pu_bacteria 2721755755 2723846799 240
789 iso_pu_bacteria 2744054633 2745076391 240
790 iso_pu_bacteria 2756170246 2756675205 240
791 iso_pu_bacteria 2791355123 2792749502 240
792 iso_pu_bacteria 2791355199 2793076454 240
793 iso_pu_bacteria 2818991439 2819556885 240
794 iso_pu_bacteria 2818991467 2819716834 240
795 iso_pu_bacteria 2838675328 2838677622 240
796 iso_pu_bacteria 2838714209 2838716511 240
797 iso_pu_bacteria 2838719591 2838719689 240
798 iso_pu_bacteria 2838724970 2838727262 240
799 iso_pu_bacteria 2840764183 2840769969 240
800 iso_pu_bacteria 2841760612 2841763824 240
801 iso_pu_bacteria 2841846520 2841846620 240
802 iso_pu_bacteria 2841859092 2841860850 240
803 iso_pu_bacteria 2841911363 2841916900 240
804 iso_pu_bacteria 2841917233 2841917596 240
805 iso_pu_bacteria 2842038055 2842043107 240
806 iso_pu_bacteria 2842045827 2842051148 240
807 iso_pu_bacteria 2842124991 2842127351 240
808 iso_pu_bacteria 2842130223 2842132515 240
809 iso_pu_bacteria 2842152218 2842152316 240
810 iso_pu_bacteria 2842170452 2842172756 240
811 iso_pu_bacteria 2842175837 2842175935 240
812 iso_pu_bacteria 2842187318 2842189618 240
813 iso_pu_bacteria 2842211629 2842213932 240
814 iso_pu_bacteria 2842224351 2842224450 240
815 iso_pu_bacteria 2842515876 2842517635 240
816 iso_pu_bacteria 2842747753 2842750522 240
817 iso_pu_bacteria 2844002411 2844007164 240
818 iso_pu_bacteria 2844104063 2844109272 240
819 iso_pu_bacteria 2851182111 2851183079 240
820 iso_pu_bacteria 2851246043 2851251379 240
821 iso_pu_bacteria 2856328259 2856331351 240
822 iso_pu_bacteria 2856334872 2856341858 240
823 iso_pu_bacteria 2857349434 2857350824 240
824 iso_pu_bacteria 2869249662 2869254407 240
825 iso_pu_bacteria 2869264136 2869268871 240
826 iso_pu_bacteria 2869271264 2869274721 240
827 iso_pu_bacteria 2869285874 2869291881 240
828 iso_pu_bacteria 2871429161 2871435090 240
829 iso_pu_bacteria 2871459585 2871465469 240
830 iso_pu_bacteria 2871466892 2871472694 240
831 iso_pu_bacteria 2871495908 2871499883 240
832 iso_pu_bacteria 2874139085 2874146140 240
833 iso_pu_bacteria 2874146452 2874149482 240
834 iso_pu_bacteria 2874155637 2874157744 240
835 iso_pu_bacteria 2874162495 2874162702 240
836 iso_pu_bacteria 2874168670 2874174544 240
837 iso_pu_bacteria 2874590934 2874592282 240
838 iso_pu_bacteria 2874604998 2874611240 240
839 iso_pu_bacteria 2874628541 2874634530 240
840 iso_pu_bacteria 2874645413 2874650111 240
841 iso_pu_bacteria 2876363079 2876369284 240
842 iso_pu_bacteria 2876369609 2876376518 240
843 iso_pu_bacteria 2876377896 2876383782 240
844 iso_pu_bacteria 2876399893 2876402986 240
845 iso_pu_bacteria 2876406927 2876408884 240
846 iso_pu_bacteria 2876413966 2876415948 240
847 iso_pu_bacteria 2876771140 2876775360 240
848 iso_pu_bacteria 2876818435 2876826287 240
849 iso_pu_bacteria 2878738818 2878745493 240
850 iso_pu_bacteria 2878745973 2878752225 240
851 iso_pu_bacteria 2878760144 2878764038 240
852 iso_pu_bacteria 2878767105 2878771077 240
853 iso_pu_bacteria 2878774303 2878774577 240
854 iso_pu_bacteria 2879074833 2879079552 240
855 iso_pu_bacteria 2879127579 2879132201 240
856 iso_pu_bacteria 2879142872 2879146850 240
857 iso_pu_bacteria 2881147464 2881151780 240
858 iso_pu_bacteria 2881665667 2881668538 240
859 iso_pu_bacteria 2885305155 2885309687 240
860 iso_pu_bacteria 2885326080 2885326982 240
861 iso_pu_bacteria 2885334103 2885337331 240
862 iso_pu_bacteria 2885374607 2885381026 240
863 iso_pu_bacteria 2889010040 2889010955 240
864 iso_pu_bacteria 2889016732 2889017353 240
865 iso_pu_bacteria 2889033259 2889038415 240
866 iso_pu_bacteria 2889914905 2889915422 240
867 iso_pu_bacteria 2891048133 2891048212 240
868 iso_pu_bacteria 2899792073 2899794324 240
869 iso_pu_bacteria 2899845264 2899845705 240
870 iso_pu_bacteria 2903448605 2903455303 240
871 iso_pu_bacteria 2903492973 2903493217 240
872 iso_pu_bacteria 2903521522 2903523109 240
873 iso_pu_bacteria 2903528002 2903534431 240
874 iso_pu_bacteria 2903540706 2903544697 240
875 iso_pu_bacteria 2906308376 2906314619 240
876 iso_pu_bacteria 2906321335 2906327787 240
877 iso_pu_bacteria 2906354277 2906361658 240
878 iso_pu_bacteria 2906363423 2906368350 240
879 iso_pu_bacteria 2906370794 2906375938 240
880 iso_pu_bacteria 2906378014 2906384733 240
881 iso_pu_bacteria 2906386501 2906387029 240
882 iso_pu_bacteria 2906408224 2906412210 240
883 iso_pu_bacteria 2906626472 2906630372 240
884 iso_pu_bacteria 2906635258 2906642910 240
885 iso_pu_bacteria 2906660503 2906667200 240
886 iso_pu_bacteria 2917699015 2917701656 240
887 iso_pu_bacteria 2919114240 2919116728 240
888 iso_pu_bacteria 2919166419 2919166429 240
889 iso_pu_bacteria 2922130491 2922133895 240
890 iso_pu_bacteria 2922151315 2922154534 240
891 iso_pu_bacteria 2922172374 2922174545 240
892 iso_pu_bacteria 2922185730 2922190041 240
893 iso_pu_bacteria 2922361189 2922362497 240
894 iso_pu_bacteria 2922386360 2922390404 240
895 iso_pu_bacteria 2924748358 2924753789 240
896 iso_pu_bacteria 2924762789 2924764122 240
897 iso_pu_bacteria 2924776078 2924783737 240
898 iso_pu_bacteria 2926754445 2926754737 240
899 iso_pu_bacteria 2926760298 2926761906 240
900 iso_pu_bacteria 2928115317 2928116540 240
901 iso_pu_bacteria 2929160207 2929160397 240
902 iso_pu_bacteria 2933006813 2933006963 240
903 iso_pu_bacteria 2933011516 2933015446 240
904 iso_pu_bacteria 2933594066 2933594166 240
905 iso_pu_bacteria 2935608549 2935616044 240
906 iso_pu_bacteria 2935819856 2935819940 240
907 iso_pu_bacteria 2935847175 2935850050 240
908 iso_pu_bacteria 2935908558 2935915201 240
909 iso_pu_bacteria 2935916978 2935923878 240
910 iso_pu_bacteria 2935926038 2935932698 240
911 iso_pu_bacteria 2935934488 2935941218 240
912 iso_pu_bacteria 2935942939 2935949368 240
913 iso_pu_bacteria 2935951376 2935958063 240
914 iso_pu_bacteria 2935959822 2935963808 240
915 iso_pu_bacteria 2935967501 2935974295 240
916 iso_pu_bacteria 2935975950 2935979496 240
917 iso_pu_bacteria 2935984226 2935991645 240
918 iso_pu_bacteria 2936055302 2936059264 240
919 iso_pu_bacteria 2937813078 2937816078 240
920 iso_pu_bacteria 2937822353 2937824738 240
921 iso_pu_bacteria 2937848649 2937852922 240
922 iso_pu_bacteria 2937868953 2937872928 240
923 iso_pu_bacteria 2937877337 2937881858 240
924 iso_pu_bacteria 2937972304 2937975597 240
925 iso_pu_bacteria 2937994558 2937998544 240
926 iso_pu_bacteria 2958034702 2958040904 240
927 iso_pu_bacteria 2958041894 2958056986 240
928 iso_pu_bacteria 2958064165 2958067677 240
929 iso_pu_bacteria 2958084443 2958088978 240
930 iso_pu_bacteria 2958092219 2958093831 240
931 iso_pu_bacteria 2958100919 2958102994 240
932 iso_pu_bacteria 2958122699 2958125357 240
933 iso_pu_bacteria 2958130278 2958136279 240
934 iso_pu_bacteria 2958137437 2958144355 240
935 iso_pu_bacteria 2958144490 2958148499 240
936 iso_pu_bacteria 2958158011 2958161156 240
937 iso_pu_bacteria 2958165035 2958169023 240
938 iso_pu_bacteria 2958172287 2958176228 240
939 iso_pu_bacteria 2958179912 2958185747 240
940 iso_pu_bacteria 2961077736 2961084124 240
941 iso_pu_bacteria 2961136820 2961141190 240
942 iso_pu_bacteria 2961163497 2961167482 240
943 iso_pu_bacteria 2963644680 2963647993 240
944 iso_pu_bacteria 2965018300 2965022305 240
945 iso_pu_bacteria 2965025482 2965026409 240
946 iso_pu_bacteria 2965032056 2965038356 240
947 iso_pu_bacteria 2965040258 2965041810 240
948 iso_pu_bacteria 2965089291 2965091802 240
949 iso_pu_bacteria 2965102966 2965104990 240
950 iso_pu_bacteria 2965110997 2965118951 240
951 iso_pu_bacteria 2965119406 2965126790 240
952 iso_pu_bacteria 2968016561 2968018175 240
953 iso_pu_bacteria 2968083720 2968090813 240
954 iso_pu_bacteria 2968117919 2968120944 240
955 iso_pu_bacteria 2968171901 2968175889 240
956 iso_pu_bacteria 2970469710 2970471651 240
957 iso_pu_bacteria 2970547951 2970549334 240
958 iso_pu_bacteria 2970554993 2970558883 240
959 iso_pu_bacteria 2970593180 2970599816 240
960 iso_pu_bacteria 2977843712 2977846314 240
961 iso_pu_bacteria 2977864932 2977868949 240
962 iso_pu_bacteria 2977872689 2977876339 240
963 iso_pu_bacteria 2977915119 2977922462 240
964 iso_pu_bacteria 2977922695 2977924497 240
965 iso_pu_bacteria 2977935797 2977936854 240
966 iso_pu_bacteria 2977942078 2977947474 240
967 iso_pu_bacteria 2977950692 2977951417 240
968 iso_pu_bacteria 2977957713 2977964378 240
969 iso_pu_bacteria 2977986579 2977988345 240
970 iso_pu_bacteria 2978969890 2978972822 240
971 iso_pu_bacteria 2979089926 2979092829 240
972 iso_pu_bacteria 2979095461 2979099783 240
973 iso_pu_bacteria 2979100975 2979104800 240
974 iso_pu_bacteria 2979710463 2979711116 240
975 iso_pu_bacteria 2979742915 2979749597 240
976 iso_pu_bacteria 2979793036 2979795543 240
977 iso_pu_bacteria 2984509177 2984513401 240
978 iso_pu_bacteria 2984518228 2984520231 240
979 iso_pu_bacteria 2984537506 2984539527 240
980 iso_pu_bacteria 2984587000 2984591073 240
981 iso_pu_bacteria 2984601300 2984601755 240
982 iso_pu_bacteria 2987636660 2987638009 240
983 iso_pu_bacteria 2987645492 2987645585 240
984 iso_pu_bacteria 2987652177 2987655922 240
985 iso_pu_bacteria 2987659509 2987663488 240
986 iso_pu_bacteria 2987666974 2987668973 240
987 iso_pu_bacteria 2987673487 2987679379 240
988 iso_pu_bacteria 3004188549 3004192549 240
989 iso_pu_bacteria 3004203850 3004205669 240
990 iso_pu_bacteria 3004211236 3004216230 240
991 iso_pu_bacteria 3004218560 3004223980 240
992 iso_pu_bacteria 3004239961 3004246501 240
993 iso_pu_bacteria 3004334049 3004341435 240
994 iso_pu_bacteria 3005409236 3005413628 240
995 iso_pu_bacteria 637000159 637074326 240
996 iso_pu_bacteria 641522639 641642502 240
997 iso_pu_bacteria 649633066 649873211 240
998 iso_pu_bacteria 650716007 650738654 240
999 iso_pu_bacteria 8003570095 8003572199 240
1000 iso_pu_bacteria 8004300914 8004301854 240
1001 iso_pu_bacteria 8004361976 8004367103 240
1002 iso_pu_bacteria 8004387939 8004394393 240
1003 iso_pu_bacteria 8004640170 8004640556 240
1004 iso_pu_bacteria 8004695233 8004697783 240
1005 iso_pu_bacteria 8004714634 8004720880 240
1006 iso_pu_bacteria 8006926726 8006928570 240
1007 iso_pu_bacteria 8006933436 8006939839 240
1008 iso_pu_bacteria 8006964411 8006970025 240
1009 iso_pu_bacteria 8006984368 8006985295 240
1010 iso_pu_bacteria 8006994254 8006995072 240
1011 iso_pu_bacteria 8016583857 8016589853 240
1012 iso_pu_bacteria 8016630954 8016633587 240
1013 iso_pu_bacteria 8019619141 8019625591 240
1014 iso_pu_bacteria 8019629233 8019636698 240
1015 iso_pu_bacteria 8019638758 8019642926 240
1016 iso_pu_bacteria 8019659431 8019664500 240
1017 iso_pu_bacteria 8019668869 8019674088 240
1018 iso_pu_bacteria 8019678201 8019682034 240
1019 iso_pu_bacteria 8019687851 8019693573 240
1020 iso_pu_bacteria 8056673599 8056679635 240
1021 iso_pu_bacteria 8057529695 8057534249 240
1022 iso_pu_bacteria 2935656913 2935663803 241
1023 iso_pu_bacteria 2936011229 2936017959 241
1024 iso_pu_bacteria 2936019824 2936026462 241
1025 iso_pu_bacteria 2936028420 2936035131 241
1026 iso_pu_bacteria 2936046547 2936053281 241
1027 3300005455 Ga0070663_100176398 Ga0070663_1001763982 242
1028 3300049571 Ga0501034_0003224 Ga0501034_0003224_4544_5410 243
1029 3300044673 Ga0453683_0001822 Ga0453683_0001822_4320_5138 244
1030 3300045051 Ga0451576_0008457 Ga0451576_0008457_7377_8195 244
1031 3300048928 Ga0496125_0076142 Ga0496125_0076142_1315_2232 244
1032 iso_pu_bacteria 2839138175 2839142327 244
1033 3300005459 Ga0068867_100095043 Ga0068867_1000950432 245
1034 3300025321 Ga0207656_10078344 Ga0207656_100783441 245
1035 3300025934 Ga0207686_10017732 Ga0207686_100177324 245
1036 3300026041 Ga0207639_10293762 Ga0207639_102937622 245
1037 3300026089 Ga0207648_10028050 Ga0207648_100280505 245
1038 3300031731 Ga0307405_10055501 Ga0307405_100555013 245
1039 3300032002 Ga0307416_100090048 Ga0307416_1000900482 245
1040 3300032005 Ga0307411_10171535 Ga0307411_101715352 245
1041 iso_pu_bacteria 2858688981 2858698239 245
1042 3300003784 Ga0055534_1000810 Ga0055534_100081013 246
1043 3300004625 Ga0055543_1014166 Ga0055543_10141661 246
1044 3300025245 Ga0207425_1003484 Ga0207425_10034844 246
1045 3300025258 Ga0209129_1000168 Ga0209129_10001684 246
1046 3300025284 Ga0209130_1001063 Ga0209130_100106316 246
1047 3300025284 Ga0209130_1001335 Ga0209130_100133510 246
1048 3300025292 Ga0209676_1007063 Ga0209676_10070632 246
1049 3300025295 Ga0209564_1000157 Ga0209564_1000157139 246
1050 3300025297 Ga0209758_1000042 Ga0209758_100004210 246
1051 3300025297 Ga0209758_1015827 Ga0209758_10158272 246
1052 3300025298 Ga0209050_1036466 Ga0209050_10364662 246
1053 3300025299 Ga0209256_1002051 Ga0209256_10020515 246
1054 3300025302 Ga0207426_1000055 Ga0207426_1000055321 246
1055 3300049743 Ga0501081_0087845 Ga0501081_0087845_989_1843 246
1056 iso_pu_bacteria 2738543013 2739247531 246
1057 iso_pu_bacteria 2842677519 2842682520 246
1058 iso_pu_bacteria 2904541872 2904543163 246
1059 3300053121 Ga0500607_116954 Ga0500607_116954_87_980 247
1060 iso_pu_bacteria 2834641062 2834645500 247
1061 iso_pu_bacteria 2904449895 2904451506 247
1062 iso_pu_bacteria 2904456579 2904458363 247
1063 iso_pu_bacteria 2929520902 2929524057 247
1064 iso_pu_bacteria 2945945610 2945950579 247
1065 iso_pu_bacteria 2945972063 2945974786 247
1066 3300005347 Ga0070668_100208450 Ga0070668_1002084502 248
1067 3300013105 Ga0157369_10029638 Ga0157369_100296383 248
1068 3300017792 Ga0163161_10289032 Ga0163161_102890322 248
1069 3300025914 Ga0207671_10208610 Ga0207671_102086102 248
1070 3300025949 Ga0207667_10384419 Ga0207667_103844192 248
1071 3300026142 Ga0207698_10037561 Ga0207698_100375613 248
1072 3300031649 Ga0307514_10001095 Ga0307514_100010956 248
1073 3300046615 Ga0495656_0003313 Ga0495656_0003313_2144_3007 248
1074 3300048925 Ga0496122_0170936 Ga0496122_0170936_180_1013 248
1075 3300048927 Ga0496124_0000178 Ga0496124_0000178_48333_49160 248
1076 iso_pu_bacteria 2547132374 2548501037 248
1077 iso_pu_bacteria 2643221596 2643993478 248
1078 iso_pu_bacteria 2643221658 2644326666 248
1079 iso_pu_bacteria 2643221672 2644397019 248
1080 iso_pu_bacteria 2643221717 2644645921 248
1081 iso_pu_bacteria 2885192300 2885193344 248
1082 iso_pu_bacteria 2990710928 2990712710 248
1083 3300002773 JGI25152J39213_1006299 JGI25152J39213_10062993 249
1084 3300002774 JGI25150J39212_1002656 JGI25150J39212_10026562 249
1085 3300005564 Ga0070664_100052511 Ga0070664_1000525113 249
1086 3300006358 Ga0068871_100306256 Ga0068871_1003062562 249
1087 3300009098 Ga0105245_10290998 Ga0105245_102909982 249
1088 3300015262 Ga0182007_10011260 Ga0182007_100112602 249
1089 3300025728 Ga0207655_1001999 Ga0207655_10019995 249
1090 3300025942 Ga0207689_10368165 Ga0207689_103681652 249
1091 3300028794 Ga0307515_10254487 Ga0307515_102544872 249
1092 3300047318 Ga0495636_0040348 Ga0495636_0040348_754_1623 249
1093 3300049591 Ga0501075_0099242 Ga0501075_0099242_1325_2188 249
1094 3300049741 Ga0501079_0016435 Ga0501079_0016435_633_1496 249
1095 3300049742 Ga0501080_0027985 Ga0501080_0027985_2400_3263 249
1096 3300053079 Ga0500610_0002372 Ga0500610_0002372_5468_6343 249
1097 3300053079 Ga0500610_0108139 Ga0500610_0108139_270_1145 249
1098 3300053121 Ga0500607_011326 Ga0500607_011326_4223_5098 249
1099 3300053158 Ga0500627_0009524 Ga0500627_0009524_2009_2875 249
1100 3300054114 Ga0501084_0020078 Ga0501084_0020078_1536_2399 249
1101 3300061734 Ga0530510_0066933 Ga0530510_0066933_153_1016 249
1102 iso_pu_bacteria 2513237150 2513954440 249
1103 iso_pu_bacteria 2513237165 2514041040 249
1104 iso_pu_bacteria 2643221570 2643866745 249
1105 iso_pu_bacteria 2643221609 2644061397 249
1106 iso_pu_bacteria 2643221611 2644076558 249
1107 iso_pu_bacteria 2643221652 2644294616 249
1108 iso_pu_bacteria 2738543012 2739246837 249
1109 iso_pu_bacteria 2816332133 2816474051 249
1110 iso_pu_bacteria 2928037797 2928043659 249
1111 iso_pu_bacteria 2928044640 2928049710 249
1112 iso_pu_bacteria 2928051484 2928054308 249
1113 iso_pu_bacteria 2928064002 2928069894 249
1114 iso_pu_bacteria 2928070936 2928074486 249
1115 iso_pu_bacteria 644736347 644748812 249
1116 3300002739 JGI25158J39367_1001672 JGI25158J39367_10016723 250
1117 3300002739 JGI25158J39367_1005795 JGI25158J39367_10057952 250
1118 3300003187 JGI25151J46595_10017707 JGI25151J46595_100177073 250
1119 3300003215 JGI25153J46596_10014479 JGI25153J46596_100144793 250
1120 3300003374 JGI25161J50226_1005466 JGI25161J50226_10054662 250
1121 3300003781 Ga0055536_1013631 Ga0055536_10136313 250
1122 3300003781 Ga0055536_1014821 Ga0055536_10148212 250
1123 3300003784 Ga0055534_1010796 Ga0055534_10107962 250
1124 3300003790 Ga0055528_1010050 Ga0055528_10100503 250
1125 3300003791 Ga0055530_10001751 Ga0055530_100017513 250
1126 3300003791 Ga0055530_10004541 Ga0055530_100045415 250
1127 3300003792 Ga0055540_1011211 Ga0055540_10112112 250
1128 3300003792 Ga0055540_1012318 Ga0055540_10123182 250
1129 3300003794 Ga0055531_10005150 Ga0055531_100051505 250
1130 3300005457 Ga0070662_100227288 Ga0070662_1002272882 250
1131 3300005844 Ga0068862_100166714 Ga0068862_1001667142 250
1132 3300009176 Ga0105242_10001450 Ga0105242_100014506 250
1133 3300013100 Ga0157373_10235924 Ga0157373_102359242 250
1134 3300025273 Ga0209673_1001328 Ga0209673_10013285 250
1135 3300025273 Ga0209673_1011889 Ga0209673_10118893 250
1136 3300025291 Ga0209675_1000393 Ga0209675_10003936 250
1137 3300025292 Ga0209676_1000040 Ga0209676_1000040381 250
1138 3300025292 Ga0209676_1011558 Ga0209676_10115582 250
1139 3300025292 Ga0209676_1012115 Ga0209676_10121152 250
1140 3300025295 Ga0209564_1000862 Ga0209564_10008629 250
1141 3300025298 Ga0209050_1000021 Ga0209050_100002112 250
1142 3300025298 Ga0209050_1001833 Ga0209050_10018335 250
1143 3300025299 Ga0209256_1004580 Ga0209256_10045805 250
1144 3300025302 Ga0207426_1000079 Ga0207426_100007913 250
1145 3300025303 Ga0209051_1000111 Ga0209051_1000111122 250
1146 3300025303 Ga0209051_1000286 Ga0209051_100028666 250
1147 3300025303 Ga0209051_1000376 Ga0209051_100037613 250
1148 3300025304 Ga0209257_1000043 Ga0209257_10000437 250
1149 3300025304 Ga0209257_1000215 Ga0209257_100021514 250
1150 3300025304 Ga0209257_1010745 Ga0209257_10107453 250
1151 3300025933 Ga0207706_10009799 Ga0207706_100097992 250
1152 3300028380 Ga0268265_10018279 Ga0268265_100182793 250
1153 3300032002 Ga0307416_100079319 Ga0307416_1000793192 250
1154 3300048905 Ga0496102_0450163 Ga0496102_0450163_48_926 250
1155 3300048920 Ga0496117_0037706 Ga0496117_0037706_406_1284 250
1156 3300048921 Ga0496118_0054541 Ga0496118_0054541_309_1187 250
1157 iso_pu_bacteria 2513020051 2513228534 250
1158 iso_pu_bacteria 2721755523 2722880962 250
1159 iso_pu_bacteria 2842718218 2842719987 250
1160 iso_pu_bacteria 2857576091 2857578331 250
1161 iso_pu_bacteria 2945909444 2945915425 250
1162 iso_pu_bacteria 2945984333 2945989173 250
1163 iso_pu_bacteria 2954767861 2954769984 250
1164 iso_pu_bacteria 2974320154 2974323061 250
1165 3300017792 Ga0163161_10001624 Ga0163161_1000162414 251
1166 3300046500 Ga0495596_0002574 Ga0495596_0002574_3796_4650 251
1167 3300046515 Ga0495620_0134320 Ga0495620_0134320_33_896 251
1168 3300046518 Ga0495631_0000416 Ga0495631_0000416_14513_15376 251
1169 3300046530 Ga0495654_0099313 Ga0495654_0099313_418_1281 251
1170 3300048924 Ga0496121_0253661 Ga0496121_0253661_78_941 251
1171 3300053093 Ga0500651_0000470 Ga0500651_0000470_2693_3556 251
1172 3300053134 Ga0500658_0001324 Ga0500658_0001324_831_1694 251
1173 3300053139 Ga0500568_0012823 Ga0500568_0012823_414_1277 251
1174 iso_pu_bacteria 2643221628 2644163377 251
1175 iso_pu_bacteria 2643221683 2644469310 251
1176 iso_pu_bacteria 2738541277 2738724044 251
1177 iso_pu_bacteria 2738541307 2738883467 251
1178 iso_pu_bacteria 2738543019 2739284729 251
1179 iso_pu_bacteria 2599185214 2599627401 252
1180 iso_pu_bacteria 2599185226 2599677128 252
1181 iso_pu_bacteria 2599185227 2599685043 252
1182 iso_pu_bacteria 2599185229 2599696949 252
1183 iso_pu_bacteria 2818991446 2819599307 252
1184 iso_pu_bacteria 2831265667 2831271055 252
1185 iso_pu_bacteria 2885198086 2885200397 252
1186 iso_pu_bacteria 2885211737 2885214087 252
1187 iso_pu_bacteria 2928084124 2928090372 252
1188 3300001979 JGI24740J21852_10038319 JGI24740J21852_100383192 253
1189 3300001989 JGI24739J22299_10021921 JGI24739J22299_100219212 253
1190 3300005455 Ga0070663_100195596 Ga0070663_1001955962 253
1191 3300006353 Ga0075370_10119806 Ga0075370_101198062 253
1192 3300026041 Ga0207639_10018991 Ga0207639_100189913 253
1193 3300047321 Ga0495676_0047327 Ga0495676_0047327_2366_3235 253
1194 3300047673 Ga0495593_0021590 Ga0495593_0021590_2476_3345 253
1195 3300048089 Ga0495614_0006317 Ga0495614_0006317_4111_4980 253
1196 3300048928 Ga0496125_0172756 Ga0496125_0172756_245_1120 253
1197 3300050493 nmdc:mga0k408_48052_c1 nmdc:mga0k408_48052_c1_282_1181 253
1198 3300050496 nmdc:mga07m45_17530_c1 nmdc:mga07m45_17530_c1_619_1518 253
1199 3300053087 Ga0500643_038555 Ga0500643_038555_206_1075 253
1200 3300053110 Ga0500571_073509 Ga0500571_073509_396_1265 253
1201 iso_pu_bacteria 2838054893 2838059105 253
1202 iso_pu_bacteria 2899924645 2899930103 253
1203 iso_pu_bacteria 2919462493 2919466528 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

124

295

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7879 68 239
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7626 50 246
3dhw-assembly2.cif.gz_F crystal structure of methionine importer metni 0.7586 74 239
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7345 76 239
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7238 60 247
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9048 64 245 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9045 69 244 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8948 70 247 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.883 68 249 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.844 64 245 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A519H0D7-F1-model_v4 ABC transporter permease 0.92 40 253 GO:0005886
GO:0055085
AF-A0A2A7MMG9-F1-model_v4 ABC transporter permease 0.9097 42 248 GO:0005886
GO:0055085
AF-A0A2E2MMU3-F1-model_v4 ABC transporter permease 0.9064 44 246 GO:0005886
GO:0055085
AF-A0A1V5ZZI9-F1-model_v4 Bicarbonate transport system permease protein CmpB 0.8865 44 252 GO:0005886
GO:0055085
AF-A0A1F7TNA4-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.8848 32 252 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
85.17 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map